>gi|26553479|ref|NP_757413.1| glycosyltransferase [Mycoplasma penetrans HF-2] >gi|26453485|dbj|BAC43817.1| glycosyltransferase [Mycoplasma penetrans HF-2] (311 aa)
Score = 1318, Expect = 1.4e-143, Identities = 311/311 (100%), Positives = 311/311 (100%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKTHNKFIGNNNFYNLETIGFHKIWFIYKALWIKKVVS 311
           MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKTHNKFIGNNNFYNLETIGFHKIWFIYKALWIKKVVS
  S:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKTHNKFIGNNNFYNLETIGFHKIWFIYKALWIKKVVS 311
>gi|26554336|ref|NP_758270.1| putative glycosyltransferase [Mycoplasma penetrans HF-2] >gi|26454345|dbj|BAC44674.1| putative glycosyltransferase [Mycoplasma penetrans HF-2] (328 aa)
Score = 608, Expect = 3.6e-61, Identities = 142/300 (47%), Positives = 195/300 (65%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQ--NIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK-YKANDLVSIIFKNKNYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKTHNKFIGNNNFYNLETIGFHKIWFI 300
           M K+S+IIPFKNT L WI +L  SL  Q NKNFEV  IDD+S N   Y  LI + GY+Y +  N     GVGK+RDYGV++A G+ IWFVDSDDW+  DA DYL+ SF ++++ID ++F+Y+WV+ +  +N   K  +    +  N  N+    WFH +YQTDWRVCFKKEFL+KN+I H + + ++EDVYFGLIWK +YKKAL +SK LYFYNR+N  S+LN  K +  + L+  I  +K+ L++  +FN  W+FYA+NW        Y D    +      IG  +  N + +GF   WF+
  S:     1 MSKISLIIPFKNTELIWINKLFDSLEKQINKNFEVICIDDSSDNGIDYKTLILEKGYRYYRSNNASLGDGVGKLRDYGVSVAKGDLIWFVDSDDWITPDATDYLINSFEEHKDIDLVVFKYQWVYKESDVNF--KERKITSFVSDNTPNRRMNKWFHTDYQTDWRVCFKKEFLLKNEILHKENLLLYEDVYFGLIWKTIYKKALFSSKILYFYNRMNRFSTLNQDKNFDPHRLLLNILSSKDNLIKRNIFNEKWFFYANNWAFVAASYIYKDRKQNKSLIKDVIGPKHCRNYKMLGFGSRWFV 301
>gi|196249424|ref|ZP_03148122.1| glycosyl transferase family 2 [Geobacillus sp. G11MC16] >gi|196211181|gb|EDY05942.1| glycosyl transferase family 2 [Geobacillus sp. G11MC16] (516 aa)
Score = 195, Expect = 2.3e-13, Identities = 68/244 (27%), Positives = 134/244 (54%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC---FKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVES---SLNTYKYKANDL---VSIIFKNKNYLLENKL 246
           KVS+IIP  N    ++++ + S+ NQ+ ++ EV  I+D ST+  +  ++   KN  ++      N G+G  R+ G++L+NG+Y++F+D DD L  DAI +LL +   +     +     +  ++K + +  +H +F+    K      + P        D   C   +KKEFL++N +S  +    +ED++F +   VL K   +T+K +Y++ R+  E    S+   + K  +    +S + +N+ +L++N++
  S:     4 KVSIIIPVYNIA-SYLEECLYSVQNQSYRDLEVIMINDGSTDGSEQILERFQKNDPRFRLFNQENRGLGYTRNRGISLSNGQYVFFLDGDDRLPKDAIQHLLSAIETHDADYAVGKVLRFHSERKYVPI--RHLEFNLYTQKQVTTIEQNP----ELLQDSIACNKLWKKEFLIQNDLSFIEG-KYYEDLFFTMRAAVLAKTVAVTNKVVYYW-RVRTEEHNRSITQEQMKLENTLHRLSALKQNRQWLIDNRV 248
>gi|166031280|ref|ZP_02234109.1| hypothetical protein DORFOR_00967 [Dorea formicigenerans ATCC 27755] >gi|166029127|gb|EDR47884.1| hypothetical protein DORFOR_00967 [Dorea formicigenerans ATCC 27755] (326 aa)
Score = 184, Expect = 4.6e-12, Identities = 76/244 (31%), Positives = 121/244 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS-TNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY-----KKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLEN 244
           M KVSVIIP  N   K++K+ + S+  QT  ++EV  ++D S  N Q  ID   K   Q +++  N  N+G+GK R+ G+  +NG+Y+ F+DSDD++  D I+    +  K +  D ++  Y    + K    F+KH+                 W    Y       ++KEFL+KN++     +   ED+YF +    LY      K +      Y+YNR ++  S+N  K     +VSI     N  +EN
  S:     1 MVKVSVIIPIYNVE-KYLKRCLQSVVRQTYVDYEVICVNDCSPDNSQFIIDEYEKRYPQLIKSYINEENLGLGKTREVGINNSNGQYLMFIDSDDYIAPDYIETYYNAMQKGK-YDVVIGGYTRDLEGKLKKHFAKHS----------------IWSLATYPIACAKMYRKEFLLKNQVKF-STIRCGEDIYFSM---ALYCANPQYKVIDYCGYHYYYNRESITGSMNYEKNHEKFIVSIF----NEFMEN 226
>gi|24637463|gb|AAN63735.1|AF454498_8 Eps7F [Streptococcus thermophilus] (327 aa)
Score = 184, Expect = 4.7e-12, Identities = 46/116 (39%), Positives = 74/116 (63%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN------PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           +S+I+P  N   K+I  L+ SL  QTNKNFEV FIDD ST+       ++ +    +  ++ +Q +  N G+   R+ G+  A GEYI+F+DSDD + ++ ++ +L S YKY   D ++F+Y
  S:     7 LSIIVPIYNVE-KYIGSLVNSLVKQTNKNFEVIFIDDGSTDESIRILKEIMVGSEQEFSFKLLQQV--NQGLSSARNIGILNATGEYIFFLDSDDEIEINFVETILTSCYKYSQPDTLIFDY 125
>gi|18309486|ref|NP_561420.1| spore coat polysaccharide biosynthesis protein [Clostridium perfringens str. 13] >gi|18144163|dbj|BAB80210.1| spore coat polysaccharide biosynthesis protein [Clostridium perfringens str. 13] (348 aa)
Score = 181, Expect = 1.2e-11, Identities = 81/251 (32%), Positives = 134/251 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQIN----LFSKHN--------QFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRL--NVESSLNTYKYKANDLVSIIFKNKNYLLENKLFN------------NNWYF 253
           KVS+I+P  N    ++++ + SL NQT +N E+  +DD ST N  V I  + +   +       N G  + R  G  ++ GE+I FVD DDW+  D I+ LL+  Y   +ID + F Y  +F++ +I     L+ K+N        QF   I+ NN++ +            W    +K+F+ KN +  P K++  ED+   +         ++  +KLYFY +   ++ S ++    +  D +  I   KN L+ENKL+N            +NWYF
  S:     5 KVSIIVPAYNIE-SYVERCLNSLINQTYENIEIIIVDDGSTDNTLVKISDMARKDKRIKVLEQENRGSSEARKKGYEMSTGEFILFVDGDDWIRNDTIEVLLE--YSNDDIDIVAFGYNEIFNENEIQKNSLLYDKNNEKIELRDTQFLREILTNNISINI-----------WNKFIRKKFIDKNNVVFPMKMSYAEDLALLISLAAKEPNVIVIKEKLYFYFKRENSITSIISPKILETKDAMYFI---KNILIENKLYNIYREEFEYCVYIHNWYF 265
>gi|182417000|ref|ZP_02948380.1| Cps2J [Clostridium butyricum 5521] >gi|182379176|gb|EDT76678.1| Cps2J [Clostridium butyricum 5521] (326 aa)
Score = 180, Expect = 1.3e-11, Identities = 66/221 (29%), Positives = 120/221 (54%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTY 223
           ++S+IIP  N+  K++++ + S+ N +N +FE   IDD S +  +V  +    + ++Y     NN GV   R+YG+  A G+Y+ F+D+DD+L  +    L+K+     +IDF +F+YE   +KK+++   K  Q  + I+++ + K    +      T W   FKK+ + KN +   + + I ED  F + +  L K      +++  Y R+N  S++NTY
  S:     2 QLSIIIPIYNSE-KYLQECLNSIKNISNIDFECLMIDDGSLDASKVICEKFINDKFKYFYK--NNSGVSCTRNYGIKQAKGKYLLFLDADDYLNENIEKSLIKAM--KDDIDFTIFDYEIKINKKRVH--KKITQDKDDILEDTIYKI---YSTAELNTCWGKLFKKKIIEKNGLKFYEDIKIGEDQIFVMEYINLIKSVQYIHEEILTY-RINKMSAMNTY 212
>gi|125631996|gb|ABN47398.1| EpsN [Lactococcus lactis subsp. cremoris] (329 aa)
Score = 180, Expect = 1.5e-11, Identities = 47/116 (40%), Positives = 75/116 (64%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLI----NKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           +S+I+P  N   K+I  L+ SL  QTNKNFEV FIDD ST+   Q+  +++     +  ++ +Q +  N G+   R+ G+  A GEYI+F+DSDD +  + ++ +L S YKY   D ++F+Y
  S:     5 ISIIVPIYNVE-KYIGSLVNSLLKQTNKNFEVIFIDDGSTDESMQILKEIMAGSEQEFSFKLLQQV--NQGLSSARNIGILNATGEYIFFLDSDDEIESNFVETILTSCYKYSQPDTLIFDY 123
>gi|71065221|ref|YP_263948.1| glycosyl transferase [Psychrobacter arcticus 273-4] >gi|71038206|gb|AAZ18514.1| probable glycosyl transferase [Psychrobacter arcticus 273-4] (346 aa)
Score = 177, Expect = 3.3e-11, Identities = 64/202 (31%), Positives = 103/202 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI--PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK-YQNIDFIMFEYEWVFDKKQI--NLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKAL 202
           M  +S+I PF N+  K  K+L+ +L N  ++  E+ F+DD ST+  V +    ++  Q    +    N G G  R+ G+ +A GEY+WFVDSDD + +DA+ YL   ++K Y  +DF       + +  +I  + +   N   EI++               +   W   FKK+FL+KN I +P+   I+ED     I+  L  K L
  S:     1 MHYLSIISPFYNSEEK-CKRLLETLMNIKDEEIEIIFVDDGSTDDTVALLTAFRSESQVEVKVIRQENKGPGGARNAGLNIAKGEYVWFVDSDDDIKLDALVYLKNIYHKGYDFVDFNYISKGSICNSMEIESDSYKDMNTNREILLA-------------KFGRIWTKIFKKDFLIKNNIYYPEYC-IYEDNPLVFIYPFLCSKFL 192
>gi|114329054|ref|YP_746211.1| glycosyltransferase [Granulibacter bethesdensis CGDNIH1] >gi|114317228|gb|ABI63288.1| glycosyltransferase [Granulibacter bethesdensis CGDNIH1] (990 aa)
Score = 177, Expect = 3.6e-11, Identities = 40/113 (35%), Positives = 68/113 (60%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP--------NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           ++S+++P  NTP  W+ + + S+  Q   N+E+  I+D S+ P V   L       Y Q  P        NN+G+ +  ++G+  A+G+Y+ F+D DD+L  DA+ +LLK+  + Q  DFI
  S:   418 RLSIVMPVYNTPQDWLIEALNSVRAQWCDNWELLCINDASSEPHVETIL-----RAYAQQDPRIRILRTGNNVGIARATNFGLRAASGQYVTFMDHDDYLEPDAVYHLLKAAGETQ-ADFI 532
>gi|164688667|ref|ZP_02212695.1| hypothetical protein CLOBAR_02313 [Clostridium bartlettii DSM 16795] >gi|164602143|gb|EDQ95608.1| hypothetical protein CLOBAR_02313 [Clostridium bartlettii DSM 16795] (335 aa)
Score = 173, Expect = 8.5e-11, Identities = 79/253 (31%), Positives = 131/253 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF--DKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQ---TDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYK-KALLTSKKLYFYN-RLNVESSLNTYKYKA--------NDLVSIIFKNKNYLLENKLFNNNWYF 253
           M KVS+++P  N   K+++Q + S+ NQT K  E+  +DD S +  PQ+  +   K+    V +  N  G+   R+ G+ +A G+YI FVDSDD++ +D  + +     +  N+DF+M +Y  V   DK +  L      +D+  +K ++  + +   + NY      W   +K+E L KN ++  ++V   ED  F  I  + YK       K  Y YN R N  S   TYK  A        N L  +    ++Y   N+L+ +  Y+
  S:     1 MAKVSIVVPIYNVE-KYLEQCVDSIINQTLKEIEIILVDDGSPDNCPQMCDEYAKKDSRIKVVHKKNG-GLSSARNAGIEVATGDYIGFVDSDDYIELDMYEKMYNIAIE-NNVDFVMSDYYRVSSEDKVKATLDMDKGIYDKNKIKKDIFPTLIMGEYINYGRLLAVWHCLYKRELLEKNDLTFDEEVKYSEDNLFSSI--IGYKVNNFYYMKGSYLYNYRYNPNSISKTYKPDAWSVYLKMNNKLKDLFLNVEDYDFRNQLYAHIIYY 265
>gi|188994089|ref|YP_001928341.1| probable glycosyltransferase [Porphyromonas gingivalis ATCC 33277] >gi|63107058|emb|CAI94405.1| hypothetical protein [Porphyromonas gingivalis] >gi|188593769|dbj|BAG32744.1| probable glycosyltransferase [Porphyromonas gingivalis ATCC 33277] (328 aa)
Score = 171, Expect = 1.6e-10, Identities = 68/237 (28%), Positives = 113/237 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY----------NRLNVESSLNTYKYKANDLVSIIFKNKN 239
           ++SVIIP  N   K++K  + +L  QT K+FEV  IDD S +    I      K+   +V +  N  GV   R  G+ LA+G YI  VD+DDW+    ++ L +   +  N D  + +Y  V+  K++    K           + +   +      + + W    K   + +NKI  PD +N+ ED  F L   +         K LY+Y          ++ ++E+S+ +Y Y  N+L +    NK+
  S:     4 RISVIIPVYNAE-KFLKHCLDTLLAQTFKDFEVILIDDGSRDRSSNICDAYAYKDTRVHVYHKENG-GVSAARQKGLELASGAYIIHVDADDWVAPSYLEVLYEEAVR-TNADITICDYIEVYPDKKVYKVQKPTS-------TSADDFVLDLCTKLHGSCWNKLIKASVIRENKIDFPDGINLREDKLFNLHVALCSSTISYAPKALYYYFCSHLGGSASSQGSLETSMKSYIY-GNNLFAHFLSNKS 241
>gi|148643370|ref|YP_001273883.1| glycosyl transferase family protein [Methanobrevibacter smithii ATCC 35061] >gi|148552387|gb|ABQ87515.1| glycosyltransferase, GT2 family [Methanobrevibacter smithii ATCC 35061] (377 aa)
Score = 170, Expect = 1.8e-10, Identities = 67/249 (26%), Positives = 132/249 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS--TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK---QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN-RLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNN 249
           M ++SV++P  N   K++++ + SL NQT ++FEV  ++D S  ++P +  +  +++    + +  N  G+   R+ G+    G Y+ F+DSDDWL ++A++ LL +     N + ++F Y +   +    + N F+K N FD  +   N N   +P        +    +  + L K  +  P+ +N +ED YF   +K+ +K   ++  +   YN R+  +S   T   K+ D+  I+   KN+L E++++ +
  S:     1 MPQISVVVPVYNVE-KYLRECLDSLANQTFEDFEVICVNDGSDDSSPDILEEYASEDERFKIVSQENK-GLSGARNTGMNYIKGRYLLFLDSDDWLELNALE-LLYNHANALNSEMVIFPYRYFNQETKQYEENDFTKLNMFDSSVDNKNFNYKNIPETVFRIPHESIKLYDVKTLKKLAVKFPEGLN-YEDAYF--FYKIFFKLNKVSIIRTPIYNYRIRNDSICTTGTEKSFDIFKILTSIKNFLKEDEIYES 249
>gi|154687561|ref|YP_001422722.1| EpsH [Bacillus amyloliquefaciens FZB42] >gi|154353412|gb|ABS75491.1| EpsH [Bacillus amyloliquefaciens FZB42] (345 aa)
Score = 165, Expect = 7.3e-10, Identities = 62/241 (25%), Positives = 118/241 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ--NIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQT-----DWRVCFKKEFLVKNKISHP--DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFK-NKNYLLEN 244
           VS++I   NT   ++++ + SL NQ+  N E+  ++D ST+    +    +   + ++ I   N G+G +R+ G+  A GE+I F+D+DDW+     DY L+ + K +    D ++ EY   F        S        I      + K  +  + ++       W   +K+  +  +++  P  D++   ED YF L   V         + LY Y R+++ S + +Y+ K  D   ++++ N+ +L EN
  S:     6 VSLLIAVYNTE-TYLERCLDSLLNQSLANIEIVAVNDGSTDQSPAVLEAYQKRDERIRVIHQQNRGLGAVRNKGIEAARGEFIAFIDADDWV---EPDYCLRMYEKAKADQADLVICEYAAEFADTGKTAVST-------IASAYAGRPKQLYLKDLFEGRVSGFSWNKLYKRTMIEHHQLRFPLRDELEHVEDQYFSLRAHVYAGAVSYVDQPLYHY-RIHLTSIVQSYQKKLFDSGLVLYRLNETFLREN 245
>gi|196038324|ref|ZP_03105633.1| glycosyltransferase [Bacillus cereus NVH0597-99] >gi|196030732|gb|EDX69330.1| glycosyltransferase [Bacillus cereus NVH0597-99] (342 aa)
Score = 164, Expect = 9.2e-10, Identities = 64/213 (30%), Positives = 102/213 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLN 215
           KVSVI+P  N+  K+I + + S+  QT KN E+  I+D S++  +  I++  K  ++      NN G  K R+ G+  A GEY+ F+DSDD ++ + + YLL       N D +   Y+ +     +N       F+  I  N+  K             W   +K+E + K  +   +K+ + ED+ F L +    KK       LY YNRLN
  S:     4 KVSVIVPVYNSE-KFISKCLESIIRQTYKNIEILIINDGSSDESETIINVYRKIDHRITYYYQNNSGPSKARNRGILNATGEYVIFLDSDDTVHENYVMYLLNEMIN-SNSDLVCCGYKDISRYGMLN--CSDFNFESSISINSFMKMVC---KGTGGVLWGKIYKREIITKFNLKMDEKIFMCEDLVFVLQYASQCKKFKYVEAYLYNYNRLN 210
>gi|13377455|gb|AAK20714.1|AF316642_8 WciV [Streptococcus pneumoniae] >gi|68643283|emb|CAI33558.1| putative glycosyl transferase [Streptococcus pneumoniae] >gi|68643312|emb|CAI33582.1| putative glycosyl transferase [Streptococcus pneumoniae] (354 aa)
Score = 164, Expect = 1.1e-09, Identities = 67/236 (28%), Positives = 117/236 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNK-------SKMPWFHNNYQ---TDWRVCFKKE-FLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNK 238
           ++SVI+P  N   ++++Q + SL NQT ++FE+  ++D ST+    +  D   K+   +V +  N  G+G  R+ GV  A G+YI FVDSDD++ +D +  L  +  +Y         Y   F   +I       +  ++    +V         S  P + N+ +   + W+V ++   F  K  + H ++  I ED  F +    L   AL+    LY+Y R N  S    YK +  +L  I++  +
  S:     9 EISVIVPVYNVE-RYLRQCMDSLINQTYRDFEIILVNDGSTDSSGVLCEDWAKKDERIHVVHKKNE-GLGFARNTGVEHAKGKYITFVDSDDYVSLDMLQTLYNAVQEYDVEVVYSAGYYRSFSNGEIKKTDVETKKPQLFEGGDVASKLLPDVISAPPEYPNDGKVGVSAWKVLYEANLFKEKGLLFHSEREFISEDAIFQIDCLKLATSALVIPDILYYY-RENFGSLSMKYKEERFELDKILYNEQ 254
>gi|116513023|ref|YP_811930.1| glycosyltransferase [Lactococcus lactis subsp. cremoris SK11] >gi|116108677|gb|ABJ73817.1| Glycosyltransferase [Lactococcus lactis subsp. cremoris SK11] (319 aa)
Score = 164, Expect = 1.2e-09, Identities = 63/220 (28%), Positives = 109/220 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNY-QTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNT 222
           KVSVI+P  N+  K+I+  + SL  QT K  E+  ++D ST+  +    DLI K  +  +  I N+ G  + R+ G+ LA G YI FVDSDD+++   ++ L +   + + +D I   +E  +  K      ++N+     V+  +   K      NY    W   +++EFL KN +    K    ++ +   +W  L K+A +     Y Y R + +S + +
  S:     5 KVSVIVPIYNSE-KYIRTCLESLIKQTLKPIEIILVNDGSTDRSIDHIFDLIEKYNFIRLIEIENS-GAAEARNKGLALARGNYISFVDSDDFVHSTFLEKLYQE-AENKKLDIICGSFEATYKNKVSKKMERNNELLRAGVQEGIVLFKKQIQLRNYIPMIWAYMYRREFLTKNSLWLSPKTIHEDEEFTPRVWN-LAKRAKIIETFEYIYQREHEDSIIES 223
>gi|67153363|ref|ZP_00415108.1| Glycosyl transferase, family 2 [Azotobacter vinelandii AvOP] >gi|67087496|gb|EAM06962.1| Glycosyl transferase, family 2 [Azotobacter vinelandii AvOP] (364 aa)
Score = 163, Expect = 1.5e-09, Identities = 46/123 (37%), Positives = 66/123 (53%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFD 124
           +KVSVIIP  N    ++ Q + S  NQ   N E+  +DD ST+  + I      ++G   V++  N  GV   R+ G+ LA GEYI FVDSDD+L   AI   ++   + Q +D + F     FD
  S:    40 EKVSVIIPVYNVA-PYLAQCLDSAVNQDYDNLEIIAVDDGSTDTSLEILEAFRARHGNLLVRSTKNQ-GVSIARNTGLELATGEYILFVDSDDFLERQAISTCVEILGR-QQVDMVFFASTVFFD 161
>gi|119026400|ref|YP_910245.1| hypothetical protein BAD_1382 [Bifidobacterium adolescentis ATCC 15703] >gi|118765984|dbj|BAF40163.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703] (323 aa)
Score = 161, Expect = 2.1e-09, Identities = 66/255 (25%), Positives = 111/255 (43%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNW 258
           VS+I+P  N   K++ Q + SL  QT+ N E+  IDD S +  P +     +K+   +V +  N+ GV   R+ G+  A GEY+ FVD DDW+  D ++Y+L+   K +N D +       F       F +  Q DE+   N     ++ ++       W   +++ FL  N +         E + F  +         +  KK+Y Y   N  S+      +   + +I      Y+ E+   +N     A NW
  S:     9 VSIIVPIYNVE-KYLDQCVASLIQQTHHNIEILLIDDGSPDNAPAICDAWQHKDERVHVLHKTNS-GVSASRNAGLHAAKGEYVCFVDGDDWIEPDFVEYMLELQAK-RNADIV--ASLCCFTSTD---FHQRTQ-DEVSTINPQEAMELFFYPTIELGAWNKLYRRSFLTANNLEFITDFCAGEGLQFITLAASKANCVTVGQKKVYHYRTDNATSATTKPDVERQGIGAI--TTMQYICEHLDLSNPKVRKAYNW 254
>gi|125625111|ref|YP_001033594.1| putative glycosyl transferase [Lactococcus lactis subsp. cremoris MG1363] >gi|124493919|emb|CAL98914.1| putative glycosyl transferase [Lactococcus lactis subsp. cremoris MG1363] (319 aa)
Score = 161, Expect = 2.3e-09, Identities = 63/216 (29%), Positives = 108/216 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNY-QTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVES 218
           KVSVI+P  N+  K+I+  + SL  QT K  E+  ++D ST+  +    DLI K  +  +  I N+ G  + R+ G+ LA G YI FVDSDD+++   ++ L +   + + +D I   +E  +  K      ++N+     V+  +   K      NY    W   +++EFL+KN +    K    ++ +   +W  L K+A +     Y Y R + +S
  S:     5 KVSVIVPIYNSE-KYIRPCLESLIKQTLKPIEIILVNDGSTDRSIDHIFDLIEKYNFIRLIEIENS-GAAEARNKGLALACGNYISFVDSDDFVHSTFLEKLYQE-AENKKLDIICGSFEATYKNKVSKKMERNNELLRAGVQEGIVLFKKQIQLRNYIPMIWAYMYRREFLMKNGLWLSPKTIHEDEEFTPRVWN-LAKRAKIIETFEYIYQREHEDS 219
>gi|125718328|ref|YP_001035461.1| cell-wall biogenesis glycosyltransferase, putative [Streptococcus sanguinis SK36] >gi|125498245|gb|ABN44911.1| Cell-wall biogenesis glycosyltransferase, putative [Streptococcus sanguinis SK36] (323 aa)
Score = 161, Expect = 2.3e-09, Identities = 66/216 (30%), Positives = 111/216 (51%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGL-IWKVLYKKALLTSKKL-YFYNRLNVESS 219
           +SVIIP  N     IK+ + SL NQ+ KN E+  ++D S +  + I    +  Y +V+ I   N GV   R+ G+ LA GEYI F+D+DD++  D I+   ++ ++ +N+D ++  Y+ V            NQ ++II   ++ +S+  W        W   ++ EFL  N +   D   I ED+ F L  +K   K  LL  K   ++YN  ++ ++
  S:     6 ISVIIPVYNAQ-DGIKRCVDSLLNQSFKNLEIILLNDGSKDNSLNILKEYELKYSFVRVIDKQNEGVAVTRNKGILLAEGEYIMFMDNDDFVDSDYIETFYQAIHE-KNLDLVIGGYKRV------------NQDNQIIFSQDIQQSE--WSKYIIMAPWAKVYRTEFLKTNNLEFFD-YGIGEDIIFNLAAYKTTDKIGLLDYKGYNWYYNNQSISNT 207
>gi|52081984|ref|YP_080775.1| polysaccharide biosynthesis protein, glycosyl transferase family 2,YveR [Bacillus licheniformis ATCC 14580] >gi|52787371|ref|YP_093200.1| YveR [Bacillus licheniformis ATCC 14580] >gi|52005195|gb|AAU25137.1| polysaccharide biosynthesis protein, Glycosyl transferase Family 2,YveR [Bacillus licheniformis ATCC 14580] >gi|52349873|gb|AAU42507.1| YveR [Bacillus licheniformis DSM 13] (343 aa)
Score = 160, Expect = 2.8e-09, Identities = 57/220 (25%), Positives = 101/220 (45%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTY 223
           VS+++   NT   ++   + SL +QT KN E+  ++D ST+  Q  ID   +   +      +N G+G +R+ G+  A+GEY+ F+DSDDW+  D    + +   K ++ D ++ +Y                     +   +  K+  P    NY+   +  F K+ L+K K+S             G  W  LY+++L+   KL F  R  +E+  + Y
  S:     6 VSLLVAVYNTE-AFLPNCLQSLISQTLKNIEIIIVNDGSTDGSQKIIDHYARKDGRIKTIQQDNQGLGAVRNKGIEAASGEYLAFIDSDDWIEPDYCQSMYEK-AKDEDADLVICDYA--------------------VEIQDTEKTVCPDIGKNYEGKPKEAFMKD-LLKGKVS-------------GFSWNKLYRRSLIERHKLVFPLRDELENIEDQY 190
>gi|47569378|ref|ZP_00240061.1| TagF domain protein [Bacillus cereus G9241] >gi|47553966|gb|EAL12334.1| TagF domain protein [Bacillus cereus G9241] (710 aa)
Score = 160, Expect = 2.9e-09, Identities = 71/249 (28%), Positives = 121/249 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQ--NIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNR-------LNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNN 249
           MK VSVI+P  N    ++K+ I S+ NQT  N E+  I+D ST+    I       Y+ ++      N GV K R+YG++ A GEY++F+D+DD+L   A++ L+ +   Y  I            KK +    K++   ++ V+    +SK+       +T   + F  +++ + K+   ++V+ F D+ F  +  +L K+       L FY +        N   S+   KYK +D  S+    K  L +N    N
  S:     1 MKTVSVIVPVYNKE-DYLKRCINSVLNQTYTNLEIILINDGSTDNSKGILTEFVREYEQIRYYEFQRNYGVAKARNYGLSKATGEYVYFLDADDYLMAQAVEVLVDNIGDYSAIAGPCL-------KKTV----KYSSIKDVNVQLYTQESKIKMLRG--KTVLNILFSNKYIRRYKLKFDEEVSFFSDLTF--LIPLLAKEDTFPMINLPFYIKGECYEPIDNPTLSIIATKYKIHDFFSVYKSLKGNLYKNIFIFN 242
>gi|68643258|emb|CAI33534.1| putative glycosyl transferase [Streptococcus pneumoniae] (354 aa)
Score = 160, Expect = 3.1e-09, Identities = 67/236 (28%), Positives = 116/236 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNK-------SKMPWFHNNYQ---TDWRVCFKKE-FLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNK 238
           ++SVI+P  N   ++++Q + SL NQT ++FE+  ++D ST+    +  +   K+   +V +  N  G+G  R+ GV  A G+YI FVDSDD++ +D +  L  +  +Y         Y   F   +I       +  ++    +V         S  P + N+ +   + W+V +K   F  K  + H ++  I ED  F +    L   AL+    LY+Y R N  S    YK    +L  I++  +
  S:     9 EISVIVPVYNVE-RYLRQCMDSLINQTYRDFEIILVNDGSTDSSGILCEEWAKKDERIHVVHKKNE-GLGFARNTGVEHAKGKYITFVDSDDYVSLDMLQTLYNAVQEYDVEVVYSAGYYRSFSNGEIKKTDVGTKKPQLFEGGDVASELLPNVISAPPEYPNDGKVGVSAWKVLYKANLFKDKGLLFHSEREFISEDAIFQIDCLKLATSALVIPDILYYY-RENFGSLSMKYKEDRFELDKILYNEQ 254
>gi|118727904|ref|ZP_01576488.1| glycosyl transferase, family 2 [Clostridium cellulolyticum H10] >gi|118662718|gb|EAV69395.1| glycosyl transferase, family 2 [Clostridium cellulolyticum H10] (333 aa)
Score = 159, Expect = 3.7e-09, Identities = 44/105 (41%), Positives = 60/105 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSVIIP  N   K + +   +L NQT K+FE+ F+DD ST+  + I    K     +   P N GV   R+ GV  A+G+ ++F+DSD  LY DAI+  LK F K
  S:     7 VSVIIPNYNYE-KTLPKCFDTLMNQTYKDFEIIFVDDGSTDNSIEI---AKKYPCKIFKTPKNGGVAAARNLGVEYASGDILFFLDSDVALYKDAIENTLKEFEK 107
>gi|171742195|ref|ZP_02918002.1| hypothetical protein BIFDEN_01301 [Bifidobacterium dentium ATCC 27678] >gi|171277809|gb|EDT45470.1| hypothetical protein BIFDEN_01301 [Bifidobacterium dentium ATCC 27678] (329 aa)
Score = 157, Expect = 6.7e-09, Identities = 59/208 (28%), Positives = 99/208 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLIN----KNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK--------------QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           VS+I+P  NT   ++   + SL  QT  N +V  +DD ST+     DL +    K+    V +  N  GV   R+ G+  A G+++ FVDSDDWL  +AI+ LL    + ++    +F Y  V D+                  + S+ +  D I+  + V               W   F +E + +  +    K+ + ED+ F + + +L    + T + LY Y
  S:     8 VSIIVPVYNTG-NYLNVCVNSLLRQTYANIQVILVDDGSTDGSA--DLCDAWADKDSRVMVIHQANG-GVSTARNAGLDAAEGDWLEFVDSDDWLEREAIEGLL-GLVQSEHAQMAIFNYRSVLDEDTPYTVCEKTSDYRISSGVLSRKDALDVILAYSGVKGYA-----------WNKFFSRELIERQNLRFDSKITMCEDLLFSVEYALLSTVTVGTDRCLYNY 217
>gi|148989439|ref|ZP_01820807.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae SP6-BS73] >gi|147925189|gb|EDK76269.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae SP6-BS73] (291 aa)
Score = 156, Expect = 8.5e-09, Identities = 40/117 (34%), Positives = 68/117 (58%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNG-YQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE 120
           +S+I+P  N   K+++Q + S+ NQT +NFE   I+D S +    I  + + K+  ++Y +    N G+   R+ G+  + G YI FVDSDDWL  D ++ L     +Y + DF++  Y+
  S:     6 ISIIVPIYNVE-KYLRQCLDSIQNQTYQNFECLLINDGSPDHSSKICEEFVEKDSRFKYFEKA--NGGLSSARNLGIECSGGAYIAFVDSDDWLESDYLEVLYSKIVEY-DTDFVIGSYK 121
>gi|60681541|ref|YP_211685.1| putative capsular polysaccharide glycosyltransferase [Bacteroides fragilis NCTC 9343] >gi|60492975|emb|CAH07753.1| putative capsular polysaccharide glycosyltransferase [Bacteroides fragilis NCTC 9343] (317 aa)
Score = 155, Expect = 1.2e-08, Identities = 68/259 (26%), Positives = 130/259 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI--NLFSKHNQFD---EIIVKNNVNKSKMPWFHNNYQTDWRVC---FKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLE----NKLFNNNWYFYASNWLGA 261
           KVSVIIP  NT   ++++ + S+  QT +  E+  IDD ST+  +  ++ I     +      +N G+   R+ G+  + GEYI+F+DSDD+L  DA++   +   K + +DF+ F+ E    +  I  + F      D   +I    ++ K+++      Y+    VC   F +EF+ + ++S    + + ED  F +I   L+       ++ +F+ R+   +S+ T K+   ++   +      L E     K +++  +F+    L A
  S:     9 KVSVIIPVYNT-CNYVQEALESICQQTLEELEIIVIDDGSTDCSRAIVEEIAIKDTRIQVYKQSNQGLSITRNQGLKFSTGEYIYFMDSDDFLEPDALELCYRKCTK-EALDFVFFDAETFTIEPNIPESSFDYQRTLDLPEKICSGIDMLKTQL----KTYKFKSSVCLNLFHREFICEERLSFYPGI-LHEDQLF-MIQAYLHASKTGFIRRSFFHRRIRT-NSIMTKKFTWKNMEGYLTVTNELLRELPIYPKTYHHTIFFFLRQMLDA 271
>gi|42526937|ref|NP_972035.1| glycosyl transferase, group 2 family protein [Treponema denticola ATCC 35405] >gi|41817252|gb|AAS11946.1| glycosyl transferase, group 2 family protein [Treponema denticola ATCC 35405] (327 aa)
Score = 154, Expect = 1.6e-08, Identities = 59/191 (30%), Positives = 95/191 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF--DKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLI 193
           K S+I+P  NT  K+++  I S+ NQ+  ++E+  ++D ST+    I     +  + + N  N  G   +R  GV  A+G+YI F+DSDDWL  D +  L K     +  D+I F Y  V+   +K+I  FSK ++  EI    +V  SK         T W  C+    +     S PD   +F + Y+ ++
  S:     2 KFSIIMPVYNTE-KYVEVAILSVLNQSYTDYELICVNDGSTDGSAQILSAFADKIKIIHNYSNK-GHHCVRKVGVQNASGDYILFLDSDDWLECDTLKILAKELTNSRP-DYIEFGYYMVYANGQKKIWHFSKEDKTKEI---TDVLLSKAN------HTLWNKCYSANIIKPIYDSLPDFYAVFSEDYYQMV 182
>gi|153807287|ref|ZP_01959955.1| hypothetical protein BACCAC_01565 [Bacteroides caccae ATCC 43185] >gi|149130407|gb|EDM21617.1| hypothetical protein BACCAC_01565 [Bacteroides caccae ATCC 43185] (322 aa)
Score = 153, Expect = 1.8e-08, Identities = 60/211 (28%), Positives = 103/211 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-------NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKH----NQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M  +S+IIP  N+  K++KQ + S+  Q + +FE+  IDD ST      D   K   +Y     N       N GV   R+ G+  A GEY+ FVDSDDWL  +A+ +L+    +  ++D I +   +      + L+S +    + F E + +  ++    P +++     W   F+   L +  I   + ++  ED  F L +    KK ++    +Y Y
  S:     1 MPTLSIIIPVYNSE-KYLKQCLDSILAQASDDFEILLIDDGST------DFSGKLCDEYASRYNNIYVFHEKNRGVSAARNKGIERAQGEYVIFVDSDDWLEKNALSFLMA---QESDVDLIFYGSSFHSVNGNVTLYSPNLCICHGFSE-VQEGMIDLITNPKYYDYLGFTWNKVFRSNILKEYNIRFIENLSYREDEVFTLHYAHYCKKLMILPNIVYNY 211
>gi|68643906|emb|CAI34082.1| putative glycosyl transferase [Streptococcus pneumoniae] (326 aa)
Score = 153, Expect = 2.0e-08, Identities = 43/106 (40%), Positives = 63/106 (59%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           KVSVIIP  N   K++++ + S+ NQT K+ E+  ++D S +    I       Y  +Q I  NN G+G  R+ G+    G+ I FVDSDDWL +DAI+Y ++S  K
  S:     2 KVSVIIPIYNVE-KYLRRCLESIVNQTYKDIEIILVNDGSPDNSKEICEEYVVKYSNIQLINQNNAGLGAARNKGLQYVTGDAITFVDSDDWLELDAIEYYVESMKK 107
>gi|116492371|ref|YP_804106.1| glycosyltransferase-like protein [Pediococcus pentosaceus ATCC 25745] >gi|116102521|gb|ABJ67664.1| Glycosyltransferase related enzyme [Pediococcus pentosaceus ATCC 25745] (322 aa)
Score = 153, Expect = 2.0e-08, Identities = 57/210 (27%), Positives = 104/210 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNI-----DFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           KKVS++IP  N    ++++ +TS+  Q+   FEV  IDD ST N     +   KN  +++     N GV   R+ G+  A G+YI FVD DD+L  + I+ ++  F+K + +     +      + +F   +   F++ N   +I+    V           Y   W   +KK+ L +N +   + ++  ED+ F + + +L  +++L +   Y Y
  S:     3 KKVSIVIPIYNVD-GFLERCLTSVKEQSYTFFEVLLIDDGSTDNSNKICNEFVKNDDRFIYIYQKNAGVSAARNNGIRNAYGDYITFVDGDDFLEENHIEKMVNGFFKAELVISGRKNVTEKGVQEIFQSNEELFFNRGNLVKQILKLGIV-----------YSFPWNKMYKKKILDENSLHFDESLDYGEDLVFNIQYALLIHESVLITSSTYNY 206
>gi|77958257|ref|ZP_00822293.1| COG0463: Glycosyltransferases involved in cell wall biogenesis [Yersinia bercovieri ATCC 43970] (325 aa)
Score = 153, Expect = 2.1e-08, Identities = 61/232 (26%), Positives = 116/232 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKK-QINLFSKHNQ-FDEII-----VKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNT-----YKYKANDLVSII 234
           +VS+I+P  N    ++ +L+ SL +Q   +FE+  ++D ST+  P++  D         + N  N  G+   R+ G+  A G++I FVD DDWL  +A+   L    K Q++D ++   Y +  D   Q      H Q + E++     +  +V + + P F       W    ++E +++N+++    + + ED+ +      + ++     +  Y Y R N ES  N+      + +AN  + II
  S:     5 EVSIIVPVYNCE-TYLAELLDSLRSQVGVSFEIIAVNDGSTDSSPEMLADTARNESRLVIINQANQ-GLSAARNAGIARATGQWIAFVDGDDWLAPNALQRWLTQ-AKEQSLDLLIGNGYRFTTDPAVQTAAPLLHKQPWGEVLDGQQWIMRSVEQDEWPHFA------WLQLIRREVIIENQLAFIRDM-VHEDILWTTQLARVARRVGFCQQPFYGY-RTNPESITNSPSPQALQRRANSYLDII 240
>gi|24637448|gb|AAN63722.1|AF454497_11 Eps6J [Streptococcus thermophilus] (330 aa)
Score = 152, Expect = 2.2e-08, Identities = 70/224 (31%), Positives = 112/224 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ--YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTD------------------WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYK 226
           K SVIIP  N   K+I + + S+ +Q   + E+  +D+ ST+    I  I  N +    V +I N+ GVG  R++G++ A GE+I+FVDSDD+L  +                F  FE + V D   + +FS +N F+E + +    +  +P F  NY  D                  W   +++EFL++N  S  ++  + EDV F L       K  L+    Y Y      S+++ Y  K
  S:     2 KYSVIIPVYNVE-KYIDRCLKSIISQNYDDLEIIVVDNGSTDSSGSICDIYANEHSNISVYHIENH-GVGSARNFGLSKAKGEFIYFVDSDDYLVGNL---------------FAEFEDKLVLD-LDLAVFSYYNSFEEDLTEKQRTEKSLP-FKGNYDKDGFIKIFKELFLSDMLYTVWNKIYRREFLLENNFSF-EQYELGEDVRFNLDVYREVNKIYLSQVSYYVYVTGRKGSAMSGYNPK 225
>gi|183602167|ref|ZP_02963535.1| glycosyltransferase [Bifidobacterium animalis subsp. lactis HN019] >gi|183218660|gb|EDT89303.1| glycosyltransferase [Bifidobacterium animalis subsp. lactis HN019] (337 aa)
Score = 152, Expect = 2.4e-08, Identities = 44/116 (37%), Positives = 69/116 (59%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQY----VQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIM 116
           M ++SVIIP  N   +++   + SL +Q+ ++FEV  ++D ST+  V I      GY+     VQ I  NN GV   R+ G++ A GE++ F+D DD++  D +D LLK+    +N D  M
  S:     1 MPEISVIIPVYNQE-EYVGACMDSLLDQSFEDFEVLAVNDGSTDASVSI----LEGYEQRDGRVQLIDQNNSGVSVARNNGLSHAKGEWVCFIDPDDYVAPDYLDTLLKA--TERNTDIAM 114
>gi|84489253|ref|YP_447485.1| glycosyltransferase [Methanosphaera stadtmanae DSM 3091] >gi|84372572|gb|ABC56842.1| predicted glycosyltransferase [Methanosphaera stadtmanae DSM 3091] (358 aa)
Score = 152, Expect = 2.6e-08, Identities = 61/214 (28%), Positives = 119/214 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEI--IVKNNV--NKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRL 214
           M KVSV+IP  N   K+++  + ++ NQT ++ E+  ++D ST+  + I  +  +K+    V +  N  G     + G+T A GEY++ +DSDD L ++A++    S  K +++DF++F+     D+K     +++   ++I  IVK+N+   +       +   T W   + + F+ +N I+ P+ +   ++V+F   WKVL+     ++K++YFY   
  S:     1 MVKVSVVIPVYNVE-KYLRDCLDTIVNQTLEDIEIICVNDGSTDKSLDILNEYASKDERMRVISQENG-GHAVATNVGMTYATGEYLFLMDSDDILKLNALEDTY-SIAKEKDVDFVLFKAINYDDEKDEYYEAENYSMNKIARIVKDNIFSYEDLGDAIFDITVTPWSKLYNRSFIEENNITFPEGLVFDDNVFF---WKVLF-----SAKRIYFYKEF 209
>gi|85858266|ref|YP_460468.1| glycosyltransferase [Syntrophus aciditrophicus SB] >gi|85721357|gb|ABC76300.1| glycosyltransferase [Syntrophus aciditrophicus SB] (361 aa)
Score = 152, Expect = 2.6e-08, Identities = 55/210 (26%), Positives = 105/210 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFD-EIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN 212
           KVS+++P  N   K++++ + SL  QT  + E+  ++D S +    I    +     ++ + N  N+G+GK RD G++ A G+YI FVDSDD+++   I++ ++   KY + D + F++ +  +   I+L  +  ++  E I  +N                W    K E +   K+        +ED  F   + +  K+A++ S  LY+Y+
  S:     7 KVSIVVPVYNVE-KYLRRCLNSLIVQTYDDLEIIIVNDCSPDDSERIIQEYQMQDPRIRYLKNDVNLGLGKSRDCGISAATGKYIMFVDSDDFIHHTTIEHCVEWMEKYDS-DIVEFKFVYYREGDVIDLDRQKPEYKIEYIAVDNRETDLTCINEKIDGVCWNKLLKTELI--KKLGLKFYARFYEDSPFTRAYVMNIKRAVIVSLPLYYYS 215
>gi|154501105|ref|ZP_02039143.1| hypothetical protein BACCAP_04794 [Bacteroides capillosus ATCC 29799] >gi|150269933|gb|EDM97461.1| hypothetical protein BACCAP_04794 [Bacteroides capillosus ATCC 29799] (294 aa)
Score = 151, Expect = 3.2e-08, Identities = 52/210 (24%), Positives = 100/210 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-----YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-------QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNR 213
           VS+I+P  N    ++++ ++S+  QT ++FEV  +DD ST+        Y+ L ++  ++ +     N G    R+ G+T A G Y+ FVD DDWL  D+++ LL +  +    D  +  +  V  ++       +        ++ + +VK   N      F+  Y   W   +++  +  N +  P  V   ED  F L +    +      + +Y+Y +
  S:     6 VSIIVPVYNVK-PYLEKCLSSIRFQTCRDFEVLLVDDGSTDGSADICRSYVALDSR--FRLLTQA--NAGASAARNLGMTQAAGRYLQFVDGDDWLPTDSVELLLHT-AESTGADLTVAHFYRVAGERCAARGHIREERVMTRTEYADYMVKAPAN------FY--YGVMWNKLYRRAIVEANHLECPADVAWCEDFLFNLDYIACCRLIAAVPRPVYYYRK 213
>gi|116618523|ref|YP_818894.1| glycosyltransferase-like protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097370|gb|ABJ62521.1| Glycosyltransferase related enzyme [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (323 aa)
Score = 151, Expect = 3.7e-08, Identities = 55/174 (31%), Positives = 98/174 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP------NNIGVGKIRDYGVTLANGEYIWFVDSDDWL---YVDAIDYLLKSFYKYQNIDFIMFEYEWVFD-KKQINLFSKHNQF---------DEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKIS 177
           +++++P  N   K+I  L+  L +QTN NFE+ F+DD ST+    ++++ +N     + +        N G+   R+ G  +A G YI+F+DSDD +   +V+ I+Y       Y N D ++F+YE + +  + I  F  H            DE+++  +++K ++P       T W    K+  +VKN IS
  S:     8 LTIVVPVYNVE-KYIGSLLACLFDQTNSNFEIIFVDDGSTDRS--LEIVRQNLPTIRKKVSAKLVKQKNEGLSSARNSGAAVATGTYIFFLDSDDVIAENFVEMINYFCDY---YDNPDTLIFDYESINEFGENIESFYGHGDIYQKKDLLNNDEVLL--SLSKDEVP------TTAWSFVTKRSIIVKNDIS 186
>gi|154487976|ref|ZP_02029093.1| hypothetical protein BIFADO_01544 [Bifidobacterium adolescentis L2-32] >gi|154083449|gb|EDN82494.1| hypothetical protein BIFADO_01544 [Bifidobacterium adolescentis L2-32] (327 aa)
Score = 150, Expect = 4.2e-08, Identities = 54/152 (35%), Positives = 82/152 (53%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK----NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNV---NKSKMPW 153
           K VS+IIP  NT  K+I   I S+  QT  N EV  ++D S +    +++I K    +    V N  NN G    R+ G+ +  G+Y++F+DSDDWL  + I+ L+ S  K + +D I F+Y   F  K I  F+    F   + KN+     ++  PW
  S:     3 KLVSIIIPAYNTE-KYIGNCIESVIKQTYHNLEVIIVNDGSEDNT--LEIITKARLRDNRIVVINQENN-GPSAARNAGLKICRGDYVFFLDSDDWLIPNCIEKLI-SIEKKKKVDIIFFDYYKNFAGKDIEHFTYKKDFYYRVSKNSALWDMRTITPW 156
>gi|84386725|ref|ZP_00989751.1| hypothetical protein V12B01_01307 [Vibrio splendidus 12B01] >gi|84378531|gb|EAP95388.1| hypothetical protein V12B01_01307 [Vibrio splendidus 12B01] (308 aa)
Score = 150, Expect = 4.4e-08, Identities = 48/146 (32%), Positives = 83/146 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFD-------------EIIVKNNV 146
           M KVSV+IP  N  L ++ + I S+  QT+++ E+  IDDNS +    Y+  I+      +  +   +G  + R+ G+  A GEYI F+D+DD+ + + I+  L+   +Y ++      YE + +  Q  ++ FS  +QF              E I++NNV
  S:     1 MAKVSVVIPTYNC-LDYLPKAIGSVLKQTHQDVELIIIDDNSNDGTSTYLASIHDERIIKLSTL--GVGAPQARNLGIEKATGEYIAFLDADDFWFPEKIERQLEFHQRYPDLAMSFTNYEHLTEDYQVIVDCFSYWSQFQDQDELFINIESPLEFIIENNV 159
>gi|68643623|emb|CAI33841.1| putative glycosyl transferase [Streptococcus pneumoniae] (322 aa)
Score = 150, Expect = 4.5e-08, Identities = 62/230 (26%), Positives = 111/230 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDL 230
           MKKVS+I+P  N   ++IK+ + S+  QT  N EV  ++D +T+  V Y + I K   ++      N G+   R+ G+  A G+Y+ FVDSDD++  D + YL+ S    +    I     +  D++  +L   +      + +      +M +  +   + W   +KKE    + I  P    +FED     +     +K + ++ KLY Y  ++ ++S+ T K+   DL
  S:     1 MKKVSIILPVYNVE-QYIKKCLESIQQQTYPNLEVIIVNDGATDKSVEYCEQICKIDSRFSVTHKENGGLSDARNVGIDKAKGDYLIFVDSDDFVSQDMVSYLVSSMENNEADIAICDPAHYYSDRQNNDLNIFYPASSVKVYEKTEALCEMFYQKSFLVSAWAKIYKKELF--DDIRFPVG-KLFEDSAVMYLLFEKCEKIVYSNAKLYAY--VHRDNSITTKKFSDKDL 225
>gi|167471592|ref|ZP_02336296.1| putative two-domain glycosyltransferase [Rickettsia africae ESF-5] (604 aa)
Score = 149, Expect = 4.9e-08, Identities = 47/123 (38%), Positives = 64/123 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           KVSVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +  I K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  LK F +  N  F    Y+ + +K
  S:   294 KVSVIIPVYNR-INWAIEAIESVLIQTHKNFEILIIDDGSTDDISELTAICKKDKRIKYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLK-FMEENNFIFSHTSYQKINEK 414
Score = 110, Expect = 2.1e-03, Identities = 43/149 (28%), Positives = 75/149 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDD----NSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           VS+IIP  N    ++K+ I S   QT KN E+  ++D    N    +V +   +K  Y + +N     G G   +YG+    GEY  ++  DD  Y + I++ +    K  N D I++    + D+K  +L  ++ + D ++  N +N S +P
  S:    16 VSIIIPVYNGA-NYMKEAINSALAQTYKNIEIIVVNDGSKDNGETERVALSYGDKIRYFHKENG----GCGSALNYGIKNMQGEYFSWLSHDDIYYPNKIEHQVDILNKLDNKDTIIYGGYELIDEKGNSL--RYIKPDSVLPINKLNISLLP 161
>gi|154497318|ref|ZP_02036014.1| hypothetical protein BACCAP_01611 [Bacteroides capillosus ATCC 29799] >gi|150273717|gb|EDN00845.1| hypothetical protein BACCAP_01611 [Bacteroides capillosus ATCC 29799] (324 aa)
Score = 149, Expect = 5.7e-08, Identities = 40/124 (32%), Positives = 62/124 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ 127
           +S+I+P  N    ++ Q + S+  QT  + E+  +DD S  N     D   +   +       N G+   R+ G+ +A+GEYI FVDSDDWL  D ++  LK   +  N D I F   W + +K 
  S:     5 ISIIVPVYNVE-PYLDQCVRSIIEQTYTDLEIILVDDGSPDNCPAMCDAWAEKDRRIKVVHKQNGGLSDARNAGMDIASGEYIGFVDSDDWLEPDILESALKQLVQ-ANADIIAFGAIWEYSEKH 127
>gi|157828334|ref|YP_001494576.1| glycosyltransferase [Rickettsia rickettsii str. 'Sheila Smith'] >gi|157800815|gb|ABV76068.1| putative two-domain glycosyltransferase [Rickettsia rickettsii str. 'Sheila Smith'] (576 aa)
Score = 149, Expect = 5.8e-08, Identities = 46/123 (37%), Positives = 64/123 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           K+SVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +  I K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  LK F +  N  F    Y+ + +K
  S:   266 KISVIIPVYNR-INWAIEAIESVLIQTHKNFEILIIDDGSTDDISELTAICKKDKRIKYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLK-FMEENNFIFSHTSYQKINEK 386
Score = 97, Expect = 6.8e-02, Identities = 37/135 (27%), Positives = 68/135 (50%)
  Q:    18 IKQLITSLNNQTNKNFEVFFIDD----NSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           +K+ I S   QT KN E+  ++D    N    +V +   +K  Y + +N     G G   +YG+    GEY  ++  DD  Y + I++ ++   K  N D I++    + D+K  +L  ++ + D ++  N +N S +P
  S:     1 MKEAINSALAQTYKNIEIIVVNDGSKDNGETERVALSYGDKIRYFHKENG----GCGSALNYGIKHMQGEYFSWLSHDDIYYPNKIEHQVEILNKLDNKDTIIYGGYELIDEKGNSL--RYIKPDSVLPINKLNISLLP 133
>gi|67458935|ref|YP_246559.1| glycosyltransferase [Rickettsia felis URRWXCal2] >gi|75536627|sp|Q4UM29|Y543_RICFE Uncharacterized glycosyltransferase RF_0543 >gi|67004468|gb|AAY61394.1| Two-domain glycosyltransferase [Rickettsia felis URRWXCal2] (602 aa)
Score = 149, Expect = 6.2e-08, Identities = 47/123 (38%), Positives = 64/123 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           KVSVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +  I K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  LK F +  N  F    Y+ + +K
  S:   294 KVSVIIPVYNR-INWAIEAIESVLIQTHKNFEILIIDDGSTDDISELTSICKKDKRIRYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLK-FMEENNFIFSHTSYQKINEK 414
Score = 105, Expect = 6.8e-03, Identities = 39/149 (26%), Positives = 72/149 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           VS+IIP  N    ++++ I S   QT +N E+  ++D S +     ++    G +       N G G   +YG+    GEY  ++  DD  Y + I++ +    K  N D I++    + D+K  +L  ++ + D ++  N +N S +P
  S:    16 VSIIIPVYNGA-NYMREAIDSALAQTYENIEIVVVNDGSKDNGETENVALSYGDKIRYFHKENGGCGSALNYGIKNMKGEYFSWLSHDDIYYPNKIEHQVNILNKLDNKDTIIYGGYELIDEKGSSL--RYIKPDSVLPINKLNISLLP 161
>gi|149191027|ref|ZP_01869288.1| hypothetical protein VSAK1_00230 [Vibrio shilonii AK1] >gi|148835161|gb|EDL52137.1| hypothetical protein VSAK1_00230 [Vibrio shilonii AK1] (312 aa)
Score = 149, Expect = 6.4e-08, Identities = 44/146 (30%), Positives = 85/146 (58%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFD-------------EIIVKNNV 146
           M K+S+IIP  N  ++++ + + S+ +QT+++ EV  +DDNST N   Y++ I+ +  Q +    + +G    R+ G+  A+G+YI F+D+DD+   + ++  L     +  +      Y+ V ++ +  I+ F   NQF              E +++NNV
  S:     1 MAKISIIIPTYNC-VEYLPKAVESVFSQTHQDIEVIVVDDNSTDNTSGYLNSISDSRMQIITT--SGLGASGARNLGINRASGDYIAFLDADDYWMPNKLERQLHFHQCHPELAGTFTNYQHVTEQYEEIIDCFGYWNQFQSDSRQYIVMNDALEFVLQNNV 159
>gi|165933043|ref|YP_001649832.1| glycosyltransferase [Rickettsia rickettsii str. Iowa] >gi|165908130|gb|ABY72426.1| glycosyltransferase [Rickettsia rickettsii str. Iowa] (604 aa)
Score = 148, Expect = 7.0e-08, Identities = 46/123 (37%), Positives = 64/123 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           K+SVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +  I K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  LK F +  N  F    Y+ + +K
  S:   294 KISVIIPVYNR-INWAIEAIESVLIQTHKNFEILIIDDGSTDDISELTAICKKDKRIKYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLK-FMEENNFIFSHTSYQKINEK 414
Score = 112, Expect = 1.2e-03, Identities = 43/149 (28%), Positives = 76/149 (51%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDD----NSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           VS+IIP  N    ++K+ I S   QT KN E+  ++D    N    +V +   +K  Y + +N     G G   +YG+    GEY  ++  DD  Y + I++ ++   K  N D I++    + D+K  +L  ++ + D ++  N +N S +P
  S:    16 VSIIIPVYNGA-NYMKEAINSALAQTYKNIEIIVVNDGSKDNGETERVALSYGDKIRYFHKENG----GCGSALNYGIKHMQGEYFSWLSHDDIYYPNKIEHQVEILNKLDNKDTIIYGGYELIDEKGNSL--RYIKPDSVLPINKLNISLLP 161
>gi|34580612|ref|ZP_00142092.1| putative two-domain glycosyltransferase [Rickettsia sibirica 246] >gi|28261997|gb|EAA25501.1| putative two-domain glycosyltransferase [Rickettsia sibirica 246] (604 aa)
Score = 148, Expect = 7.1e-08, Identities = 46/123 (37%), Positives = 64/123 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           K+SVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +  I K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  LK F +  N  F    Y+ + +K
  S:   294 KISVIIPVYNR-INWAIEAIESVLIQTHKNFEILIIDDGSTDDISELTAICKKDKRIKYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLK-FMEENNFIFSHTSYQKINEK 414
Score = 110, Expect = 2.1e-03, Identities = 43/149 (28%), Positives = 75/149 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDD----NSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           VS+IIP  N    ++K+ I S   QT KN E+  ++D    N    +V +   +K  Y + +N     G G   +YG+    GEY  ++  DD  Y + I++ +    K  N D I++    + D+K  +L  ++ + D ++  N +N S +P
  S:    16 VSIIIPVYNGA-NYMKEAINSALAQTYKNIEIIVVNDGSKDNGETERVALSYGDKIRYFHKENG----GCGSALNYGIKNMQGEYFSWLSHDDIYYPNKIEHQVDILNKLDNKDTIIYGGYELIDEKGNSL--RYIKPDSVLPINKLNISLLP 161
>gi|86147027|ref|ZP_01065345.1| hypothetical protein MED222_20034 [Vibrio sp. MED222] >gi|85835277|gb|EAQ53417.1| hypothetical protein MED222_20034 [Vibrio sp. MED222] (308 aa)
Score = 148, Expect = 7.6e-08, Identities = 48/146 (32%), Positives = 82/146 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFD-------------EIIVKNNV 146
           M KVSV+IP  N  L ++ + I S+  QT+++ E+  IDDNS +    Y+  I       +  +   +G  + R+ G+  A GEYI F+D+DD+ + + I+  L+   +Y ++      YE + +  Q  ++ FS  +QF              E I++NNV
  S:     1 MAKVSVVIPTYNC-LDYLPKAIGSVLKQTHQDVELIVIDDNSNDGTSTYLASIEDERIITLSTL--GVGAPQARNLGIEKATGEYIAFLDADDFWFPEKIERQLEFHQRYPDLAMSFTNYEHLTEDYQVIVDCFSYWSQFQDQDEAFINIENPLEFIIENNV 159
>gi|154504892|ref|ZP_02041630.1| hypothetical protein RUMGNA_02402 [Ruminococcus gnavus ATCC 29149] >gi|153794775|gb|EDN77195.1| hypothetical protein RUMGNA_02402 [Ruminococcus gnavus ATCC 29149] (336 aa)
Score = 148, Expect = 7.8e-08, Identities = 58/211 (27%), Positives = 100/211 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFS--KHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKA---LLTSKKLYFY 211
           M  VS+I+P  N    +I+  I SL  QT  N EV  +DD ST+    +        + ++ I   N G+   R+ G++ A GEY+ FVDSDD++    ++  +    + Q  D ++F+Y+      +I L S  K  +   +     ++   +P       +     +K+ F    +I +P+  N FED+   +I ++L +      L    LYFY
  S:     3 MSLVSIIVPVYNVE-PYIETCIQSLIRQTMGNIEVILVDDGSTDRSGELCDQYAEADERIRVIHKQNGGLSSARNAGISAAKGEYLLFVDSDDYVSASLVEKTVSCAEQNQ-ADVVVFDYQ------EIELCSGGKQTRTSALPAGQVIHAESVPQLLLITPSACNKLYKRSFWEMTQIVYPEGRN-FEDL--SVIPRILLQAGRVVYLEGDPLYFY 208
>gi|167767626|ref|ZP_02439679.1| hypothetical protein CLOSS21_02159 [Clostridium sp. SS2/1] >gi|167710643|gb|EDS21222.1| hypothetical protein CLOSS21_02159 [Clostridium sp. SS2/1] (324 aa)
Score = 148, Expect = 7.8e-08, Identities = 68/254 (26%), Positives = 114/254 (44%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI-----MFEYEWVFD-KKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVES-SLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFY 254
           M K+S+I+P  NT  K+I   I S+  Q  K+FE+  IDD S +    I          ++ I   N GV   R+ G+  A GE I+F+DSDD +  D     LK+     + DF+     + E +++       ++F  +NQF               W  +  Q     C  ++ + +N +     + + ED  F  I+    KK   T+   Y+YN  N++S S   Y+ +    + +I K + Y  +  L    W ++
  S:     1 MPKISIIVPVYNTE-KYISNCIESILKQKEKDFELLLIDDGSKDQSGRICDTYATKDDRIKVIHKKNGGVSSARNLGIDHAKGEMIFFIDSDDTVGPD----YLKNLEIIDDEDFVQSGVKILENDYLKPIMTHEDIFKDYNQF---------------WMQSRQQWPSMCCLSRKVIEENHLRFDTNLKMGEDGLFNQIFISKCKKIRRTTFNQYYYNSDNLQSASHKFYEDRLEQQLILIAKLEEYFPDKDLNRIRWDYW 242
>gi|16080483|ref|NP_391310.1| hypothetical protein BSU34300 [Bacillus subtilis subsp. subtilis str. 168] >gi|1495286|emb|CAA96475.1| hypothetical protein [Bacillus subtilis] >gi|1945697|emb|CAB08030.1| hypothetical protein [Bacillus subtilis] >gi|2635943|emb|CAB15435.1| yveR [Bacillus subtilis subsp. subtilis str. 168] (344 aa)
Score = 147, Expect = 9.3e-08, Identities = 57/241 (23%), Positives = 114/241 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQV---YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQT-----DWRVCFKKEFLVKNKISHP--DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFK-NKNYLLEN 244
           VS+++   NT   +I+  + SL NQT  N E+  ++D S +  P +   Y  + N+  ++ +     N G+G +R+ G+  A GE+I F+DSDDW+  D  + +L++       D ++  Y   F+             D  I +   ++ K  +    ++       W   +++  +  +++S P   ++   ED +F        +        LY Y R+++ S +  Y+ K  +    +++ N  +L EN
  S:     6 VSLLVAVYNTE-TYIRTCLESLRNQTMDNIEIIIVNDGSADASPDIAEEYAKMDNR--FKVIHQ--ENQGLGAVRNKGIEAARGEFIAFIDSDDWIEPDYCEQMLRT--AGDETDLVICNYAAEFE-------DTGKTMDSDIAQTYQDQPKEHYIKALFEGKVRGFSWNKLYRRSMIEAHRLSFPLRGELEHVEDQFFSFRAHFFARSVSYVKTPLYHY-RIHLSSIVQRYQKKLFESGLALYETNAAFLQEN 244
>gi|190150745|ref|YP_001969270.1| Putative glycosyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189915876|gb|ACE62128.1| Putative glycosyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (331 aa)
Score = 147, Expect = 9.6e-08, Identities = 65/232 (28%), Positives = 108/232 (46%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-----YIDLI-NKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVES-SLNTYKYKANDLVSII 234
           KVS+++P  NT  ++I++   SL  QT ++ E  FI+D + +  +      IDL  N+  Y  +     N G+   R+ G+  A GEYI  VDSDD++ + A++ L     +  N D +M +  W ++K    +          I  +N +  +M     +    W   FK+E  + N+I   D VN  ED            K     K LY Y + N  + + N  K    D++S++
  S:     4 KVSILVPIYNTS-RFIEKCAISLFEQTFQDIEYIFINDCTPDNSIEILKNVIDLYPNRKKYVKILEHQENKGLASSRNTGIANAKGEYILHVDSDDYIDLYAVELLYNKAIQ-DNADIVMCDALWEWNKTSKLVIQN-------IGNSNQDCLEMILSGKSPPCVWNKLFKRELYINNRIKALDGVNFGEDYLVTPQLIYFSNKISKVDKPLYHYIQFNTNAYTKNISKKSVYDIISVL 233
>gi|182684716|ref|YP_001836463.1| glycosyl transferase [Streptococcus pneumoniae CGSP14] >gi|182630050|gb|ACB90998.1| glycosyl transferase [Streptococcus pneumoniae CGSP14] (291 aa)
Score = 147, Expect = 9.6e-08, Identities = 38/117 (32%), Positives = 67/117 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNG-YQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE 120
           +S+I+P  N   K+++Q + S+  QT  NFE   ++D+S +    I  + + K+  ++Y +    N G+   R+ G+  + G YI FVDSDDWL  D ++ L     +Y + DF++  Y+
  S:     6 ISIIVPIYNVE-KYLRQCLDSIQKQTYPNFECIMVNDDSPDHSSKICEEFVEKDSRFKYFEKA--NGGLSSARNLGIECSGGAYIVFVDSDDWLESDYLEVLYSKIVEY-DTDFVIGSYK 121
>gi|150423686|gb|EDN15628.1| putative teichuronic acid biosynthesis glycosyl transferase TuaG [Vibrio cholerae AM-19226] (266 aa)
Score = 147, Expect = 9.8e-08, Identities = 44/113 (38%), Positives = 70/113 (61%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL---YVDAIDYLLK-----SFYKYQNID 113
           M+KVSVI+P  N+  +++   I S+ NQT KN+E+  IDD S +  V I     +++    +  +P N G    R+ G+ +A+G YI F+DSDD WL     + ID++ K     S+  Y+ I+
  S:     1 MEKVSVIMPLYNSA-RFLSSSIESVINQTYKNWELLLIDDCSKDDSVIIAQSYSDQDKRIRLLRLPKNSGAAIARNEGIRIASGRYISFLDSDDIWLPNKLKEQIDFMEKNDASFSYSAYKKIN 123
>gi|76799046|ref|ZP_00781240.1| CpsVJ [Streptococcus agalactiae 18RS21] >gi|76585606|gb|EAO62170.1| CpsVJ [Streptococcus agalactiae 18RS21] >gi|126722163|emb|CAM57119.1| Cps5J protein [Streptococcus agalactiae] >gi|157644630|gb|ABV59009.1| putative glycosyl transferase [Streptococcus agalactiae] >gi|157644645|gb|ABV59023.1| putative glycosyl transferase [Streptococcus agalactiae] (321 aa)
Score = 147, Expect = 1.0e-07, Identities = 45/137 (32%), Positives = 74/137 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQF 137
           M+K+S+IIP  N   K++   I S+ NQT  N E+  IDD ST+    Y D I K   +       N G+ + R+ G+ ++ G+YI F+DSDD++    I+ L  S  +Y+    I+ +Y    ++K ++L +    F
  S:     1 MEKISIIIPVYNVK-KYLNDCIQSVINQTYNNLEIILIDDGSTDGSGDYCDEIAKKDSRIFVYHKTNGGLSEARNVGIKISTGKYITFIDSDDYIENLYIETLYNSLIEYKADIAIVNKYHLKDNEKIVHLANSKELF 137
>gi|81097135|ref|ZP_00875444.1| Glycosyl transferase, family 2 [Streptococcus suis 89/1591] >gi|80976809|gb|EAP40383.1| Glycosyl transferase, family 2 [Streptococcus suis 89/1591] (334 aa)
Score = 147, Expect = 1.0e-07, Identities = 57/223 (25%), Positives = 109/223 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFYNRLNVESSLNTY 223
           M  +S+I+P  N   +++ + I S+ NQT K+ E+  ++D ST+    I L        ++     N G+   R+YG++ A G+Y+ F+DSDD+++ + I  L ++  + +N    +  Y+ V                 ++   NV K  +    + +   W   +KKE     +    +K  I ED YF   +++LY  +K  +  + LY+Y  ++ E+S+ T+
  S:     1 MINISIIVPIYNVE-QYLSKCINSIVNQTYKHIEILLVNDGSTDNSEEICLAYAKKDSRIRYFKKENGGLSDARNYGISRAKGDYLAFIDSDDFIHSEFIQRLHEAIER-ENALVAVAGYDRVDASGHFLTAEPLPTNQAVLSGRNVCKKLLEADGHRFVVAWNKLYKKELFEDFRF---EKGKIHEDEYF--TYRLLYELEKVAIVKECLYYY--VDRENSITTF 217
>gi|194244999|gb|ACF35269.1| putative glycosyltransferase [Streptococcus parasanguinis] (293 aa)
Score = 147, Expect = 1.0e-07, Identities = 56/211 (26%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNG-YQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVK----------NKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M+K+SVI+P  N   ++++  + S+ NQ+  N E+  I+D ST+    +  + ++++   + VQ      GVG  R+  + L  G++I FVD+DDWL ++ I+ L +   K    D  +  +   F+++Q   F+ H    +  ++     +   WF   Y  D R+ F + F V             I +P++  + +D+     WKV      ++ + L  Y
  S:     1 MEKISVIVPIYNAG-EYLRPCLDSIVNQSYSNLEIILINDGSTDTSAAVCEEYLHRDSRIRIVQKKLGGSGVGAARNSALPLVTGDFILFVDNDDWLELNHIEILYQDL-KETGSDIAVTNFTEFFEERQS--FAFHVDLSDPYLE---VYTPQEWFRKQY--DGRLSFSQCFTVPWGKLYKAELFQDIVYPEEEKVEDDL---TTWKVYLMADRISYRNLGLY 212
>gi|157964418|ref|YP_001499242.1| glycosyltransferase [Rickettsia massiliae MTU5] >gi|157844194|gb|ABV84695.1| Glycosyltransferase, two domains [Rickettsia massiliae MTU5] (616 aa)
Score = 146, Expect = 1.2e-07, Identities = 46/123 (37%), Positives = 64/123 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           K+SVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +  I K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  LK F +  N  F    Y+ + +K
  S:   306 KISVIIPVYNR-INWAIEAIESVLIQTHKNFEILIIDDGSTDDISELTSICKKDKRIKYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLK-FMEENNFIFSHTSYQKINEK 426
Score = 108, Expect = 3.1e-03, Identities = 43/149 (28%), Positives = 75/149 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDD----NSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           VS+IIP  N    ++K+ I S   QT KN E+  ++D    N    +V +   +K  Y + +N     G G   +YG+    GEY  ++  DD  Y + I++ +    K  N D I++    + D+K  +L  ++ + D ++  N +N S +P
  S:    28 VSIIIPVYNGT-NYMKEAINSALAQTYKNIEIIVVNDGSKDNGETERVALSYGDKIRYFHKENG----GCGSALNYGIKNMKGEYFSWLSHDDIYYPNKIEHQVDILNKLDNKDTIIYGGYELIDEKGNSL--RYIKPDSVLPINKLNISLLP 173
>gi|15892384|ref|NP_360098.1| glycosyltransferase [Rickettsia conorii str. Malish 7] >gi|81595583|sp|Q92IF9|Y461_RICCN Uncharacterized glycosyltransferase RC0461 >gi|15619533|gb|AAL02999.1| putative two-domain glycosyltransferase [EC:2.4.1.-] [Rickettsia conorii str. Malish 7] (604 aa)
Score = 146, Expect = 1.2e-07, Identities = 46/123 (37%), Positives = 63/123 (51%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           K+SVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +  I K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  LK F +  N  F    Y  + +K
  S:   294 KISVIIPVYNR-INWAIEAIKSVLIQTHKNFEILIIDDGSTDDISELTAICKKDKRIKYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLK-FMEENNFIFSHTSYHKINEK 414
Score = 114, Expect = 6.1e-04, Identities = 44/149 (29%), Positives = 75/149 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDD----NSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           VS+IIP  N    ++K+ I S   QT KN E+  ++D    N    +V +   +K  Y Y +N     G G   +YG+    GEY  ++  DD  Y + I++ +    K  N D I++    + D+K  +L  ++ + D ++  N +N S +P
  S:    16 VSIIIPVYNGA-NYMKEAINSALAQTYKNIEIIVVNDGSKDNGETERVALSYGDKIRYFYKENG----GCGSALNYGIKNMQGEYFSWLSHDDIYYPNKIEHQVDILNKLDNKDTIIYGGYELIDEKGNSL--RYIKPDSVLPINKLNISLLP 161
>gi|148978037|ref|ZP_01814584.1| hypothetical protein VSWAT3_02081 [Vibrionales bacterium SWAT-3] >gi|145962721|gb|EDK27995.1| hypothetical protein VSWAT3_02081 [Vibrionales bacterium SWAT-3] (308 aa)
Score = 146, Expect = 1.3e-07, Identities = 48/146 (32%), Positives = 83/146 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFD-------------EIIVKNNV 146
           M KVS+IIP  N  L ++ + I S+  QT+++ E+  IDDNS +    Y+  I+      +  +   +G  K R+ G+  A GEYI F+D+DD+ + + I+  L+   +Y ++      YE + +  +  ++ FS  +QF              E I++NNV
  S:     1 MAKVSIIIPTYNC-LDYLPKAIGSVLKQTHQDVELIIIDDNSNDGTSTYLATIHDERIIKLSTL--GVGAPKARNLGIEKATGEYIAFLDADDFWFPEKIERQLEFHQRYPDLAMSFTNYEHLTEDYEVIVDCFSYWSQFQDQDELFINIENPLEFIIENNV 159
>gi|75911036|ref|YP_325332.1| glycosyl transferase family protein [Anabaena variabilis ATCC 29413] >gi|75704761|gb|ABA24437.1| Glycosyl transferase, family 2 [Anabaena variabilis ATCC 29413] (337 aa)
Score = 146, Expect = 1.4e-07, Identities = 69/247 (27%), Positives = 120/247 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI--PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTD-----------WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNN 250
           +SVIIP  NT   +I + I S+  QT +NFE+  +DD ST+  V  D+I     Q ++    P N G    R+  + +A G++I  +D+DDW   + ++ L +     +N D +  ++  V D +    F +     E   K N  K   P F    +TD            +  FK+EFL+KN I + + + + +D +  +   V   K +L  +  Y+Y         +++ +K N L     K  +++ +  L+N N
  S:    12 ISVIIPAYNTE-AYIAKAIESVLFQTWRNFELIVVDDASTDCTV--DVIKSFTDQRIKLFVNPKNTGASGARNRALQIAQGKWIAVLDADDWYAPERLEKLWQ-VATSENADIVADDFYIVQDGEH---FPRSTAIRESGEKINDLKIIEPVFF--VKTDVYGKRGLRLGLSKPMFKREFLIKNNIKYDETLTVVQDFWLDMECLVRGAKFILIPQPYYYYRCREGSLITSSHNHKKN-LEQSCQKIVDFIKQENLYNQN 261
>gi|163790727|ref|ZP_02185154.1| capsular polysaccharide biosynthsis protein [Carnobacterium sp. AT7] >gi|159874028|gb|EDP68105.1| capsular polysaccharide biosynthsis protein [Carnobacterium sp. AT7] (336 aa)
Score = 146, Expect = 1.4e-07, Identities = 69/234 (29%), Positives = 123/234 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTN-KNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINL------FSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNT--YKYKANDLVSIIFK 236
           K+SVI+P  N    +++  I S+ +Q N ++ E+  IDD ST+    I       Y  + +    N G  K R+ G+  A GEYI+F+DSDD +   A+++L     K ++++ I+FE +  FDK   N+      + ++  +D+I+   ++   +M    + Y +      KK+ L+KN I   + + I ED  F     +  KK      KL FY R+ ++S++ +  Y+++   L  +I K
  S:     5 KISVIVPVYNVE-NYLEDCIESVISQKNFQDIELILIDDGSTDQSSKIIKKYTESYTNILDYYQENAGQSKARNKGIQHAKGEYIYFLDSDDLIPDLAMEHLYNLAVK-EDLELILFEGKSFFDKSVDNMKIGNMNYERNKVYDKILNGQDLF-IEMTVNKDFYASPCLQFIKKKVLLKNSIYFLEGI-IHEDELFSYQLLMKSKKVKCIKDKL-FYRRIRLDSTITSLNYEHRIESLTKVIQK 243
>gi|111658228|ref|ZP_01408921.1| hypothetical protein SpneT_02000585 [Streptococcus pneumoniae TIGR4] (291 aa)
Score = 145, Expect = 1.7e-07, Identities = 39/116 (33%), Positives = 65/116 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNG-YQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           +S+++P  N    +++  + S+ NQT +NFE   I+D S +    I  + + K+  ++Y +    N G+   R+ G+  + G YI FVDSDDWL  DA+D L  +  K +N D  +  Y
  S:     6 ISIVVPIYNVE-NYLRMCLDSIQNQTYQNFECLLINDGSPDHSSKICEEFVEKDSRFKYFEKA--NGGLSSARNLGIECSGGAYITFVDSDDWLEHDALDRLYGAL-KKENADISIGRY 120
>gi|186680825|ref|YP_001864021.1| glycosyl transferase family protein [Nostoc punctiforme PCC 73102] >gi|186463277|gb|ACC79078.1| glycosyl transferase, family 2 [Nostoc punctiforme PCC 73102] (337 aa)
Score = 144, Expect = 1.9e-07, Identities = 67/229 (29%), Positives = 109/229 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFD----------KKQINLFSKHNQFDEI-IVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN-------RLNVESSLNTYKYKANDLV 231
           KVSVIIP  NT   +I + I S   QT  + EV  +DD S++  V +     +    V     N+GV   R+  +  A GE++  +DSDDW   + ++ LL    K  N D I  +   + D          ++      +  Q D I +VK+ V    +  F  +     +  F++EFLVK+ I + + V+I ED +  +   +   +  +  +  YFY        R ++ S LN Y    N  +
  S:     4 KVSVIIPAYNTE-AYIAKAIQSALEQTLSDIEVIIVDDGSSDKTVEVAKSFTDQRLKVIVNQQNLGVSAARNRAIKAAQGEWVAVLDSDDWYTPERLEKLLLQAEK-TNADMIADDLYLIHDGATSPWSTFIQESGECIDETLQIDLISLVKSGVYGEPVLPFGLS-----KPIFRREFLVKHGILYDETVSIAEDFWLDVKCLINGARFFIVPEPYYFYRSRPISLVRQSILSRLNQYCIATNSFM 243
>gi|146318228|ref|YP_001197940.1| cell wall biosynthesis glycosyltransferase [Streptococcus suis 05ZYH33] >gi|146320426|ref|YP_001200137.1| cell wall biosynthesis glycosyltransferase [Streptococcus suis 98HAH33] >gi|82395260|gb|ABB71973.1| Cps2K [Streptococcus suis] >gi|145689034|gb|ABP89540.1| Glycosyltransferases involved in cell wall biogenesis [Streptococcus suis 05ZYH33] >gi|145691232|gb|ABP91737.1| Glycosyltransferases involved in cell wall biogenesis [Streptococcus suis 98HAH33] (334 aa)
Score = 144, Expect = 2.0e-07, Identities = 58/225 (25%), Positives = 111/225 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFY-NRLN--VESSLNTYKY 225
           M  +S+I+P  N   +++ + I S+ NQT K+ E+  ++D ST+    I L        ++     N G+   R+YG++ A G+Y+ F+DSDD+++ + I  L ++  + +N    +  Y+ V                 ++   NV K  +    + +   W   +KKE     +    +K  I ED YF   +++LY  +K  +  + LY+Y +R N  + SS+  +++
  S:     1 MINISIIVPIYNVE-QYLSKCINSIVNQTYKHIEILLVNDGSTDNSEEICLAYAKKDSRIRYFKKENGGLSDARNYGISRAKGDYLAFIDSDDFIHSEFIQRLHEAIER-ENALVAVAGYDRVDASGHFLTAEPLPTNQAVLSGRNVCKKLLEADGHRFVVAWNKLYKKELFEDFRF---EKGKIHEDEYF--TYRLLYELEKVAIVKECLYYYVDRENSIITSSMTDHRF 224
>gi|188588147|ref|YP_001922565.1| glycosyl transferase, group 2 family protein [Clostridium botulinum E3 str. Alaska E43] >gi|188498428|gb|ACD51564.1| glycosyl transferase, group 2 family protein [Clostridium botulinum E3 str. Alaska E43] (334 aa)
Score = 144, Expect = 2.1e-07, Identities = 38/101 (37%), Positives = 61/101 (60%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLL 103
           KVS+++   N+  K++ +LI S+ NQT++N E+  IDD S +    I D   K   + V     N G  + R+ G+ +A+GEY+  +D DDWL +D ++YLL
  S:     8 KVSLVVAIYNSE-KFLDKLIKSIINQTHRNLEIILIDDGSPDCSGQICDNYAKKDDRIVVIHKENGGACEARNKGLEIASGEYLMIIDGDDWLSLDCVEYLL 108
>gi|164688657|ref|ZP_02212685.1| hypothetical protein CLOBAR_02303 [Clostridium bartlettii DSM 16795] >gi|164602133|gb|EDQ95598.1| hypothetical protein CLOBAR_02303 [Clostridium bartlettii DSM 16795] (217 aa)
Score = 144, Expect = 2.3e-07, Identities = 64/195 (32%), Positives = 97/195 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK----KQINLFSKHNQFDE---IIVKNNVNKSK----MPWFHNNYQTDWRVCFKKEFLVK--NKISHPDKVNIFEDVYFG-LIWKVL 197
           KVSVI+P  N   K+I++ + SL NQT  + E+  IDD S +    I     K   +       N GV   R+ G+ +A G+YI FVD DDW+ +D ++ + +   K Q  D  +  Y   F      K INL       DE   I+ +  V   K     P   ++  T W   + +E L+K  NK     ++   ED  F  +++K+L
  S:     5 KVSVIVPVYNCE-KYIERCMDSLINQTLADIEIIVIDDESKDTTFEILKEYEKKDKRIKLMTKKNSGVSSSRNKGIEIATGKYIAFVDGDDWIDLDCLEKMYEVAEKNQT-DITICSYTREFKDHSKPKNINLKEDKVYEDEDLKILHRKLVGPIKEEFSQPESLDSLGTVWGKLYNRELLIKSDNKFIDLKEIGTAEDTLFNFMVFKIL 212
>gi|168493682|ref|ZP_02717825.1| glycosyl transferase [Streptococcus pneumoniae CDC3059-06] >gi|183576256|gb|EDT96784.1| glycosyl transferase [Streptococcus pneumoniae CDC3059-06] (291 aa)
Score = 144, Expect = 2.3e-07, Identities = 39/116 (33%), Positives = 65/116 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNG-YQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           +S+++P  N    +++  + S+ NQT +NFE   I+D S +    I  + + K+  ++Y +    N G+   R+ G+  + G YI FVDSDDWL  DA+D L  +  K +N D  +  Y
  S:     6 ISIVVPIYNVE-NYLRMCLDSIQNQTYQNFECLLINDGSPDHSSKICEEFVEKDSRFKYFEKA--NGGLSSARNLGIECSGGAYITFVDSDDWLEHDALDRLYGAL-KKENADISIGRY 120
>gi|4580634|gb|AAD24457.1|AF118389_14 Cps2K [Streptococcus suis] >gi|89513252|gb|ABD74485.1| Cps2K [Streptococcus suis] >gi|89513254|gb|ABD74486.1| Cps2K [Streptococcus suis] >gi|89513256|gb|ABD74487.1| Cps2K [Streptococcus suis] >gi|89513258|gb|ABD74488.1| Cps2K [Streptococcus suis] (276 aa)
Score = 144, Expect = 2.4e-07, Identities = 58/225 (25%), Positives = 111/225 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFY-NRLN--VESSLNTYKY 225
           M  +S+I+P  N   +++ + I S+ NQT K+ E+  ++D ST+    I L        ++     N G+   R+YG++ A G+Y+ F+DSDD+++ + I  L ++  + +N    +  Y+ V                 ++   NV K  +    + +   W   +KKE     +    +K  I ED YF   +++LY  +K  +  + LY+Y +R N  + SS+  +++
  S:     1 MINISIIVPIYNVE-QYLSKCINSIVNQTYKHIEILLVNDGSTDNSEEICLAYAKKDSRIRYFKKENGGLSDARNYGISRAKGDYLAFIDSDDFIHSEFIQRLHEAIER-ENALVAVAGYDRVDASGHFLTAEPLPTNQAVLSGRNVCKKLLEADGHRFVVAWNKLYKKELFEDFRF---EKGKIHEDEYF--TYRLLYELEKVAIVKECLYYYVDRENSIITSSMTDHRF 224
>gi|42518486|ref|NP_964416.1| hypothetical protein LJ0393 [Lactobacillus johnsonii NCC 533] >gi|41582771|gb|AAS08382.1| hypothetical protein LJ_0393 [Lactobacillus johnsonii NCC 533] (292 aa)
Score = 144, Expect = 2.4e-07, Identities = 64/224 (28%), Positives = 102/224 (45%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY-EWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP--WFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK 224
           M+K+SVIIP  N   K++ Q + S+  QT  N E+  +DD ST+    +    +  Y  ++ +   N GVG  R+ G+ +A GEYI FVD DD L    I+ L K   K  + D  +  +  ++ +K+   ++ K + + E        K+  P  WF   Y+T                     V     + F + W  LYKK+L   + + +     VE  L T+K
  S:     1 MEKISVIIPVYNDE-KYLAQCLDSVLRQTYSNLEIILVDDGSTDSTPELCEKYREKYANIRILHKKNGGVGSSRNAGLEMATGEYILFVDHDDLLGETHIEELYK-LLKKNDADIAVGNFNHFIEEKRAYGIWLKEDDYFE--------KTYTPEEWFTVEYET---------------------VPYNMSIIFAVPWAKLYKKSLF--ENIVYPINARVEDDLTTWK 195
>gi|167412433|gb|ABZ79882.1| unknown [Campylobacter jejuni] (269 aa)
Score = 143, Expect = 2.5e-07, Identities = 59/211 (27%), Positives = 107/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  +N ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +    H  +   W  CFKK+ ++K+  KI   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSNSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQR----HFCWSV-WAKCFKKDIILKSFEKIKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|113476442|ref|YP_722503.1| glycosyl transferase family protein [Trichodesmium erythraeum IMS101] >gi|110167490|gb|ABG52030.1| glycosyl transferase, family 2 [Trichodesmium erythraeum IMS101] (333 aa)
Score = 143, Expect = 2.7e-07, Identities = 42/113 (37%), Positives = 66/113 (58%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           +VSVIIP  N   ++I Q I S+  QT +++E+  IDD ST+      + Y+++I+   Y Y QN     GV   R++G+ LA GE I F+D+DD+   D +   +K F    N+  +
  S:     9 RVSVIIPVYNCD-RYINQAIESIFAQTYQSYEIIVIDDGSTDNTRKTMEPYMEMIH---YVYQQNQ----GVSAARNHGINLARGELIAFLDADDFFLPDKLTAQVKVFDAKPNLGIV 118
>gi|153854452|ref|ZP_01995730.1| hypothetical protein DORLON_01725 [Dorea longicatena DSM 13814] >gi|149752978|gb|EDM62909.1| hypothetical protein DORLON_01725 [Dorea longicatena DSM 13814] (363 aa)
Score = 143, Expect = 2.8e-07, Identities = 78/255 (30%), Positives = 121/255 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-----PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK--KQINLFSKH-NQFDEIIVKNNVNKSKM---PWFH-----NNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASN 257
           K+S+I+P  NT  +++K+ + SL NQT K  EV  IDD STN    I     + Y  V N        N GV   R+ G+ +A GE+I FVD+DDW      + +L+   +  +   I   Y    +K  K+   F K   +FDE + +    K+ +   P F      N     W     + FL K+ +    ++   +D+ F L    L++KA      + +YNR      L  Y+Y  N  VS  ++   Y +  K+ N  + F   N
  S:    16 KISIIVPVYNTKKEYLKKCVDSLLNQTMKEIEVILIDDGSTNQAGKI----CDEYAGVDNRVKVLHQKNQGVAVARNNGLDIAEGEWITFVDADDWCENTMCEEILRKAVENSSEILIFTNYSVQSEKTVKKNQFFDKDIKKFDEKMKEEAELKTMLRTHPSFSFQPPINMMGGTWCKLINRNFLEKSGVKFEPELLRSQDIIFYL---NLFEKA----DDISYYNR-----QLYYYRYDENS-VSRRYRKDAYKIFLKVLNKQYKFILEN 269
>gi|189459581|ref|ZP_03008366.1| hypothetical protein BACCOP_00207 [Bacteroides coprocola DSM 17136] >gi|189433663|gb|EDV02648.1| hypothetical protein BACCOP_00207 [Bacteroides coprocola DSM 17136] (344 aa)
Score = 143, Expect = 2.8e-07, Identities = 61/218 (27%), Positives = 111/218 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNK------SKMPWFHNNYQTDWRVCFKKEFLVKNKISH------PDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSL 220
           KVS+I+P  N   K+I + + SL NQT K+ E+  +DD S +  P +  +   K+    V +  N  G+G  R+ G+ +A+GE+I F+DSDDW+ +   + L  +  K    D +    ++ +   +I  F + N+      +  ++       + +P +H++ +    VC  K    +N I +       +++   ED+ F   +  L +K     K  YFYN    E+S+
  S:     4 KVSIIVPVYNVE-KYIHRCVESLINQTLKDIEIILVDDESPDSCPSICDEYAQKDARIKVIHKKNE-GLGLTRNAGLEIASGEFIAFIDSDDWVDLTMYETLYNT-AKNNQCDTVYCSLQYYYSPNKIIPFKEVNEETFFQGRKEIDTFLLDMLAPLPTYHSDVKYMVSVC--KAIYSRNIIRNHHLKFVSERIIASEDMVFHTQYLKLSEKIGFIPK--YFYNYFQNENSI 228
>gi|27466943|ref|NP_763580.1| teichoic acid biosynthesis protein F [Staphylococcus epidermidis ATCC 12228] >gi|27314485|gb|AAO03622.1|AE016744_25 teichoic acid biosynthesis protein F [Staphylococcus epidermidis ATCC 12228] (775 aa)
Score = 143, Expect = 2.9e-07, Identities = 39/99 (39%), Positives = 57/99 (57%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDY 101
           + S+++P+K T  K     + SLNNQT K+FEV FI D  +N    I  IN N      N+ +N      R+ G+  A GEYI F+DSDD+L+ +++ Y
  S:    22 RYSIVMPYKETDTKMFNDCLDSLNNQTFKDFEVLFIHDGDSNLHDEIKNINFNHKVLESNVSSNPQY--YRNIGIKEATGEYILFMDSDDYLHPNSLIY 118
>gi|68644188|emb|CAI34312.1| putative glycosyl transferase [Streptococcus pneumoniae] (326 aa)
Score = 143, Expect = 2.9e-07, Identities = 42/106 (39%), Positives = 60/106 (56%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           KVSVIIP  N   K++++ + S+ NQT K+ EV  ++D S +    I       Y  +Q I   N G+G  R+ G+    G  + FVDSDDWL +DAI+Y + S  K
  S:     2 KVSVIIPVYNVE-KYLRRCLDSVVNQTYKDIEVILVNDGSPDNSKEICEEYVAKYSNIQLINQKNAGLGAARNTGLQYITGNAVTFVDSDDWLELDAIEYYVASMKK 107
>gi|187598557|ref|ZP_02984809.1| glycosyl transferase family 2 [Gluconacetobacter diazotrophicus PAl 5] >gi|187489416|gb|EDU27365.1| glycosyl transferase family 2 [Gluconacetobacter diazotrophicus PAl 5] (958 aa)
Score = 143, Expect = 2.9e-07, Identities = 40/113 (35%), Positives = 62/113 (54%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDL---INKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           ++S+++P  NTP  W+ Q I S+  Q    +E+  IDD ST P V   L    +++    V     N G+    + G+  A G+Y+ F+D DD L  DAI +LLK+  +  + DFI
  S:   412 RLSIVMPVYNTPRDWLVQAIESVLAQWCGRWELICIDDCSTAPHVGAVLRAYADRDPRIRVLTPQVNGGIAVATNLGLRAARGDYVTFLDHDDVLEPDAIYHLLKT-ARETDADFI 526
>gi|162147394|ref|YP_001601855.1| putative glycosyl transferase [Gluconacetobacter diazotrophicus PAl 5] >gi|161785971|emb|CAP55552.1| putative glycosyl transferase [Gluconacetobacter diazotrophicus PAl 5] (965 aa)
Score = 143, Expect = 2.9e-07, Identities = 40/113 (35%), Positives = 62/113 (54%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDL---INKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           ++S+++P  NTP  W+ Q I S+  Q    +E+  IDD ST P V   L    +++    V     N G+    + G+  A G+Y+ F+D DD L  DAI +LLK+  +  + DFI
  S:   419 RLSIVMPVYNTPRDWLVQAIESVLAQWCGRWELICIDDCSTAPHVGAVLRAYADRDPRIRVLTPQVNGGIAVATNLGLRAARGDYVTFLDHDDVLEPDAIYHLLKT-ARETDADFI 533
>gi|53713130|ref|YP_099122.1| putative glycosyltransferase [Bacteroides fragilis YCH46] >gi|60681396|ref|YP_211540.1| putative LPS biosynthesis related glycosyltransferase [Bacteroides fragilis NCTC 9343] >gi|11023517|gb|AAG26474.1|AF285774_14 putative glycosyltransferase [Bacteroides fragilis] >gi|52215995|dbj|BAD48588.1| putative glycosyltransferase [Bacteroides fragilis YCH46] >gi|60492830|emb|CAH07604.1| putative LPS biosynthesis related glycosyltransferase [Bacteroides fragilis NCTC 9343] (348 aa)
Score = 143, Expect = 3.1e-07, Identities = 41/127 (32%), Positives = 76/127 (59%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI----PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINL 130
           VS+IIP  N  + ++++ I+S   QT K  E+  +DD  T+ Q  ID++ K  Y+  + +     +N GV   RD GV   +G++++F+D+DD++  DAI+ L+ S Y   +++ +M    + +  + I+L
  S:    16 VSIIIPVYNVGI-YLEKCISSCLEQTYKRCEIILVDDGCTD-QCTIDILQK--YRTFKEMFLIKQDNRGVSIARDVGVKYCHGKFLFFLDADDYITPDAIELLVNS-YNANSVEMVMAALAYDYSGRLISL 141
>gi|148658176|ref|YP_001278381.1| glycosyl transferase family protein [Roseiflexus sp. RS-1] >gi|148570286|gb|ABQ92431.1| glycosyl transferase, family 2 [Roseiflexus sp. RS-1] (336 aa)
Score = 142, Expect = 3.2e-07, Identities = 33/92 (35%), Positives = 55/92 (59%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVY--IDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           M +VS++IP  N   +++++ + S   QT+ + EV  +DD ST+P     ID +  +    V   PN  GV + R+YG++LA G Y+  +D+DD
  S:     1 MTRVSIVIPCYNLG-EYLQEALDSALQQTHADLEVILVDDGSTDPATIRTIDQLAPHPQLRVFRTPNQ-GVARARNYGISLATGAYVLPLDADD 92
>gi|23465254|ref|NP_695857.1| glycosyltransferase [Bifidobacterium longum NCC2705] >gi|23325885|gb|AAN24493.1| probable glycosyltransferase [Bifidobacterium longum NCC2705] (386 aa)
Score = 142, Expect = 3.3e-07, Identities = 43/147 (29%), Positives = 76/147 (51%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFS-KHNQFDEIIVKNNVNKSK 150
           VS+IIP      K++ + + S+  QT  N E+  +DD S +  P +      ++    V + PN  G+   R+ G+  A G YI+F DSDD +    ++  L +  +Y + D +MF+++ + +  +  L + +HN F E+ V   V   K
  S:     2 VSIIIPVYKVE-KFLDECVASVAAQTYANLEILLVDDGSPDNCPAMCDAWAARDPRIRVIHKPNG-GLSDARNSGIAEAIGAYIYFADSDDTVAPTLVEDCLNAMREY-DADLVMFQFDTISENNKPLLSNYRHNDFTEVQVLTPVEAIK 148
>gi|113200436|gb|ABI32349.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 142, Expect = 3.4e-07, Identities = 59/211 (27%), Positives = 105/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L  DA +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CFKK+ ++K+  KI   +++N  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPDACEIAFKEMRK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQRHFCW------SVWAKCFKKDIILKSFEKIKIDERLNYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|57641649|ref|YP_184127.1| glycosyl transferase family protein [Thermococcus kodakarensis KOD1] >gi|57159973|dbj|BAD85903.1| glycosyltransferase, family 2 [Thermococcus kodakarensis KOD1] (323 aa)
Score = 142, Expect = 3.4e-07, Identities = 33/93 (35%), Positives = 60/93 (64%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINK--NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDW 93
           M KVS+I+P  NT   ++ +L++S+  QT +++E+  +DDNS +   ++ +D  +K  +  + ++      GV   R+ G+ +A+G YI F+DSDDW
  S:     1 MAKVSIIVPVYNTR-DYVPRLLSSIEKQTYEDWELILVDDNSDDGTYELLLDFKDKHPDRVEVLRTPKRRSGVSVGRNMGIEVASGRYIAFIDSDDW 96
>gi|46487632|gb|AAS99173.1| WbrX [Escherichia coli] (719 aa)
Score = 142, Expect = 3.6e-07, Identities = 67/252 (26%), Positives = 128/252 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFS-------KHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKN----KNYLLENKLFN---NNWYFY 254
           K+SVI+P     + +++Q + S+ +QT KN E+  ++D S +  PQ+ ID    +  + +     N G G   + G+ +A+G++I  +++DDW+ +D  + L+ ++ K  N   I   +  + ++  IN  S        ++   EI+ +N+V    +        + W   ++++FL +N I   +     ++D+ F  I     +K  L +  +Y Y  +NV SS       + D   I F N    K +LL    F    N++YF+
  S:     7 KISVILPVYGGEV-YLEQCLDSVLSQTYKNLEIIIVNDGSPDACPQI-IDRYASSDTRIIAIHKKNAGYGAAINSGLDVASGDFISIIETDDWVQLDMFERLIDAYNKIPN-PVIKASFNRISNEVVINTQSLAHLCTFDNDNLAEIVPENSVELFLLE------SSIWTGLYRRDFLEENHIRFYESPGASYQDMPFKFITYASVEKITLLNVPVYNYRVMNVGSS-----SASADKALISFNNYDIIKKHLLSVGTFQKYLNHFYFH 261
>gi|86152792|ref|ZP_01070997.1| glycosyltransferase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|6940839|gb|AAF31776.1|AF130984_12 putative glycosyltransferase [Campylobacter jejuni] >gi|6969993|gb|AAF34148.1| glycosyltransferase [Campylobacter jejuni] >gi|40217911|gb|AAR82880.1| putative glycosyltransferase [Campylobacter jejuni] >gi|85843677|gb|EAQ60887.1| glycosyltransferase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|113200450|gb|ABI32362.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 142, Expect = 3.7e-07, Identities = 59/211 (27%), Positives = 105/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L  DA +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CFKK+ ++K+  KI   +++N  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQRHFCW------SVWAKCFKKDIILKSFEKIKIDERLNYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|23335913|ref|ZP_00121144.1| COG0463: Glycosyltransferases involved in cell wall biogenesis [Bifidobacterium longum DJO10A] >gi|189440327|ref|YP_001955408.1| Glycosyltransferase for cell wall membrane [Bifidobacterium longum DJO10A] >gi|189428762|gb|ACD98910.1| Glycosyltransferase for cell wall membrane [Bifidobacterium longum DJO10A] (391 aa)
Score = 142, Expect = 3.7e-07, Identities = 41/139 (29%), Positives = 74/139 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFS-KHNQFDEIIV 142
           VS+IIP      K++ + + S+  QT  N E+  +DD S +  P +      ++    V + PN  G+   R+ G+  A G YI+F DSDD +    ++  L +  +Y + D +MF+++ + +  +  L + +HN F E+ V
  S:     7 VSIIIPVYKVE-KFLDECVASVAAQTYANLEILLVDDGSPDNCPAMCDAWAARDPRIRVIHKPNG-GLSDARNSGIAEAIGAYIYFADSDDTVAPTLVEDCLNAMREY-DADLVMFQFDTISENNKPLLSNYRHNDFTEVQV 145
>gi|189465520|ref|ZP_03014305.1| hypothetical protein BACINT_01878 [Bacteroides intestinalis DSM 17393] >gi|189437794|gb|EDV06779.1| hypothetical protein BACINT_01878 [Bacteroides intestinalis DSM 17393] (359 aa)
Score = 142, Expect = 3.8e-07, Identities = 43/116 (37%), Positives = 66/116 (56%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE 118
           KVSVIIP  NT   ++   + S+ NQT K+ E+  I+D ST N Q  I+   +   +    I  N   G  R+ G+ LA G+YI+F+DSDD L +DA+    +   + + +DF+ F+
  S:    57 KVSVIIPVYNTA-TYLHSALDSICNQTLKDLEIILINDGSTDNSQYIIEKYARKDNRIKYLIQPNQRQGVARNNGLQLATGQYIYFMDSDDILDIDALRQCYE-MCERKELDFVTFD 171
>gi|187735259|ref|YP_001877371.1| glycosyl transferase family 2 [Akkermansia muciniphila ATCC BAA-835] >gi|187425311|gb|ACD04590.1| glycosyl transferase family 2 [Akkermansia muciniphila ATCC BAA-835] (341 aa)
Score = 142, Expect = 3.9e-07, Identities = 34/105 (32%), Positives = 59/105 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           +SV++P  N    ++ Q + S+ +QT +  E+  +DD ST+  + I  +   ++    V   P N G+ + R+  ++ A GEY++ VDSDDWL  D    LL+  Y+
  S:     7 ISVLVPVYNVE-PYLAQCLESICSQTLRELEIVCVDDASTDGSLSILREFAERDPRVKVVQAPENGGLSRSRNLAMSHAVGEYLFLVDSDDWLETD----LLEEMYR 108
>gi|167211994|ref|ZP_02282301.1| hypothetical protein LmonL_09539 [Listeria monocytogenes LO28] (165 aa)
Score = 142, Expect = 4.0e-07, Identities = 40/114 (35%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   K++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-KYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVETCLDTVQK-TNADLVLF 115
>gi|73667785|ref|YP_303800.1| hypothetical protein Mbar_A0236 [Methanosarcina barkeri str. Fusaro] >gi|72394947|gb|AAZ69220.1| hypothetical protein Mbar_A0236 [Methanosarcina barkeri str. Fusaro] (783 aa)
Score = 142, Expect = 4.1e-07, Identities = 40/113 (35%), Positives = 65/113 (57%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV------YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           K+S+I+P  N    W+++ I S+ NQ   N+E+   DD ST P +      Y +L ++   +Y   + NN G+    +  + LA GE+I  +D+DD L VDA+  ++K   K  +ID I
  S:   262 KISIIMPVYNVDEIWLEKAIDSVINQIYTNWELCIADDASTKPHIKSTLSKYSELDSRIKVKY---LSNNRGISGASNEALLLATGEFIGLLDNDDELSVDALYEVVKVLNKKSDIDLI 377
>gi|168204577|ref|ZP_02630582.1| glycosyl transferase, group 2 family protein [Clostridium perfringens E str. JGS1987] >gi|170663888|gb|EDT16571.1| glycosyl transferase, group 2 family protein [Clostridium perfringens E str. JGS1987] (334 aa)
Score = 142, Expect = 4.1e-07, Identities = 72/245 (29%), Positives = 121/245 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW--RVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKK-------LYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKL 246
           K +S++IP  N+  K+I++ +  L+ QT+ NFEV  +DD ST+    +    L N      V     N G    R+ G+  + G+YI F+DSDD+   + +  L ++   +   D + F+Y+ + +   +N+    N +F +I     V  +    + +N    W   + + KEFL KNK+   +  +  ED+ F         KALL+SKK       L FY +     + N   YK   +V  +     ++ ENKL
  S:     7 KFLSIVIPAYNSE-KYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSEACLENFKINHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNM--FNEPDIVFFDYKRIKEDDSVNVNIAQNFEFGKIKSGEEVFNA----YKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIF-------KALLSSKKVRGIEDSLVFYCQRGDSLTNNPNIYKNITVVESMEDVAKFIDENKL 250
>gi|116627836|ref|YP_820455.1| cell wall biosynthesis glycosyltransferase [Streptococcus thermophilus LMD-9] >gi|116101113|gb|ABJ66259.1| Glycosyltransferase involved in cell wall biogenesis [Streptococcus thermophilus LMD-9] (326 aa)
Score = 141, Expect = 4.3e-07, Identities = 61/245 (24%), Positives = 114/245 (46%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQ----TDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLF 247
           ++S+++P  N  + ++ + I S+  Q+NKNFE+  +DD ST+  Q+  D  +++  +       N G+   R+ G+  A G+YI F+DSDD++    I+ L K   +    D  M +Y  V    QI+  +   ++       N  ++    + N+        W   +K E    N I  P++  + ED +    +K+ Y   K    +  LYFY   +     + +  K  D++    +   +  EN+ F
  S:     6 EISIVLPVYNV-IDYLNECIKSILRQSNKNFELIIVDDGSTDGSQILCDRYSESDSRIKVIHQKNAGLSAARNTGLNHAKGKYITFIDSDDFVGEKYIEVLYKIIIE-SCADISMCDYMEVAQDTQISDVTFQEKYPIDKYYYNGKEAIANVYKNSSHGMEFVSWAKMYKLELFKSNGILFPEE-KLHEDAF--TTYKLFYASNKIAFVNAPLYFYRIRSGSIMTSEFTEKRLDMIQATREEYLFFRENRDF 252
>gi|186901703|ref|ZP_02974653.1| glycosyl transferase family 2 [Cyanothece sp. PCC 7424] >gi|186691269|gb|EDU15895.1| glycosyl transferase family 2 [Cyanothece sp. PCC 7424] (347 aa)
Score = 141, Expect = 4.4e-07, Identities = 42/94 (44%), Positives = 55/94 (58%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL 94
           MKKVSVIIP  N   K+I   I S+ +QT  NFE+  IDD+S  P   I +  +     ++ I  NN G+   R+ G+  A GEYI F+D DD WL
  S:     1 MKKVSVIIPVYNVE-KYIAATIQSVLSQTYPNFELLIIDDSS--PDNSIKICQQFTDSRIKIIHQNNRGLAGARNAGIRNAQGEYIAFLDGDDLWL 93
>gi|116628180|ref|YP_820799.1| cell wall biosynthesis glycosyltransferase [Streptococcus thermophilus LMD-9] >gi|116101457|gb|ABJ66603.1| Glycosyltransferase involved in cell wall biogenesis [Streptococcus thermophilus LMD-9] (322 aa)
Score = 141, Expect = 4.4e-07, Identities = 67/232 (28%), Positives = 110/232 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIF 235
           VSVIIP  N   + IKQ + SL NQ+  +FE+  ++D ST+  + +         +++ I   N GV K R+ G+ LANG+YI F+D+DD++  D ++       + Q +D ++  Y+ V            NQ  + + K ++ +S+  W        W   ++  FL  N I   D   I EDV F L    L +K  +     Y +   N +S  NT +   N  + I++
  S:     6 VSVIIPVYNAQ-EGIKQCMDSLLNQSFTDFEIILLNDGSTDNSLEVIKKYAADNDFIRVIDKENEGVAKTRNKGIQLANGKYIVFIDNDDFVDSDYLERFYNEIDQEQ-LDIVLGGYKRV------------NQEMKTLFKQDLTQSE--WSKYIVVAPWARIYRTSFLTDNNIQFFD-YPIGEDVIFTLTAYNLTEKIKIIDYNGYNW-FFNEKSISNTSQRGFNPNIDIVY 220
>gi|168217152|ref|ZP_02642777.1| glycosyl transferase, group 2 family protein [Clostridium perfringens NCTC 8239] >gi|182380692|gb|EDT78171.1| glycosyl transferase, group 2 family protein [Clostridium perfringens NCTC 8239] (334 aa)
Score = 141, Expect = 4.6e-07, Identities = 72/245 (29%), Positives = 121/245 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW--RVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKK-------LYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKL 246
           K +S++IP  N+  K+I++ +  L+ QT+ NFEV  +DD ST+    +    L N      V     N G    R+ G+  + G+YI F+DSDD+   + +  L ++   +   D + F+Y+ + +   +N+    N +F +I     V  +    + +N    W   + + KEFL KNK+   +  +  ED+ F         KALL+SKK       L FY +     + N   YK   +V  +     ++ ENKL
  S:     7 KFLSIVIPAYNSE-KYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSEACLENFKINHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNM--FNEPDIVFFDYKRIKEDDSVNVNIAQNFEFGKIKSGEEVFNA----YKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIF-------KALLSSKKVRGIEDSLVFYCQRGDSLTNNPNIYKNITVVESMEDVAKFIDENKL 250
>gi|73661666|ref|YP_300447.1| putative glycosyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72494181|dbj|BAE17502.1| putative glycosyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (574 aa)
Score = 141, Expect = 4.6e-07, Identities = 44/120 (36%), Positives = 71/120 (59%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQVYIDLINKNGYQYV--QNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           K S+I+P  N+  K+I +L+ SL NQ+   K+FEV  +DD S++  + +    KN    +  Q   N+ G GK R+  + LA GEY++FVDSDD++  D +  + K F    + D ++ + E V
  S:     2 KFSIIVPSYNSE-KYIAELLNSLQNQSYDKKDFEVILVDDCSSDNTLNVVEAYKNKLNLIIKQLDTNSGGPGKPRNTALQLAQGEYVFFVDSDDYINKDTLKDVSK-FVDQNHADVVLVKMEGV 123
>gi|153812419|ref|ZP_01965087.1| hypothetical protein RUMOBE_02818 [Ruminococcus obeum ATCC 29174] >gi|149831581|gb|EDM86668.1| hypothetical protein RUMOBE_02818 [Ruminococcus obeum ATCC 29174] (367 aa)
Score = 141, Expect = 4.7e-07, Identities = 60/221 (27%), Positives = 103/221 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI---MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLN 221
           M KVS+IIP  N  + ++ + + S+  QT ++ E+  ++D ST+  +  I    +N  ++V     N G GK  + G+  A GEYI  V+ DD++ +   + L K   K  ++D +    + +    +   +NL   H            + S+ P         W   +K+EFL ++ I H +     F+D  F     V  K+A++  K  Y   R N  SS+N
  S:     1 MAKVSIIIPTYNVEM-FLDECLESIQRQTLQDIEIICVNDGSTDHSLEIIKKYAENDPRFVIVDKENGGYGKAMNVGLDKATGEYIGIVEPDDYVPLAMYEDLYK-IAKENDLDMVKADFYRFTRNPENGNMNLVYNHLDLTGKWYGKLFDPSEEPETLRFIMNTWSGIYKREFLEQHHIRHNETPGASFQDNGFYFQTFVYAKRAMIVDKPYYMNRRDNPNSSVN 224
>gi|110800548|ref|YP_695167.1| glycosyl transferase, group 2 family protein [Clostridium perfringens ATCC 13124] >gi|168209903|ref|ZP_02635528.1| glycosyl transferase, group 2 family protein [Clostridium perfringens B str. ATCC 3626] >gi|168214313|ref|ZP_02639938.1| glycosyl transferase, group 2 family protein [Clostridium perfringens CPE str. F4969] >gi|110675195|gb|ABG84182.1| glycosyl transferase, group 2 family protein [Clostridium perfringens ATCC 13124] >gi|170711979|gb|EDT24161.1| glycosyl transferase, group 2 family protein [Clostridium perfringens B str. ATCC 3626] >gi|170714171|gb|EDT26353.1| glycosyl transferase, group 2 family protein [Clostridium perfringens CPE str. F4969] (334 aa)
Score = 141, Expect = 4.7e-07, Identities = 72/245 (29%), Positives = 121/245 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW--RVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKK-------LYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKL 246
           K +S++IP  N+  K+I++ +  L+ QT+ NFEV  +DD ST+    +    L N      V     N G    R+ G+  + G+YI F+DSDD+   + +  L ++   +   D + F+Y+ + +   +N+    N +F +I     V  +    + +N    W   + + KEFL KNK+   +  +  ED+ F         KALL+SKK       L FY +     + N   YK   +V  +     ++ ENKL
  S:     7 KFLSIVIPAYNSE-KYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSEACLENFKINHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNM--FNEPDIVFFDYKRIKEDDSVNVNIAQNFEFGKIKSGEEVFNA----YKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIF-------KALLSSKKVRGIEDSLVFYCQRGDSLTNNPDIYKNITVVESMEDVAKFIDENKL 250
>gi|29376983|ref|NP_816137.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] >gi|29344448|gb|AAO82207.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] (836 aa)
Score = 141, Expect = 4.7e-07, Identities = 67/252 (26%), Positives = 122/252 (48%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQIN---LFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKV--LYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKN-----KNYLLENKLFNNNWYFY 254
           KVSVI+P  N    ++++ + SL NQT K  E   I+D ST N Q  I+ I ++  ++      N G+GK  + GV+ A GEYI   +SDD++ + A + L  +  K  + D +   +     ++++    L+   ++++++I     +     +        W   +KK  + K  ++  +++  + D   GL WK+    +  +     LYFY + N  S++N    K    V  +F+       N + +NK      YFY
  S:     5 KVSVIVPVYNVE-TYLEEALMSLKNQTLKEIEFLIINDGSTDNSQKIIEEIAQDDPRFRVFNVKNGGIGKAFNLGVSEAKGEYIAEFESDDYVALHAYERLYNT-AKSHHADVVRCNWVEFSSEEEVERDILWQYPDKYNQLIDLKTTDLIVQVY-------PWNAIYKKSMIEKENVTWDEEIKSYGDT--GLFWKINSASQNVIFIKDCLYFYRQDNPNSTVNNVATK----VPFLFQQFKLIRSNLIEQNKFERYKGYFY 252
Score = 97, Expect = 6.3e-02, Identities = 27/92 (29%), Positives = 56/92 (60%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGV---GKIRDYGVTLANGEYIWFVDSDD 92
           + KVSV++P  N   K+++Q + ++  Q+ +  E+  +++ ST+    +D+IN+   +  +    +IG    G  R+ G+++A G Y+ F+D+DD
  S:   323 LYKVSVVMPIHNAS-KYLRQTLETVCEQSLREIEIILVENGSTDNT--MDIINEFAVKDPRITGISIGKSNPGHARNVGISMARGRYLQFLDADD 414
>gi|18309701|ref|NP_561635.1| capsular polysaccharide biosynthesis protein [Clostridium perfringens str. 13] >gi|18144378|dbj|BAB80425.1| probable capsular polysaccharide biosynthesis protein [Clostridium perfringens str. 13] (334 aa)
Score = 141, Expect = 5.0e-07, Identities = 72/245 (29%), Positives = 121/245 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW--RVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKK-------LYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKL 246
           K +S++IP  N+  K+I++ +  L+ QT+ NFEV  +DD ST+    +    L N      V     N G    R+ G+  + G+YI F+DSDD+   + +  L ++   +   D + F+Y+ + +   +N+    N +F +I     V  +    + +N    W   + + KEFL KNK+   +  +  ED+ F         KALL+SKK       L FY +     + N   YK   +V  +     ++ ENKL
  S:     7 KFLSIVIPAYNSE-KYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSEACLENFKINHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNM--FNEPDIVFFDYKRIKEGDSVNVNIAQNFEFGKIKSGEEVFNA----YKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIF-------KALLSSKKVRGIEDSLVFYCQRGDSLTNNPDIYKNITVVESMEDVAKFIDENKL 250
>gi|90961059|ref|YP_534975.1| N-acetylglucosaminyltransferase [Lactobacillus salivarius UCC118] >gi|90820253|gb|ABD98892.1| N-acetylglucosaminyltransferase [Lactobacillus salivarius UCC118] (338 aa)
Score = 141, Expect = 5.0e-07, Identities = 70/222 (31%), Positives = 108/222 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKN---FEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIG-VGKIRDYGVTLANGEYIWFVDSDDWL-YVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLY---------FYNRLNVESSLNTYKY 225
           ++++IP  N     I++LI S++          EV  IDD ST+  V I   L  KN    ++ I N+ G V K R+ G+  + G+Y+ FVDSDD L  VD +D   K     QN + I+F+     D+  +   +K N   E++      +  M   H          + + FL++NKI+  DK+ + ED  F      L  K + T+ K Y          +N  NV + L   KY
  S:     6 ITIVIPMYNVE-NSIERLIISISKAFKNQESLVEVLAIDDGSTDKTVKIFEKLQKKNQALALKLIKNSHGGVSKARNTGIKYSTGQYVTFVDSDDELTLVDVVDLKGK---LAQNAEIIIFDT----DRNNVIDLNKDNNRAEVLA-----EIAMLGKHAISTGIQDKIYLRSFLIENKIAFNDKLRVGEDTLFVFDAVSLANKVVETNSKFYMVHGSSSVHLFNEYNVTNELLFRKY 230
>gi|125623098|ref|YP_001031581.1| glycosyl transferase [Lactococcus lactis subsp. cremoris MG1363] >gi|124491906|emb|CAL96827.1| similar to glycosyl transferase [Lactococcus lactis subsp. cremoris MG1363] (330 aa)
Score = 141, Expect = 5.2e-07, Identities = 65/240 (27%), Positives = 111/240 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP-NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLE 243
           VS+I+P  N  L ++++ I S+  QT KN E+  IDD ST+    I          VQ+   +N G GK R+ G+ + +G+++ FVDSDD +  D ++ LL++      I    F      D K++   +K  +    I  +++    +P F ++        + KE    +++  PD ++++ED    L    +  K        Y+Y R N ES  N    + N     IF+    +LE
  S:     8 VSIIVPVYNAEL-YLEECINSILEQTYKNLEIILIDDGSTDNSFEIMKQYSENDSRVQSFSISNSGPGKCRNVGLDIFSGDFVMFVDSDDRICRDLVEILLENLGSSSEIAMCKFSK----DIKKLAKGTKKVENQTSIFVDSIKSIYLPGFPSSGPV--AKLYGKEIF--SELRFPD-ISMYEDAAISLQVLSIADKVSFVDYYGYYY-RFNSESITNKRVSERN---LFIFEKTKIMLE 234
>gi|169344542|ref|ZP_02865511.1| glycosyl transferase, group 2 family protein [Clostridium perfringens C str. JGS1495] >gi|169297462|gb|EDS79571.1| glycosyl transferase, group 2 family protein [Clostridium perfringens C str. JGS1495] (334 aa)
Score = 141, Expect = 5.3e-07, Identities = 72/245 (29%), Positives = 121/245 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW--RVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKK-------LYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKL 246
           K +S++IP  N+  K+I++ +  L+ QT+ NFEV  +DD ST+    +    L N      V     N G    R+ G+  + G+YI F+DSDD+   + +  L ++   +   D + F+Y+ + +   +N+    N +F +I     V  +    + +N    W   + + KEFL KNK+   +  +  ED+ F         KALL+SKK       L FY +     + N   YK   +V  +     ++ ENKL
  S:     7 KFLSIVIPAYNSE-KYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSEACLENFKINHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNM--FNEPDIVFFDYKRIKEDDSVNVNIAQNFEFGKIKSGEEVFNA----YKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIF-------KALLSSKKVRGIEDSLVFYCQRGDSLTNNPDIYKNITVVESMEDVAKFIDENKL 250
>gi|28379268|ref|NP_786160.1| glycosyltransferase [Lactobacillus plantarum WCFS1] >gi|28272107|emb|CAD65011.1| glycosyltransferase [Lactobacillus plantarum WCFS1] (244 aa)
Score = 140, Expect = 5.5e-07, Identities = 64/245 (26%), Positives = 109/245 (44%)
  Q:     5 SVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIM---FEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK---YKANDLVSIIFKNKNYLLENKLFNN 249
           SV++P  N   K+I   +TSL  QT  +FEVF +DD ST+   +    LI  +   +V    +N GV   R+ G+  A G+Y+ FVD DDW+  D +   L ++    +   ++   + Y  V    +      +NQ D I    N+N   +  F       W   F +  +  + +   + ++  ED  F   +    + +     + Y Y R    S+L       + A   +  I K +N  + N+ +NN
  S:     7 SVVVPAYNQH-KFIDSCLTSLQRQTLTDFEVFVVDDCSTDDTGEQIAALIKGDDRFHVITHAHNRGVSAARNSGMAAAKGKYLCFVDGDDWVEPDFLATFLAAYRSAPDTQLVVCGHYGYLAVPSPAK-----TYNQKDLIA---NINFGTVGGF------SWNKAFIRSIITTHHLKFNEDIDFLEDQLFAFRYANYVQSSEYVPDRTYHY-RWRFRSNLAHIGIPFFTARRKMMKILKQENKQVLNEDWNN 243
>gi|110803438|ref|YP_698032.1| glycosyl transferase group 2 family protein [Clostridium perfringens SM101] >gi|110683939|gb|ABG87309.1| glycosyl transferase, group 2 family protein domain protein [Clostridium perfringens SM101] (334 aa)
Score = 140, Expect = 5.8e-07, Identities = 72/245 (29%), Positives = 121/245 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW--RVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKK-------LYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKL 246
           K +S++IP  N+  K+I++ +  L+ QT+ NFEV  +DD ST+    +    L N      V     N G    R+ G+  + G+YI F+DSDD+   + +  L ++   +   D + F+Y+ + +   +N+    N +F +I     V  +    + +N    W   + + KEFL KNK+   +  +  ED+ F         KALL+SKK       L FY +     + N   YK   +V  +     ++ ENKL
  S:     7 KFLSIVIPAYNSE-KYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSETCLENFKIDHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNM--FNEPDIVFFDYKRIKEDDSVNVNIAQNFEFGKIKSGEEVFNA----YKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIF-------KALLSSKKVRGIEDSLVFYCQRGDSLTNNPDIYKNITVVESMEDVAKFIDENKL 250
>gi|41019068|gb|AAR98508.1| putative glycosyltransferase [Campylobacter jejuni] (310 aa)
Score = 140, Expect = 5.8e-07, Identities = 73/242 (30%), Positives = 120/242 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFD--KKQINLFSKHNQFDE---IIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLL 242
           M K+S+I+P  N   K+I + I S  NQT K+ E+  +DD  ++  + I        + ++ I N  N+G+ + R  GV  AN  YI F+D DD+L ++A + + K  Y  QN D I F Y  +    KK I   + +   DE    + K  VN +   W        W   F+K+  +K   KI+   K+ + ED     ++ +  K+ +   + L  YN  N+ SS N  + K  D +    +N N+++
  S:     1 MPKISIILPTFNVE-KYIAKAIESCINQTFKDIEIIIVDDCGSDKSINIAKEYAKKDERIKIIHNEKNLGLLRARYEGVKAANSLYIMFLDPDDYLELEACEEVSK--YLDQNNDLICFNYNTLDTTLKKNIFFINNNYNIDEYLKFLAKQIVNSNIYNW------GIWTKVFQKQKYLKTFEKINENPKLTMAEDALLLTLYYLECKRIVTLEQCLINYNMQNISSSTN--ERKNFDKMKFFIENLNFVI 240
>gi|113200408|gb|ABI32323.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 140, Expect = 5.9e-07, Identities = 59/211 (27%), Positives = 104/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M  +S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L  DA +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CFKK+ ++K+  KI   +++N  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPHLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQRHFCW------SVWAKCFKKDIILKSFEKIKIDERLNYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|196253969|ref|ZP_03152567.1| glycosyl transferase family 2 [Clostridium thermocellum DSM 4150] >gi|196196615|gb|EDX91514.1| glycosyl transferase family 2 [Clostridium thermocellum DSM 4150] (347 aa)
Score = 140, Expect = 5.9e-07, Identities = 59/211 (27%), Positives = 103/211 (48%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEW---------------VFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN 212
           + +S IIP  N        +   +NN+ N   E+  IDD S +    I       Y ++Q    +N GV   R+ G+ +A+G +I+F+D+DD L  +AID L     +  N D I+ +Y+                  D K + L SK+ + D+     ++N + + W      T W   ++++FL++ K+     + + ED++F L          ++  K YFYN
  S:     4 ESISFIIPVYNAQDVIEANIEKIVNNKKNYLIELILIDDGSVDKSSEICKSYSLKYPWIQYYRKDNGGVSSARNKGIEVASGNWIYFIDADDMLMDNAIDVLFDLIEENNNADIIITDYDTNKSTCAERKNTITRKAHDMKLLTLDSKYLKKDK-----DLNDAFLLW------TCWGKLYRRDFLIEYKLQFSLDLTLGEDIFFLLNCYDYCSSVKISFSKTYFYN 219
>gi|160942764|ref|ZP_02090005.1| hypothetical protein FAEPRAM212_00241 [Faecalibacterium prausnitzii M21/2] >gi|158445929|gb|EDP22932.1| hypothetical protein FAEPRAM212_00241 [Faecalibacterium prausnitzii M21/2] (340 aa)
Score = 140, Expect = 6.0e-07, Identities = 52/207 (25%), Positives = 96/207 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFH-NNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYF 210
           VS+I+P  N   K + + + S+ +QT +  E+  ++D ST+  + I +       + V     N GV + R+ G+TLA G+YI F DSDD L  D    L+++  ++ N D ++  Y  V         SK     E +  +   + + P    + Y    +  + +E   +  +  P         Y+G++W  LY++ ++   +L F
  S:     6 VSIIVPVYNAQ-KGLSRCLESICSQTYQELEIIVLNDGSTDDSLAICEQFRAKDPRIVVVDKENEGVSRTRNAGLTLAQGDYIQFADSDDALDPDYTQNLVQAALEH-NADLVIAPYWMVIPSNS----SKTGHALETLQTSLGIEPEAPKTEVHKYGFLPQGVYSREDYARRLMQQP------ASFYYGVLWNKLYRREIIAQNQLAF 202
>gi|6601345|gb|AAF18946.1|AF155804_7 Cps1K [Streptococcus suis] (279 aa)
Score = 140, Expect = 6.0e-07, Identities = 57/222 (25%), Positives = 108/222 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFYNRLNVESSLNT 222
           + K+S+I+P  N   K++ + I S+ NQT K+ E+  ++D ST+    I L        ++     N G+   R+YG++ A G+Y+ F+DSDD+++ + I  L ++  + +N    +  Y+ V                 ++   NV K  +    + +       +KKE     +    +K  I ED YF   +++LY  +K  +  + LY+Y  ++ E+S+ T
  S:     4 ISKISIIVPIYNVE-KYLSKCIDSIVNQTYKHIEILLVNDGSTDNSEEICLAYAKKDSRIRYFKKENGGLSDARNYGISRAKGDYLAFIDSDDFIHSEFIQRLHEAIER-ENALVAVAGYDRVDASGHFLTAEPLPTNQAVLSGRNVCKKLLEADGHRFVVACNKLYKKELFEDFRF---EKGKIHEDEYF--TYRLLYELEKVAIVKECLYYY--VDRENSITT 219
>gi|160931555|ref|ZP_02078950.1| hypothetical protein CLOLEP_00387 [Clostridium leptum DSM 753] >gi|156869426|gb|EDO62798.1| hypothetical protein CLOLEP_00387 [Clostridium leptum DSM 753] (330 aa)
Score = 140, Expect = 6.2e-07, Identities = 40/107 (37%), Positives = 60/107 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-------NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           VS+IIP  N   +++ + + S+  QT K FEV  +DD ST+  + I         + +  PN       N GV K R+ G+  A GEYI F+DSDD++    +  L +S  KY+
  S:     8 VSLIIPVYNVE-QYLPKCLESIAAQTLKGFEVILVDDGSTDHSLEIL------RGFARRFPNTCVIHQENGGVSKARNAGIQAARGEYIAFMDSDDYIAPLYLQRLYESAKKYR 114
>gi|60679782|ref|YP_209926.1| putative glycosyltransferase [Bacteroides fragilis NCTC 9343] >gi|60491216|emb|CAH05964.1| putative glycosyltransferase [Bacteroides fragilis NCTC 9343] (356 aa)
Score = 140, Expect = 6.2e-07, Identities = 38/107 (35%), Positives = 60/107 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           +S+I+P  N   ++  + I SL NQT KN E+  +DD ST+  P +  +   ++    V +   N G+   R+ G+ +A GEYI FVD DDW+  D  + L    Y++Q
  S:    10 ISIIVPIYNIA-EYASECIQSLINQTYKNIEIILVDDGSTDHSPAICDEFAEQDERIKVIH-KRNGGLSDARNAGLDVATGEYIGFVDGDDWVDEDMYETLYHLIYEHQ 116
>gi|40217893|gb|AAR82863.1| putative glycosyltransferase [Campylobacter jejuni] >gi|61387374|gb|AAX45345.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 140, Expect = 6.3e-07, Identities = 54/211 (25%), Positives = 105/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K     F +  ++    + +   F +  Q DE++ +    +      H  +   W  CF+K+ ++KN  K+   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNIGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK----GFDLLCFDAFVHRVKTKQFYRFKQ-DEVLNQKEFLEFLSKQRHFCWSV-WAKCFRKDIILKNFEKVKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|152993122|ref|YP_001358843.1| hypothetical protein SUN_1535 [Sulfurovum sp. NBC37-1] >gi|151424983|dbj|BAF72486.1| hypothetical protein [Sulfurovum sp. NBC37-1] (315 aa)
Score = 140, Expect = 6.6e-07, Identities = 36/106 (33%), Positives = 59/106 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           V+VIIP  N   KW+K+ I S+  QT +N E+  ++D ST+  V  +  I     Q ++ +  N GV   R+ G+  A G +I F+D+DD  +   I+ L++   +Y
  S:     7 VTVIIPLYNKE-KWVKRAIDSVQEQTYENLEILVVNDGSTDRSVEVVQSIKDERIQVLEKV--NGGVSSARNRGIEEAKGGFIAFLDADDVWFQKHIEVLVEGVARY 110
>gi|148643384|ref|YP_001273897.1| glycosyl transferase family protein [Methanobrevibacter smithii ATCC 35061] >gi|148552401|gb|ABQ87529.1| glycosyltransferase, GT2 family [Methanobrevibacter smithii ATCC 35061] (344 aa)
Score = 140, Expect = 7.0e-07, Identities = 81/277 (29%), Positives = 136/277 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQN----IPNNIGV-GKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDL----VSIIFKNKNYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKTH 277
           M K+SV++   N+   ++ + + S+ +Q+   ++ EV F+DD ST+    +DL++    +Y       +  N G  G  R+ G+ LA GEY+ F D DD    +A + +     K +N DF++  Y  V++++ +    +   FD   V  N  K  +  F     + W   FKK+FL +N I   + + + ED+Y       +Y  ALL SKK  + +         +Y Y   D+     +I  +NK Y LE+ +   N YF   N L  LN+  +    N+ K H
  S:     1 MYKISVVVATYNSG-DFLSEFLDSIKSQSLGFEDIEVIFVDDASTD-SCTLDLLHDFNKKYSNVSAVFLDENSGFPGTGRNRGLDLAGGEYVIFADHDDSYVENAFEVMYNEISK-ENADFLITNYYKVYERETVK---EKTVFDGENVVVNTFKDDLRLFDIG-PSIWTKLFKKDFLAENNIRFLEGM-LAEDLY-------VYVYALLKSKKTVYLD------DFYSYNYSIRDVDGNKSTIHIRNKKY-LESMV---NGYFEVDNLLDKLNKEEFFS--NIFKRH 261
>gi|186683157|ref|YP_001866353.1| glycosyl transferase family protein [Nostoc punctiforme PCC 73102] >gi|186465609|gb|ACC81410.1| glycosyl transferase, family 2 [Nostoc punctiforme PCC 73102] (337 aa)
Score = 139, Expect = 7.4e-07, Identities = 55/211 (26%), Positives = 98/211 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQIN----LFSKHNQFDEIIVKNNVN--KSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           + +V+VI+P  NT   +I Q I S+  QT K+ E+  +DD ST+  + I     +    V     N+G    R+  +  A G++I  +DSDDW   + ++ LL+     +N D +  +  ++ D  Q      +     Q D I   ++V   ++ +P          +   K+EFL+K  I + + + + ED +F L       + +      YFY
  S:     5 IPEVTVIMPAYNTE-AYISQAIESVLGQTLKSLELIVVDDASTDKTLAIAQNFSDERLKVIASSKNLGPSGARNLAIKEAKGKWIAILDSDDWYLPERLEKLLQ-VADAENADMVADDLYYIKDGDQTPWNTLIAQSGEQIDTIKEIDSVYYVETDLPGRGGLTIGLTKPVIKREFLIKKNIEYDESIRLSEDFWFYLKCLAYKARFIFVPTPYYFY 219
>gi|53711519|ref|YP_097511.1| putative glycosyltransferase [Bacteroides fragilis YCH46] >gi|52214384|dbj|BAD46977.1| putative glycosyltransferase [Bacteroides fragilis YCH46] (356 aa)
Score = 139, Expect = 7.5e-07, Identities = 38/107 (35%), Positives = 60/107 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           +S+I+P  N   ++  + I SL NQT KN E+  +DD ST+  P +  +   ++    V +  N  G+   R+ G+ +A GEYI FVD DDW+  D  + L    Y++Q
  S:    10 ISIIVPIYNIA-EYASECIQSLINQTYKNIEIILVDDGSTDHSPAICNEFAEQDERIKVIHKRNG-GLSDARNAGLDVATGEYIGFVDGDDWVDEDMYETLYHLIYEHQ 116
>gi|154149052|ref|YP_001406518.1| ss-1,4-galactosyltransferase [Campylobacter hominis ATCC BAA-381] >gi|153805061|gb|ABS52068.1| ss-1,4-galactosyltransferase [Campylobacter hominis ATCC BAA-381] (325 aa)
Score = 139, Expect = 7.8e-07, Identities = 71/223 (31%), Positives = 104/223 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSF--YKYQNIDFIMFEYEWVFD----------KKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYK 226
           +SVI+P  N   +++   I SL NQ+ +NFE+  IDD S +  + I  +   K     V +  N  G G  R+ G+  A GE+I FVDSDD L   A  +L K+F   K  N+   M  Y    D          K ++ + +    F EI + N       P F       WR  + K      K+  P    I+EDV          +KA   ++ LYFY RL   S+ N++  +
  S:     5 ISVIVPVFNVA-EFLDDCIKSLLNQSYENFEILLIDDGSGDKSLEICQNFAKKEPKIRVFSKQNG-GQGSARNLGLDNAKGEFICFVDSDDIL---ASGFLDKTFEILKQNNVKMAMCAYAPFVDASEISNIESVKSEVKILNDKEIFKEIFLAN-------PAFGTAV---WRNLYHKSIF--EKLRFPQN-QIYEDVAIAFEIFNNAEKAAFCNETLYFY-RLRAGSTTNSFSKR 222
>gi|182624082|ref|ZP_02951869.1| glycosyl transferase, group 2 family protein [Clostridium perfringens D str. JGS1721] >gi|177910698|gb|EDT73058.1| glycosyl transferase, group 2 family protein [Clostridium perfringens D str. JGS1721] (334 aa)
Score = 139, Expect = 7.9e-07, Identities = 72/245 (29%), Positives = 120/245 (48%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW--RVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKK-------LYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKL 246
           K +S++IP  N+  K+I++ +  L+ QT+ NFEV  +DD ST+    +    L N      V     N G    R+ G+  + G+YI F+DSDD+   + +  L ++   +   D + F+Y+ + +   +N+    N +F +I     V       + +N    W   + + KEFL KNK+   +  +  ED+ F         KALL+SKK       L FY +     + N   YK   +V  +     ++ ENKL
  S:     7 KFLSIVIPAYNSE-KYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSEACLENFKINHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNM--FNEPDIVFFDYKRIKEGDSVNVNIAQNFEFGKIKSGEEVFND----YKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIF-------KALLSSKKVRGIEDSLVFYCQRGDSLTNNPDIYKNITVVESMEDVAKFIDENKL 250
>gi|157644644|gb|ABV59022.1| beta-1,3-N-acetylglucosaminyl transferase [Streptococcus agalactiae] (323 aa)
Score = 139, Expect = 8.8e-07, Identities = 40/102 (39%), Positives = 57/102 (55%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           K+SVI+P  N   K+I   I+SL NQT +N E+  IDD ST+    I   + +  ++ +     N GV   R+ G+  A G YI FVDSDD++     + LLK
  S:     8 KISVIVPLYNVE-KYIINCISSLTNQTYQNIEIILIDDGSTDNSGRICKKLAQEDHRIIYLRKENGGVSSARNLGLQYATGSYIGFVDSDDYISKTMYENLLK 109
>gi|157415411|ref|YP_001482667.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 81116] >gi|13123727|gb|AAK12948.1|AF343914_1 WaaV [Campylobacter jejuni] >gi|108514951|gb|ABF93273.1| putative glycosyltransferase [Campylobacter jejuni] >gi|157386375|gb|ABV52690.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 81116] (272 aa)
Score = 139, Expect = 8.8e-07, Identities = 56/211 (26%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVK--NKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I +++ S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L  DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CF+K+ ++K   K+   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRVLQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFRKDMILKIFEKVKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|76799043|ref|ZP_00781237.1| glycosyl transferase cpsJ [Streptococcus agalactiae 18RS21] >gi|76585603|gb|EAO62167.1| glycosyl transferase cpsJ [Streptococcus agalactiae 18RS21] >gi|126722162|emb|CAM57118.1| CpsJ protein [Streptococcus agalactiae] >gi|157644629|gb|ABV59008.1| beta-1,3-N-acetylglucosaminyl transferase [Streptococcus agalactiae] (323 aa)
Score = 139, Expect = 8.9e-07, Identities = 40/102 (39%), Positives = 57/102 (55%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           K+SVI+P  N   K+I   I+SL NQT +N E+  IDD ST+    I   + +  ++ +     N GV   R+ G+  A G YI FVDSDD++     + LLK
  S:     8 KISVIVPLYNVE-KYIINCISSLTNQTYQNIEIILIDDGSTDNSGRICKKLAQEDHRIIYLRKENGGVSSARNLGLQYATGSYIGFVDSDDYISKTMYENLLK 109
>gi|68643595|emb|CAI33818.1| putative glycosyl transferase [Streptococcus pneumoniae] (323 aa)
Score = 139, Expect = 9.0e-07, Identities = 60/229 (26%), Positives = 108/229 (47%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDL 230
           K VS+I+P  N   ++IK  + S+  QT  N EV  ++D ST+  V Y + I K   ++      N G+   R+ G+  A G+Y+ FVDSDD++  D + YL+      +    I     +  D++   +N+FS  +     + +      +M +  +   + W   FK+E    + I  P    +FED    +++ +L K   +       Y  ++ ++S+ T K+   DL
  S:     3 KLVSIILPVYNVE-QYIKNCLESIQQQTYPNLEVIIVNDGSTDKSVEYCEQICKIDSRFSITHKENGGLSDARNVGIDKAKGDYLIFVDSDDFVSQDMVSYLVSCMENNEADIAICDPVHYYSDRQNNDLNIFSPASSVK--VYETTEALCEMFYQKSFLVSAWAKIFKRELF--DDIRFPVG-KLFEDS--AIMYLLLEKCETIAYSDAKLYAYVHRDNSITTKKFSDRDL 226
>gi|182417921|ref|ZP_02949231.1| CpsIaI [Clostridium butyricum 5521] >gi|182378230|gb|EDT75764.1| CpsIaI [Clostridium butyricum 5521] (327 aa)
Score = 139, Expect = 9.1e-07, Identities = 44/122 (36%), Positives = 64/122 (52%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           M KVS+I P  N     I++ + S+ NQT K FE   IDD S +  + I  +L+  +   Y      N GV   R+ G+  A GEYI F+DSDD++  + I+ + K   K  N D +  +Y  V
  S:     1 MVKVSIITPVYNVE-ACIEKCVKSVMNQTCKEFEFLLIDDGSKDKSIDIAKELLEGSDINYKIITQKNSGVSTARNEGIKKAVGEYITFLDSDDYIAPEFIELMTKKADK-TNCDVVFCDYSEV 122
>gi|153951676|ref|YP_001397751.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. doylei 269.97] >gi|152939122|gb|ABS43863.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. doylei 269.97] (272 aa)
Score = 138, Expect = 9.4e-07, Identities = 57/211 (27%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    RD GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRDLGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDGVFNQKEFLEFLSKQR----HFCWSV-WAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|123285409|gb|ABM74213.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 138, Expect = 9.7e-07, Identities = 58/211 (27%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CFKK+ ++K+  KI   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDVEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQR----HFCWSV-WAKCFKKDIILKSFEKIKIDERLSYGEDVLFCYIYFMFCEKIAVFKICIYHY 208
>gi|157825589|ref|YP_001493309.1| glycosyltransferase [Rickettsia akari str. Hartford] >gi|157799547|gb|ABV74801.1| Two-domain glycosyltransferase [Rickettsia akari str. Hartford] (604 aa)
Score = 138, Expect = 1.0e-06, Identities = 45/125 (36%), Positives = 64/125 (51%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ 127
           KVSVIIP  N  + W  + I S+  QT+KNFE+  IDD ST+    +    K   +       N G    R+ G+  A G+YI F+DSDD  Y D I+  L+ F +  N  F    Y+ + +K +
  S:   294 KVSVIIPVYNR-INWAIEAIESVLIQTHKNFEILIIDDGSTDDISELIARCKKDKRIRYFHKKNEGPAAARNLGIKNAIGKYIAFLDSDDLFYKDKIEIQLQ-FMEENNCIFSHTSYQKIDEKAK 416
Score = 110, Expect = 1.6e-03, Identities = 42/149 (28%), Positives = 75/149 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDD----NSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP 152
           VS+IIP  N    ++++ I S   QT +N E+  ++D    N     V +   +K  Y Y +N     G G   +YG+   NGEY  ++  DD  Y + I++ +    K  N D I++    + D+K  +L  ++ + D ++  + +N S +P
  S:    16 VSIIIPVYNGA-NYMREAIDSALAQTYENIEIVVVNDGSKDNGKTENVALSYGDKIRYFYKENG----GCGSALNYGIKNMNGEYFSWLSHDDIYYPNKIEHQVNILNKLDNKDTIIYGGYELIDEKGSSL--RYIKPDSVLPIDKLNISLLP 161
>gi|161702194|gb|ABX75656.1| glycosyltransferase [Lactococcus lactis subsp. lactis] (319 aa)
Score = 138, Expect = 1.0e-06, Identities = 62/211 (29%), Positives = 101/211 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIP-NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNY-QTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNR 213
           KVSVI+P  N+  K+I+  + SL  QT +  E+  ++D ST+  +    DLI+   Y ++Q I   N G  + R+ G+  A G+YI FVDSDD++    ++ L +   + +N+D I   +E  +  K      +  +   I V +  +  K      NY    W   +++ FL  N +    K  I ED  F     +  K+A +     Y Y R
  S:     5 KVSVIVPIYNSE-KYIRFCLKSLIQQTLRPIEIILVNDGSTDNSIKNISDLIDN--YDFIQLIEIENSGAAEARNQGLFTAQGKYISFVDSDDFVKATFLEKLYQEC-ENKNLDIICGSFEATYKNKSSKKMIRSPELLNIGVGDGASLFKKQIQLRNYIPMIWAYLYRRSFLEDNALYLSAK-TIHEDEEFSSRVWINAKRAEIIESYDYIYQR 214
>gi|195953945|ref|YP_002122235.1| glycosyl transferase family 2 [Hydrogenobaculum sp. Y04AAS1] >gi|195933557|gb|ACG58257.1| glycosyl transferase family 2 [Hydrogenobaculum sp. Y04AAS1] (746 aa)
Score = 138, Expect = 1.1e-06, Identities = 38/113 (33%), Positives = 66/113 (58%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLIN---KNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           K+S+++P  NTP K++  +I S+ NQT  N+E+  +D NS    V   L +   K+    V+ +  N G+    +  + LA GEYI F+D DD L   A+  ++++  + +++DFI
  S:   216 KISIVVPVWNTPKKFLIDMIESVLNQTYSNWELCIVDGNSKEKHVKETLEHYTLKDKRIKVKYLKENKGIAGNSNEAIALATGEYIAFLDHDDVLAPFALYEVVRAINENEDVDFI 331
Score = 89, Expect = 4.6e-01, Identities = 27/89 (30%), Positives = 49/89 (55%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNI---------GVGKIRDYGVTLANGEYIWFVDSD 91
           KVS+IIP K+      K + + +N  T KN+E+  +++NS   + +        Y+Y+QN  NNI             + ++    ANG+ + F+++D
  S:   473 KVSIIIPNKDHKEDLEKCITSIINKSTYKNYEIIIVENNSKEKKTF------EYYKYLQNKYNNIVLLEWKDKFNYSAVNNFASKYANGDILLFLNND 564
>gi|125381155|gb|ABN41498.1| putative glycosyltransferase [Campylobacter jejuni] (272 aa)
Score = 138, Expect = 1.1e-06, Identities = 57/211 (27%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVK--NKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +  LK   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++K   K+   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEIALKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEFFNQKEFLEFLSKQRHFCW------SVWAKCFRKDMILKIFEKVKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|160931556|ref|ZP_02078951.1| hypothetical protein CLOLEP_00388 [Clostridium leptum DSM 753] >gi|156869427|gb|EDO62799.1| hypothetical protein CLOLEP_00388 [Clostridium leptum DSM 753] (332 aa)
Score = 137, Expect = 1.3e-06, Identities = 58/244 (23%), Positives = 118/244 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINK-NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ-NIDFIMFEYEWVFDKKQINL--FSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLF 247
           +S++IP  N  + ++++ + S+ +QT +N+E   +DD ST+  P++    + K + ++ V+    N G+   R+ G+ LA GE+I F+DSDD+     ++ +  +      +I +  F + + ++  +I L    +   ++     N + + K     + +   W   +K+   ++N +++      FEDV          K+  +TSK LY Y R       +    K ND +  +   +N+L E   F
  S:    17 ISIVIPVYNVDM-FLRKALQSVADQTFQNYEAIIVDDGSTDRCPEIIAKYVRKYSNFKSVRQ--ENAGLSAARNTGLRLAQGEFIAFMDSDDYYQPTFLEDMYNACVANDCDISYCSFYFYFPYNGLRIPLPFTCRTAVYESRQALNLLIRDK-----SMHHFAWNKLYKRSLFLENDVTYTQMY--FEDVATSPKLYYHAKRVAVTSKPLYNYTRRRGSILKSMNAKKINDFIRTLGYTRNFLEEADDF 256
>gi|167762142|ref|ZP_02434269.1| hypothetical protein BACSTE_00494 [Bacteroides stercoris ATCC 43183] >gi|167699785|gb|EDS16364.1| hypothetical protein BACSTE_00494 [Bacteroides stercoris ATCC 43183] (305 aa)
Score = 137, Expect = 1.3e-06, Identities = 44/141 (31%), Positives = 74/141 (52%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF---DKKQINLFSKHNQFDEII 141
           M +VSVIIP  NT   ++++ + S+  QT K  E+  IDD ST+  +  I+   K   +       N G+   R+ G+  A G+YI+F+DSDD L   A+        + + +DFI F+ + +    D + I  + +  + DE +
  S:     1 MPEVSVIIPIYNTA-AYLRKALDSICGQTLKELEIILIDDGSTDGSRGIIEEYAKRDARIRWYAQPNQGLSVARNRGLLHATGKYIYFMDSDDILDTQALRR-CHDLCEKRELDFIFFDAKPLTESADSQNIPNYDRKGKIDESV 143
>gi|171742219|ref|ZP_02918026.1| hypothetical protein BIFDEN_01325 [Bifidobacterium dentium ATCC 27678] >gi|171277833|gb|EDT45494.1| hypothetical protein BIFDEN_01325 [Bifidobacterium dentium ATCC 27678] (343 aa)
Score = 137, Expect = 1.3e-06, Identities = 32/91 (35%), Positives = 51/91 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           +SVI+P  N   ++++Q + SL  Q   +FEV  +DD S +   +  D       ++      N G+   R+ G+T A+G+YI FVDSDDW+
  S:     7 ISVIVPVYNVR-RYLRQCLESLATQNYPSFEVILVDDGSADGSDLLCDEYAAKDERFKVVHQQNAGLSVARNTGLTHASGQYISFVDSDDWV 97
>gi|119485059|ref|ZP_01619444.1| glycosyl transferase [Lyngbya sp. PCC 8106] >gi|119457287|gb|EAW38412.1| glycosyl transferase [Lyngbya sp. PCC 8106] (1161 aa)
Score = 137, Expect = 1.4e-06, Identities = 42/115 (36%), Positives = 63/115 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           + KVSVIIP  N    +I+Q + S+  QT  ++EV  IDD ST+        Y+D+I     QYV    +N G  K R+ G  +A GE + F+D DD+   + +   +K F +   ID +
  S:   330 LPKVSVIIPAYNCE-NYIEQAVKSVLEQTYTDYEVIVIDDGSTDNTKNILSPYLDII-----QYVYQ--SNQGAAKARNKGCQIAQGELLAFLDGDDFFTPNKLAEQVKVFEQDATIDLV 441
Score = 104, Expect = 8.7e-03, Identities = 34/113 (30%), Positives = 53/113 (46%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           +VSVIIP  N   ++I Q + S+ +QT+ +FEV  +DD ST+    I     +  +Y      N GV   R+ G+  A  E I  +D DD      +      F K+  +  +
  S:     9 QVSVIIPAYNGS-RYISQAVESVLSQTDCHFEVIVVDDGSTDNTNTILQHYSDRIRYFSQ--KNQGVAAARNRGIQEAKAEIIALLDQDDIFLPHKLAEQTACFQKFPEVGLV 118
>gi|187932850|ref|YP_001887375.1| minor teichoic acid biosynthesis protein GgaB [Clostridium botulinum B str. Eklund 17B] >gi|187721003|gb|ACD22224.1| minor teichoic acid biosynthesis protein GgaB [Clostridium botulinum B str. Eklund 17B] (335 aa)
Score = 137, Expect = 1.4e-06, Identities = 75/255 (29%), Positives = 123/255 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTD---WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNW 258
           +S+I+P       ++   ITS+ NQT KNFE+  +DD S +    I     +N N  + +     N G    R+ G+ +A GE+I FVDSDDW+  +  + L  +  K  N D     Y  V ++ +  +    N   EII+  N  +S    ++  Y +    W   +KK      +I  P+ + IFED    +++K+L+  KK + T+KKLY+Y   N   S+   K+    L  +   ++     +KL N + Y     W
  S:    19 ISIIMPIYKAE-DYLNNSITSILNQTLKNFELILVDDGSPDNSGKICNELALNDNRIKVIHK--ENGGASTARNAGLDIAQGEFIAFVDSDDWIEPNMFETLF-NLAKEHNADISQCNYIKVENEDEKII----NDDKEIIISFNNTESLNNLYNEMYVSTVVLWNKIYKKSLF--KEIRFPN-MRIFEDE--AIMYKLLFESKKLVYTNKKLYYYR--NTPDSIMNAKFDKKRLCMLDVFDEKVEFMSKLNNEHLYAKTLKW 266
>gi|163816809|ref|ZP_02208172.1| hypothetical protein COPEUT_02999 [Coprococcus eutactus ATCC 27759] >gi|158448066|gb|EDP25061.1| hypothetical protein COPEUT_02999 [Coprococcus eutactus ATCC 27759] (321 aa)
Score = 137, Expect = 1.4e-06, Identities = 61/220 (27%), Positives = 113/220 (51%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINL-FSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNT 222
           KVS+I+P  N   + + + + SL NQT +N E+  +DD S    P++  +   K+    V + PN  G+   R+ G+  A+G+Y+ FVDSDD++  D+ +  L +F K  ++D ++     +  K +I L  S   + ++   ++   KS      N+Y       + +EFL+KN +   + + IFED+   ++ ++  K   +      FYN +  + S+ T
  S:    16 KVSIIVPVYNVENE-LDRCVASLINQTYQNIEILLVDDGSPGACPKMCDEYAKKDKRIIVIHKPNG-GLSSARNTGLKRASGKYVLFVDSDDYIETDSCEKFL-TFVK-DDVDLVVGAGRMIKGKDEILLRHSNIREREKYSARDFTIKSIKHSEWNSYAC--LSLYDREFLIKNDLFFREGI-IFEDMQ--ILPEIYLKAGNIVYMDYAFYNYVVRDGSIMT 229
>gi|148926155|ref|ZP_01809840.1| putative glucosyltransferase [Campylobacter jejuni subsp. jejuni CG8486] >gi|145845326|gb|EDK22419.1| putative glucosyltransferase [Campylobacter jejuni subsp. jejuni CG8486] (298 aa)
Score = 137, Expect = 1.4e-06, Identities = 58/211 (27%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CFKK+ ++K+  KI   ++++  EDV F  I+ +  +K  +    +Y Y
  S:    29 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDVEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQRHFCW------SVWAKCFKKDIILKSFEKIKIDERLSYGEDVLFCYIYFMFCEKIAVFKICIYHY 236
>gi|196181952|gb|EDX76939.1| glycosyl transferase, group 2 family protein [Microcoleus chthonoplastes PCC 7420] (325 aa)
Score = 137, Expect = 1.4e-06, Identities = 39/106 (36%), Positives = 59/106 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSF 106
           M  +SV+IP  N   K I+Q I S+ NQT  NFE+  IDD S +  + I     +    V + PN  G+   R+ G+ LA+G+YI F+D+DD    + ++  LK+ 
  S:     1 MSLISVVIPVYNGE-KTIRQTIESVINQTFSNFELIVIDDGSQDSTLDIVRSISDSRLKVFSFPN-AGLATSRNRGIQLASGDYISFIDADDLWTGNKLEAQLKAL 104
>gi|150006455|ref|YP_001301199.1| glycosyl transferase family protein [Bacteroides vulgatus ATCC 8482] >gi|149934879|gb|ABR41577.1| glycosyltransferase family 2 [Bacteroides vulgatus ATCC 8482] (341 aa)
Score = 137, Expect = 1.5e-06, Identities = 75/253 (29%), Positives = 119/253 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP-------NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIW-KVLYKKA---LLTSKKLYFYNRLNVESSLNTYKYK----ANDLVSIIFKNKNYLLENKLFNNNWYF 253
           MK+++V++P      K++ + + S+ NQT   FE   IDD S  P   + LI +    Y  NI         N GV   R+ G+ L+ G Y++F+DSDD LY + ++ L +   +Y  ID +  +    + +   N  S   ++ E  ++ N    K+        T      +KE L +N I     + +FED     +W   LYKK       +   YFY R N  S++N  K      A D +  I    N  +E +L+  N  F
  S:     2 MKEITVVMPVYKVE-KYVSECLDSIINQTFDCFECIIIDDCS--PDNSMRLIEEKLAGYKGNISFRIVRNERNEGVSAARNKGIELSRGGYLFFIDSDDMLYENCLEKLWEETKRYPGIDLVQGD---SYSEGMENKNSDLQRYTEGRIRIN----KLFLDSKITSTPVNRLIRKEVLTENAIYFRTGI-LFED----FLWCYFLYKKVETFASVNSFTYFYRRSNPFSTMNKAKTDFDKPAKDFI-FILTVFNEHMEQELYAENICF 253
>gi|164688674|ref|ZP_02212702.1| hypothetical protein CLOBAR_02320 [Clostridium bartlettii DSM 16795] >gi|164602150|gb|EDQ95615.1| hypothetical protein CLOBAR_02320 [Clostridium bartlettii DSM 16795] (365 aa)
Score = 137, Expect = 1.5e-06, Identities = 72/262 (27%), Positives = 125/262 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP------------WF-------HNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY-NRLN--VESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNWLGAL 262
           M K+S+I+   N     IK+ + SL  Q N+  E+  ++D ST+   ++  +   K+    + N  N  G+   R+ G+  + G YI FVD DD++     D L+    + +   F M  Y   FD     ++ K N+   II + ++ K  +P            WF       +N + + WR  + +  + KNKI   + V   ED+ F L +    K+  +  +  Y+Y  R     +S     K+  + L  +I + K   L  KL+N     Y+S + G +
  S:     4 MIKLSIIVTIYNLE-NCIKKCLDSLIKQQNQEIEIICVNDGSTDSSKEILEEYELKDSRIKIINKKNG-GISSARNVGLQYSKGRYILFVDGDDYIDDITSDKLISIVEQNEADTFFMGYYRQWFDGAINKIYPKLNK--SIIYEEDIKKLLIPSIVGISFEKLYDWFSGESLTSNNEFPSVWRFLYSRNIIQKNKIKFNENVITGEDILFNLEYLHYAKRVCILRECFYYYVERFGSLTQSYDKKQKFYESKLKLLIEREK---LTKKLYNKEKIDYSSLYQGTI 282
>gi|53714939|ref|YP_100931.1| putative glycosyltransferase [Bacteroides fragilis YCH46] >gi|52217804|dbj|BAD50397.1| putative glycosyltransferase [Bacteroides fragilis YCH46] (350 aa)
Score = 137, Expect = 1.5e-06, Identities = 62/249 (24%), Positives = 123/249 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQ----NIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV-FDKKQINLFSK----HNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNN 249
           M K+SVIIP   +  K++++ + S+ +QT K+ E+  IDD S  P +  ++ ++   +Y +    +IPN+ GV   R++G++ ++GEY+ F+DSDD++  + ++     F  Y ++D  M  Y  +  +KK+   F +    +NQ +  I          P F           +++  +V+N I   + +++ ED  F L +        +++   Y Y     E  L        ++  + + ++     NK+F N
  S:     1 MPKISVIIPIYKSE-KFLRKCVDSVLSQTFKDIEILLIDDGS--PDLSGEICDQYASKYSRVKAFHIPNS-GVSAARNFGISKSSGEYLCFIDSDDYVEDEYLECF--GFNVYLDLDLYMQGYRMIGLNKKEEKKFPQSAVYYNQKEPYIYSEMNFIIASPCFK---------LYRRSIVVENHILFDESISLGEDHLFSLNYYCYVTSVYVSTGCFYNYIYHGSEQHLTNRYVSLENI--LYYSDQIEFFRNKIFAN 241
>gi|15193226|gb|AAK91730.1|AF400048_12 putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 137, Expect = 1.5e-06, Identities = 56/211 (26%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVK--NKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I +++ S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L  DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CF+K+ ++K   KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRVLQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFRKDMILKIFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|41019071|gb|AAR98511.1| putative glycosyltransferase [Campylobacter jejuni] (269 aa)
Score = 137, Expect = 1.6e-06, Identities = 56/211 (26%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CFKK+ ++K+  K+   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNIGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQRHFCW------SVWAKCFKKDIILKSFEKVKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|18309463|ref|NP_561397.1| beta-1,4-galactosyltransferase [Clostridium perfringens str. 13] >gi|18144139|dbj|BAB80187.1| beta-1,4-galactosyltransferase [Clostridium perfringens str. 13] (342 aa)
Score = 137, Expect = 1.6e-06, Identities = 38/105 (36%), Positives = 58/105 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKS 105
           + KVS+I+P       ++ + I S+ NQ+ KN E+  +DD ST+     IDL  K   +       N G+   R+YG+    G+Y+ FVDSDDWL  D +  L+K+
  S:     2 LPKVSLIVPIYKVQ-DYLNKCIDSIINQSYKNLEIILVDDGSTDRCGEIIDLYEKQDNRIKVFHKKNGGLSDARNYGMNFITGDYVIFVDSDDWLSEDMVSDLMKT 106
>gi|57238021|ref|YP_179270.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni RM1221] >gi|57166825|gb|AAW35604.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni RM1221] (269 aa)
Score = 137, Expect = 1.6e-06, Identities = 56/211 (26%), Positives = 107/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|150019442|ref|YP_001311696.1| glycosyl transferase family protein [Clostridium beijerinckii NCIMB 8052] >gi|149905907|gb|ABR36740.1| glycosyl transferase, family 2 [Clostridium beijerinckii NCIMB 8052] (322 aa)
Score = 137, Expect = 1.6e-06, Identities = 71/227 (31%), Positives = 102/227 (44%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS-TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTD----WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDL 230
           +SVI+P  N   K++ Q I S+ NQT KN E+  +DD S  N     D  +K   + V     N G+   R+ G+ +A G YI FVDSDDWL     + LLK   K  N D    ++      K  N        D  I+ +  N   +  F+N+  T     W   +K+E      IS+P    I ED   G  +K+ YK   +T   +  Y      +S+ T K+    L
  S:     8 ISVIVPVYNVE-KYLPQCIYSILNQTEKNLEIILVDDGSLDNSGKICDEFSKKDDRIVVIHKKNNGLSSARNAGLEIAKGNYIGFVDSDDWLDKSMYEILLK-LLKENNSDISCCDF-----FKTANSDGSIPHIDNEIINSYNNIESLNNFYNDLYTQTVVAWNKLYKRELF--KDISYPVG-KIHEDE--GTTYKLYYKANKITYTNMPLYYYRITPNSITTSKFNKKRL 227
>gi|188588425|ref|YP_001922309.1| minor teichoic acid biosynthesis protein GgaB [Clostridium botulinum E3 str. Alaska E43] >gi|188498706|gb|ACD51842.1| minor teichoic acid biosynthesis protein GgaB [Clostridium botulinum E3 str. Alaska E43] (335 aa)
Score = 136, Expect = 1.6e-06, Identities = 75/255 (29%), Positives = 121/255 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS-TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTD---WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNW 258
           +S+I+P       ++   ITS+ NQT +NFE+  +DD S  N     D +  N  +       N G    R+ G+ +A GE+I FVDSDDW+  +  + L  +  K  N D     Y  V ++ +  +    N   EII+  N  +S    ++  Y +    W   +KK     NKI  P+ + IFED    +++K+L+  KK + T+KKLY+Y   N   S+   K+    L  +   ++     +KL   + Y     W
  S:    19 ISIIMPIYKAE-DYLNNSITSILNQTLENFELILVDDGSPDNSGKICDELALNDNRIKVIHKENGGASTARNAGLDIAQGEFIAFVDSDDWIEPNMFETLF-NLAKEHNADISQCNYIKVENEDEKII----NDDKEIIISFNNIESLNNLYNEMYVSTVVLWNKIYKKSLF--NKIRFPN-MRIFEDE--AIMYKLLFESKKLVYTNKKLYYYR--NTPDSIMNAKFDKKRLCMLDVFDEKVEFMSKLNTEHLYAKTLKW 266
>gi|170692096|ref|ZP_02883260.1| glycosyl transferase family 2 [Burkholderia graminis C4D1M] >gi|170143380|gb|EDT11544.1| glycosyl transferase family 2 [Burkholderia graminis C4D1M] (723 aa)
Score = 136, Expect = 1.6e-06, Identities = 34/93 (36%), Positives = 56/93 (60%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGV------GKI---RDYGVTLANGEYIWFVDSDDWLY 95
           KVS+++P  NTP KW+++ + S+ +Q  +N+E+   DD ST P+V + L +     YV   P  + V      G I    +  + LA GE++  +D DD L+
  S:   183 KVSIVMPTYNTPEKWLRKALDSVVDQVYENWEICIADDCSTKPEVRMVLDS-----YVAKYPGQVKVAYRTTNGHISASSNTALELATGEFVGLLDHDDELH 279
>gi|153854320|ref|ZP_01995619.1| hypothetical protein DORLON_01614 [Dorea longicatena DSM 13814] >gi|149753095|gb|EDM63026.1| hypothetical protein DORLON_01614 [Dorea longicatena DSM 13814] (313 aa)
Score = 136, Expect = 1.6e-06, Identities = 33/103 (32%), Positives = 62/103 (60%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKS 105
           K+SVI+P  N    ++++ + S+  QT KN EV  +DD ST+   ++ D + K  Y+       N G+   R+ G+ ++ G+Y+ F+DSDD+L   A++ ++++
  S:     5 KISVIVPVFNVE-NYLEKCVKSIIEQTYKNLEVILVDDGSTDKSGFLCDELKKQDYRIKVIHKTNGGLSDARNAGIQVSTGKYLSFIDSDDYLERTALEQMMQA 107
>gi|149372430|ref|ZP_01891618.1| hypothetical protein SCB49_01472 [unidentified eubacterium SCB49] >gi|149354820|gb|EDM43383.1| hypothetical protein SCB49_01472 [unidentified eubacterium SCB49] (315 aa)
Score = 136, Expect = 1.6e-06, Identities = 40/120 (33%), Positives = 65/120 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE 120
           M K+SVIIP  N   K I + I SL  QT K+FEV  ++D ST+  +       +   Y+ +  N  GV K R++ VT A  E++ F+D+DD+ + + ++ LL +   +   ++    YE
  S:     1 MSKISVIIPLYNKE-KDIAKTIDSLLKQTVKDFEVIIVNDGSTDGSLEAVKKYADDRFYIYDNQNQ-GVAKTRNFAVTKATTEFVAFLDADDYWHPNHLEMLLNAVALFPEANWYATAYE 118
>gi|149372908|ref|ZP_01891905.1| glycosyltransferase [unidentified eubacterium SCB49] >gi|149354401|gb|EDM42967.1| glycosyltransferase [unidentified eubacterium SCB49] (310 aa)
Score = 136, Expect = 1.7e-06, Identities = 38/113 (33%), Positives = 60/113 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           KVSVIIP+ N P K + + I S+  Q++ N E+  IDD S      +D        Y +N   N+G G  R+ G  LA G++I F+D DD+ +   ++  L  F + ++I  +
  S:     2 KVSVIIPYYNRPKK-LARCIASVQKQSHTNLEIIVIDDCSQQAPTSLD----PSIVYKKN-ETNLGPGLSRNEGKALATGQFITFLDCDDYWHPTFLEKALACFLEQKHIAMV 108
>gi|121592422|gb|ABM63331.1| putative glycosyltransferase [Campylobacter jejuni] (269 aa)
Score = 136, Expect = 1.7e-06, Identities = 56/211 (26%), Positives = 107/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|55823030|ref|YP_141471.1| exopolysaccharide biosynthesis protein, sugar transferase [Streptococcus thermophilus CNRZ1066] >gi|33313717|gb|AAQ04245.1|AF430847_8 putative glycosyltransferase EpsI [Streptococcus thermophilus] >gi|1276882|gb|AAC44016.1| EpsI >gi|22218122|gb|AAM94574.1| putative glycosyltransferase EpsI [Streptococcus thermophilus] >gi|22316052|gb|AAL32502.1| putative glycosyltransferase CpsI [Streptococcus thermophilus] >gi|55739015|gb|AAV62656.1| exopolysaccharide biosynthesis protein, sugar transferase [Streptococcus thermophilus CNRZ1066] >gi|90655822|gb|ABD96528.1| EpsI [Streptococcus thermophilus] >gi|1588813|prf||2209356K epsi gene (324 aa)
Score = 136, Expect = 1.7e-06, Identities = 34/100 (34%), Positives = 61/100 (61%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLL 103
           +S++IP  N   K++++ + S+ NQT  NFEV  ++D ST+  + I    +N++    V +  N  G+   R++G+  A G +I FVDSDD++  D + +L+
  S:     7 ISIVIPVYNVE-KYLEKCLQSVQNQTYNNFEVILVNDGSTDSSLSICEKFVNQDKRFSVFSKENG-GMSSARNFGIKKAKGSFITFVDSDDYIVKDYLSHLV 106
>gi|90961673|ref|YP_535589.1| glycosyltransferase [Lactobacillus salivarius UCC118] >gi|90820867|gb|ABD99506.1| Glycosyltransferase [Lactobacillus salivarius UCC118] (315 aa)
Score = 136, Expect = 1.7e-06, Identities = 47/146 (32%), Positives = 78/146 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF-DKKQINLFSKHNQFDEIIVKNNV 146
           M K+S+I+P  N   K++K+ + SL NQT ++ E+  +DD ST+    I    K  Y  V  +   N G+   R++G+  A+GEYI F+DSDD++     + +  +  +      I   + W F DK   ++  K+N  +E +VK  V
  S:     1 MTKISIIVPIYNVE-KYLKRSLDSLVNQTLEDIEIILVDDGSTDNSHKIAEDYKENYSNVLLVTKENGGLSDARNFGLQYASGEYIAFIDSDDYVESQMFERMY-NLSENGRKKIIESNFLWEFPDKNVKDVVKKYNSLNEYLVKGRV 146
>gi|34539983|ref|NP_904462.1| glycosyl transferase, group 2 family protein [Porphyromonas gingivalis W83] >gi|34396294|gb|AAQ65361.1| glycosyl transferase, group 2 family protein [Porphyromonas gingivalis W83] (351 aa)
Score = 136, Expect = 1.8e-06, Identities = 37/116 (31%), Positives = 67/116 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           VS+IIP  N   K++ + + S+ +Q   ++E+  +DD ST+    I  +L  ++G+  V + PN  G G  R+ G+  A G+YIWF+DSDD++   ++  ++    +  + D + F Y
  S:    16 VSIIIPVYNVE-KYLYRCVKSILSQDYYDYEIILVDDGSTDGSGMICDELTEQHGHISVIHKPNG-GQGSARNAGLNHAKGKYIWFIDSDDYISPHSLSVIMSQITQ-GDFDALFFPY 130
>gi|153854317|ref|ZP_01995616.1| hypothetical protein DORLON_01611 [Dorea longicatena DSM 13814] >gi|149753092|gb|EDM63023.1| hypothetical protein DORLON_01611 [Dorea longicatena DSM 13814] (329 aa)
Score = 136, Expect = 1.8e-06, Identities = 49/134 (36%), Positives = 71/134 (52%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP---NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN 135
           +K+S+IIP  N   K+IK+   S+  QT  N EV  +DD S++    I  I K   +  + IP    N GV   R  GV  + GE+I FVD DD +  D  + LL +  +Y N D     Y+ +F+  ++N F  HN
  S:     3 EKISIIIPVYNLE-KYIKRTAESVLKQTYTNIEVIIVDDGSSDESWKI--IQKIADKDNRVIPIHQENGGVTSARLKGVRRSTGEWIGFVDGDDEIESDMYEILLNNAKRY-NADISHCGYQMIFEDGRVNYF--HN 133
>gi|125625105|ref|YP_001033588.1| glycosyl transferase family protein [Lactococcus lactis subsp. cremoris MG1363] >gi|124493913|emb|CAL98908.1| glycosyltransferase family 2 protein [Lactococcus lactis subsp. cremoris MG1363] (187 aa)
Score = 136, Expect = 1.8e-06, Identities = 49/161 (30%), Positives = 90/161 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS--TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ----NIDFIMFEYEWVFDKKQI---------NLFSKHNQFDEIIVKNNVNKSKMPW--FHNNYQTD 161
           M KVSVI+P  N   K +++ + S+ NQ+ ++FE+  IDD S  ++ Q+  +   K+    V +IPN  G    R+ G+    G YI F+DSDD++ +D ++ L +   +Y+    +  +I +  E   + K+I         +  + H+   + + K   +    PW  + N Y+T+
  S:     1 MPKVSVIVPVYNVE-KLLERCLNSVLNQSFQDFELLLIDDGSKDSSGQICDNYAKKDQRVRVWHIPNG-GQSAARNLGIDNVYGTYIAFIDSDDFVELDYLEQLYQPMVEYEADVVSCRYIAYSKERDEEVKKIIQENQAKVYHFRTNHDVMQDFLEKEFKDDRNFPWESYANLYKTE 176
>gi|148549132|ref|YP_001269234.1| glycosyl transferase family protein [Pseudomonas putida F1] >gi|148513190|gb|ABQ80050.1| glycosyl transferase, family 2 [Pseudomonas putida F1] (1509 aa)
Score = 136, Expect = 1.8e-06, Identities = 45/175 (25%), Positives = 84/175 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIG-VGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISH 178
           +S+I+P  N P+  +++ I S+  Q  KN+E+   DD ST+P+V  Y+  + K   ++   +    G + K  +  + LA+G Y+  +D+DD L   A+ ++ ++ ++  +   I                  ++  D+I V+ N      P+F    +TDW +     F   N ISH
  S:   973 ISIIMPVYNPPMDLLREAIDSVTAQLYKNWELCIADDASTDPEVIAYLKGLTKQDQRFKVVLREKNGHISKASNSALELASGRYVALMDNDDLLPAHALYWIARAVHENPDAAVI------------------YSDEDKIDVEGN---RSAPYF----KTDWNLYL---FRSHNMISH 1122
>gi|53711775|ref|YP_097767.1| glycosyltransferase [Bacteroides fragilis YCH46] >gi|52214640|dbj|BAD47233.1| glycosyltransferase [Bacteroides fragilis YCH46] (337 aa)
Score = 136, Expect = 1.8e-06, Identities = 43/105 (40%), Positives = 64/105 (60%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ-----YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL---YVDAIDYLLKS 105
           M + SVIIP  N P + + +L+ SL  Q  K+FEV  ++D S+ P   I     N YQ     +  N PN+ G G+ R+YG   +NGEY+  +DSD  L   Y+DA++  L++
  S:     8 MMRYSVIIPVYNRPDE-VDELLQSLTAQHFKDFEVVVVEDGSSVPCEKI----VNQYQGKLDIHYYNKPNS-GPGQTRNYGAERSNGEYLIILDSDCILPEGYLDAVEKELQT 114
>gi|167767625|ref|ZP_02439678.1| hypothetical protein CLOSS21_02158 [Clostridium sp. SS2/1] >gi|167710642|gb|EDS21221.1| hypothetical protein CLOSS21_02158 [Clostridium sp. SS2/1] (358 aa)
Score = 136, Expect = 1.8e-06, Identities = 69/250 (27%), Positives = 127/250 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP----NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHN------NYQTD--WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNWYF 253
           ++VIIP  N   ++I++ + SL +QT K  E+  +DD S +    I     + Y+ ++N+      N G    R+ G+  A+G+Y+ FVDSDD++  DA + ++ +  K+   D + F + ++ +  +       N  ++++ K  +    +P   N      N+  D  W   +KKE + + +I   ++ N +ED  F  + + L            FYN ++V+ SL + +Y A  L  I+   KNY L  +LF   + F
  S:     6 ITVIIPVYNAE-QYIERAVKSLLDQTTKEIEIILVDDGSKDASGKI----CDKYKQLENVKVIHKENGGACTARNIGLANASGKYVSFVDSDDFMDTDAYEKII-NILKHNEADILDFGWRYISETGEKTENFHKNPKNKLLNKKYIKTQILPPLLNLLEDRANFVFDFAWNKIYKKEIIDQYQIKFDERRNTWEDRIF--VVEFLRYCDNYYCMDECFYNYVSVQESL-SRRYNAQYLELIL---KNYNLYVQLFGKEYDF 255
>gi|29346763|ref|NP_810266.1| glycosyltransferase [Bacteroides thetaiotaomicron VPI-5482] >gi|29338660|gb|AAO76460.1| glycoside transferase family 2 [Bacteroides thetaiotaomicron VPI-5482] (345 aa)
Score = 136, Expect = 1.9e-06, Identities = 59/216 (27%), Positives = 105/216 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESS 219
           VSVI+P  N   K+++Q + SL +QT +N E+  ++D S +  + I  +   K+    V ++  N+  G  R+ G+  A   YI FVDSDDW+ VD  + L        + D +  +Y     +  I  + K+ +    ++K   NK     F     +     ++K     N+I  P+++  +ED     +  +L  K +  ++ LY+Y RLN +S+
  S:     8 VSVIVPVYNVE-KYLRQCLDSLISQTLQNIEIICVNDASPDNSLAILKEYEAKDKRIVVVDLYENMRQGGARNRGIEYARANYIAFVDSDDWVSVDIYEKLFACAL-MNDADIVNCDYYEYRGEDNIKKYIKYKELTFNMLKEIANKE----FILRLPSPCHNLYRKAIFSDNEIRFPEQI-FWEDAAIMSLIFLLADKIVKVNEPLYYY-RLNNDST 217
>gi|60680008|ref|YP_210152.1| putative glycosyltransferase [Bacteroides fragilis NCTC 9343] >gi|60491442|emb|CAH06192.1| putative glycosyltransferase [Bacteroides fragilis NCTC 9343] (342 aa)
Score = 136, Expect = 1.9e-06, Identities = 43/105 (40%), Positives = 64/105 (60%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ-----YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL---YVDAIDYLLKS 105
           M + SVIIP  N P + + +L+ SL  Q  K+FEV  ++D S+ P   I     N YQ     +  N PN+ G G+ R+YG   +NGEY+  +DSD  L   Y+DA++  L++
  S:    13 MMRYSVIIPVYNRPDE-VDELLQSLTAQHFKDFEVVVVEDGSSVPCEKI----VNQYQGKLDIHYYNKPNS-GPGQTRNYGAERSNGEYLIILDSDCILPEGYLDAVEKELQT 119
>gi|167764108|ref|ZP_02436235.1| hypothetical protein BACSTE_02491 [Bacteroides stercoris ATCC 43183] >gi|167698224|gb|EDS14803.1| hypothetical protein BACSTE_02491 [Bacteroides stercoris ATCC 43183] (301 aa)
Score = 136, Expect = 2.0e-06, Identities = 38/105 (36%), Positives = 59/105 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKS 105
           M KVS++IP  N    ++   I SL  Q+ ++FE+  +DD ST+    +  +L  K+    V ++ N  G    R  GV LA GE++ FVDSDD +  DA+  L ++
  S:     1 MVKVSIVIPVYNRK-NFLTVCIKSLLAQSFEDFEICLVDDGSTDGTGLLCDELAEKDTRIRVLHVQNG-GAAYARQKGVELATGEWVVFVDSDDTMPADALQRLFQA 105
>gi|163816808|ref|ZP_02208171.1| hypothetical protein COPEUT_02998 [Coprococcus eutactus ATCC 27759] >gi|158448065|gb|EDP25060.1| hypothetical protein COPEUT_02998 [Coprococcus eutactus ATCC 27759] (318 aa)
Score = 135, Expect = 2.1e-06, Identities = 58/188 (30%), Positives = 91/188 (48%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI--PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMP---WFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYF 190
           KV++IIP  N     I + I SL  QT  ++    I+D ST+    I +  KN Y     +    NIG  + R++ V +A G+Y+ FVD+DD+L  D +   +K   K         +Y+ V     I  F + +       K N+ K  +P   W   ++   W   FK++FL+ N I   + ++I ED YF
  S:     5 KVTIIIPVYNGA-DTISRTIDSLIAQTYDDWIALVINDGSTDGTNDILMQYKNRYPSKIKVVCQKNIGQAETRNHAVKMATGKYVMFVDADDYLDPDYVGTYVKEAEKG--------DYDCV-----IGGFRREDN------KGNIIKKFVPSSRWLMYSHMVPWARIFKRQFLLDNDIEFLN-ISIGEDSYF 176
>gi|150019440|ref|YP_001311694.1| glycosyl transferase family protein [Clostridium beijerinckii NCIMB 8052] >gi|149905905|gb|ABR36738.1| glycosyl transferase, family 2 [Clostridium beijerinckii NCIMB 8052] (327 aa)
Score = 135, Expect = 2.1e-06, Identities = 38/94 (40%), Positives = 55/94 (58%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M KVS+I P  N   + I++ I S+ NQT K+FE+  IDD S +  + I   L+  +   Y      N GV   R+ G+  A+GEYI F+DSDD++
  S:     1 MVKVSIITPVYNVE-ECIERSIKSVMNQTCKDFELLLIDDGSKDKSIDIARGLLENSSINYKIITQKNSGVSAARNRGIKEASGEYITFLDSDDYI 95
>gi|167412350|gb|ABZ79812.1| putative glycosyltransferase [Campylobacter jejuni] (301 aa)
Score = 135, Expect = 2.2e-06, Identities = 56/211 (26%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:    29 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQR----HFCWSV-WAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKICIYHY 236
>gi|167768499|ref|ZP_02440552.1| hypothetical protein CLOSS21_03058 [Clostridium sp. SS2/1] >gi|167710023|gb|EDS20602.1| hypothetical protein CLOSS21_03058 [Clostridium sp. SS2/1] (1145 aa)
Score = 135, Expect = 2.2e-06, Identities = 57/186 (30%), Positives = 101/186 (54%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK-----NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQ-----TDWRVCFKKEFLVKNKISHPDKVNIFEDV 188
           KVSVIIP  N   +++++ + S+ +QT ++ +V  IDD S +     D+  K     + ++YV+ +  N G+G  R+ GV  A G+YI F+DSDD +  DA + +  +  K  N   ++      FD K+ ++ + H    EI  +  ++K+ M    +N       T W     KEF  +N    P+++ ++ED+
  S:     5 KVSVIIPIYNVE-EYLEECLQSVVDQTLEDLQVIMIDDGSLDGST--DIAKKFASRYDHFEYVRQV--NGGLGNARNTGVKYAKGKYIIFLDSDDIVPDDAYEKMYLAAEK--NHSEMVVGSVARFDSKKDHISNLH----EIAFRKYIDKTHMT---DNTDLIYDTTSWNKLILKEFWDRNHFEFPERI-LYEDI 185
>gi|153815270|ref|ZP_01967938.1| hypothetical protein RUMTOR_01504 [Ruminococcus torques ATCC 27756] >gi|145847332|gb|EDK24250.1| hypothetical protein RUMTOR_01504 [Ruminococcus torques ATCC 27756] (335 aa)
Score = 135, Expect = 2.2e-06, Identities = 41/116 (35%), Positives = 66/116 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID----LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           +S+I+PF N P    ++ + SL +QT  N E+  IDD ST+    I      I+K   + V     N GV   R+ G+ +A+G+Y  F+DSDD+L +D  +YLL      + +D + +E+
  S:    22 ISIIVPFYN-PGGNFRRCLDSLIHQTYGNLEIILIDDGSTDGSYEIAKEYAQIDK---RVVLEKQKNSGVSHARNRGIQIAHGDYFSFIDSDDYLDLDTYEYLL-GILNEKKVDVVNYEH 136
>gi|150006447|ref|YP_001301191.1| glycosyl transferase family protein [Bacteroides vulgatus ATCC 8482] >gi|149934871|gb|ABR41569.1| glycosyltransferase family 2 [Bacteroides vulgatus ATCC 8482] (315 aa)
Score = 135, Expect = 2.2e-06, Identities = 43/104 (41%), Positives = 56/104 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           M  VSVIIP  NT  K++   I S+ NQT  + EV  ++D ST+    I        Q +Q I   N GV   R+ G+  A GEYI F+DSDDW+  D I  L +
  S:     1 MPLVSVIIPIYNTE-KFLPLCINSVLNQTLTDIEVLLVNDGSTDGSGKICDEYACKDQRIQVIHTLNQGVSHARNQGLETAKGEYIAFMDSDDWIETDMIATLYQ 104
>gi|68643341|emb|CAI33607.1| putative glycosyl transferase [Streptococcus pneumoniae] (348 aa)
Score = 135, Expect = 2.3e-06, Identities = 64/238 (26%), Positives = 115/238 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKM--------PWFHNNYQ---TDWRVCFKKE-FLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNK 238
           M   SV++P  N    ++ Q + +L NQ+ K+FE+  ++D ST+    + +   K  ++       N G+G  R+ G+    G+YI FVDSDD++  + ++ +  ++ +  N D I  E  +  D K   +       D I  KN+   +++        P F  + +   + W+  +K+  F  K  + H ++  I ED  F +    L   AL+    LY+Y R N  S    YK    +L  I++  +
  S:     1 MPTFSVVVPVYNVE-NYLSQCLNALVNQSFKDFELILVNDGSTDTSGSLCEEWGKKDHRIKVIHKTNEGLGFARNTGIENCTGDYIVFVDSDDYVSYEMLE-IYDTYLQRFNADVIYSENFYRVDNKGNIIEPLDQSLDSIFYKNDSIFTELLPDVISSPPEFIGDGKIGVSVWKGVYKRSLFKDKGLLFHSEREFISEDAIFQIDCLKLAISALVIPDILYYY-RENFGSLSMKYKEDRFELNKILYNEQ 248
>gi|134094369|ref|YP_001099444.1| putative glycosyltransferase [Herminiimonas arsenicoxydans] >gi|133738272|emb|CAL61317.1| putative Glycosyl transferase, family 2 [Herminiimonas arsenicoxydans] (303 aa)
Score = 135, Expect = 2.3e-06, Identities = 39/142 (27%), Positives = 75/142 (52%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLF---SKHNQFDEIIVKNN 145
           V+V+IP  N    ++++ + SL  Q+  N+E   +++ S +  + +     +    ++N  NN  +   R+ G+ LA G+YI F+DSDD  Y + +   ++SF    N+D +     W F  ++ N+F   ++   FD ++ K N
  S:     7 VTVVIPTYNHA-HFLREALQSLCAQSFSNWEAIVVNNYSEDDTIAVVASFSDPRIRLENFRNNGVIASSRNRGIALAQGQYIAFLDSDDIWYPEKLTQCMQSF--DDNVDLVCHGLYW-FGNEERNMFCGPAQRATFDALLDKGN 147
>gi|52081982|ref|YP_080773.1| putative capsular polysaccharide biosynthesis protein,glycosyl transferase family 2, YveT [Bacillus licheniformis ATCC 14580] >gi|52787369|ref|YP_093198.1| YveT [Bacillus licheniformis ATCC 14580] >gi|52005193|gb|AAU25135.1| putative capsular polysaccharide biosynthesis protein,Glycosyl Transferase Family 2, YveT [Bacillus licheniformis ATCC 14580] >gi|52349871|gb|AAU42505.1| YveT [Bacillus licheniformis DSM 13] (339 aa)
Score = 135, Expect = 2.3e-06, Identities = 59/231 (25%), Positives = 102/231 (44%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN--RLNVESSLNTYKYKANDLVSII 234
           +S+I+P  N    +I++ + SL  QT KN E+  +DD S +    I     +    V+ I   N G+   R+ G+  A G+Y+ FVD DD++ + A+   + +  K  ++D +M  Y             KH+  ++             +F     TD R+    +   + K +H       E  +   +W+ LY++ LL   +LYF+   R   +S  N Y + A   V  I
  S:     5 ISIIVPMYNVE-DYIEECVDSLRRQTLKNIEIILVDDGSPDRSGEIARTYCSLDARVKVIHKKNGGLSSARNAGLQAATGDYVGFVDGDDFV-LPAMFENMYAAAKKDDLDIVMCGYH------------KHSDTED------------AYFPPPLPTD-RLLLSWDIKRELKKAH-------ETRFIWYVWRNLYRRDLLKKNQLYFFEDIRFAEDSPFNLYAFYAAKRVRAI 204
>gi|163781790|ref|ZP_02176790.1| hypothetical protein HG1285_02868 [Hydrogenivirga sp. 128-5-R1-1] >gi|159883010|gb|EDP76514.1| hypothetical protein HG1285_02868 [Hydrogenivirga sp. 128-5-R1-1] (291 aa)
Score = 135, Expect = 2.4e-06, Identities = 57/186 (30%), Positives = 101/186 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS---TNPQVYI---DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQ----FDEIIVKNNVN--------KSKMPWFHNNY--QTDWRVCFKKEFL--VKNKISHPDKVNIFE 186
           M +VSV+IP  N   ++IK+ +  + NQT K+ EV  +DD S   T   VY    +LI +   +Y++N   N+     R+ G   ++GEY++F+D DD    + I+ +LK+F  Y     +++ +   F      +F +  +     +E I   N+         +   P ++ N+  + DW + F + +L  +K +I   D V I E
  S:     1 MAEVSVVIPVYNGE-RYIKESVGCVLNQTFKDVEVIVVDDASRDRTQDVVYENFGELIGEGKIKYMRN-ERNMERAFSRNVGFENSSGEYVFFLDHDDLWKENHIEEVLKAFPGYD----VVYSFPRSFIDDGSQVFRRSGKRIKPLEETIFSGNIGYPSASAFRRESFPGYNGNFIMREDWEI-FIRSYLEGLKIRIVDSDTVLIRE 201
>gi|15792471|ref|NP_282294.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|88596294|ref|ZP_01099531.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 84-25] >gi|15150374|gb|AAK85424.1|AF400047_13 putative glycosyltransferase [Campylobacter jejuni] >gi|14993929|gb|AAK73188.1| putative glycosyltransferase [Campylobacter jejuni] >gi|88191135|gb|EAQ95107.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 84-25] >gi|112360465|emb|CAL35262.1| putative glucosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] (274 aa)
Score = 135, Expect = 2.4e-06, Identities = 71/247 (28%), Positives = 123/247 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYF--------YNRLNVESSLNTY--KYKANDLVSIIFKN-KNYLLENKLF 247
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA    LK   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y         Y   N E     Y  K K+N+LV  +  N KN     KLF
  S:     1 MPQLSIIIPLFNS-CNFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACKIALKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEFFNQKEFLEFLSKQRHFCW------SVWAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHYEFNPNGRYENKNKEILWQNYQDKKKSNELVKKLCLNFKNNDFHKKLF 255
>gi|62868795|gb|AAY17583.1| putative glycosyltransferase [Campylobacter jejuni] >gi|108514884|gb|ABF93235.1| putative glycosyltransferase [Campylobacter jejuni] (272 aa)
Score = 135, Expect = 2.5e-06, Identities = 58/211 (27%), Positives = 108/211 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFID----DNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  ID    DNS N  + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDNKSKDNSLN--MVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|21221427|ref|NP_627206.1| glycosyl transferase [Streptomyces coelicolor A3(2)] >gi|7546673|emb|CAB87333.1| putative glycosyl transferase [Streptomyces coelicolor A3(2)] (745 aa)
Score = 135, Expect = 2.6e-06, Identities = 36/119 (30%), Positives = 68/119 (57%)
  Q:     1 MKKVSVIIP-FKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           M + SVI+P FK     +++Q + S+ +Q+ ++ EV  +DD S +    I  +   ++    V ++  N G+G+ R+ G+ LA G+Y++F+DSDD L   A+  +     +    D ++F+Y
  S:     1 MPRFSVIVPCFKVQ--GFLRQCLDSVLDQSFRDIEVIAVDDCSPDGSGAILDEYAARDDRVRVLHLEENAGLGRARNAGLPLATGDYLFFLDSDDTLTPGALRAMADRLAETDGPDVLVFDY 120
>gi|85708052|ref|ZP_01039118.1| glucosyltransferase [Erythrobacter sp. NAP1] >gi|85689586|gb|EAQ29589.1| glucosyltransferase [Erythrobacter sp. NAP1] (310 aa)
Score = 135, Expect = 2.6e-06, Identities = 33/90 (36%), Positives = 55/90 (61%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           K SV+IP  N     ++  + S+  QT+++FE+  +DD S++  +   +DL  K+    + + PN+ GV   R+YG +LA GE I F+D+DD
  S:     6 KFSVVIPAYNAGAT-LRSTVVSVLAQTDQDFEIVVVDDGSSDGTLNAMLDLAVKDERIRIVSQPNS-GVSATRNYGASLAKGELIAFLDADD 95
>gi|157693828|ref|YP_001488290.1| glycosyltransferase [Bacillus pumilus SAFR-032] >gi|157682586|gb|ABV63730.1| glycosyltransferase [Bacillus pumilus SAFR-032] (340 aa)
Score = 135, Expect = 2.6e-06, Identities = 53/224 (23%), Positives = 107/224 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQ-VYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKM--PWFHNNYQT-DWRVCFKKEFLVKNKISHP--DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK 224
           M  +S+++   NT  ++++Q + S+ +Q+  + EV  ++D ST+    Y++       ++      N G+G +R+ G+  A G YI F+DSDD L     + L +   K    D ++ EY   F++      SK      ++ + +  K+ +     H +     W   +++ F+ ++ I  P   ++   ED Y  L    L +      + LY+Y R+++ S +  Y+
  S:     1 MPAISLLVAVYNTS-QYLEQCLQSIVDQSFSDIEVILVNDGSTDRSGEYLEAFAAQDQRFRVIHQTNQGLGAVRNRGIEEAKGTYIAFIDSDDVLAPHYCEALYEK-AKMTGADLVISEYWIQFEQ------SKRTIPTTLLAERSAEKTSLIEALLHGDITGFSWNKLYRRAFIEEHDIRFPLRGELENIEDQYVTLRCFSLSRGIAFVHEPLYYY-RVHLSSIVQRYQ 221
>gi|153195886|ref|ZP_01940294.1| hypothetical protein LMRG_00552 [Listeria monocytogenes 10403S] >gi|127634168|gb|EBA23554.1| hypothetical protein LMRG_00552 [Listeria monocytogenes 10403S] (327 aa)
Score = 135, Expect = 2.6e-06, Identities = 41/114 (35%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   K++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + I+  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-KYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLIETCLDTVQK-TNADLVLF 115
>gi|194015156|ref|ZP_03053772.1| glycosyltransferase [Bacillus pumilus ATCC 7061] >gi|194012560|gb|EDW22126.1| glycosyltransferase [Bacillus pumilus ATCC 7061] (340 aa)
Score = 135, Expect = 2.7e-06, Identities = 54/224 (24%), Positives = 110/224 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQ-VYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL---YVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ----INLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHP--DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK 224
           M  +S+++   NT  ++++Q + S+ +Q+  + EV  ++D ST+    Y++       ++      N G+G +R+ G+  A G YI F+DSDD L   Y +A    L    +    D ++ EY   F++ +      L ++ +    I+++  ++   M  F       W   +++ F+ ++ I  P   ++   ED Y  L    L +      + LY+Y R+++ S +  Y+
  S:     1 MPAISLLVAVYNTS-QYVEQCLQSIADQSFSDIEVILVNDGSTDHSGEYLEAFAAQDQRFRVIHQTNQGLGAVRNRGIEEAKGTYIAFIDSDDILAPHYCEA----LHEKAEMTGADLVISEYWIQFEQSKRTIPTTLLAERSAEKTILIEALLH-GDMTGF------SWNKLYRRAFIEEHDIRFPLRGELENIEDQYVTLRCFSLSRSIAFVHEPLYYY-RVHLSSIVQRYQ 221
>gi|148985684|ref|ZP_01818838.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP3-BS71] >gi|147922165|gb|EDK73287.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP3-BS71] (237 aa)
Score = 135, Expect = 2.7e-06, Identities = 63/230 (27%), Positives = 109/230 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC----FKKEFLVKNKI-----------------SHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI 233
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ +    +++S Y+                     L  +        V N     + P   N  Q D+ VC    F KE+L+  KI                 S P  + I+ED Y+      L KK ++ +K  Y+Y   +   S+ T  Y   DL  I
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDDRVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPE----MIQSLYE--------------------QLVQEDADVSSCGVMNVYANDESPQSAN--QDDYFVCDSQTFLKEYLIGEKIPGTICNKLIKRQIATALSFPKGL-IYEDAYYHFDLIKLAKKYVVNTKPYYYY--FHRGDSITTKPYAKKDLAYI 227
>gi|169834193|ref|YP_001695142.1| glycosyl transferase family protein [Streptococcus pneumoniae Hungary19A-6] >gi|168996695|gb|ACA37307.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae Hungary19A-6] (294 aa)
Score = 135, Expect = 2.7e-06, Identities = 64/223 (28%), Positives = 111/223 (49%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPW------FHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYK 226
           +SVI+P  N    +I   + SL+ Q  +NFEV  ++D ST+      + Y D  ++  + Y +    N GV   R++G+  + G+YI FVDSDDW+  + +  L+++  K Q+ + ++  Y    +     LF  H    +  VKN  +K  M        +  ++ T W + FK+E     ++  P    + ED+       +  +K    +K LY+Y R+  E   N+Y  K
  S:     5 ISVIVPVYNVE-PFISSCLDSLSKQIYQNFEVLLVNDGSTDNSGAICREYADRDSR--FHYFEK--ENAGVADARNFGIERSKGDYITFVDSDDWVTEEYLSILIETL-KEQHSEIVVSTYSTYNESD--GLFYIHVFDSDYYVKNYNSKLLMEELPLLERYDMSFLTSWGILFKRELF--QEVQFPFG-RVCEDIGTNYKLFMQVEKVTYINKVLYWY-RVGKEGLSNSYSPK 226
>gi|153854454|ref|ZP_01995732.1| hypothetical protein DORLON_01727 [Dorea longicatena DSM 13814] >gi|149752980|gb|EDM62911.1| hypothetical protein DORLON_01727 [Dorea longicatena DSM 13814] (352 aa)
Score = 135, Expect = 2.7e-06, Identities = 37/94 (39%), Positives = 53/94 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M+K+SVI+P  N   K++ + + S+  Q  KN EV  +DD STN    +     +  + +Q I   N GV   R+ G+  A GE+I FVD DDWL
  S:     1 MEKISVIVPIYNAEKKYLTECVDSIIGQDYKNIEVILVDDGSTNSSGEVCDGYADKDERIQVIHQKNQGVSVARNTGIDQATGEWIAFVDVDDWL 95
>gi|17228409|ref|NP_484957.1| hypothetical protein all0914 [Nostoc sp. PCC 7120] >gi|17130260|dbj|BAB72871.1| all0914 [Nostoc sp. PCC 7120] (337 aa)
Score = 134, Expect = 2.7e-06, Identities = 36/99 (36%), Positives = 55/99 (55%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAID 100
           KKVSVIIP  N   KWI++ I S   QT  + E+  IDD ST+    +++I   G + +       G    R+ G  L+ GEYI ++D+DD++  + I+
  S:    11 KKVSVIIPCFNAE-KWIREAIESCLTQTYADVEIIVIDDGSTDNS--LEIIKTFGNEIIWRSYPQQGGNHARNRGFELSQGEYIQYLDADDYILPEKIE 106
>gi|168204340|ref|ZP_02630345.1| beta-1,4-galactosyltransferase [Clostridium perfringens E str. JGS1987] >gi|170664112|gb|EDT16795.1| beta-1,4-galactosyltransferase [Clostridium perfringens E str. JGS1987] (342 aa)
Score = 134, Expect = 2.8e-06, Identities = 59/244 (24%), Positives = 114/244 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK-----------SFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLEN 244
           + KVSVI+P       ++ + I S+ NQ+ KN E+  +DD S +     IDL  K   +       N G+   R+YG+    G+Y+ FVDSDDWL  D +  L+K           S + Y   D+++++  +  +     + ++     E+++   V           +   ++    K+   K  +       +FEDV++         K ++  K +Y+Y R   +S ++TY  +  D++  + +   ++ +N
  S:     2 LPKVSVIVPIYKVQ-DYLNKCIDSIINQSYKNLEIILVDDGSPDRCGEIIDLYEKQDNRIKVFHKKNGGLSDARNYGMNFTTGDYVIFVDSDDWLSEDMVSNLIKTSLELNADIVQSGFYYAYEDYLLYDNRYYLENMNPVVLNREELMYELVINEKVKNFA-------WGKLYKSALIKDIFFKIGV-------LFEDVFWAHKVMNRVDKYVIIHKSMYYY-RQRKDSIVSTYTERNLDILKGLKERHEFIEKN 241
>gi|194397215|ref|YP_002038013.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae G54] >gi|194356882|gb|ACF55330.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae G54] (328 aa)
Score = 134, Expect = 2.9e-06, Identities = 65/237 (27%), Positives = 111/237 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC----FKKEFLVKNKI-----------------SHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNY 240
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ +    +++S Y+                     L  +        V N     + P   N  Q D+ VC    F KE+L+  KI                 S P  + I+ED Y+      L KK ++ +K  Y+Y   +   S+ T  Y   DL  I    K Y
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDARVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPE----MIQSLYE--------------------QLVQEDADVSSCGVMNVYANDESPQSAN--QDDYFVCDSQTFLKEYLIGEKIPGTICNKLIKRQIATDLSFPKGL-IYEDAYYHFDLIKLAKKYVVNTKPYYYY--FHRGDSITTKPYAEKDLAYIDIYQKFY 234
>gi|153166408|ref|ZP_01926994.1| hypothetical protein LMHG_02094 [Listeria monocytogenes FSL N1-017] >gi|133727605|gb|EBA29303.1| hypothetical protein LMHG_02094 [Listeria monocytogenes FSL N1-017] (623 aa)
Score = 134, Expect = 2.9e-06, Identities = 54/188 (28%), Positives = 99/188 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI----MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYF 190
           K+SV++P  NT L+ +K L+ S++ QT  +  +E+ F+DD ST    +   +         V+ I N+    + R+    +A GEYI ++D DD ++ +  + +  +F K  N+D +    +    W +  KQ   FS++N   E +    +    +P   + +       +K+EFL++N I+  D   + +EDVYF
  S:    20 KISVVVPTYNTELEGLKNLMASIDKQTMNSDEYELVFVDDGSTTDTYERLQEFAETRPNMTVKQIENSGWGSRPRNIATKMAKGEYILYLDHDDTVFPETFERVY-NFGKENNLDVVSGKEVRTNGWSWGWKQ---FSENNPHAEEMGIECL----LPMTPHKF-------YKREFLLENDITFDDGARVLWEDVYF 201
>gi|108514916|gb|ABF93254.1| putative glycosyltransferase [Campylobacter jejuni] (195 aa)
Score = 134, Expect = 3.0e-06, Identities = 56/192 (29%), Positives = 100/192 (52%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFID----DNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGL 192
           M ++S+IIP  N+   +I + + S  NQT K+ E+  ID    DNS N  + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F L
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDNKSKDNSLN--MVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFRKDIILKSFEKIKIDERLSYGEDVLFLL 189
>gi|168204344|ref|ZP_02630349.1| Cps5J protein [Clostridium perfringens E str. JGS1987] >gi|170664111|gb|EDT16794.1| Cps5J protein [Clostridium perfringens E str. JGS1987] (349 aa)
Score = 134, Expect = 3.1e-06, Identities = 61/232 (26%), Positives = 114/232 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQF--DEIIVKNNVNKSKMPWFHNNYQTDWRVC---FKKEFLVKNKISHPDKVNIF-EDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVS 232
           M K+SVI+P  N   K++ + I S+ NQT KNFE+  ++D S +  + I +   K   +       N G    R  GV ++  +YI F+DSDDW+  + ++ L+     Y   D I+F    V D   I      N++   +    + + +     + + +     +C   +K+E L +    + DK++   ED+++ L   +  KK  + ++ LY+Y      S+  +Y +  ND+++
  S:     1 MSKISVIVPLYNAE-KYLDKCINSILNQTFKNFELILVNDGSRDKSLEICNKYEKKDSRITVINKENEGSIIARRRGVEISKSQYITFIDSDDWIKANTLEILVNEI-NYSASDVIVFNMYKVLDSLGIIKRENDNRYFIKKYYKGDEIREELASAYLHGHSFPAGLCGKVYKREILCECG-KYLDKISFLGEDLFYNLEIFLKVKKVAMINEPLYYYRAGGNTSNYMSYLF--NDMIN 234
>gi|167453728|ref|ZP_02319951.1| hypothetical protein LmonocytoFSL_07543 [Listeria monocytogenes FSL J2-064] (623 aa)
Score = 134, Expect = 3.1e-06, Identities = 54/188 (28%), Positives = 99/188 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI----MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYF 190
           K+SV++P  NT L+ +K L+ S++ QT  +  +E+ F+DD ST    +   +         V+ I N+    + R+    +A GEYI ++D DD ++ +  + +  +F K  N+D +    +    W +  KQ   FS++N   E +    +    +P   + +       +K+EFL++N I+  D   + +EDVYF
  S:    20 KISVVVPTYNTELEGLKNLMASIDKQTMNSDEYELVFVDDGSTTDTYERLQEFAETRPNMTVKQIENSGWGSRPRNIATKMAKGEYILYLDHDDTVFPETFERVY-NFGKENNLDVVSGKEVRTNGWSWGWKQ---FSENNPHAEEMGIECL----LPMTPHKF-------YKREFLLENDITFDDGARVLWEDVYF 201
>gi|75759890|ref|ZP_00739963.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|167937711|ref|ZP_02524786.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus cereus AH1134] >gi|74492625|gb|EAO55768.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] (326 aa)
Score = 134, Expect = 3.2e-06, Identities = 39/105 (37%), Positives = 61/105 (58%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSV+IP  NT  K+I++ + S+ +QT KN E+  +DD S +  P +  +L  K   Q       N GV   R+ G+  A+GEY+ F+DSDD  +   I+  ++S +K
  S:     8 VSVVIPLYNTE-KYIEETMQSILDQTYKNIEIVIVDDGSKDQSPSIVKNLAEKYPGQVKYVHQKNQGVSVARNTGIENASGEYVAFLDSDDLWHPTKIEKQIESMHK 113
>gi|47094948|ref|ZP_00232561.1| glycosyltransferases [Listeria monocytogenes str. 1/2a F6854] >gi|153184731|ref|ZP_01935458.1| hypothetical protein LMOG_01370 [Listeria monocytogenes J0161] >gi|47016566|gb|EAL07486.1| glycosyltransferases [Listeria monocytogenes str. 1/2a F6854] >gi|126942702|gb|EBA20439.1| hypothetical protein LMOG_01370 [Listeria monocytogenes J0161] (327 aa)
Score = 134, Expect = 3.2e-06, Identities = 41/114 (35%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   K++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + I+  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-KYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLIETCLDTVQK-TNADLVLF 115
>gi|29348277|ref|NP_811780.1| putative glycosyltransferase yibD [Bacteroides thetaiotaomicron VPI-5482] >gi|29340180|gb|AAO77974.1| glycoside transferase family 2 [Bacteroides thetaiotaomicron VPI-5482] (332 aa)
Score = 134, Expect = 3.2e-06, Identities = 52/220 (23%), Positives = 96/220 (43%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQ--------NIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTY 223
           +SVIIP  N  +  +   + SL+ QT +N E+ F+DD ST+  +YI  +     Q+ +            N GV   R+  +  A G+YI++VD+DD +    ++ L+     ++ +D +  E+   F+        +      +     +    M W        W    ++   V+N I   + +N+ ED+   +   +   K  +  +  Y Y + N ES    Y
  S:     8 ISVIIPVYNASVT-LPHCLESLHKQTYRNLELLFVDDCSTDESLYI--LTSYAEQFAEIDFTIRILQHERNRGVAAARNTALKCATGDYIYYVDADDSIEPHTLECLVNEI-NHKGLDIVGHEWYLTFNSNA-RYMKQPAYTTSVEALRKMMGGVMRW------NLWLFLVRRSLYVENDIRFTEGLNMGEDMMVMMKLFICAGKVGIVHRPFYHYRQSNPESLTKIY 224
>gi|168493679|ref|ZP_02717822.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae CDC3059-06] >gi|183576467|gb|EDT96995.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae CDC3059-06] (294 aa)
Score = 134, Expect = 3.3e-06, Identities = 64/223 (28%), Positives = 111/223 (49%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPW------FHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYK 226
           +SVI+P  N    +I   + SL+ Q  +NFEV  ++D ST+      + Y D  ++  + Y +    N GV   R++G+  + G+YI FVDSDDW+  + +  L+++  K Q+ + ++  Y    +     LF  H    +  VKN  +K  M        +  ++ T W + FK+E     ++  P    + ED+       +  +K    +K LY+Y R+  E   N+Y  K
  S:     5 ISVIVPVYNVE-PFISSCLDSLSKQIYQNFEVLLVNDGSTDNSGAICREYADRDSR--FHYFEK--ENAGVADARNFGIERSKGDYITFVDSDDWVTEEYLSILIETL-KEQHSEIVVSTYSTYNESD--GLFYIHVFDSDYYVKNYNSKLLMEELPLLERYDMSFLTSWGILFKRELF--QEVQFPFG-RVCEDIGTNYKLFMQVEKVTYINKVLYWY-RVGKEGLSNSYSPK 226
>gi|166982619|ref|ZP_02254051.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus cereus AH187] >gi|168160996|ref|ZP_02596229.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus cereus H3081.97] (326 aa)
Score = 134, Expect = 3.3e-06, Identities = 42/110 (38%), Positives = 63/110 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNID 113
           VSV+IP  N   K+I++ + S+ +QT KN E+  +DD S +  P +  +L  K   Q       N GV   R+ G+  A+GEYI F+DSDD  +   I+  +KS +K  N+D
  S:     8 VSVVIPLYNAE-KYIEETMQSILDQTYKNIEIVIVDDGSKDQSPSIVKNLAEKYPGQVKYVHQKNQGVSVARNTGIENASGEYIAFLDSDDLWHPTKIEKQVKSIHK-NNMD 117
>gi|158521309|ref|YP_001529179.1| glycosyl transferase family protein [Desulfococcus oleovorans Hxd3] >gi|158510135|gb|ABW67102.1| glycosyl transferase family 2 [Desulfococcus oleovorans Hxd3] (343 aa)
Score = 134, Expect = 3.4e-06, Identities = 34/125 (27%), Positives = 73/125 (58%)
  Q:    17 WIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQIN--------LFSKHNQFDEII 141
           +I   ++S+ +QT  + E+  I+D + +  + I  +       ++ I   N G+   R+ G+  ANGEYI+F+DSDD+L + A++ L     + +N+D + F+ + VF+ +++          +S+   +D+++
  S:    19 YIADCLSSIVSQTLTDMEIICINDGTPDDSMAIVRVFAGRDDRIKIINKENGGLSDTRNVGIDNANGEYIYFIDSDDYLDIRALEMLYAKAVQ-ENLDIVYFDTKPVFETRELKERFRGCEAYYSRKKAYDDVV 151
>gi|168143883|ref|ZP_02587112.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus cereus G9842] (326 aa)
Score = 134, Expect = 3.5e-06, Identities = 39/105 (37%), Positives = 61/105 (58%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSV+IP  NT  K+I++ + S+ +QT KN E+  +DD S +  P +  +L  K   Q       N GV   R+ G+  A+GEY+ F+DSDD  +   I+  ++S +K
  S:     8 VSVVIPLYNTE-KYIEETMQSILDQTYKNIEIVIVDDGSKDQSPSIVKNLAEKYPGQVKYVHQKNQGVSVARNTGIENASGEYVAFLDSDDLWHPTKIEKQIESMHK 113
>gi|30023459|ref|NP_835090.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus cereus ATCC 14579] >gi|29899020|gb|AAP12291.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus cereus ATCC 14579] (326 aa)
Score = 134, Expect = 3.5e-06, Identities = 39/105 (37%), Positives = 61/105 (58%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSV+IP  NT  K+I++ + S+ +QT KN E+  +DD S +  P +  +L  K   Q       N GV   R+ G+  A+GEY+ F+DSDD  +   I+  ++S +K
  S:     8 VSVVIPLYNTE-KYIEETMQSILDQTYKNIEIVIVDDGSKDQSPSIVKNLAEKYPGQVKYVHQKNQGVSVARNTGIENASGEYVAFLDSDDLWHPTKIEKQIESMHK 113
>gi|196185207|gb|EDX80183.1| glycosyl transferase, group 2 family protein [Brevundimonas sp. BAL3] (606 aa)
Score = 133, Expect = 3.5e-06, Identities = 30/110 (27%), Positives = 56/110 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQ--VYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNID 113
           +SV++P   TP   ++  + SL +Q   NFE+  +DD    P   +   L+N +    +     N G+ +  + GV  A GE+I F+D DD L  +++   ++   ++  +D
  S:    85 LSVVVPLYKTPYPLLRACLASLLDQAYPNFELILVDDAPAAPTGPLAEKLVNGDDRVRIIQPEVNGGISRATNLGVAAARGEFILFIDHDDELVPESLLSFVEHIVRHPEVD 196
>gi|49477279|ref|YP_035803.1| glycosyl transferase, group 2 family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|196033616|ref|ZP_03101028.1| glycosyl transferase, group 2 family protein [Bacillus cereus W] >gi|49328835|gb|AAT59481.1| glycosyl transferase, group 2 family protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|195994050|gb|EDX58006.1| glycosyl transferase, group 2 family protein [Bacillus cereus W] (266 aa)
Score = 133, Expect = 3.6e-06, Identities = 35/91 (38%), Positives = 56/91 (61%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL 94
           VSVI P  N+ +++I + I S+ NQ+ +N+E+  +DD ST+  V    ++I  +    + ++  NIG  K R+  +  A G YI F+DSDD WL
  S:    14 VSVITPSYNS-IRFIGETIVSVQNQSYENWEMIIVDDASTDESVTKIKEIIEGDSRIRLVSLKENIGAAKARNIAIQEARGRYIAFLDSDDIWL 106
>gi|78779717|ref|YP_397829.1| hypothetical protein PMT9312_1333 [Prochlorococcus marinus str. MIT 9312] >gi|78713216|gb|ABB50393.1| hypothetical protein PMT9312_1333 [Prochlorococcus marinus str. MIT 9312] (292 aa)
Score = 133, Expect = 3.6e-06, Identities = 41/110 (37%), Positives = 62/110 (56%)
  Q:     5 SVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIP--NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDF 114
           S+IIP  N P + I +   S+  Q   N EV  IDD++ +    I D I  N    +++I      GV K R+ G+  + G  I F+DSDD L + A+D++ K+F KY+N+D 
  S:     6 SIIIPVFNRPFE-ILEAFESIKLQKKSNIEVLVIDDSNDDTSKNISDFIYLNSSIKIKHIKPTKRAGVSKSRNIGIISSIGNVILFLDSDDKLIIGALDHVEKAFIKYKNLDL 117
>gi|153174155|ref|ZP_01929717.1| hypothetical protein LMIG_02303 [Listeria monocytogenes FSL N3-165] >gi|133730524|gb|EBA32222.1| hypothetical protein LMIG_02303 [Listeria monocytogenes FSL N3-165] (327 aa)
Score = 133, Expect = 3.7e-06, Identities = 40/114 (35%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   K++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-KYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVETCLDTVQK-TNADLVLF 115
>gi|168265617|ref|ZP_02687582.1| glycosyl transferase, group 2 family protein [Listeria monocytogenes FSL J2-071] (324 aa)
Score = 133, Expect = 3.7e-06, Identities = 39/108 (36%), Positives = 64/108 (59%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           K+SVI+P  N  + +I + I+SL  QT K+ E+  +DD S++   +  ID  ++     V   PN  G G  R+ G+++A G+YI FVDSDD L   A++ + ++  + Q
  S:    15 KISVIVPVYNV-ISYIDETISSLLKQTLKDIEIILVDDGSSDGSFEKIIDYGDRFDNICVAKEPN-AGPGMARNNGLSIAKGKYISFVDSDDLLPERALEIMYEAAEREQ 122
>gi|120400334|gb|ABM21390.1| glycosyltransferase [Lactobacillus johnsonii] (340 aa)
Score = 133, Expect = 3.8e-06, Identities = 74/277 (26%), Positives = 135/277 (48%)
  Q:     6 VIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS-TNPQVYIDLINKNG-YQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY-EWVFDKKQINLFSKHNQFD-EIIVKNNVNKSKMPW--FHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKK-ALLTSKKLYFYNRLNVESSLNTYKYKANDL-VSIIFKNKNYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKTHNKFIG 282
           +IIP  N+   ++  +  ++++Q   NFEV  IDD+S  N +  +    KN  ++Y     N  GV   R+ G+  + G Y+ F+D DD +  D ++ +L +     NI   +  Y E   DK+    F     FD E ++   + ++  P     + +   WR   K++ ++ N I   +K++  ED  F +   +  ++ ++++ K +YFYNR    S++N  KY  ND+     F  + Y L NK  N+ +  Y   +L    ++    + N  +  NK +G
  S:     1 MIIPVHNSS-NFVDTIYNNISSQIYTNFEVLIIDDHSRDNTKEELKEKFKNAKFKYRILSSNGNGVSAARNMGIEKSQGRYVAFIDDDDEIVPDYLE-ILHNHVANDNIPIALGNYSEITQDKETPFKFKNAGIFDNEWVINKLIPQTIFPLEGEQSIWLPVWRTIIKRDIIISNNIKFDEKISQAEDFLFMIELLLKAERISIISGKSIYFYNRRQ-SSAMN--KYIENDIEKQKYFHKRFYELLNK--NDLYNLYRKRYLSNRVKMYSTLISNATRASNKKVG 278
>gi|196249425|ref|ZP_03148123.1| CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase [Geobacillus sp. G11MC16] >gi|196211182|gb|EDY05943.1| CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase [Geobacillus sp. G11MC16] (888 aa)
Score = 133, Expect = 4.0e-06, Identities = 66/259 (25%), Positives = 138/259 (53%)
  Q:     6 VIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE------YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFG-----------------LIWKVLYKKAL--LTSKKLYFYN---RLNVESSLNTYKYKANDLVSIIFKNKNYLLEN-KLFNNNWYFYASNWLGALNQ 264
           V+I + N    +I++ + SL+ QT ++ EV  ++D ST+   ++    ++        ++PNN G   + R+ G+  + G+YI F+D DDW   DA + ++ +  K    DF+  +      YE  + K   N++S        + + N+N  + P    +  +  ++ +K+ FL K+ +  P+ ++ +ED+ F                    W+V+   A+  +T+++L   N   RL     L+ +     D + +++KN  +L  + KL+ N++Y +  ++    +Q
  S:    15 VVIAYNNE--LYIEEALESLDEQTFEDMEVVVVNDASTDRTGEIIDRFVSTRPKFRAIHLPNNSGGCSVPRNTGIANSTGKYIMFLDGDDWYAKDACELMVNAI-KRTGSDFVSGQVVRTNTYEIWYHK---NIYS--------MERTNINIREFPELIFDSLSVNKI-YKRSFLEKHHLRFPEGIH-YEDIVFTGKAYFLANSISIIPKPIYYWRVVENAAVKSITNQRLEIRNLKYRLKAHQVLDQFLVNNGDAIYLMYKNNKFLRHDLKLYVNDYYKFDEDYKQHFHQ 289
>gi|149018045|ref|ZP_01834504.1| exopolysaccharide biosynthesis protein, sugar transferase [Streptococcus pneumoniae SP23-BS72] >gi|3320393|gb|AAC38751.1| galactosyl transferase [Streptococcus pneumoniae] >gi|3818489|gb|AAC69531.1| Cps23fH [Streptococcus pneumoniae] >gi|68643651|emb|CAI33863.1| putative glycosyl transferase [Streptococcus pneumoniae] >gi|147931609|gb|EDK82587.1| exopolysaccharide biosynthesis protein, sugar transferase [Streptococcus pneumoniae SP23-BS72] (323 aa)
Score = 133, Expect = 4.1e-06, Identities = 36/102 (35%), Positives = 58/102 (56%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLL 103
           K VS+I+P  N   ++IK  + S+  QT  N EV  ++D ST+  V Y + I K   ++      N G+   R+ G+  + G+Y+ FVDSDD++  D + YL+
  S:     3 KLVSIILPVYNVE-QYIKNCLESIQQQTYSNLEVIIVNDGSTDKSVEYCEQICKIDSRFSITHKENGGLSDARNVGIDKSKGDYLIFVDSDDFVSQDMVSYLV 104
>gi|15430488|gb|AAK96006.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 133, Expect = 4.1e-06, Identities = 57/211 (27%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  I+D S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CFKK+ ++K+  KI   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIINDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQR----HFCWSV-WTKCFKKDIILKSFEKIKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|110632849|ref|YP_673057.1| glycosyl transferase family protein [Mesorhizobium sp. BNC1] >gi|110283833|gb|ABG61892.1| glycosyl transferase, family 2 [Mesorhizobium sp. BNC1] (609 aa)
Score = 133, Expect = 4.1e-06, Identities = 39/120 (32%), Positives = 63/120 (52%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF 123
           VSVI+P  N     I   I SL  QT +N E+  +DD ST+  V I   L NK+    V  +  N G    R+ G+  A G+Y+   DSDDW + + +   +++ +  ++ D I+  Y +++
  S:   210 VSVIVPAYNAQYT-IATAIRSLQEQTWRNIEILVVDDCSTDETVSIVTKLANKDSRIQVLRMERNSGAYCARNLGLKNARGKYVTCHDSDDWSHPEKLQ--IQAEHLERHTDRIVANYSYLY 328
>gi|15901219|ref|NP_345823.1| glycosyl transferase family protein [Streptococcus pneumoniae TIGR4] >gi|111657800|ref|ZP_01408518.1| hypothetical protein SpneT_02001009 [Streptococcus pneumoniae TIGR4] >gi|168487363|ref|ZP_02711871.1| glycosyl transferase, family 2 [Streptococcus pneumoniae CDC1087-00] >gi|168491267|ref|ZP_02715410.1| glycosyl transferase, family 2 [Streptococcus pneumoniae CDC0288-04] >gi|168493267|ref|ZP_02717410.1| glycosyl transferase, family 2 [Streptococcus pneumoniae CDC3059-06] >gi|14972850|gb|AAK75463.1| glycosyl transferase, family 2 [Streptococcus pneumoniae TIGR4] >gi|183569762|gb|EDT90290.1| glycosyl transferase, family 2 [Streptococcus pneumoniae CDC1087-00] >gi|183574507|gb|EDT95035.1| glycosyl transferase, family 2 [Streptococcus pneumoniae CDC0288-04] >gi|183576606|gb|EDT97134.1| glycosyl transferase, family 2 [Streptococcus pneumoniae CDC3059-06] (328 aa)
Score = 133, Expect = 4.2e-06, Identities = 65/237 (27%), Positives = 111/237 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC----FKKEFLVKNKI-----------------SHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNY 240
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ +    +++S Y+                     L  +        V N     + P   N  Q D+ VC    F KE+L+  KI                 S P  + I+ED Y+      L KK ++ +K  Y+Y   +   S+ T  Y   DL  I    K Y
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDDRVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPE----MIQSLYE--------------------QLVQEDADVSSCGVMNVYANDESPQSAN--QDDYFVCDSQTFLKEYLIGEKIPGTICNKLIKRQIATALSFPKGL-IYEDAYYHFDLIKLAKKYVVNTKPYYYY--FHRGDSITTKPYAEKDLAYIDIYQKFY 234
>gi|104773384|ref|YP_618364.1| glycosyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422465|emb|CAI97018.1| Glycosyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (286 aa)
Score = 133, Expect = 4.2e-06, Identities = 34/117 (29%), Positives = 60/117 (51%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           K++VI+   N   K++ + +  L  Q N+ F++  IDD ST+    I    ++ +Q    +   N GV   R+ G+ + +  Y  F D DDW+  D  DY +K+F ++ + D +   Y
  S:    20 KLTVIMTVYNQE-KYLARALDCLLEQKNQQFKLLVIDDGSTDSTAEIAASYQDRFQAFDLVSKANEGVAAARNLGLDMVDTPYCIFHDGDDWVEPDYTDYFIKAFDRHPDDDMVTCGY 136
>gi|167412430|gb|ABZ79879.1| unknown [Campylobacter jejuni] (283 aa)
Score = 133, Expect = 4.4e-06, Identities = 67/224 (29%), Positives = 111/224 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK--KQINLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDW----RVCFKKEFLVK-NKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK 224
           M ++S+I+P  N   K+I + I S  NQT K+ E+  +DD  ++  + +        + ++ I N  N+G+ + R  GV  AN  YI F+D DD+L ++A + + K  Y  QN D + F Y  + D   K+I  F+  N   DE +      K    W   +    W    +V  K+++L    KI+   K+ + ED     ++ +  K  +   + L  YN  N+ SS N  K
  S:     1 MPEISIILPTYNVE-KYIARAIESCINQTFKDIEIIVVDDCGSDKSIDVAKEYAKKDERIKIIHNEKNLGLLRARYEGVKAANSLYIMFLDPDDYLELEACEEVSK--YLEQNNDLVCFNYN-ILDTTLKKIFFFTDSNYNIDEYL------KFLTKWIIGSKICHWNIWGKVLQKQKYLKTFEKINENPKLTMAEDALILTLYYLECKHIVTLEQCLINYNMQNISSSTNERK 224
>gi|166031263|ref|ZP_02234092.1| hypothetical protein DORFOR_00950 [Dorea formicigenerans ATCC 27755] >gi|166029110|gb|EDR47867.1| hypothetical protein DORFOR_00950 [Dorea formicigenerans ATCC 27755] (533 aa)
Score = 133, Expect = 4.4e-06, Identities = 31/99 (31%), Positives = 62/99 (62%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV------YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAI 99
           M   S+++P  NTP+ ++++++ S+ NQT + +++   + N  N +V      YI++  +   Q V N+P N+G+ +  +  +++A G+YI  +D DD L  DA+
  S:    61 MPLFSILVPVYNTPIPYLREMLDSVRNQTYQKWQLCIANANPENEEVARILNQYIEMDKR--IQTV-NVPENLGIAQNTNKALSIAKGDYIGLLDHDDMLAADAL 162
>gi|167627700|ref|YP_001678200.1| glycosyl transferase family protein [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597701|gb|ABZ87699.1| glycosyl transferase, family 2 [Francisella philomiragia subsp. philomiragia ATCC 25017] (319 aa)
Score = 133, Expect = 4.5e-06, Identities = 39/105 (37%), Positives = 63/105 (60%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKS 105
           M  VSVIIP  N   +++ + + S+ NQT KN E+  ++D S++  + I  D   K+    + N  NN G+   R+ G+ +  G+YI F+DSDDW+ +D ID L ++
  S:     1 MILVSVIIPIYNVE-QFLSRCLDSVINQTYKNLEIILVNDGSSDNSLEICEDYAKKDNRIKIVN-KNNGGLSSARNAGLDICKGKYISFIDSDDWVSLDYIDILYEN 105
>gi|167014417|ref|ZP_02276950.1| hypothetical protein LmonFS_06351 [Listeria monocytogenes FSL J1-194] (623 aa)
Score = 133, Expect = 4.5e-06, Identities = 54/188 (28%), Positives = 98/188 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI----MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYF 190
           K+SV++P  NT L+ +K L+ S++ QT  +  +E+ F+DD ST        +         V+ I N+    + R+    +A GEYI ++D DD ++ +  + +  +F K  N+D +    +    W +  KQ   FS++N   E +    +    +P   + +       +K+EFL++N I+  D   + +EDVYF
  S:    20 KISVVVPTYNTELEGLKNLMASIDKQTMNSDEYELVFVDDGSTTDTYDRLQEFAETRPNMTVKQIENSGWGSRPRNIATKMAKGEYILYLDHDDTVFPETFERVY-NFGKENNLDVVSGKEVRTNGWSWGWKQ---FSENNPHAEEMGIECL----LPMTPHKF-------YKREFLLENDITFDDGARVLWEDVYF 201
>gi|16803130|ref|NP_464615.1| hypothetical protein lmo1090 [Listeria monocytogenes EGD-e] >gi|16410492|emb|CAC99168.1| lmo1090 [Listeria monocytogenes] (327 aa)
Score = 133, Expect = 4.6e-06, Identities = 40/114 (35%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   K++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-KYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVETCLDTVQK-TNADLVLF 115
>gi|146272421|dbj|BAF58173.1| galactosyltransferase [Streptococcus gordonii] (321 aa)
Score = 132, Expect = 4.7e-06, Identities = 36/101 (35%), Positives = 59/101 (58%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           +SVI+P  N   ++++  + SL NQT K+FEV  +DD ST+    +     + Y +V      N G+   R+YGVT A G++I F+D DD+    A++ L++
  S:     2 ISVIVPIYNVE-EYLRYAMESLVNQTYKDFEVILVDDGSTDNSGQLCDQYASEYDWVSAYHKVNGGLSDARNYGVTKAKGDWIVFLDPDDYFEPCALELLME 102
>gi|146272425|dbj|BAF58176.1| galactosyltransferase [Streptococcus oralis] (327 aa)
Score = 132, Expect = 4.7e-06, Identities = 36/101 (35%), Positives = 59/101 (58%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           +SVI+P  N   ++++  + SL NQT K+FEV  +DD ST+    +     + Y +V      N G+   R+YGVT A G++I F+D DD+    A++ L++
  S:     2 ISVIVPIYNVE-EYLRYAMESLVNQTYKDFEVILVDDGSTDNSGQLCDQYASEYDWVSAYHKVNGGLSDARNYGVTKAKGDWIVFLDPDDYFEPCALELLME 102
>gi|30261686|ref|NP_844063.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. Ames] >gi|47526889|ref|YP_018238.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49184514|ref|YP_027766.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. Sterne] >gi|65318953|ref|ZP_00391912.1| COG0463: Glycosyltransferases involved in cell wall biogenesis [Bacillus anthracis str. A2012] >gi|165869251|ref|ZP_02213910.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0488] >gi|166992246|ref|ZP_02258706.1| glycosyl transferase, group 2 family protein [Bacillus cereus AH820] >gi|167633296|ref|ZP_02391621.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0442] >gi|167639146|ref|ZP_02397419.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0193] >gi|170686104|ref|ZP_02877326.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0465] >gi|170706536|ref|ZP_02896996.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0389] >gi|177650424|ref|ZP_02933391.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0174] >gi|190568657|ref|ZP_03021562.1| glycosyl transferase, group 2 family protein [Bacillus anthracis Tsiankovskii-I] >gi|30255914|gb|AAP25549.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. Ames] >gi|47502037|gb|AAT30713.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49178441|gb|AAT53817.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. Sterne] >gi|164714691|gb|EDR20209.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0488] >gi|167512936|gb|EDR88309.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0193] >gi|167531334|gb|EDR94012.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0442] >gi|170128634|gb|EDS97501.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0389] >gi|170669801|gb|EDT20542.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0465] >gi|172083568|gb|EDT68628.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0174] >gi|190560257|gb|EDV14237.1| glycosyl transferase, group 2 family protein [Bacillus anthracis Tsiankovskii-I] (266 aa)
Score = 132, Expect = 4.7e-06, Identities = 41/119 (34%), Positives = 65/119 (54%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           VSVI P  N+ +++I + I S+ NQ+ +N+E+  +DD ST+  V    ++I  +    + ++  NIG  K R+  +  A G YI F+DSDD WL       LL  F +  N+ F    Y  +
  S:    14 VSVITPSYNS-IRFIGETIVSVQNQSYENWEMIIVDDASTDESVTKIKEIIEGDSRIRLVSLKENIGAAKARNIAIQEARGRYIAFLDSDDIWLPHKLKTQLL--FMEEMNVSFSYASYSLI 132
>gi|167755072|ref|ZP_02427199.1| hypothetical protein CLORAM_00576 [Clostridium ramosum DSM 1402] >gi|167705122|gb|EDS19701.1| hypothetical protein CLORAM_00576 [Clostridium ramosum DSM 1402] (325 aa)
Score = 132, Expect = 4.8e-06, Identities = 54/191 (28%), Positives = 90/191 (47%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI--PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGL 192
           KKV++IIP  N     I+  I S+  QT+++F+V  I+D ST+  +       N Y  +  +    N+GV + R  G+  A+ EYI F+D+DD++  D ++ LL    K  + D ++  Y             +   FD+++    +      W        W   F++ FLV+N +    K  I ED YF +
  S:     8 KKVTIIIPVYNAGAN-IEHCIQSILKQTSRDFKVLLINDGSTDDSLIRITEYANRYPDIFKVLTHENMGVVETRHRGIKEADTEYIMFMDNDDFIDNDYVEVLLNEIEKTDS-DIVITGY-------------RRANFDKVLF--TIPAYDDEWTKYRITAPWARIFRRNFLVENNVRFL-KTYIGEDTYFNM 182
>gi|182684324|ref|YP_001836071.1| glycosyl transferase family protein [Streptococcus pneumoniae CGSP14] >gi|182629658|gb|ACB90606.1| glycosyl transferase, family 2 [Streptococcus pneumoniae CGSP14] (328 aa)
Score = 132, Expect = 4.8e-06, Identities = 67/237 (28%), Positives = 113/237 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC----FKKEFLVKNKI-----------------SHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNY 240
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ + I  L +          IM E   V     +N+++     DE     N             Q D+ VC    F +E+L+  KI                 S P  + I+ED Y+      L KK ++ +K  Y+Y   +   S+ T  Y   DL  I    K Y
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDDRVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPEMIQSLYEQ---------IMQEDADVSSCGVMNVYAN----DESPQSAN-------------QDDYFVCDSQRFLREYLIGEKIPGTICNKLIKREIATALSFPKGL-IYEDAYYHFDLIKLAKKYVVNTKPYYYY--FHRGDSITTKPYAEKDLAYIDIYQKFY 234
>gi|118497798|ref|YP_898848.1| glycosyl transferase family protein [Francisella tularensis subsp. novicida U112] >gi|194323770|ref|ZP_03057546.1| glycosyl transferase, group 2 family protein [Francisella tularensis subsp. novicida FTE] >gi|118423704|gb|ABK90094.1| glycosyl transferase, family 2 [Francisella tularensis subsp. novicida U112] >gi|194322134|gb|EDX19616.1| glycosyl transferase, group 2 family protein [Francisella tularensis subsp. novicida FTE] (335 aa)
Score = 132, Expect = 4.9e-06, Identities = 37/106 (34%), Positives = 61/106 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D ST+  P +     +K+    + N  N+ G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:    10 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIILINDGSTDNSPSICQKYKSKDNRIVLLNQQNS-GQALARNSALDMAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 115
>gi|116513365|ref|YP_812271.1| glycosyltransferase-like protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092680|gb|ABJ57833.1| Glycosyltransferase related enzyme [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (274 aa)
Score = 132, Expect = 4.9e-06, Identities = 34/117 (29%), Positives = 60/117 (51%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           K++VI+   N   K++ + +  L  Q N+ F++  IDD ST+    I    ++ +Q    +   N GV   R+ G+ + +  Y  F D DDW+  D  DY +K+F ++ + D +   Y
  S:     8 KLTVIMTVYNQE-KYLARALDCLLEQKNQQFKLLVIDDGSTDSTAEIAASYQDRFQAFDLVSKANEGVAAARNLGLDMVDTPYCIFHDGDDWVEPDYTDYFIKAFDRHPDDDMVTCGY 124
>gi|110600775|ref|ZP_01388987.1| Glycosyl transferase, family 2 [Geobacter sp. FRC-32] >gi|110548535|gb|EAT61749.1| Glycosyl transferase, family 2 [Geobacter sp. FRC-32] (281 aa)
Score = 132, Expect = 4.9e-06, Identities = 39/92 (42%), Positives = 55/92 (59%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           M KVSVIIP  N   + +K  ITS+ +Q   N+E+  IDD ST+    I  +N  G   ++ I  +N G    R+YG+ L+ GEY+ F+DSDD
  S:     1 MVKVSVIIPTYNRS-ELLKCAITSVLDQAYDNYELLIIDDGSTDDTKSI--VNGFGSPKIRYIYQSNSGRSSARNYGIKLSKGEYVSFLDSDD 90
>gi|46487350|gb|AAS99071.1| Tgh003 [Campylobacter jejuni] >gi|58585455|gb|AAW79076.1| WaaV [Campylobacter jejuni] (272 aa)
Score = 132, Expect = 4.9e-06, Identities = 53/211 (25%), Positives = 103/211 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L   A +   K   K     F +  ++    + +   F +  Q DE++ +    +      H  +   W  CF+K+ ++KN  K+   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNIGVLHSSSDFIMFLDSDDFLTPGACEIAFKEMKK----GFDLLCFDAFVHRVKTKQFYRFKQ-DEVLNQKEFLEFLSKQRHFCWSV-WAKCFRKDIILKNFEKVKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|149006985|ref|ZP_01830654.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP18-BS74] >gi|168484543|ref|ZP_02709495.1| glycosyl transferase, group 2 [Streptococcus pneumoniae CDC1873-00] >gi|169832469|ref|YP_001694801.1| galactosyl transferase paralog [Streptococcus pneumoniae Hungary19A-6] >gi|147761289|gb|EDK68255.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP18-BS74] >gi|168994971|gb|ACA35583.1| galactosyl transferase paralog [Streptococcus pneumoniae Hungary19A-6] >gi|172042241|gb|EDT50287.1| glycosyl transferase, group 2 [Streptococcus pneumoniae CDC1873-00] (328 aa)
Score = 132, Expect = 5.0e-06, Identities = 65/237 (27%), Positives = 111/237 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC----FKKEFLVKNKI-----------------SHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNY 240
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ +    +++S Y+                     L  +        V N     + P   N  Q D+ VC    F KE+L+  KI                 S P  + I+ED Y+      L KK ++ +K  Y+Y   +   S+ T  Y   DL  I    K Y
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDDRVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPE----MIQSLYE--------------------QLVQEDADVSSCGVMNVYANDESPQSAN--QDDYFVCDSQTFLKEYLIGEKIPGTICNKLIKRQIATDLSFPKGL-IYEDAYYHFDLIKLAKKYVVNTKPYYYY--FHRGDSITTKPYAEKDLAYIDIYQKFY 234
>gi|148989435|ref|ZP_01820803.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae SP6-BS73] >gi|147925185|gb|EDK76265.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae SP6-BS73] (294 aa)
Score = 132, Expect = 5.1e-06, Identities = 65/223 (29%), Positives = 113/223 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPW------FHNNYQTDWRVCFKKEFLVKNKISHP-DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYK 226
           +SVI+P  N    +I   + SL+ Q  +NFEV  ++D ST+      + Y D  ++  + Y +    N GV   R++G+  + G+YI FVDSDDW+  + +  L+++  K Q+ + ++  Y    +     LF  H    +  VKN  +K  M        +  ++ T W + FK+E     ++  P  +V  +    + L  +V  +K    +K LY+Y R+  E   N+Y  K
  S:     5 ISVIVPVYNVE-PFISSCLDSLSKQIYQNFEVLLVNDGSTDNSGAICREYADRDSR--FHYFEK--ENAGVADARNFGIERSKGDYITFVDSDDWVTEEYLSILIETL-KEQHSEIVVSTYSTYNESD--GLFYIHVFDSDYYVKNYNSKLLMEELPLLERYDMSFLTSWGILFKRELF--QEVQFPFGRVCEYIGTNYKLFMQV--EKVTYINKVLYWY-RVGKEGLSNSYSPK 226
>gi|23099913|ref|NP_693379.1| hypothetical protein OB2458 [Oceanobacillus iheyensis HTE831] >gi|22778144|dbj|BAC14414.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (372 aa)
Score = 132, Expect = 5.2e-06, Identities = 40/106 (37%), Positives = 63/106 (59%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRD--YGVTLANGEYIWFVDSDDWLYV-DAIDYLLKSF 106
           +K +SVIIP +N   + I +L+ S+N QT K  EV  +DD ST+     +++   GY+ ++N  N   VGK      G   ANGEY+ F+D+D  LY  D+++ ++  F
  S:    38 LKMLSVIIPARNEG-RQIGRLLDSINIQTYKKLEVLVVDDGSTDNTA--EIVRSFGYRVIKNELNKGWVGKSSACWKGANQANGEYLLFLDADTELYKPDSLETIVNHF 143
>gi|16803120|ref|NP_464605.1| hypothetical protein lmo1080 [Listeria monocytogenes EGD-e] >gi|47094938|ref|ZP_00232551.1| minor teichoic acids biosynthesis protein GgaB [Listeria monocytogenes str. 1/2a F6854] >gi|153184740|ref|ZP_01935467.1| hypothetical protein LMOG_01380 [Listeria monocytogenes J0161] >gi|16410482|emb|CAC99158.1| lmo1080 [Listeria monocytogenes] >gi|47016556|gb|EAL07476.1| minor teichoic acids biosynthesis protein GgaB [Listeria monocytogenes str. 1/2a F6854] >gi|126942711|gb|EBA20448.1| hypothetical protein LMOG_01380 [Listeria monocytogenes J0161] (623 aa)
Score = 132, Expect = 5.3e-06, Identities = 54/188 (28%), Positives = 98/188 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNK--NFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI----MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYF 190
           K+SV++P  NT L+ +K L+ S++ QT     +E+ F+DD ST    +   +         V+ I N+    + R+    +A GEYI ++D DD ++ +  + +  +F K  N+D +    +    W +  KQ   FS++N   E +    +    +P   + +       +K+EFL++N I+  D   + +EDVYF
  S:    20 KISVVVPTYNTELEGLKNLMASIDKQTMNPDEYELVFVDDGSTTDTYERLQEFAETRPNMTVKQIENSGWGSRPRNIATKMAKGEYILYLDHDDTVFPETFERVY-NFGKENNLDVVSGKEVRTNGWSWGWKQ---FSENNPHAEEMGIECL----LPMTPHKF-------YKREFLLENDITFDDGARVLWEDVYF 201
>gi|152977609|ref|YP_001377126.1| glycosyl transferase family protein [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026361|gb|ABS24131.1| glycosyl transferase family 2 [Bacillus cereus subsp. cytotoxis NVH 391-98] (326 aa)
Score = 132, Expect = 5.3e-06, Identities = 37/104 (35%), Positives = 60/104 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFY 107
           VSV+IP  N   K+I++ + S+ NQT +N E+  +DD S +  P +  +L  K+  +       N GV   R+ G+  ANGEY+ F+DSDD  +   I+  ++S +
  S:     8 VSVVIPLYNAE-KYIEETMQSILNQTYQNIEIIVVDDGSKDQSPTIVKELQRKHPEKVRYIHQKNQGVSVARNTGIEHANGEYVAFLDSDDLWHPSKIEKQVQSMH 112
>gi|167767621|ref|ZP_02439674.1| hypothetical protein CLOSS21_02154 [Clostridium sp. SS2/1] >gi|167710638|gb|EDS21217.1| hypothetical protein CLOSS21_02154 [Clostridium sp. SS2/1] (322 aa)
Score = 132, Expect = 5.5e-06, Identities = 62/220 (28%), Positives = 108/220 (49%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQIN-----LFSKHNQFDEIIVKNNVNKSKMPWFHNN--YQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKA--LLTSKKLYFYNRLNVESSLN 221
           KKVS++IP        I + + SL   T +N ++  I+D S +  + +     + Y  VQ I N  N GV   R++G+  A+G Y+ FVDSDD++  D ++ ++ +   Y + + +M    +V   ++ N         H Q D   +K ++    MP  + N   Q  W   F+ + + +N I   +++ I ED  F L +    K +     +K L  Y R N  S ++
  S:     5 KKVSIVIPVYKAA-DTITRCVESLERNTYENLQIILIEDCSGDQTINVCKKLASMYDNVQCIENDENHGVSYTRNHGLDYADGNYLMFVDSDDYVEADYVEMMISAI-SYVDDERVMPVCGYVNHDEKKNGRTDIFLPSHEQED---LKKSIQ--IMPELYENRMLQIIWNKIFRLDVIKQNHIRFKEEMFIGEDFRFLLEYMKAAKISGFFFVNKALCHYMRDNENSLMS 228
>gi|194244998|gb|ACF35268.1| putative glycosyltransferase [Streptococcus parasanguinis] (582 aa)
Score = 132, Expect = 5.6e-06, Identities = 38/103 (36%), Positives = 61/103 (59%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINK--NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSF 106
           +S+I+P  N   K++K+ + SL  QT KNFE+  I+D ST N  +  +   K  N  Q +     N G    R+ G+T A+G+YI FVDSDD++    +++L ++ 
  S:   293 ISIIVPVYNVE-KYLKRCLDSLLRQTYKNFEIILINDGSTDNSSIICEEYAKIDNRIQILHQ--TNAGPSAARNAGITYASGKYITFVDSDDFVEEFYLEHLYRAL 395
>gi|170690269|ref|ZP_02881436.1| glycosyl transferase family 2 [Burkholderia graminis C4D1M] >gi|170144704|gb|EDT12865.1| glycosyl transferase family 2 [Burkholderia graminis C4D1M] (319 aa)
Score = 132, Expect = 5.6e-06, Identities = 37/118 (31%), Positives = 63/118 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-----PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE 118
           M   S+I+P  N    ++ + + S+  Q+  +FE+  +DD ST+      Q Y D  +   ++YV   PN  G    R+ G +L  G Y++++DSDD +  D +    + F   + ID +MFE
  S:     1 MPAFSIIVPAYNVE-HYLDEALASVAAQSFTDFELILVDDGSTDGTAAIAQRYCD--SDPRFRYVYQ-PNR-GQSAARNLGTSLTTGTYVYYMDSDDLIDTDTLSVCHREFSNPE-IDAVMFE 117
>gi|151572327|gb|EDN37981.1| glycosyltransferase [Francisella tularensis subsp. novicida GA99-3548] (335 aa)
Score = 132, Expect = 5.6e-06, Identities = 36/106 (33%), Positives = 61/106 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D ST+  P +     +K+    + N  N+ G    R+  + +A G+Y+ F+DSDDW+ +D I  L    + Y
  S:    10 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIILINDGSTDNSPSICQKYKSKDNRIVLLNQQNS-GQALARNSALDMAKGDYVAFIDSDDWISLDYIQALYNHVFSY 115
>gi|12004287|gb|AAG43984.1|AF215659_12 glycosyltransferase [Campylobacter jejuni] >gi|85682804|gb|ABC73388.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 132, Expect = 5.6e-06, Identities = 57/211 (27%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  I+D S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CFKK+ ++K+  KI   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIINDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIIFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQR----HFCWSV-WTKCFKKDIILKSFEKIKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 208
>gi|167404123|ref|ZP_02308931.1| hypothetical protein LmonocytFSL_08528 [Listeria monocytogenes FSL J2-003] (110 aa)
Score = 132, Expect = 5.7e-06, Identities = 37/105 (35%), Positives = 59/105 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSVIIP  N   K++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K
  S:     5 VSVIIPVYNVE-KYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVETCLDTVQK 107
>gi|116872476|ref|YP_849257.1| glycosyl transferase, group 2 family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741354|emb|CAK20478.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (783 aa)
Score = 132, Expect = 5.7e-06, Identities = 40/108 (37%), Positives = 63/108 (58%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           K+SVI+P  N  + +I + I SL +QT K  E+  +DD S++   +  ID   ++    V   PN  G G  R+ G+++A G+YI FVDSDD L   A++ + ++  K Q
  S:    15 KISVIVPVYNV-ISYIDETINSLLSQTLKEIEIILVDDGSSDGSFERIIDYGERHDNICVAKEPN-AGPGMARNNGLSIAKGKYISFVDSDDILPERALEIMYEAAEKEQ 122
>gi|150003116|ref|YP_001297860.1| glycosyl transferase family protein [Bacteroides vulgatus ATCC 8482] >gi|149931540|gb|ABR38238.1| glycosyltransferase family 2 [Bacteroides vulgatus ATCC 8482] (329 aa)
Score = 132, Expect = 5.7e-06, Identities = 35/89 (39%), Positives = 51/89 (57%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSD 91
           + S IIP  N P + + +L+ SL  QTNKNFEV  ++D S+ P       Y D ++   Y       +N G G+ R+YG    +GEY+  +DSD
  S:     2 RYSFIIPVYNRPEE-VDELLNSLTRQTNKNFEVLIVEDGSSVPCKEVVDNYADRLDICYY-----FKSNSGPGQTRNYGAERGHGEYLIILDSD 89
>gi|121310072|dbj|BAF44337.1| beta-galactose transferase [Streptococcus oralis] >gi|146272417|dbj|BAF58170.1| galactosyltransferase [Streptococcus oralis] (321 aa)
Score = 132, Expect = 5.7e-06, Identities = 36/101 (35%), Positives = 59/101 (58%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           +SVI+P  N   ++++  + SL NQT K+FEV  +DD ST+    +     + Y +V      N G+   R+YGVT A G++I F+D DD+    A++ L++
  S:     2 ISVIVPIYNVE-EYLRYAMESLVNQTYKDFEVILVDDGSTDNSGELCDQYASEYDWVSAYHKVNGGLSDARNYGVTKAKGDWIVFLDPDDYFEPCALELLME 102
>gi|15903266|ref|NP_358816.1| galactosyl transferase paralog [Streptococcus pneumoniae R6] >gi|116516760|ref|YP_816666.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae D39] >gi|148993077|ref|ZP_01822671.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP9-BS68] >gi|149011599|ref|ZP_01832795.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP19-BS75] >gi|149013236|ref|ZP_01834022.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP19-BS75] >gi|149019318|ref|ZP_01834680.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP23-BS72] >gi|168489527|ref|ZP_02713726.1| glycosyl transferase, group 2 [Streptococcus pneumoniae SP195] >gi|15458859|gb|AAL00027.1| Galactosyl transferase paralog [Streptococcus pneumoniae R6] >gi|116077336|gb|ABJ55056.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae D39] >gi|147762987|gb|EDK69932.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP19-BS75] >gi|147764030|gb|EDK70962.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP19-BS75] >gi|147928278|gb|EDK79295.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP9-BS68] >gi|147931188|gb|EDK82167.1| glycosyl transferase, group 2 family protein [Streptococcus pneumoniae SP23-BS72] >gi|183571974|gb|EDT92502.1| glycosyl transferase, group 2 [Streptococcus pneumoniae SP195] (328 aa)
Score = 132, Expect = 5.8e-06, Identities = 65/237 (27%), Positives = 111/237 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC----FKKEFLVKNKI-----------------SHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNY 240
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ +    +++S Y+                     L  +        V N     + P   N  Q D+ VC    F KE+L+  KI                 S P  + I+ED Y+      L KK ++ +K  Y+Y   +   S+ T  Y   DL  I    K Y
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDDRVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPE----MIQSLYE--------------------QLVQEDADVSSCGVMNVYANDESPQSAN--QDDYFVCDSQTFLKEYLIGEKIPGTICNKLIKRQIATDLSFPKGL-IYEDAYYHFDLIKLAKKYVVNTKPYYYY--FHRGDSITTKPYAEKDLAYIDIYQKFY 234
>gi|40037132|gb|AAR37385.1| putative glycosyltransferase [Campylobacter jejuni] >gi|167412415|gb|ABZ79867.1| unknown [Campylobacter jejuni] (269 aa)
Score = 132, Expect = 5.9e-06, Identities = 58/211 (27%), Positives = 108/211 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFID----DNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  ID    DNS N  + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDNKSKDNSLN--MVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|113475084|ref|YP_721145.1| glycosyl transferase, group 1 [Trichodesmium erythraeum IMS101] >gi|110166132|gb|ABG50672.1| glycosyl transferase, group 1 [Trichodesmium erythraeum IMS101] (1991 aa)
Score = 132, Expect = 5.9e-06, Identities = 34/115 (29%), Positives = 61/115 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI---PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           + K+SV++P  + PLK++ Q I+S+ NQ  +N+E    DD S+NP++   L  +        +     N  +    +    LA G+++ F+D+DD L  DA+  +     +   IDF+
  S:   993 LPKISVVMPVYDPPLKFLHQGISSVLNQVYQNWEFCIADDCSSNPKIREILTERAKTDSRIKLTFRSENGNISAATNSAAELATGDFLLFLDNDDELTPDALGEVALYISQNSEIDFL 1110
>gi|84489040|ref|YP_447272.1| glycosyltransferase [Methanosphaera stadtmanae DSM 3091] >gi|84372359|gb|ABC56629.1| predicted glycosyltransferase [Methanosphaera stadtmanae DSM 3091] (888 aa)
Score = 132, Expect = 5.9e-06, Identities = 71/245 (28%), Positives = 120/245 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF----EYEWVFDKKQINLFSKH-NQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKAND---LVSIIFKNKNYLLENKLFN 248
           VS+IIP  N   K++   I+S+ NQ+ K+ EV  +DD ST+  +  +     +  ++      N G G  R+ G+  A GEY+ F+D+DDW+  ++++ L K      N D ++F     Y   + +K+I   S     +D        NK  +    N+Y        K +FL KN I   + V +FEDV F +  K + K   ++    +FY+ +  ++S      + +    L  I  + K +L +NKL N
  S:     6 VSIIIPIYNKE-KYLNNCISSIKNQSLKDIEVICVDDGSTDDSLSTLKSYTSDDSRFKIIKQENRGPGLARNVGLENATGEYVLFLDADDWIESESLEQLYKQATS-NNSDLVLFNSIEHYPDNYLRKRIYAVSNDIKNYDNFTFNCLYNKRLV---MNSYFIVCTKLHKLDFLRKNNIKFQEDV-LFEDVLFHI--KTMIKANNISYNPQFFYHYVRTDNSRQNTSIQTSKSFVLFDIFNEVKTFLKKNKLMN 251
>gi|49478996|ref|YP_039416.1| beta-1,3-N-acetylglucosaminyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49330552|gb|AAT61198.1| beta-1,3-N-acetylglucosaminyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] (326 aa)
Score = 131, Expect = 6.1e-06, Identities = 40/105 (38%), Positives = 60/105 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSVI+P  N   K+I++ + S+ NQT KN E+  +DD S +    I  +L  K   Q    +  N GV   R+ G+  A+GEYI F+DSDD  +   I+  ++S +K
  S:     8 VSVIVPLYNAE-KYIEETLESILNQTYKNIEIVIVDDGSKDQSSSIVKNLKKKYPEQIKYILQENQGVSVARNTGIENASGEYISFLDSDDLWHPTKIEKQIESMHK 113
>gi|171742199|ref|ZP_02918006.1| hypothetical protein BIFDEN_01305 [Bifidobacterium dentium ATCC 27678] >gi|171277813|gb|EDT45474.1| hypothetical protein BIFDEN_01305 [Bifidobacterium dentium ATCC 27678] (342 aa)
Score = 131, Expect = 6.1e-06, Identities = 36/122 (29%), Positives = 64/122 (52%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNI-GVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           +  VS+I+P +N    ++   + SL +Q     ++  +DD ST+    +        Q ++ I     GV + R+ G+  A GEY+ FVDSDD L VDA+   L+  +++ + D ++  Y+ V
  S:    10 LPSVSIIVPVRNAK-NYLDACVDSLRSQIYPKLDIILVDDGSTDGSSELCDAAAERDQRIRVIHQTCKGVSEARNAGLDTATGEYVLFVDSDDQLRVDAVMGALRCAHEH-SADMVVCGYDVV 130
>gi|91205521|ref|YP_537876.1| glycosyltransferase [Rickettsia bellii RML369-C] >gi|157827237|ref|YP_001496301.1| glycosyltransferase [Rickettsia bellii OSU 85-389] >gi|119368444|sp|Q1RIM7|Y706_RICBR Uncharacterized glycosyltransferase RBE_0706 >gi|91069065|gb|ABE04787.1| Glycosyltransferase [Rickettsia bellii RML369-C] >gi|157802541|gb|ABV79264.1| Glycosyltransferase [Rickettsia bellii OSU 85-389] (690 aa)
Score = 131, Expect = 6.2e-06, Identities = 42/118 (35%), Positives = 61/118 (51%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE 120
           KVSVIIP  N  + W  Q I S+ NQT++NFEV  I+D ST     +    K   +       N G    R+ G+  ++G+YI F+DSDD  + + ++  LK F +  N  F    Y+
  S:   292 KVSVIIPVYNR-INWTIQSIESVLNQTHENFEVIVINDGSTEDISELIKFCKKDKRIQYFHKKNEGPASARNLGIKKSSGKYIAFLDSDDLFFHNKLELQLK-FMEENNFIFSHTSYQ 407
>gi|68644436|emb|CAI34520.1| putative glycosyl transferase [Streptococcus pneumoniae] (331 aa)
Score = 131, Expect = 6.2e-06, Identities = 36/106 (33%), Positives = 60/106 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +SV++P  N    ++++ + S+  QT KN E+  ++D S +  + I     NK+    V   PN  G+   R++GV  + GE+I FVDSDD++  D ++YL     KY
  S:    13 ISVVLPVYNVE-NYLEKCLNSVVRQTYKNIEIIIVNDGSLDSSIDICNKYANKDSRIKVFTKPNG-GLSDARNFGVKKSMGEFITFVDSDDYVTDDYVEYLYSLVKKY 118
>gi|67157650|ref|ZP_00418845.1| Glycosyl transferase, family 2 [Azotobacter vinelandii AvOP] >gi|67085232|gb|EAM04707.1| Glycosyl transferase, family 2 [Azotobacter vinelandii AvOP] (340 aa)
Score = 131, Expect = 6.2e-06, Identities = 31/90 (34%), Positives = 51/90 (56%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           +V+V IP  N   ++I   + S+  QT  +FE+  +DD ST+  + +    ++    V+  P N+G+   R+ G+ LA GEYI  +DSDD
  S:     6 RVTVFIPVHNRQ-RYIATAVDSILAQTFGDFELLVVDDGSTDATLEVLSHYRDPRLRVECNPRNLGLPGTRNRGLELARGEYIALLDSDD 94
>gi|68643479|emb|CAI33719.1| putative glycosyl transferase [Streptococcus pneumoniae] (342 aa)
Score = 131, Expect = 6.3e-06, Identities = 52/220 (23%), Positives = 108/220 (49%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNF-EVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKH----NQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTY 223
           +S+IIP  N     I+ + + +N++   +  E+  +++ ST+    I          ++ + ++ G    R+ G+  + G+++ F+D+DD+L+   +D ++++     N D  ++ YE     K+I LFS+     +  D  IV++    +K       Y T W   F K  + +  +     + + ED  F L + +L     LTS+ LY Y+ ++  S++ T+
  S:     8 ISIIIPLHNGEDTIIRAVKSVINSRLYGDLIEIIIVENGSTDQSFKISQKLATENSNIRVLKSDKGTSFARNVGIEKSKGKWLIFLDADDYLFESDLDVIVENLIT-NNTDLCVYNYEKGL--KKIELFSEEVELIDDLDSFIVQSLSEPTK-------YMTVWGKAFNKNLIDEYGLKFNTNLRVSEDSDFYLRFLLLIHSLTLTSQTLYHYS-IDSPSTMRTF 221
>gi|167217277|ref|ZP_02286913.1| hypothetical protein LmonocFSL_08788 [Listeria monocytogenes FSL J1-175] (193 aa)
Score = 131, Expect = 6.3e-06, Identities = 39/114 (34%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   +++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-EYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVEICLDTVQK-TNADLVLF 115
>gi|68644212|emb|CAI34329.1| putative glycosyl transferase [Streptococcus pneumoniae] (331 aa)
Score = 131, Expect = 6.4e-06, Identities = 36/106 (33%), Positives = 60/106 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +SV++P  N    ++++ + S+  QT KN E+  ++D S +  + I     NK+    V   PN  G+   R++GV  + GE+I FVDSDD++  D ++YL     KY
  S:    13 ISVVLPVYNVE-NYLEKCLNSVVRQTYKNIEIIIVNDGSLDSSIDICNKYANKDSRIKVFTKPNG-GLSDARNFGVKKSMGEFITFVDSDDYVTDDYVEYLYSLVKKY 118
>gi|182684719|ref|YP_001836466.1| glycosyl transferase family protein [Streptococcus pneumoniae CGSP14] >gi|182630053|gb|ACB91001.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae CGSP14] (696 aa)
Score = 131, Expect = 6.7e-06, Identities = 33/108 (30%), Positives = 61/108 (56%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           K++VI+P  N    ++++ + S+  QT KN E+  ++D ST+    I    ++  ++ +     N G+   R+ G+   +G Y+ FVDSDDW+ +D ++ L K   +YQ
  S:     6 KITVIVPVYNVE-NYLRKCLDSIITQTYKNIEIVVVNDGSTDASGEICKEFSEMDHRILYIEQENAGLSAARNTGLNNMSGNYVTFVDSDDWIELDYVETLYKEITEYQ 113
>gi|75907071|ref|YP_321367.1| glycosyl transferase family protein [Anabaena variabilis ATCC 29413] >gi|75700796|gb|ABA20472.1| Glycosyl transferase, family 2 [Anabaena variabilis ATCC 29413] (330 aa)
Score = 131, Expect = 6.9e-06, Identities = 39/109 (35%), Positives = 60/109 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           M  +SVIIP  N  L  IK+ I S+ NQT  ++E+  I+D ST+    I    K+    + N  N  G+   R+ G+  A GE+I F+D+DD   VD ++  LK+  ++
  S:     4 MALISVIIPAYNAELT-IKKTIESVQNQTFTDWEIIVINDGSTDKTPEIIQSIKDERLKIFNYKNG-GLPVARNRGILHATGEFIAFLDADDLWTVDKLERQLKALQQH 110
>gi|148989484|ref|ZP_01820843.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP6-BS73] >gi|148997582|ref|ZP_01825187.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP11-BS70] >gi|168575825|ref|ZP_02721740.1| glycosyl transferase, family 2 [Streptococcus pneumoniae MLV-016] >gi|147756637|gb|EDK63678.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP11-BS70] >gi|147925027|gb|EDK76108.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP6-BS73] >gi|183578301|gb|EDT98829.1| glycosyl transferase, family 2 [Streptococcus pneumoniae MLV-016] (328 aa)
Score = 131, Expect = 7.1e-06, Identities = 65/237 (27%), Positives = 111/237 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVC----FKKEFLVKNKI-----------------SHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNY 240
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ +    +++S Y+                     L  +        V N     + P   N  Q D+ VC    F KE+L+  KI                 S P  + I+ED Y+      L KK ++ +K  Y+Y   +   S+ T  Y   DL  I    K Y
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDDRVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPE----MIQSLYE--------------------QLVQEDADVSSCGVMNVYANDESPQSAN--QDDYFVCDSQTFLKEYLIGEKIPGTICNKLIKRQIATALSFPKGL-IYEDAYYHFDLIKLAKKYVVNTKPYYYY--FHRGDSITTKPYAKKDLAYIDIYQKFY 234
>gi|41323928|gb|AAS00037.1| putative glycosyltransferase [Campylobacter jejuni] (297 aa)
Score = 131, Expect = 7.1e-06, Identities = 58/211 (27%), Positives = 108/211 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFID----DNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  ID    DNS N  + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +    H  +   W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:    29 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDNKSKDNSLN--MVLEFAKKDPRITIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQR----HFCWSV-WAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 236
>gi|160888054|ref|ZP_02069057.1| hypothetical protein BACUNI_00462 [Bacteroides uniformis ATCC 8492] >gi|156862553|gb|EDO55984.1| hypothetical protein BACUNI_00462 [Bacteroides uniformis ATCC 8492] (329 aa)
Score = 131, Expect = 7.2e-06, Identities = 35/89 (39%), Positives = 57/89 (64%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSD 91
           + SVIIP  N P + + +L+ SL  Q+ K+FEV  ++D S+ P     + Y +L++ + Y    + PN+ G G+ R+YGV  + GEY+  +DSD
  S:     2 RYSVIIPVYNRPDE-VDELLQSLTQQSFKDFEVIVVEDGSSIPCKPVTEKYQELLDVHYY----DKPNS-GPGQTRNYGVERSKGEYLIILDSD 89
>gi|12006007|gb|AAG44714.1|AF267127_11 beta(1,4)galactosyltransferase EpsJ [Lactobacillus delbrueckii subsp. bulgaricus] (327 aa)
Score = 131, Expect = 7.2e-06, Identities = 58/211 (27%), Positives = 105/211 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINK-NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQF---DEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYK--KALLTSKKLYFYNR 213
           K+S+I+P      +++K  + S+ NQT  +FE+  +DD S +  P++  +   K N  + V     N G+   R+ G+ +A GEYI F+DSDD+L  +  +++  S  K +  D ++    +V+      L  K N +   D       +N S + +F       W   +K+     N +S+P+   + ED Y    +KV  K  + +  S  +Y+Y +
  S:     2 KLSIIVPVYKVE-EYLKDCVNSILNQTFHDFELILVDDGSPDSCPKICDEYSQKFNNVKVVHK--QNGGLSSARNAGMKVATGEYISFIDSDDYLASNMYEHVF-SIMKKECADIVVVGRCYVYPNGSKKLREKQNVYEVMDGPKATAIMNTSLLGYFD---AAAWDKVYKRSLF--NDVSYPEG-KLSEDWY--TTYKVFAKANRIVYDSTPMYYYRQ 208
>gi|84683738|ref|ZP_01011641.1| capsule polysaccharide modification protein LipA [Rhodobacterales bacterium HTCC2654] >gi|84668481|gb|EAQ14948.1| capsule polysaccharide modification protein LipA [Rhodobacterales bacterium HTCC2654] (1255 aa)
Score = 131, Expect = 7.2e-06, Identities = 32/92 (34%), Positives = 50/92 (54%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDD-NSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           KVSVIIP       +I+  I S+  QT +  E+  ++D    N Q  ID + K   +    + + N+G G  R+  +  A G++IWF+D DDW+
  S:   390 KVSVIIPVHGVE-AYIEDCIASVQAQTLREIEILPVNDVTPDNAQAIIDRLAKADPRIKPIVLDENVGQGFARNIAIDQAKGDFIWFIDGDDWM 482
>gi|139437024|ref|ZP_01771184.1| Hypothetical protein COLAER_00158 [Collinsella aerofaciens ATCC 25986] >gi|133776671|gb|EBA40491.1| Hypothetical protein COLAER_00158 [Collinsella aerofaciens ATCC 25986] (335 aa)
Score = 131, Expect = 7.3e-06, Identities = 34/89 (38%), Positives = 53/89 (59%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           +S+++P  N+  + I++ + SL +QT  + E+  IDD ST+  +     L +K+    V     N G G  R+YG+ LA GE+I FVDSDD
  S:     6 LSIVVPIYNSS-ETIEECVASLVSQTINDLEILLIDDGSTDDSLEKCKKLASKDNRIRVFT-KENAGQGIARNYGLDLATGEFIAFVDSDD 94
>gi|153808252|ref|ZP_01960920.1| hypothetical protein BACCAC_02540 [Bacteroides caccae ATCC 43185] >gi|149129155|gb|EDM20371.1| hypothetical protein BACCAC_02540 [Bacteroides caccae ATCC 43185] (341 aa)
Score = 131, Expect = 7.4e-06, Identities = 56/216 (25%), Positives = 104/216 (48%)
  Q:     3 KVSVIIP-FKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFY-KYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVES 218
           KVS+I+P +K+ P  +++  I S+ NQ   ++E+  +DD S +   ++      K+    V +  N+ GV   R+ G+  A GEYI FVDSDD +  D     L SF+   +N D  +  Y+ V + K++      +  D++ V+   +        + + + W   FK++ ++++ I     ++  ED  F L + +  +         Y Y +   ES
  S:     2 KVSIIVPVYKSEP--FLEDCINSIINQIFTDWELILVDDGSPDFCGRICDSFAVKDSRIKVLHQKNS-GVSVARNRGIYQAKGEYICFVDSDDLIEPD----FLNSFWIGEENADLYLQGYKIVNEDKEVQNIISFSGMDQLSVREWKSVYIFAEEKHIFNSPWARLFKRQIIIEHHIQFDSSLSFGEDHVFSLQFLLYVQTLSFIQNSGYLYVKRKQES 214
>gi|196181830|gb|EDX76817.1| glycosyl transferase, group 2 family protein [Microcoleus chthonoplastes PCC 7420] (324 aa)
Score = 131, Expect = 7.6e-06, Identities = 43/127 (33%), Positives = 66/127 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ 127
           M  +SVIIP  N   K IK+ I S+ NQT  +FEV  I+D ST+  + +    K+    V + P+  GV   R+ G+  A GEYI F+D+DD    D ++  LK+  +           +W+ + +Q
  S:     1 MPIISVIIPAYNAE-KTIKETIESVLNQTVTDFEVLVINDGSTDGTLNVIDGIKDERLRVFSYPH-AGVALTRNRGLVHAVGEYISFLDADDLWTPDKLEAQLKALQENPQAAVAYSWTDWIDELRQ 125
>gi|77411079|ref|ZP_00787433.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae CJB111] >gi|77162902|gb|EAO73859.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae CJB111] (295 aa)
Score = 131, Expect = 7.6e-06, Identities = 68/232 (29%), Positives = 117/232 (50%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGE--YIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI---NLFSKHNQFDEIIVKNNVNKSKMPWFHNN--YQTDWRVCFKKEFLVKNKISHP-DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN-RLNVESSLNTYKYKANDLVSI 233
           K VSVIIP  N    +++  + ++  QT + FE+  IDD ST+    I   L  ++    V +I N  G  K R++G+   + E  ++ FVDSDDW+  + ++ LL    KY N D ++  Y    + + I    +  K    +EI  +  +++ ++ W  N+  +   W   +++E    + I+ P DKV  FED    ++  +  KK +L +   Y Y  R N   +      +A DL+ I
  S:     8 KLVSVIIPVYNAA-PYLEGCVNTILGQTYQVFEILLIDDGSTDTSASICDQLSLRDNRIRVFHIENG-GASKARNFGLARISSESQFVTFVDSDDWVKENYLEVLLAQQEKY-NADIVISNYYIYRETEDIFGYYITDKDFVIEEISAQTAIDR-QVHWHLNSSVFIVIWGKLYRRELF--DTITFPIDKV--FEDELVSVLLFIKSKKTILVNGSYYGYRIRPNSIMTSAFSSKRAEDLIYI 242
>gi|168137505|ref|ZP_02580734.1| Beta-1,3-N-acetylglucosaminyltransferase [Bacillus cereus B4264] (326 aa)
Score = 131, Expect = 7.8e-06, Identities = 39/105 (37%), Positives = 60/105 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSV+IP  NT  K+I++ + S+ +QT KN E+  +DD S +  P +  +L  K   Q       N GV   R+ G+  A+GEY+ F+DSDD  +   I+  ++S  K
  S:     8 VSVVIPLYNTE-KYIEETMQSILDQTYKNIEIVIVDDGSKDQSPSIVKNLAEKYPRQVKYVHQKNQGVSVARNTGIENASGEYVAFLDSDDLWHPTKIEKQIESMNK 113
>gi|119485683|ref|ZP_01619958.1| glycosyl transferase, group 2 family protein [Lyngbya sp. PCC 8106] >gi|119457008|gb|EAW38135.1| glycosyl transferase, group 2 family protein [Lyngbya sp. PCC 8106] (2105 aa)
Score = 131, Expect = 7.8e-06, Identities = 31/99 (31%), Positives = 58/99 (58%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ----YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAI 99
           + K+SV++P  N P++++++ I S+ NQ   N+E+   DD S++P++  + +NK   +     V   P N  + +  +    LA GE+I  +D DD L  +A+
  S:   855 LAKISVVMPVYNPPIEFLEKAINSVINQVYSNWELCIADDCSSDPEI-AEFLNKFAEEDERIKVIFRPENGNISRATNSAAVLATGEFILLLDHDDELTPNAL 956
>gi|76787068|ref|YP_330096.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae A909] >gi|76562125|gb|ABA44709.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae A909] (291 aa)
Score = 131, Expect = 7.8e-06, Identities = 68/232 (29%), Positives = 117/232 (50%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGE--YIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI---NLFSKHNQFDEIIVKNNVNKSKMPWFHNN--YQTDWRVCFKKEFLVKNKISHP-DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN-RLNVESSLNTYKYKANDLVSI 233
           K VSVIIP  N    +++  + ++  QT + FE+  IDD ST+    I   L  ++    V +I N  G  K R++G+   + E  ++ FVDSDDW+  + ++ LL    KY N D ++  Y    + + I    +  K    +EI  +  +++ ++ W  N+  +   W   +++E    + I+ P DKV  FED    ++  +  KK +L +   Y Y  R N   +      +A DL+ I
  S:     4 KLVSVIIPVYNAA-PYLEGCVNTILGQTYQVFEILLIDDGSTDTSASICDQLSLRDNRIRVFHIENG-GASKARNFGLARISSESQFVTFVDSDDWVKENYLEVLLAQQEKY-NADIVISNYYIYRETEDIFGYYITDKDFVIEEISAQTAIDR-QVHWHLNSSVFIVIWGKLYRRELF--DTITFPIDKV--FEDELVSVLLFIKSKKTILVNGSYYGYRIRPNSIMTSAFSSKRAEDLIYI 238
>gi|160945700|ref|ZP_02092926.1| hypothetical protein FAEPRAM212_03232 [Faecalibacterium prausnitzii M21/2] >gi|158443431|gb|EDP20436.1| hypothetical protein FAEPRAM212_03232 [Faecalibacterium prausnitzii M21/2] (821 aa)
Score = 130, Expect = 8.2e-06, Identities = 34/112 (30%), Positives = 62/112 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFID---DNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           +S+++P  NTP  ++ +L+ S+ NQT +N+E+  +D   D      V       +  +Y + + +N G+    + G  LA G+YI  +D DD L+  A+ Y+ ++  K Q  DF+
  S:   285 ISIVVPLYNTPHDFLVELLDSVQNQTYRNWELCMVDAGQDADVGALVQERARTDSRIRY-RKLDSNEGIAGNTNQGFALATGDYIALLDHDDILHPCALWYVAEAIAK-QGADFV 397
>gi|99866980|gb|ABF67968.1| putative glycosyltransferase [Campylobacter jejuni] (270 aa)
Score = 130, Expect = 8.2e-06, Identities = 55/211 (26%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  I+D S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L  DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +   W      + W  CFKK+ ++K+  K+   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIINDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPDACEIAFKEMKK--GFDLLYFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQRHFCW------SVWAKCFKKDIILKSFEKVKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|167768638|ref|ZP_02440691.1| hypothetical protein CLOSS21_03197 [Clostridium sp. SS2/1] >gi|167710162|gb|EDS20741.1| hypothetical protein CLOSS21_03197 [Clostridium sp. SS2/1] (342 aa)
Score = 130, Expect = 8.4e-06, Identities = 50/221 (22%), Positives = 105/221 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQ-VYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK 224
           +S+I+P  N   K++ + + S+  Q+ K++E+  +DD ST+   +  D   K   +      +N G+   R+ G+ LA G+YI+++DSDD++  +A+  ++K+  K + +D + F Y    +        K   ++E  +K NV    +        + W   ++++F+ + K+    +  +  + Y   +   L  K L   +   +   L + S  N Y+
  S:     7 LSIILPIYNVE-KYLDRCMKSILKQSFKDYEIILVDDGSTDSSPILCDKYGKQLNKVKVLHKSNGGLSSARNAGLELAKGKYIFWLDSDDYISEEALSSIVKTLNKSE-VDILKFNYRRQPNDIIRKSLLKPGLYNEEEIKKNVIPLALEHVGEFTMSAWSHIYRRKFIEEEKLRFISEREVGSEDYLFNLQAFLSAKTLCAIEDDLYNYDLRLGSLSNKYR 226
>gi|189424584|ref|YP_001951761.1| glycosyl transferase family 2 [Geobacter lovleyi SZ] >gi|189420843|gb|ACD95241.1| glycosyl transferase family 2 [Geobacter lovleyi SZ] (857 aa)
Score = 130, Expect = 8.5e-06, Identities = 35/96 (36%), Positives = 55/96 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--------YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAI 99
           +SV++P  NTPL+++K+ I S+  Q  K +E+  +DD ST+ ++          DL  K  ++      NN  +    + G  LA GEYI  +D DD L  DA+
  S:   337 ISVVMPVYNTPLRYLKEAIDSVIAQVYKTWELCIVDDASTDSEIKGLLQEYERSDLRIKVVFR-----ENNGNISTATNSGFELAAGEYIALLDHDDLLTWDAL 435
Score = 96, Expect = 7.4e-02, Identities = 27/88 (30%), Positives = 47/88 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSD 91
           VS+IIP K+ P    + L +     T  N+EV  ID+N+T+P V   +++    + V+ I +     +  + GV  A GEY+  +++D
  S:   595 VSIIIPTKDAPQHIGRCLESIYTRSTYPNYEVIVIDNNTTDP-VARHILDNTPAKLVKFI-DKFNYSRANNIGVQEAAGEYVILLNND 680
>gi|32265704|ref|NP_859736.1| glycosyl transferase [Helicobacter hepaticus ATCC 51449] >gi|32261752|gb|AAP76802.1| conserved hypothetical glycosyl transferase [Helicobacter hepaticus ATCC 51449] (376 aa)
Score = 130, Expect = 8.5e-06, Identities = 56/187 (29%), Positives = 93/187 (49%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDW---------LYVDAIDYLL----KSFYKYQ----NIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDW---RVCFKKEFLVKNKISHPDKVNIFEDVYF 190
           VSVIIP  N   K++++ + S+ NQT +  E+  ++D ST+    I +   ++  + V     N GV K R+  + LA G++++F+DSDD+         LY +A+          F  Y+    N DF    Y + F          HN F E               + +YQ D+   R  + ++FL+ + I HP      + V+F
  S:     8 VSVIIPIYNVE-KYLRECLDSVINQTLREIEIICVNDGSTDKSGSILESFAQSDKRIVAIHKANAGVAKARNEALNLARGKFVYFIDSDDFCPSHDTLFTLYTNAVANQALICGGCFSDYKNGVINTDFPSILYGYTF---------THNGFVE---------------YKDYQFDFGWTRFIYDRKFLIDSHIFHPHYTRYEDPVFF 190
>gi|68644162|emb|CAI34287.1| putative glycosyl transferase [Streptococcus pneumoniae] (331 aa)
Score = 130, Expect = 8.5e-06, Identities = 35/106 (33%), Positives = 60/106 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +SV++P  N    ++++ + S+  QT KN E+  ++D S +  + I     NK+    V   PN  G+   R++G+  + GE+I FVDSDD++  D ++YL     KY
  S:    13 ISVVLPVYNVE-NYLEKCLNSVVRQTYKNIEIIIVNDGSLDSSIDICNKYANKDSRIKVFTKPNG-GLSDARNFGIKKSMGEFITFVDSDDYVTDDYVEYLYSLVKKY 118
>gi|120555528|ref|YP_959879.1| glycosyl transferase family protein [Marinobacter aquaeolei VT8] >gi|120325377|gb|ABM19692.1| glycosyl transferase, family 2 [Marinobacter aquaeolei VT8] (328 aa)
Score = 130, Expect = 8.7e-06, Identities = 58/218 (26%), Positives = 96/218 (44%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKV----NIFEDVYFGLIWKVLYK-KALLTSKKLYFYNRLNVESSLN 221
           +S+IIP  N    ++   + S+  Q+    EV  IDD ST+  + +    +    Y      N G G  R+ GV +A+ +YI+F DSDD L  + I  + K     Q  D ++F  E   D+  Q N +S + +    +  N        + HN        C    ++ K  +  PD +    N  ED    L + VL+   + L   +++F  R    S++N
  S:     6 ISIIIPAYNVD-HYLGAALDSIKAQSELPDEVILIDDGSTDRTLEVARAYEFSVPYRVVPIENGGQGNARNIGVGMASSQYIYFFDSDDLLTENFISSIKKRIRDNQRPDIVLFSGESFNDRDYQGNRWSDYRRGFSGMYFNRAEFLDQAYSHNAL-----FCSPCLYVSKKSLWGPDGLAFGPNFLEDE--ALFYPVLFACDSFLVIDEVFFLRRNREGSTMN 221
>gi|63029671|gb|AAY27730.1| putative glycosyltransferase [Campylobacter jejuni subsp. jejuni] (274 aa)
Score = 130, Expect = 8.7e-06, Identities = 57/211 (27%), Positives = 105/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA    LK   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CF+K+ ++K+  KI   + ++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACKIALKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEFFNQKEFLEFLSKQR----HFCWSV-WAKCFRKDVILKSFEKIKIDECLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|160947071|ref|ZP_02094238.1| hypothetical protein PEPMIC_01002 [Peptostreptococcus micros ATCC 33270] >gi|158446205|gb|EDP23200.1| hypothetical protein PEPMIC_01002 [Peptostreptococcus micros ATCC 33270] (325 aa)
Score = 130, Expect = 8.9e-06, Identities = 59/233 (25%), Positives = 108/233 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQF---DEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI 233
           M K+SVI+P  N   K++K+ + S++NQT +N E+  ++D +T N +       +N  +       N G+   R++G+    G+Y+ F+DSDD++    ++ L K+  K ++ D  +     V+   Q     +   F    E  +K      K+P    N    + +  K  F V           I+ED ++        KK ++T+K  Y+Y   + E+S+ T  Y   ++  I
  S:     1 MDKISVIVPVYNVE-KYVKKCLDSISNQTYENIEIIIVNDGATDNSENICKEFVENENRAKLYTKENGGLSSARNHGMRFVTGKYVLFIDSDDYIAEGMVEELYKNI-KGEDADVSVCGVYNVYSDNQSPQCKEEIYFCCGKERFLKEYFIGEKIPGTICNKLISYEIASKISFPVG---------KIYEDAFYQFELVKYAKKYVVTTKPYYYY--FHRENSITTKPYTVKNMNCI 224
>gi|22086361|gb|AAM90648.1|AF400669_9 putative glycosyltransferase [Campylobacter jejuni] (297 aa)
Score = 130, Expect = 9.3e-06, Identities = 58/211 (27%), Positives = 108/211 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFID----DNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  ID    DNS N  + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +    H  +   W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:    29 MPQLSIIIPLFNS-CDFISRALQSCINQTLKDIEILIIDNKSKDNSLN--MVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQR----HFCWSV-WAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 236
>gi|166366894|ref|YP_001659167.1| glycosyl transferase family protein [Microcystis aeruginosa NIES-843] >gi|166089267|dbj|BAG03975.1| glycosyl transferase family 2 [Microcystis aeruginosa NIES-843] (308 aa)
Score = 130, Expect = 9.3e-06, Identities = 36/107 (33%), Positives = 55/107 (51%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           VS+IIP  NT   +I + I S   QT  N E+  IDD ST+  + I     +    + +   N+GV   R+  + LA G ++  +DSDDW   + ++ LL+   K Q
  S:     7 VSIIIPAYNTE-SYIAKAIQSAQEQTLTNIEIIVIDDCSTDNTLAIAQSFNDPRIIIIHNSENLGVASTRNKAIKLAKGSWLALLDSDDWYEPNRLETLLEVAQKTQ 112
>gi|194244996|gb|ACF35266.1| putative glycosyltransferase [Streptococcus parasanguinis] (297 aa)
Score = 130, Expect = 9.6e-06, Identities = 33/94 (35%), Positives = 53/94 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNI--GVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M+K+SVIIP  N   K+++Q + S+  Q   N E+  ++D ST+    I    K     ++ +   I  G+G  R+  + L  G+YI F+DSDDW+
  S:     6 MEKISVIIPAYNAE-KYLEQCVESVRTQIYNNIEIIIVNDGSTDRTAEIIERLKEKDSRIRTLHKRINEGIGATRNSALELVTGQYILFLDSDDWI 100
>gi|157147112|ref|YP_001454431.1| hypothetical protein CKO_02889 [Citrobacter koseri ATCC BAA-895] >gi|157084317|gb|ABV13995.1| hypothetical protein CKO_02889 [Citrobacter koseri ATCC BAA-895] (357 aa)
Score = 130, Expect = 9.7e-06, Identities = 63/231 (27%), Positives = 116/231 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP-------NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI--NLFSKHNQFDEIIVKNNVNKS-KMPWFHNNYQTD------------WRVCFKKEFLVKNKISHPDKVNIFEDVYFG--LIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSII 234
           VS+I+P  N    ++++ + SL  QT ++ E+  ++D ST+     D++ +    Y   +P        N G+ + R+  +  A+GEYI+ +DSDD +  D I+ +++   K+ ++D + F     F    I  N+ S + Q      +N +NK+     F N+  T+            W   ++++     +   P     FED YF   L+  V   K    + +LYF+   N   S+ T   KA   ++I+
  S:     6 VSIILPVYNVS-AYLERCLDSLVAQTWRHLEIIAVNDGSTDNSR--DILAR----YQSRLPGMRIVDQENRGLAEARNAALASASGEYIYCLDSDDHIASDGIETIVREMEKH-HLDVLFFSTHLEFHLHHISNNMVSGYYQRP----RNLINKTFHAETFFNHCITERARTGHGYSVVVWGYTWRRKTYAHMRFKTP----FFEDEYFTTELLLSVPDAKVRCLADRLYFHTIRN--GSITTSSSKAKRALAIL 242
>gi|29376689|ref|NP_815843.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] >gi|29344153|gb|AAO81913.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] (1047 aa)
Score = 130, Expect = 1.0e-05, Identities = 40/143 (27%), Positives = 77/143 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP-----NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK-KQINLFSKHNQFDEIIVKNN 145
           K+SV +P  N   KW+   ++SL NQ  +N+E+   DD S  P  +I  + +   +  Q I       N  + +  +  +++A G++I F+D+DD L   A+  ++K+      IDF+  + + + +  ++ N F K +   E+I+ +N
  S:   555 KISVAVPVYNVEEKWLAACVSSLQNQYYENWELCLADDAS--PSEHIKPMLEKYKELDQRIKVIYREENGHISEATNSALSIATGDFIGFMDNDDELAPQALYEVVKALNTDPTIDFLYTDEDKITENGRRFNAFYKSDWNPELILNHN 701
>gi|153854427|ref|ZP_01995705.1| hypothetical protein DORLON_01700 [Dorea longicatena DSM 13814] >gi|149752953|gb|EDM62884.1| hypothetical protein DORLON_01700 [Dorea longicatena DSM 13814] (605 aa)
Score = 130, Expect = 1.0e-05, Identities = 33/113 (29%), Positives = 65/113 (57%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ----YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           K+S+++P  NTP  ++KQ+I S+  QT  N+E+   + N +N +V   ++N  G +     V ++P N G+ +  +  + +A GE++  +D DD L  +A+  ++    K +  D +
  S:    76 KISILVPVYNTPEVFLKQMIQSVRKQTYTNWELCIANANPSNQEVS-SILNVAGKKDNRIKVVDVPENEGIAQNTNRALEIATGEFVGLLDHDDLLEENALYEIVSCLNKDRKTDVL 191
>gi|153166417|ref|ZP_01927003.1| hypothetical protein LMHG_02104 [Listeria monocytogenes FSL N1-017] >gi|133727614|gb|EBA29312.1| hypothetical protein LMHG_02104 [Listeria monocytogenes FSL N1-017] (327 aa)
Score = 130, Expect = 1.0e-05, Identities = 39/114 (34%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   +++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-EYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVEICLDTVQK-TNADLVLF 115
>gi|22537322|ref|NP_688173.1| glycosyl transferase CpsJ(V) [Streptococcus agalactiae 2603V/R] >gi|77412218|ref|ZP_00788537.1| glycosyl transferase CpsJ [Streptococcus agalactiae CJB111] >gi|13549136|gb|AAK29658.1|AF349539_12 CpsVJ [Streptococcus agalactiae] >gi|22534193|gb|AAN00046.1|AE014245_4 glycosyl transferase CpsJ(V) [Streptococcus agalactiae 2603V/R] >gi|77161725|gb|EAO72717.1| glycosyl transferase CpsJ [Streptococcus agalactiae CJB111] >gi|90576969|gb|ABD95560.1| CpsJ [Streptococcus agalactiae] >gi|90576988|gb|ABD95578.1| CpsJ [Streptococcus agalactiae] >gi|90577027|gb|ABD95615.1| CpsJ [Streptococcus agalactiae] >gi|90577035|gb|ABD95622.1| CpsJ [Streptococcus agalactiae] >gi|90577060|gb|ABD95646.1| CpsJ [Streptococcus agalactiae] >gi|90577082|gb|ABD95667.1| CpsJ [Streptococcus agalactiae] >gi|90577086|gb|ABD95670.1| CpsJ [Streptococcus agalactiae] (321 aa)
Score = 130, Expect = 1.0e-05, Identities = 40/111 (36%), Positives = 64/111 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYV-DAIDYLLKSFYKYQN 111
           M KVS+IIP  N    ++ + I S+  QT  N E+  ++D ST N     D  ++   +      NN G+   R+YG++ A G+YI+ +DSDD+LY  DAI+ +++   KY +
  S:     1 MDKVSIIIPVYNVQ-SFLNECIESVLAQTYSNLEIILVNDGSTDNSGDICDYYSEIDGRIFVFHKNNGGLSDARNYGISRATGDYIYLLDSDDYLYKEDAIERMVEFSEKYNS 112
>gi|18033347|gb|AAL57083.1|AF332897_6 CpsI [Streptococcus agalactiae] (264 aa)
Score = 129, Expect = 1.0e-05, Identities = 73/247 (29%), Positives = 126/247 (51%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFK--KEFLVKNKISHPDKVNIFEDVYFGLIWKVL---YKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLENKLFN 248
           +KV+VIIP  N+   ++K+ + S+  QT+   EV  IDD ST N     D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+    +N D    +++   ++       K   F ++   NN  K     F +  + +  VC K  K+ ++ N +   + + I ED+ F    K+L   ++  + T+  LY Y R+   S++N  K+  N L  I IF   + L+  KL N
  S:     3 EKVTVIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGGICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLIT-ENADIAEVDFDISNERDYRK--KKRRNFYKVFKNNNSLKE----FLSGNRVENIVCTKLYKKSIIGN-LRFDENLKIGEDLLFNC--KLLCQEHRIVVDTTSSLYTY-RIVKTSAMNQ-KFNENSLDFITIFNEVSSLVPAKLAN 243
>gi|182624666|ref|ZP_02952448.1| beta-1,4-galactosyltransferase [Clostridium perfringens D str. JGS1721] >gi|177910270|gb|EDT72658.1| beta-1,4-galactosyltransferase [Clostridium perfringens D str. JGS1721] (342 aa)
Score = 129, Expect = 1.0e-05, Identities = 37/105 (35%), Positives = 57/105 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKS 105
           + KVS+I+P       ++ + I S+ NQ+ KN E+  +DD S +     IDL  K   +       N G+   R+YG+    G+Y+ FVDSDDWL  D +  L+K+
  S:     2 LPKVSLIVPIYKVQ-DYLNKCIDSIINQSYKNLEIILVDDGSPDRCGEIIDLYEKQDNRIKVFHKKNGGLSDARNYGMNFITGDYVIFVDSDDWLSEDMVSDLMKT 106
>gi|119485677|ref|ZP_01619952.1| Glycosyl transferase, family 2 [Lyngbya sp. PCC 8106] >gi|119457002|gb|EAW38129.1| Glycosyl transferase, family 2 [Lyngbya sp. PCC 8106] (1237 aa)
Score = 129, Expect = 1.0e-05, Identities = 44/174 (25%), Positives = 81/174 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAID---YLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN 174
           M +VSV+IP  N    +I Q + S+  QT ++FE+  ++D S++  V   L N +    + +   N G     +YG+  A GE I  + SDD      ++     L    +YQ +      Y  + D +  NL   ++  D++ ++   N+++  W +  +  D  +C     + KN
  S:     1 MPRVSVVIPAYNQA-AYISQAVDSVLRQTYQDFEIIIVNDGSSDQTVEKILENNDPRIRLFSFEQNHGESIATNYGIQQAQGELIAILHSDDVFVPKKLEKQVLFLDQNPQYQAV----LSYPQLIDSQGENLPPSNSFLDQVFLQQ--NRTRFQWLNTFFSKDNCLCQTSSLIRKN 170
>gi|163791355|ref|ZP_02185767.1| putative glycosyltransferase [Carnobacterium sp. AT7] >gi|159873378|gb|EDP67470.1| putative glycosyltransferase [Carnobacterium sp. AT7] (353 aa)
Score = 129, Expect = 1.1e-05, Identities = 56/223 (25%), Positives = 110/223 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ-NIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFG-LIWKVLYKKALLTSKKLYFYNRLNVESSLNTY 223
           M  VS+I+P  N     + + I SL +QT ++FE+  ++D ST+    I D   +   + +     N G G  R+ G+  A GEYI+F D DD++  + I+  LK   + Q N+    + +E +  +K+I   ++      +  K +  KS   +   +    W   +K  +L++N     D+  + +D  F  L+++ L  +++  ++  Y++    + S++N Y
  S:     1 MVAVSIIMPIYNVA-DALGKSIQSLLDQTYQDFELILVNDGSTDSSGRICDEFQRKDSRILVVHQENAGSGFARNAGLDQATGEYIYFSDPDDYVEAELIEENLKIALENQANMVVFGYYFEEMNSRKKIKRTTQLPTLSVVTTKEDFRKSFRAFQGLDSNVLWNKLYKHLYLLENNCRFTDQ-RVGQDALFNHLVYRNL--ESVYFNQIPYYHYVSRMGSAINRY 222
>gi|28916147|gb|AAO59432.1| glycosyltransferase [Aeromonas hydrophila] (743 aa)
Score = 129, Expect = 1.1e-05, Identities = 55/190 (28%), Positives = 95/190 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT------NKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI----PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNY----QTDWRVCFKKEFLVKNKISHPDKVNIFEDVYF 190
           MK V+VI+P  N   K+I++ I S+  Q+        + E+ FIDD S  P    ++I K   +Y +NI      N G    R+  + +A+GEYI+F+DSDD L  +A+  L K     +    ++  +   F+ ++      H +        + +  K+ ++H +        W   +K+E L +N I  P  + + ED  F
  S:     1 MKLVTVIVPVYNVE-KYIEECIDSILTQSIDGIKCEDSIEIIFIDDGS--PDSSSEIIQKYQEKY-KNIFLISQENAGQSVARNNAINIASGEYIFFLDSDDLLPPNALSPLYK--LAKETDSEVIISHSKAFNSRRSWFVDDHAEV------ASASFRKINFYHRSILVKTPAPWAKLYKRELLTRNDIKFPVGIKLAEDWIF 192
>gi|22537600|ref|NP_688451.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae 2603V/R] >gi|76797656|ref|ZP_00779926.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae 18RS21] >gi|77413522|ref|ZP_00789711.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae 515] >gi|22534484|gb|AAN00324.1|AE014258_11 glycosyl transferase, group 2 family protein [Streptococcus agalactiae 2603V/R] >gi|76587017|gb|EAO63505.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae 18RS21] >gi|77160410|gb|EAO71532.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae 515] (295 aa)
Score = 129, Expect = 1.1e-05, Identities = 68/232 (29%), Positives = 117/232 (50%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGE--YIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI---NLFSKHNQFDEIIVKNNVNKSKMPWFHNN--YQTDWRVCFKKEFLVKNKISHP-DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN-RLNVESSLNTYKYKANDLVSI 233
           K VSVIIP  N    +++  + ++  QT + FE+  IDD ST+    I   L  ++    V +I N  G  K R++G+   + E  ++ FVDSDDW+  + ++ LL    KY N D ++  Y    + + I    +  K    +EI  +  +++ ++ W  N+  +   W   +++E    + I+ P DKV  FED    ++  +  KK +L +   Y Y  R N   +      +A DL+ I
  S:     8 KLVSVIIPVYNAA-PYLEGCVNTILGQTYQVFEILLIDDGSTDTSASICDQLSLRDNRIRVFHIENG-GASKARNFGLARISPESQFVTFVDSDDWVKENYLEVLLAQQEKY-NADIVISNYYIYRETEDIFGYYITDKDFVIEEISAQTAIDR-QVHWHLNSSVFIVIWGKLYRRELF--DTITFPIDKV--FEDELVSVLLFIKSKKTILVNGSYYGYRIRPNSIMTSAFSSKRAEDLIYI 242
>gi|157376085|ref|YP_001474685.1| glycosyl transferase family protein [Shewanella sediminis HAW-EB3] >gi|157318459|gb|ABV37557.1| glycosyl transferase, family 2 [Shewanella sediminis HAW-EB3] (347 aa)
Score = 129, Expect = 1.1e-05, Identities = 33/97 (34%), Positives = 52/97 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAI 99
           KVSV++P  N    ++KQ I S+  QT  +FE+  ++D ST+  + I     +    V N   N G+   R+ G+  A G Y+ F+DSDD  + D +
  S:     4 KVSVVMPIYNVQ-HFVKQAINSVLAQTFTDFELILVNDCSTDKSLEISRTILDHRIRVVNHVTNKGLAAARNTGIRHAIGRYVAFIDSDDMWHADKL 99
>gi|68644261|emb|CAI34367.1| putative glycosyl transferase [Streptococcus pneumoniae] (321 aa)
Score = 129, Expect = 1.1e-05, Identities = 38/109 (34%), Positives = 61/109 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           M KVS+++P  N    ++K  I SL NQ+ K+ E+  +DD ST+    I      ++    V +I N  G+   R+ GV  A+ E+I F+DSDD+     ++YL++   KY
  S:     1 MGKVSIVVPVYNVE-DYLKYCIDSLINQSYKDIEIILVDDGSTDDSGRICDKYAQEDDRIRVLHIENG-GLSNARNTGVKFASAEWIIFIDSDDYYDRRTVEYLVQLQKKY 109
>gi|189464341|ref|ZP_03013126.1| hypothetical protein BACINT_00682 [Bacteroides intestinalis DSM 17393] >gi|189438131|gb|EDV07116.1| hypothetical protein BACINT_00682 [Bacteroides intestinalis DSM 17393] (329 aa)
Score = 129, Expect = 1.1e-05, Identities = 34/89 (38%), Positives = 52/89 (58%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSD 91
           + SVIIP  N P + + +L+ SL  Q  K+FEV  ++D S+ P +  +D   K    +  N PN+ G G+ R+YG   + GEY+  +DSD
  S:     2 RYSVIIPVYNRPDE-VDELLQSLTEQNFKDFEVVIVEDGSSIPCKEVVDRYQKQLDIHYYNKPNS-GPGQTRNYGAERSTGEYLIILDSD 89
>gi|3608403|gb|AAC35929.1| putative glycosyl transferase [Enterococcus faecalis] (535 aa)
Score = 129, Expect = 1.1e-05, Identities = 39/143 (27%), Positives = 77/143 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP-----NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK-KQINLFSKHNQFDEIIVKNN 145
           K+SV +P  N   KW+   ++SL NQ  +N+E+   DD S  P  +I  + +   +  Q I       N  + +  +  +++A G+++ F+D+DD L   A+  ++K+      IDF+  + + + +  ++ N F K +   E+I+ +N
  S:    91 KISVAVPVYNVEEKWLAACVSSLQNQYYENWELCLADDAS--PSEHIKPMLEKYKELDQRIKVIYREENGHISEATNSALSIATGDFVGFMDNDDELAPQALYEVVKALNTDPTIDFLYTDEDKITENGRRFNAFYKSDWNPELILNHN 237
>gi|168830443|gb|ACA34487.1| WaaV [Campylobacter jejuni] (325 aa)
Score = 129, Expect = 1.1e-05, Identities = 54/211 (25%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R++GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CF+++ ++K+  K+   + ++  EDV F  ++ +  +K  +    +Y Y
  S:    44 MPQLSIIIPLFNS-CNFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNFGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQR----HFCWSV-WAKCFRRDIILKSFEKVKIDECLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 251
>gi|151570880|gb|EDN36534.1| hypothetical protein FTCG_00735 [Francisella tularensis subsp. novicida GA99-3549] (330 aa)
Score = 129, Expect = 1.1e-05, Identities = 36/106 (33%), Positives = 59/106 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D ST+  + I    K+    +  +   N G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:     5 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIILINDGSTDNSLSICQKYKSKDNRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 110
>gi|153809655|ref|ZP_01962323.1| hypothetical protein RUMOBE_00036 [Ruminococcus obeum ATCC 29174] >gi|149833833|gb|EDM88913.1| hypothetical protein RUMOBE_00036 [Ruminococcus obeum ATCC 29174] (249 aa)
Score = 129, Expect = 1.2e-05, Identities = 35/90 (38%), Positives = 54/90 (60%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDW 93
           +SVI+P  N     I+Q + S+  Q N   E+  IDD ST+   +V     N+  + Y++N P+NIG    R+ GV  A+G+Y+ F+D+DDW
  S:     8 ISVIMPVYNGGFT-IRQAVESVFCQ-NIPLELLVIDDGSTDQTSEVLSVYRNRPDFHYLKN-PHNIGAAASRNRGVQEAHGQYVAFLDADDW 96
>gi|94972353|ref|YP_595573.1| Cps2K [Lawsonia intracellularis PHE/MN1-00] >gi|94731890|emb|CAJ53933.1| Cps2K [Lawsonia intracellularis PHE/MN1-00] (339 aa)
Score = 129, Expect = 1.2e-05, Identities = 54/209 (25%), Positives = 100/209 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKH-NQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           ++SVIIP   +  + I + + S  +QT KNFE+  + DN  +    V  + +N+   Q    +    G G  R+ G++L+ G YI F D+DD++  + +  +L S  K+ + DFI   ++ +     I  FSK   +F + I +  V    +      +   W   FK+  +  ++    + ++ +ED  F L      K+ ++  + LY Y
  S:     2 EISVIIPVYKS--QDIARCLDSFLSQTYKNFEIICVGDNVKDECHNVIKEYVNRYPEQIQFVLQKGRGQGGARNLGISLSKGNYIMFCDADDYVEQNILQIMLSSLIKF-DADFICCGFDRISVSGHI--FSKEMMKFSQTIFQ--VTPQNINTLAYIFPAPWGKIFKRSIIGDSRFPE-NPISAYEDCIFFLSLAPKIKRYVILPQILYHY 205
>gi|18033354|gb|AAL57089.1|AF332898_6 CpsI [Streptococcus agalactiae] (264 aa)
Score = 129, Expect = 1.2e-05, Identities = 73/247 (29%), Positives = 127/247 (51%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFK--KEFLVKNKISHPDKVNIFEDVYFGLIWKVL---YKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLENKLFN 248
           +KV+VIIP  N+   ++K+ + S+  QT+   EV  IDD ST+    I D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+    +N D    +++   ++       K   F ++   NN  K     F +  + +  VC K  K+ ++ N +   + + I ED+ F    K+L   ++  + T+  LY Y R+   S++N  K+  N L  I IF   + L+  KL N
  S:     3 EKVTVIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGEICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLIT-ENADIAEVDFDISNERDYRK--KKRRNFYKVFKNNNSLKE----FLSGNRVENIVCTKLYKKSIIGN-LRFDENLKIGEDLLFNC--KLLCQEHRIVVDTTSSLYTY-RIVKTSAMNQ-KFNENSLDFITIFNEVSSLVPAKLAN 243
>gi|167767619|ref|ZP_02439672.1| hypothetical protein CLOSS21_02152 [Clostridium sp. SS2/1] >gi|167710636|gb|EDS21215.1| hypothetical protein CLOSS21_02152 [Clostridium sp. SS2/1] (319 aa)
Score = 129, Expect = 1.2e-05, Identities = 58/230 (25%), Positives = 107/230 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDL 230
           M+ VS+IIP       ++ + + ++ NQT +N E+  IDD S +  P++      K+    V +  N  G    R++G+ +A GEYI F+DSDD +  + ++ LL +  K Q+   +    +W  +K Q ++  K+ ++     K+ + K    W        W   F K+ L   +     K+   +D +F     +  +K  +  + LY+Y        L+  +Y+A  L
  S:     2 MELVSMIIPVYGVE-AYLGECLETVLNQTYENLEIILIDDESPDYCPEICDQHAQKDARIKVIHQKNG-GAANARNHGLDMATGEYICFIDSDDKIENNYVEKLLNAIKKSQSDVAVCSFKQWYKNKTQDSIGFKNKEYSS---KDYIRKFLSDW---TCGLIWNKMFDKKTLEGVRFEEGHKI---DDEFFTYQAILKAEKVAIFDESLYWYRMRKSGVMLSGTQYQAQML 222
>gi|167453739|ref|ZP_02319962.1| hypothetical protein LmonocytoFSL_07618 [Listeria monocytogenes FSL J2-064] (224 aa)
Score = 129, Expect = 1.2e-05, Identities = 39/114 (34%), Positives = 64/114 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           VSVIIP  N   +++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K  N D ++F
  S:     5 VSVIIPVYNVE-EYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVEICLDTVQK-TNADLVLF 115
>gi|118579844|ref|YP_901094.1| glycosyl transferase family protein [Pelobacter propionicus DSM 2379] >gi|118502554|gb|ABK99036.1| glycosyl transferase, family 2 [Pelobacter propionicus DSM 2379] (261 aa)
Score = 129, Expect = 1.2e-05, Identities = 34/106 (32%), Positives = 58/106 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSF 106
           M +VSVIIP  N   +++ + I S+  QT  + E+  +DD S++P     +D +N+   + ++    N G+   R+ G+  A+G YI  +D DD +  D I   L +F
  S:     4 MPEVSVIIPCYNQG-QYLHEAIDSVLGQTFSDLEIIVVDDGSSDPATREVLDALNRTATRLLRR--KNGGLAAARNSGINAAHGRYILPLDCDDRIAPDYIRQALAAF 108
>gi|90577002|gb|ABD95591.1| CpsJ [Streptococcus agalactiae] (321 aa)
Score = 129, Expect = 1.2e-05, Identities = 40/111 (36%), Positives = 64/111 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYV-DAIDYLLKSFYKYQN 111
           M KVS+IIP  N    ++ + I S+  QT  N E+  ++D ST N     D  ++   +      NN G+   R+YG++ A G+YI+ +DSDD+LY  DAI+ +++   KY +
  S:     1 MDKVSIIIPVYNVQ-SFLNECIESVLAQTYSNLEIILVNDGSTDNSGDICDYYSEIDGRIFVFHKNNGGLSDARNYGISRATGDYIYLLDSDDYLYKEDAIERMVEFSEKYNS 112
>gi|154148811|ref|YP_001407015.1| putative glycosyltransferase [Campylobacter hominis ATCC BAA-381] >gi|153804820|gb|ABS51827.1| putative glycosyltransferase [Campylobacter hominis ATCC BAA-381] (327 aa)
Score = 129, Expect = 1.2e-05, Identities = 72/243 (29%), Positives = 119/243 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINK-----NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI--NLFSKHN-QFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIF---EDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKA--NDLVSIIFKNKNYLLENKL 246
           VS+I+P  N    +I++  T+L  Q   N E  F++D + +  + +  ++I K     +G Q + N   N G+ + R  G+  +NGEYI  VDSDDW+ +D +  L+    K  + D ++ +Y   + KK+I    F   N   D+II+K               +    +C K   LV+ +I       +F   ED++  L +  + KK    ++  Y YN+ N  S    Y+     NDL       KN+L +N L
  S:     6 VSIIVPVYNVE-NFIEKCATTLFEQDYDNIEYIFVNDCTPDGSISVLKEIIEKYPNRKSGIQII-NKEKNEGLPQARKTGLKNSNGEYIMHVDSDDWVELDMVSSLIGEAIK-TDADMVICDYYINYSKKEIYKKTFPISNLSSDDIIIKT-----------LTLEILSSMCCK---LVRKEIYSKVIFPVFSNREDMFVNLQFYSIIKKYSYLNRAFYHYNKANDSSITQNYENNKNINDLRDFYIVTKNFLQDNSL 246
>gi|167014425|ref|ZP_02276958.1| hypothetical protein LmonFS_06411 [Listeria monocytogenes FSL J1-194] >gi|167214220|ref|ZP_02284527.1| hypothetical protein LmonoFSL_08396 [Listeria monocytogenes FSL R2-503] (110 aa)
Score = 129, Expect = 1.2e-05, Identities = 36/105 (34%), Positives = 59/105 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           VSVIIP  N   +++K+ + S+  QT  N EV  ++D +T N    I  I+ N  +Y +    N G    R++G+ +A G+YI  VDSDD++  + ++  L +  K
  S:     5 VSVIIPVYNVE-EYVKRCLDSVLEQTYHNLEVIVVNDGATDNSAKVIKSISDNRIRYFEK--ENGGQATARNFGLDVATGDYIVMVDSDDYISKNLVEICLDTVQK 107
>gi|196253972|ref|ZP_03152570.1| glycosyl transferase family 2 [Clostridium thermocellum DSM 4150] >gi|196196618|gb|EDX91517.1| glycosyl transferase family 2 [Clostridium thermocellum DSM 4150] (323 aa)
Score = 129, Expect = 1.2e-05, Identities = 65/238 (27%), Positives = 107/238 (44%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI----DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSL--NTYKYKANDLVSIIFKNKNYL 241
           +++IIP  NT  K++ +L+  LN Q N   +V  IDD ST+  + I      IN N     Q    N G    R+ G+  A GEY+ F+DSDD +  + I+ + +   K    D I  ++       +   F K NQ  + ++   +    +          W   FK   +++N+I   D + + ED+ F L  +V+    ++  +    Y  LN  S L  N      NDL  +    KN++
  S:     5 LTLIIPVYNTE-KYLDKLLPKLNGQINDLVQVILIDDGSTDSSLEICNKFSSINSNFTVIHQE---NKGASAARNNGIRNAKGEYMAFLDSDDMITDNYIEVVCR-LCKESRADIIQLDH--YCGSPETGYFLKKNQLPQGLIPYEIFCKFL--LEQKSNPLWNKIFKSSCIIENEIYFDDSMIMGEDISFTL--EVMKYSNIIQVEHEAVYYYLNNRSGLCANVKTNYLNDLDKLYSNMKNFV 237
>gi|77918871|ref|YP_356686.1| putative glycosyl transferase [Pelobacter carbinolicus DSM 2380] >gi|77544954|gb|ABA88516.1| putative glycosyl transferase [Pelobacter carbinolicus DSM 2380] (300 aa)
Score = 129, Expect = 1.2e-05, Identities = 32/98 (32%), Positives = 61/98 (62%)
  Q:     5 SVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP---------NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           S+IIP  N   ++I++ + S+ +Q+ +++E+  +DD ST+     D+I    +     +P         +N G    R++G+  A G++IWF+DSDD L  +A+++L
  S:     4 SIIIPTYNYG-RYIERCLLSILDQSGEDYEIVVVDDGSTDDTR--DVIKT--FMQKHKLPVGRLRLLHQSNQGPAAARNHGIAKARGDFIWFLDSDDRLAPNALEHL 105
>gi|13876780|gb|AAK43612.1|AF355776_12 putative glycosyltransferase CpsIVJ [Streptococcus agalactiae] (315 aa)
Score = 129, Expect = 1.2e-05, Identities = 74/272 (27%), Positives = 134/272 (49%)
  Q:    16 KWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQN--IDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPW--FHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLE--NKLFNNNWYFYASNWLGALNQL-NYIDLINVQKTHNKFIGNNNFY 287
           K++++ I S+ NQT KN E+  +DD ST N  +  D  +    +      NN G+   R++GV  A G YI F+DSDD  Y+D  +Y+ K +Y   N  +D ++  Y  V++     + S+     + I+ + V      +  + + + T W    + +  +  K++ P    + ED +    + +   K     + LYFY R   E+S+ +  Y   +L S+  ++ +  +LE  N   +   Y Y S  L  + ++  Y ++ N Q+  +KF   NN+Y
  S:    17 KFLEECIDSVLNQTYKNIEILLVDDGSTDNSGIICDNYSLKDKRIRVFHKNNGGLSDARNFGVVNAEGRYISFIDSDD--YIDK-NYIRKMYYCLSNHKVDMVICNYLSVYNNDLKPIVSR---LQDCIIYSRVELFSNLYGKYKDPFTTAWGSLIRTD--IAKKVTFPIG-KLHEDEFTTYKYYLYSDKIAFVPEPLYFYRRR--EASIMSSSYSKRNLDSLEAYEERIKILEKNNISISETVYIYLSLILYHIYRIRKYPEVCNKQELLDKF---NNYY 283
>gi|168485495|ref|ZP_02710003.1| Eps5I [Streptococcus pneumoniae CDC1087-00] >gi|168486641|ref|ZP_02711149.1| Eps5I [Streptococcus pneumoniae CDC1087-00] >gi|168487593|ref|ZP_02712101.1| Eps5I [Streptococcus pneumoniae CDC1087-00] >gi|183569600|gb|EDT90128.1| Eps5I [Streptococcus pneumoniae CDC1087-00] >gi|183570385|gb|EDT90913.1| Eps5I [Streptococcus pneumoniae CDC1087-00] >gi|183571189|gb|EDT91717.1| Eps5I [Streptococcus pneumoniae CDC1087-00] (333 aa)
Score = 129, Expect = 1.3e-05, Identities = 59/208 (28%), Positives = 106/208 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFDEI-IVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFY 211
           ++++IP  N   K++K+ I S+ +Q    +EV  ++D ST+    I       Y ++  I   N G+ + R+ G++ ANG+Y++F+DSDDW+  D    L K   + QN D + F  +    +++   N+  K   F+     KN ++   +  F  +        +K+E   KN I  P     +ED+  G ++K++   KK  LT++  Y Y
  S:     8 LTIVIPVYNVE-KYLKRCIDSVISQEWDKYEVILVNDGSTDASPNICEEYAQKYHFISVIHKENGGLSETRNTGLSHANGKYVFFLDSDDWITKDMFRNLSKMIME-QNYDILQFGMQMFHSEREELKNVQCKEKNFNSSDAFKNMLSVEGITSFATDK------IYKRELFEKNGIEFPIGY-FYEDL--GTVYKLILSAKKIYLTTQVYYCY 210
>gi|68642454|emb|CAI32864.1| putative glycosyl transferase [Streptococcus pneumoniae] (337 aa)
Score = 129, Expect = 1.3e-05, Identities = 59/208 (28%), Positives = 106/208 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFDEI-IVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFY 211
           ++++IP  N   K++K+ I S+ +Q    +EV  ++D ST+    I       Y ++  I   N G+ + R+ G++ ANG+Y++F+DSDDW+  D    L K   + QN D + F  +    +++   N+  K   F+     KN ++   +  F  +        +K+E   KN I  P     +ED+  G ++K++   KK  LT++  Y Y
  S:    12 LTIVIPVYNVE-KYLKRCIDSVISQEWDKYEVILVNDGSTDASPNICEEYAQKYHFISVIHKENGGLSETRNTGLSHANGKYVFFLDSDDWITKDMFRNLSKMIME-QNYDILQFGMQMFHSEREELKNVQCKEKNFNSSDAFKNMLSVEGITSFATDK------IYKRELFEKNGIEFPIGY-FYEDL--GTVYKLILSAKKIYLTTQVYYCY 214
>gi|68642536|emb|CAI32932.1| putative glycosyl transferase [Streptococcus pneumoniae] (337 aa)
Score = 129, Expect = 1.3e-05, Identities = 59/208 (28%), Positives = 106/208 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ--INLFSKHNQFDEI-IVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLY--KKALLTSKKLYFY 211
           ++++IP  N   K++K+ I S+ +Q    +EV  ++D ST+    I       Y ++  I   N G+ + R+ G++ ANG+Y++F+DSDDW+  D    L K   + QN D + F  +    +++   N+  K   F+     KN ++   +  F  +        +K+E   KN I  P     +ED+  G ++K++   KK  LT++  Y Y
  S:    12 LTIVIPVYNVE-KYLKRCIDSVISQEWDKYEVILVNDGSTDASPNICEEYAQKYHFISVIHKENGGLSETRNTGLSHANGKYVFFLDSDDWITKDMFRNLSKMIME-QNYDILQFGMQMFHSEREELKNVQCKEKNFNSSDAFKNMLSVEGITSFATDK------IYKRELFEKNGIEFPIGY-FYEDL--GTVYKLILSAKKIYLTTQVYYCY 214
>gi|119489295|ref|ZP_01622102.1| hypothetical protein L8106_07566 [Lyngbya sp. PCC 8106] >gi|119454769|gb|EAW35914.1| hypothetical protein L8106_07566 [Lyngbya sp. PCC 8106] (297 aa)
Score = 129, Expect = 1.3e-05, Identities = 42/143 (29%), Positives = 78/143 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKH-----NQFDEIIVK 143
           M  +SVIIP  N   K IK+ I S+ NQT  ++E+  +DD ST+    +    K+   ++ + PN  GV   R+ GV  ++GE++ F+D+DD    D ++  LK+  ++          +++ +  QI    +H     N +++++V+
  S:     1 MPIISVIIPAYNAE-KTIKKTIQSVLNQTFLDWELIVVDDGSTDSTKEVVAEIKDNRIFLFSFPN-AGVSAARNRGVNKSSGEFLAFIDADDLWTPDKLELQLKALQEHPKAAVAYSWTDYIDESDQIIYSGRHITLNGNIYEKLLVR 146
>gi|15901601|ref|NP_346205.1| glycosyl transferase family protein [Streptococcus pneumoniae TIGR4] >gi|111658226|ref|ZP_01408919.1| hypothetical protein SpneT_02000583 [Streptococcus pneumoniae TIGR4] >gi|14973268|gb|AAK75845.1| glycosyl transferase, family 2/glycosyl transferase family 8 [Streptococcus pneumoniae TIGR4] (696 aa)
Score = 128, Expect = 1.3e-05, Identities = 33/108 (30%), Positives = 60/108 (55%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           K++VI+P  N    ++++ + S+  QT KN E+  ++D ST+    I    ++  ++ +     N G+   R+ G+   +G Y+ FVDSDDW+  D ++ L K   +YQ
  S:     6 KITVIVPVYNVE-NYLRKCLDSIITQTYKNIEIVVVNDGSTDASGEICKEFSEMDHRILYIEQENAGLSAARNTGLNNMSGNYVTFVDSDDWIEQDYVETLYKKIVEYQ 113
>gi|57790357|gb|AAW56103.1| Cj81-010 [Campylobacter jejuni] (120 aa)
Score = 128, Expect = 1.4e-05, Identities = 37/117 (31%), Positives = 64/117 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           M K+S+I+P  N   ++I + I S  NQT K+ E+  +DD   +  + I        + ++ I N  N+G+ + R  GV +AN  YI F+D DD+L ++A +  +K   +   +D + F
  S:     1 MFKISIILPTYNVE-QYIARAIESCINQTFKDIEIIVVDDCGNDNSINIAKEYSKKDKRIKIIHNEKNLGLLRARYEGVKVANSPYIMFLDPDDYLELNACEECIKILDEQDEVDLVFF 118
>gi|18033361|gb|AAL57095.1|AF332899_6 CpsI [Streptococcus agalactiae] >gi|18033368|gb|AAL57101.1|AF332900_6 CpsI [Streptococcus agalactiae] (264 aa)
Score = 128, Expect = 1.4e-05, Identities = 71/247 (28%), Positives = 125/247 (50%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFK--KEFLVKNKISHPDKVNIFEDVYFGLIWKVL---YKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLENKLFN 248
           +KV+VIIP  N+   ++K+ + S+  QT+   EV  IDD ST N     D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+    +N D    +++   ++       K   F ++   NN  K     F +  + +  VC K  K+ ++ N +   + + I ED+ F    K+L   ++  + T+  LY Y    V++S+   K+  N L  I IF   + L+  +L N
  S:     3 EKVTVIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGEICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLIT-ENADIAEVDFDISNERDYRK--KKRRNFYKVFKNNNSLKE----FLSGNRVENIVCTKLYKKSIIGN-LRFDENLKIGEDLLFNC--KLLCQEHRIVVDTTSSLYTYRI--VKTSVMNQKFNENSLDFITIFNEISSLVPARLAN 243
>gi|86151134|ref|ZP_01069350.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842304|gb|EAQ59550.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 260.94] (270 aa)
Score = 128, Expect = 1.5e-05, Identities = 55/211 (26%), Positives = 104/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L   A +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNIGVLHSSSDFIMFLDSDDFLTPGACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDGVFNQKEFLEFLSKQRHFCW------SVWAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|166984670|ref|ZP_02256003.1| glycosyltransferase family 2 [Bacillus cereus AH187] (353 aa)
Score = 128, Expect = 1.5e-05, Identities = 79/295 (26%), Positives = 130/295 (44%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTD-WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNNNW------YFYASNWLGALNQLNYID---LINVQKTHNKFIGNNNFYNLETIGFHK 296
           K VS+I+P  N   K++ + I SL  QT KN E+  I+D ST+    I     N    ++ I   N G    R+ G+ +ANG YI FVDSDD++  +  + +LK+      +    ++   +F+ K IN+             ++        F + Y    W   +    + +N +   D V + ED+ F L +        + +K LY Y  +N ES   ++K        ++F      L+   F N+         Y    +  L  L + D    +N++K +   I NNN    E IG+ K
  S:     4 KMVSIIVPVYNAE-KYVHKCIDSLLQQTYKNIEIILINDGSTDNSGKICDEYANESSKIRVIHQKNSGPSATRNVGIDVANGAYIQFVDSDDYVEPNMTEEMLKAMNNKFQLVICGYKSLSLFN-KDINIKEHKCHISGGYDYSSFMMEFGYLFRDVYINPLWNKLYNTALIKENHLRFKDNVYMGEDLLFNLEYIKKCNYINVINKYLYNYAVINSESLTISFKKDFFKTQQMLFTAIREFLKVDYFYNDSNKKMIEIAYTDTVVSCLEHLFHKDSNLTVNLRKENISSIVNNNCTR-ENIGYFK 306
>gi|121612965|ref|YP_001000816.1| beta-1,3-galactosyltransferase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005728|ref|ZP_02271486.1| beta-1,3-galactosyltransferase [Campylobacter jejuni subsp. jejuni 81-176] >gi|87249117|gb|EAQ72078.1| beta-1,3-galactosyltransferase [Campylobacter jejuni subsp. jejuni 81-176] (181 aa)
Score = 128, Expect = 1.5e-05, Identities = 52/174 (29%), Positives = 87/174 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF----EYEWVFDKK---QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN 174
           M K+S+I+P  N   ++I + I S  NQT K+ E+  +DD   +  + I        + ++ I N  N+G+ + R  GV +AN  YI F+D DD+L ++A +  +K   +   +D + F    E   +  KK       +SK     +II K N+           Y T W   +KKE + ++
  S:     1 MFKISIILPTYNVE-QYIARAIESCINQTFKDIEIIVVDDCGNDNSINIAKEYSKKDKRIKIIHNEKNLGLLRARYEGVKVANSPYIMFLDPDDYLELNACEECIKILDEQDEVDLVFFNAIVESNVISYKKFDFNSGFYSKKEFVKKIIAKKNL-----------YWTMWGETYKKEIVFRS 171
>gi|148989442|ref|ZP_01820810.1| nicotinic acid mononucleotide adenyltransferase [Streptococcus pneumoniae SP6-BS73] >gi|147925192|gb|EDK76272.1| nicotinic acid mononucleotide adenyltransferase [Streptococcus pneumoniae SP6-BS73] (694 aa)
Score = 128, Expect = 1.5e-05, Identities = 33/108 (30%), Positives = 59/108 (54%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ 110
           K++VI+P  N    ++++ + S+  QT KN E+  ++D ST+    I     +  ++       N G+   R+ G+   +G Y+ FVDSDDW+ +D ++ L K   +YQ
  S:     4 KITVIVPVYNVE-NYLRKCLDSIITQTYKNIEIVVVNDGSTDASGEICKEFAEMDHRITYIEQENAGLSAARNTGLNNMSGNYVTFVDSDDWIELDYVETLYKKITEYQ 111
>gi|124486245|ref|YP_001030861.1| hypothetical protein Mlab_1428 [Methanocorpusculum labreanum Z] >gi|124363786|gb|ABN07594.1| glycosyl transferase, family 2 [Methanocorpusculum labreanum Z] (346 aa)
Score = 128, Expect = 1.6e-05, Identities = 60/226 (26%), Positives = 109/226 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI---DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINL----FSKHNQFDEIIVKNNVNKSKMPW--FHNNYQTDWRVCFKKEFLVKNKISHP-DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKAND 229
           +SVI+P  N    ++K  I S+  QT +N E+  +   S +  V I    L   +  Q +   P   G+   R+ GV++A+G Y+ FVDSDD++  + ++ L     KY + D +   +  + +    ++     S  N   EI + +NV+     +    ++    W   ++KE  +   + +P  K++  E   + L +  L K+  +TS KLY+Y    +  +  TY  K  D
  S:     8 ISVIVPVYNVE-PYLKTCIDSILKQTYRNLEIILVASTSIDNSVVICDSYLQVDSRLQVLHTEPQ--GLSAARNIGVSMASGTYLCFVDSDDFISQNFVETLYGLSQKY-DADIVQCNFLEISENATYSICESCTSIFNDALEIHIYSNVDMCANLYNDLADSSTASWTKLYRKELFM--NVKYPIGKIHEDEGTSYKLFY--LAKRVAVTSLKLYYYRSNPLSLTRATYTLKKQD 235
>gi|196191696|gb|EDX86660.1| glycosyl transferase, group 2 family protein [Synechococcus sp. PCC 7335] (329 aa)
Score = 128, Expect = 1.6e-05, Identities = 63/220 (28%), Positives = 106/220 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQ----INLFSKHNQFDEIIVKNNV-----NKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY----NRLNVESSL 220
           + ++SVI+P  NT  K+I + I S  NQ+  N E+  +DD ST+  V +    +   + ++ + N  N+GV K R+  +  A G++I  +DSDDW     ++ +L    K +N D +  +   + D +       L     QF  +   + V     +    P  H  Y    +  FKK FL ++ I +   +    D +F L   V   +  L  +  Y+Y    N L  +SSL
  S:     3 LPEISVILPAYNTE-KYIGRAIASALNQSISNIEIIVVDDGSTDNTVSVIQQIQAQDERLKLLINEQNMGVSKTRNRALAAAQGDWIAVLDSDDWYDQKRLEKIL-WVAKAENADIVADDLHLIRDGENSPWSTLLCQGKAQFSSLKQISPVYFLETDTYGQPGLHLGYS---KPLFKKSFLTEHNIWYDPTLRNAGDFWFLLDCLVHKARFCLIPEPYYYYRSRPNSLIRQSSL 232
>gi|86150365|ref|ZP_01068591.1| glycosyltransferase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85839190|gb|EAQ56453.1| glycosyltransferase [Campylobacter jejuni subsp. jejuni CF93-6] (270 aa)
Score = 128, Expect = 1.6e-05, Identities = 55/211 (26%), Positives = 104/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +    + ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L   A +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNIVLEFAKKDPRIKIFQNEENLGTFASRNIGVLHSSSDFIMFLDSDDFLTPGACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDGVFNQKEFLEFLSKQRHFCW------SVWTKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|134301655|ref|YP_001121623.1| glycosyl transferase group 2 family protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|134049432|gb|ABO46503.1| glycosyl transferase group 2 family protein [Francisella tularensis subsp. tularensis WY96-3418] (335 aa)
Score = 128, Expect = 1.6e-05, Identities = 36/106 (33%), Positives = 57/106 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D ST+  + I         + V     N G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:    10 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIILINDGSTDNSLSICQKYKSKDSRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 115
>gi|89256716|ref|YP_514078.1| glycosyl transferase family protein [Francisella tularensis subsp. holarctica] >gi|115315124|ref|YP_763847.1| glycosyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|156502877|ref|YP_001428942.1| glycosyl transferase group 2 family protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|89144547|emb|CAJ79862.1| glycosyl transferase family protein [Francisella tularensis subsp. holarctica LVS] >gi|115130023|gb|ABI83210.1| glycosyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|134253832|gb|EBA52926.1| glycosyl transferase [Francisella tularensis subsp. holarctica 257] >gi|156253480|gb|ABU61986.1| glycosyl transferase group 2 family protein [Francisella tularensis subsp. holarctica FTNF002-00] (335 aa)
Score = 128, Expect = 1.6e-05, Identities = 36/106 (33%), Positives = 57/106 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D ST+  + I         + V     N G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:    10 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIILINDGSTDNSLSICQKYKSKDSRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 115
>gi|196181706|gb|EDX76693.1| glycosyl transferase, group 2 family protein [Microcoleus chthonoplastes PCC 7420] (335 aa)
Score = 128, Expect = 1.7e-05, Identities = 36/108 (33%), Positives = 60/108 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           M  +SVIIP  N+    I++ I S+ +QT  + E+  I+D ST+  + I    ++    V + PN  G+   R+ G++ A+ EYI F+D+DD    D ++  LK+  K
  S:     1 MSLISVIIPLYNSETT-IQETIQSVLSQTFSDLELIIINDGSTDSSLEIVSQIQDPRLQVFSYPNG-GLAVSRNRGLSHASSEYISFIDADDLWTPDKLELQLKALTK 106
>gi|24637482|gb|AAN63753.1|AF454499_10 Eps9I [Streptococcus thermophilus] (324 aa)
Score = 128, Expect = 1.7e-05, Identities = 58/208 (27%), Positives = 99/208 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           ++V+IP  N   K++K+ + S+  Q   N+++  +DD ST+  PQ+  D +    Y ++  I   N G+ + R+ G++ A GEY++F+DSDDW+  +    L +     Q  D I F  E+V  +  I + S   +   +  K  +       F   + TD    ++K    KN I  P     +ED        +  KK   T++K Y Y
  S:     5 LTVVIPVYNVE-KYLKRCVESVLVQEWNNYDILLVDDGSTDSSPQICDDYVK--AYDFISVIHKENGGLSEARNTGISNAEGEYVYFLDSDDWIEPNTFSDLAEVIESDQ-YDIISFNQEFVKSEHDI-IKSDSKRTKRLTGKEALIDMFSFGFITGFATD--KIYRKALFTKNTIQFPVG-KYYEDHGTNYKLFLSAKKVYATNQKYYHY 207
>gi|119026516|ref|YP_910361.1| hypothetical protein BAD_1498 [Bifidobacterium adolescentis ATCC 15703] >gi|118766100|dbj|BAF40279.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703] (347 aa)
Score = 128, Expect = 1.7e-05, Identities = 35/102 (34%), Positives = 59/102 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS--TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKS 105
           VS+I+P  N+  +++   + S+ NQ+  N E+  +DD S  T+P++  D   K+    V +  N  G+ K ++ G+  A+GEYI F D+DD L    I+ LL +
  S:     8 VSIIVPVYNSE-RYLPYCVESILNQSYTNLEIILVDDGSKDTSPRICDDYAEKDSRVIVIHQKNG-GIAKAQNTGLDAAHGEYIAFADNDDILDSRNIELLLHA 109
>gi|166368266|ref|YP_001660539.1| glycosyl transferase [Microcystis aeruginosa NIES-843] >gi|166090639|dbj|BAG05347.1| glycosyl transferase [Microcystis aeruginosa NIES-843] (325 aa)
Score = 127, Expect = 1.8e-05, Identities = 42/144 (29%), Positives = 75/144 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNV 146
           +VSVIIP  N   +++   IT++  QT +NFE+  IDD ST P+  I+++        + I   N GV   R+ G+  A G YI  +D+DD +    ++  +      + +  +  E E+  D++ I    ++ +F +I+V N +
  S:     6 QVSVIIPCYNQG-RYLDDAITAVLVQTYQNFEILVIDDGSTEPET-IEILQDYQQPKTRIIRTENQGVATARNLGIAQAQGTYILPLDADDKIADSYLEKAVALLEGNEQLGIVYCEAEYFGDRQGIWPLPEY-EFPDILVDNMI 147
>gi|167934848|ref|ZP_02521923.1| putative N-acetylgalactosaminyl-diphosphoundecaprenol glucuronosyltransferase [Bacillus cereus AH1134] (266 aa)
Score = 127, Expect = 1.8e-05, Identities = 40/119 (33%), Positives = 65/119 (54%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           VSVI P  N+ +++I + I+S+ NQ+ +N+E+  +DD ST+       ++I  +    + ++  N+G  K R+  +  A G YI F+DSDD WL       LL  F +  NI F    Y  +
  S:    14 VSVITPSYNS-IRFIGETISSVQNQSYENWEMIIVDDGSTDQSAAKIKEIIEGDSRIRLLSLKENVGAAKARNLAIQEARGRYIAFLDSDDIWLPHKLKTQLL--FMEEMNIAFSYASYSLI 132
>gi|25011566|ref|NP_735961.1| glycosyl transferase, group 2 family protein [Streptococcus agalactiae NEM316] >gi|24413105|emb|CAD47183.1| Unknown [Streptococcus agalactiae NEM316] (291 aa)
Score = 127, Expect = 1.8e-05, Identities = 62/210 (29%), Positives = 108/210 (51%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGE--YIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI---NLFSKHNQFDEIIVKNNVNKSKMPWFHNN--YQTDWRVCFKKEFLVKNKISHP-DKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           K VSVIIP  N    +++  + ++  QT + FE+  IDD ST+    I   L  ++    V +I N  G  K R++G+   + E  ++ FVDSDDW+  + ++ LL    KY N D ++  Y    + + I    +  K    +EI  +  +++ ++ W  N+  +   W   +++E    + I+ P DKV  FED    ++  +  KK +L +   Y Y
  S:     4 KLVSVIIPVYNAA-PYLEGCVNTILGQTYQVFEILLIDDGSTDTSASICDQLSLRDNRIRVFHIENG-GASKARNFGLARISPESQFVTFVDSDDWVKENYLEVLLAQQEKY-NADIVISNYYIYRETEDIFGYYITDKDFVIEEISAQTAIDR-QVHWHLNSSVFIVIWGKLYRRELF--DTITFPIDKV--FEDELVSVLLFIKSKKTILVNGSYYGY 215
>gi|157122529|gb|EDO66664.1| glycosyl transferase family protein [Francisella tularensis subsp. holarctica FSC022] (335 aa)
Score = 127, Expect = 1.8e-05, Identities = 36/106 (33%), Positives = 57/106 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D ST+  + I         + V     N G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:    10 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIILINDGSTDNSLSICQKYKSKDSRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 115
>gi|149002743|ref|ZP_01827669.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP14-BS69] >gi|147759037|gb|EDK66031.1| glycosyl transferase, family 2 [Streptococcus pneumoniae SP14-BS69] (178 aa)
Score = 127, Expect = 1.8e-05, Identities = 30/105 (28%), Positives = 60/105 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           +SVI+P  N   +++++ I S+  QT +N E+  +DD +T+    + D I +   +       N G+ + R+ G+  A+G+Y+ F+DSDD+++ + I  L +   +
  S:     6 ISVIVPVYNVA-QYLEKSIASIQKQTYQNLEIILVDDGATDESGRLCDSIAEQDDRVSVLHKKNEGLSQARNDGMKQAHGDYLIFIDSDDYIHPEMIQSLYEQLVQ 110
>gi|150403284|ref|YP_001330578.1| glycosyl transferase family protein [Methanococcus maripaludis C7] >gi|150034314|gb|ABR66427.1| glycosyl transferase family 2 [Methanococcus maripaludis C7] (348 aa)
Score = 127, Expect = 1.8e-05, Identities = 41/119 (34%), Positives = 66/119 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           +S+IIP  N    +I   + SL NQT+KNFEV  I+D S +  + +  + I  +          N GV   R+ G+  ANG YI+F+D+DD++  + I+   K   + +N D I F+++ V
  S:     7 ISIIIPAYNVE-NYICNTLQSLENQTHKNFEVILINDGSEDNTLNVIENFIKSSKLDIKLINQENAGVSVARNRGIKEANGTYIYFLDADDYVEHNIIEESSKIILE-KNPDLIYFKFDRV 125
>gi|50429217|gb|AAT77201.1| putative glycosyltransferase [Campylobacter jejuni] (282 aa)
Score = 127, Expect = 1.9e-05, Identities = 54/211 (25%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R++GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++      ++K +    H  +   W  CF+++ ++K+  K+   + ++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CNFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNFGVLHSSSDFIMFLDSDDFLTLDACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLEFLSKQR----HFCWSV-WAKCFRRDIILKSFEKVKIDECLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 208
>gi|167217263|ref|ZP_02286899.1| hypothetical protein LmonocFSL_08698 [Listeria monocytogenes FSL J1-175] (442 aa)
Score = 127, Expect = 1.9e-05, Identities = 54/188 (28%), Positives = 99/188 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI----MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYF 190
           K+SV++P  NT L+ +K L+ S++ QT  +  +E+ F+DD ST    +   +         V+ I N+    + R+    +A GEYI ++D DD ++ +  + +  +F K  N+D +    +    W +  KQ   FS++N   E +    +    +P   + +       +K+EFL++N I+  D   + +EDVYF
  S:    20 KISVVVPTYNTELEGLKNLMASIDKQTMNSDEYELVFVDDGSTTDTYERLQEFAETRPNMTVKQIENSGWGSRPRNIATKMAKGEYILYLDHDDTVFPETFERVY-NFGKENNLDVVSGKEVRTNGWSWGWKQ---FSENNPHAEEMGIECL----LPMTPHKF-------YKREFLLENDITFDDGARVLWEDVYF 201
>gi|187931743|ref|YP_001891728.1| glycosyl transferase family 2 protein [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712652|gb|ACD30949.1| glycosyl transferase family 2 protein [Francisella tularensis subsp. mediasiatica FSC147] (335 aa)
Score = 127, Expect = 2.0e-05, Identities = 36/106 (33%), Positives = 57/106 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D ST+  + I         + V     N G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:    10 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIIIINDGSTDNSLSICQKYKSKDSRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 115
>gi|194684497|emb|CAR46269.1| glycosyl transferase [Proteus mirabilis HI4320] (329 aa)
Score = 127, Expect = 2.0e-05, Identities = 55/195 (28%), Positives = 98/195 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ----YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVL 197
           KVSV++   N  +  +++ I S+ NQT K+ E   IDD ST+  V +D++ +   Q     V    +NIG+ K  + G  L++GEYI  +D+DD+ Y   +   L+    ++NI         +     + ++  HN+F      +N   + + +  N Y     V F+  F+  N+I++P+     +D  +GL  K+L
  S:     6 KVSVLMSVYNDAVH-LEEAINSILNQTVKDLEFIIIDDGSTD--VSVDILRRYEKQDSRVKVYTNESNIGLAKSLNKGFLLSSGEYIARMDADDYAYPIRLQKQLEFMEAHKNI---------MVCGTSMEIYEDHNKFMVPPTAHNAIAAGLIFGTNFYHPT--VMFRASFIGDNQITYPEDYKYAQD--YGLWVKLL 188
>gi|109899370|ref|YP_662625.1| glycosyl transferase family protein [Pseudoalteromonas atlantica T6c] >gi|109701651|gb|ABG41571.1| glycosyl transferase, family 2 [Pseudoalteromonas atlantica T6c] (289 aa)
Score = 127, Expect = 2.0e-05, Identities = 40/123 (32%), Positives = 67/123 (54%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP----NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK 126
           VSV+IP  N+   +I   I S+  QT ++FE+  IDD ST+    +D++    YQ  Q I      N G    R+ G+  A G+Y+ F+DSDD    + ++  + +  + + +D ++F+ E   D K
  S:     5 VSVVIPVYNSQ-SYIADCIDSVLAQTYQDFEIIVIDDGSTDSS--LDILKS--YQKKQKIKLLQIENSGQSVARNLGIEQATGKYLIFIDSDDCWENNTLEVTV-ALAEQKQLDMVLFDGESFVDDK 125
>gi|24637428|gb|AAN63704.1|AF454496_9 Eps5I [Streptococcus thermophilus] >gi|11595695|emb|CAC18359.1| putative beta-glucosyltransferase [Streptococcus salivarius] (324 aa)
Score = 127, Expect = 2.0e-05, Identities = 57/208 (27%), Positives = 100/208 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS--TNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           ++V+IP  N   K++K+ + S+  Q   N+++  +DD S  ++PQ+  D +    Y ++  I   N G+ + R+ G++ A GEY++F+DSDDW+  +    L +     Q  D I F  E+V  +  I + S   +   +  K  +       F   + TD    ++K    KN I  P     +ED+       +  KK   T++K Y Y
  S:     5 LTVVIPVYNVE-KYLKRCVESVLVQEWNNYDILLVDDGSIDSSPQICDDYVK--AYDFISVIHKENGGLSEARNTGISNAEGEYVYFLDSDDWIEPNTFSDLAEVIESDQ-YDIISFNQEFVKSEHDI-IKSDSKRIKRLTGKEALIDMFSYGFITGFATD--KIYRKALFTKNTIQFPVG-KYYEDLGTNYKLFLSAKKVYATNQKYYHY 207
>gi|167013923|ref|ZP_02276456.1| hypothetical protein LmonFS_02699 [Listeria monocytogenes FSL J1-194] (299 aa)
Score = 127, Expect = 2.0e-05, Identities = 67/211 (31%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQV----YIDLINKNGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M K+SVIIP  N    +I++  +SL NQT     FE+  IDD ST+  +     +  I+KN    + N+  N G   I R+ G+  A G+YI F+D+DD+L  +A++ L     K Q+ + I  +Y  +  +    + F K N+ +  I+ +N+  +  P  H  +QT         FL   KI     + I ED YF +   V  K   + +   Y+Y
  S:     1 MIKISVIIPIYNAE-NYIEKAFSSLKNQTLAQNEFEILCIDDKSTDNSLGKLKQLSKIHKN--MRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALERLFIQAEKNQS-EVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAP--HKMFQT--------AFLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYY 205
>gi|14590304|ref|NP_142370.1| hypothetical protein PH0396 [Pyrococcus horikoshii OT3] >gi|3256788|dbj|BAA29471.1| 321aa long hypothetical protein [Pyrococcus horikoshii OT3] (321 aa)
Score = 127, Expect = 2.0e-05, Identities = 34/93 (36%), Positives = 58/93 (62%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKI----------RDYGVTLANGEYIWFVDSDDW 93
           M KVS+I+P  NT   ++ +L+TS+  QT  N+E+  +DD+S +    + L  K+ Y      PN + V K           ++ G+ +++G+++ FVDSDDW
  S:     1 MTKVSIIVPVYNTK-NYVPRLLTSIEKQTYTNWELILVDDHSNDGTYELLLEFKDRY------PNKVEVLKTPKPRSGPMIGKNMGIEVSSGKFLAFVDSDDW 96
>gi|171741997|ref|ZP_02917804.1| hypothetical protein BIFDEN_01100 [Bifidobacterium dentium ATCC 27678] >gi|171277611|gb|EDT45272.1| hypothetical protein BIFDEN_01100 [Bifidobacterium dentium ATCC 27678] (280 aa)
Score = 127, Expect = 2.1e-05, Identities = 55/177 (31%), Positives = 94/177 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQN-IDFIM---------------------FEYEWVFDKKQIN---LFSKHNQFDEIIVKNNVNKSKMPWFHN-----NYQTDWRVCFKKEFLVKNKIS 177
           M KVSV+IP  N     I   I S+  QT K+FEV  +DD ST+  +  +     +  +Y+  + +N G    R+ G+  ANGEYI F DSDD+     ++  L++   + + ID                        F YE++  +  ++   + ++H  F++     N+   K+P F +         D+++ +  E LV+  IS
  S:     1 MPKVSVVIPTFNRA-DTIGDSIKSVLEQTFKDFEVIVVDDGSTDGTESVVAAFGDSRIKYI--MQDNAGACAARNNGIRHANGEYIAFQDSDDYWMPRKLERQLQNISLHDSKIDICKMHSAGLPKDEYEPCRQAIEANFSYEYLLGRNFVSTQMILARHELFED-----NLFDVKIPRFQDWDLMLRLLRDYKLSYTDEVLVERYIS 200
>gi|153808950|ref|ZP_01961618.1| hypothetical protein BACCAC_03251 [Bacteroides caccae ATCC 43185] >gi|149128283|gb|EDM19502.1| hypothetical protein BACCAC_03251 [Bacteroides caccae ATCC 43185] (329 aa)
Score = 127, Expect = 2.1e-05, Identities = 40/98 (40%), Positives = 58/98 (59%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL---YVDAID 100
           + SVIIP  N P + + +L+ SL  Q  K+FEV  ++D S+ P       YID +N   +      PN+ G G+ R+YG   + GEY+  +DSD  L   Y DAI+
  S:     2 RYSVIIPVYNRPDE-VDELLQSLTAQYFKDFEVVVVEDGSSIPCKEVTDRYIDRLNIKYFSK----PNS-GPGQTRNYGAERSEGEYLIILDSDVILPERYFDAIE 101
>gi|15616275|ref|NP_244580.1| glycosyltransferase [Bacillus halodurans C-125] >gi|10176337|dbj|BAB07432.1| glycosyltransferase [Bacillus halodurans C-125] (303 aa)
Score = 127, Expect = 2.1e-05, Identities = 49/159 (30%), Positives = 77/159 (48%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV--FDKKQINLFS----KHNQFDEIIVKNNVNKSKMPWFHNNYQTD 161
           KVS+IIP  N   K +K+ + S  NQT KN EV  + D ST N  + +D   ++      +     G    R+ G+  A GE+I F+D DD    D ++  +K F +  N+  +    E +  F+K+ I  +S      N   EI+V N +  +       N  T+
  S:     2 KVSIIIPTHNRA-KLLKRALESTLNQTYKNIEVIVVSDGSTDNTDIVMDEYKRDSRVNFISYHPAKGGNYARNTGIKNAKGEFIAFLDDDDEWMPDKLELQIKEFNQNANVGLVYTGVEIIYNFNKRNIKYYSLPKKTGNLSKEILVANCIGTTSSVMVRKNLITE 166
>gi|150005467|ref|YP_001300211.1| glycosyl transferase family protein [Bacteroides vulgatus ATCC 8482] >gi|149933891|gb|ABR40589.1| glycosyltransferase family 2 [Bacteroides vulgatus ATCC 8482] (321 aa)
Score = 127, Expect = 2.1e-05, Identities = 40/125 (32%), Positives = 66/125 (52%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL--LKSFYKYQNIDFIMFEYEWVFDKKQI 128
           +S+I+P  N   +++ + + SL NQT  N E+  +DD S +    I D   K   +      +N G+   R+  + +A G+Y+ FVDSDDW+     + L  L S YK    D ++F   +VFD  ++
  S:     8 ISIIVPVYNVE-QYLSRCVDSLVNQTYHNIEIILVDDGSPDRSGEICDEYAKKDKRVKVIHQSNGGLSDARNTALDIAKGDYLMFVDSDDWIEKKTCEILNRLASDYK---ADTVIFGLNFVFDSGKV 131
>gi|150384525|ref|ZP_01923214.1| glycosyl transferase, family 2 [Victivallis vadensis ATCC BAA-548] >gi|150259085|gb|EDM96331.1| glycosyl transferase, family 2 [Victivallis vadensis ATCC BAA-548] (757 aa)
Score = 127, Expect = 2.2e-05, Identities = 33/118 (27%), Positives = 62/118 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE 120
           +VS++IP  NT  +++ + + S+ NQT    E+  ++D S +   +V  +   K+    +     N G+   R  G+  A G+Y+ F+D+DD+L +D     L+   +    D + FE+E
  S:    10 RVSILIPVYNTA-QYLPRCLASVQNQTLHEIEIIVVNDASPDNAAEVLAEYAAKDSRIRIVTHEKNGGILAARLSGIAAATGDYLIFLDADDYLSLDCAKLALEK-AESTGADMVHFEFE 127
>gi|72162572|ref|YP_290229.1| cell wall biosynthesis glycosyltransferase [Thermobifida fusca YX] >gi|71916304|gb|AAZ56206.1| similar to Glycosyltransferases involved in cell wall biogenesis [Thermobifida fusca YX] (662 aa)
Score = 127, Expect = 2.2e-05, Identities = 36/100 (36%), Positives = 60/100 (60%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQ---VYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLL 103
           V+VIIP  NT  + +   + SL  QT     FEV ++DD ST+     +  +L  +  +  V +I N+   G+ R+ G+  A GEY++F+D DD+L  +A++ L+
  S:     5 VTVIIPVHNTG-RGVLAGLESLRAQTLPRSRFEVIYVDDGSTDGTGELLDTELAGEENFSVV-HIENSGWPGRPRNIGIDRARGEYLFFMDDDDYLGAEALERLV 107
>gi|29347056|ref|NP_810559.1| putative glycosyltransferase [Bacteroides thetaiotaomicron VPI-5482] >gi|29338954|gb|AAO76753.1| glycoside transferase family 2 [Bacteroides thetaiotaomicron VPI-5482] (303 aa)
Score = 127, Expect = 2.2e-05, Identities = 45/150 (30%), Positives = 72/150 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPW 153
           +S IIP  N   ++I   + SL  QT  +++   I+D ST N    +    K+  ++V    NN GV   R+ G+  A GEYI F+D DD L  D ++  +  F K  N+D ++  Y  V   K++     +   ++I     V + K  W
  S:     3 ISFIIPVYNGE-RYISACLYSLLKQTYTDWQAILINDGSTDNSLSVLQSFAKSDSRFVVYSQNNQGVAIARNRGIKEAQGEYISFLDIDDTLVSDFLERFICHFEK--NVDIVIAGYHVVRKNKKVLKQEANVTLEKIDYLKKVLRGKYGW 150
>gi|160942187|ref|ZP_02089502.1| hypothetical protein CLOBOL_07077 [Clostridium bolteae ATCC BAA-613] >gi|158435078|gb|EDP12845.1| hypothetical protein CLOBOL_07077 [Clostridium bolteae ATCC BAA-613] (578 aa)
Score = 127, Expect = 2.2e-05, Identities = 39/127 (30%), Positives = 68/127 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE----WVFDKKQ 127
           M  VS+IIP  N   K++++ + S   QT ++ E+  ++D S +  + I     K   ++      N GV   R+  +  A GEY+ F+DSDDWL  DA +  + +  K+ + D ++ ++      VF +KQ
  S:   128 MPFVSLIIPVYNAE-KYLRRCLNSAMEQTFQDMEIIVVNDGSQDTSLEICREYEKMDRRFRVINKENTGVSDSRNQAIETARGEYLQFMDSDDWLTPDATESFVHAARKF-DCDLVVSDFYRVDGAVFTEKQ 257
>gi|68644068|emb|CAI34216.1| putative glycosyl transferase [Streptococcus pneumoniae] (320 aa)
Score = 127, Expect = 2.2e-05, Identities = 49/127 (38%), Positives = 68/127 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF------EYEWVFDKKQINL 130
           +SV+IP  N    ++   I SL NQT+KNFEV  I+D ST+    +       Y +++     N G+   R+YGV  A  E+I+F+D DD++     + L     KYQ  D I        EYE  F KKQ NL
  S:     3 ISVVIPVYNVE-AYLHYAIESLVNQTHKNFEVLLINDGSTDNSGKLCDKYAQEYDWIRVFHKENGGLSDARNYGVLKATNEWIFFLDPDDYIEPFTFELLSLIQEKYQ-ADLISTKVQTTNEYE-KFSKKQFNL 133
>gi|120400335|gb|ABM21391.1| glycosyltransferase [Lactobacillus johnsonii] (342 aa)
Score = 127, Expect = 2.3e-05, Identities = 38/110 (34%), Positives = 59/110 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS-TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNID 113
           ++VI+P  N   K+I++ + SL  QT KNFEV+ IDD S  N +  +        ++   +  N G G + +YG+     +Y    D DDWL  DA++  L +F K  N+D
  S:     5 ITVIVPIYNVE-KYIRKCLDSLKRQTYKNFEVWAIDDGSPDNSKKIVQEYADKDPRFKSILKENGGYGSVLEYGIKNTKTKYFLVCDPDDWLTDDALEK-LHNFAKNSNLD 113
>gi|167412384|gb|ABZ79842.1| unknown [Campylobacter jejuni] (267 aa)
Score = 126, Expect = 2.3e-05, Identities = 55/206 (26%), Positives = 102/206 (49%)
  Q:     6 VIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVK--NKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           +IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +  LK   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++K   K+   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 IIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEIALKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEFFNQKEFLEFLSKQRHFCW------SVWAKCFRKDMILKIFEKVKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 203
>gi|163790737|ref|ZP_02185164.1| putative capsular polysaccharide glycosyltransferase [Carnobacterium sp. AT7] >gi|159874038|gb|EDP68115.1| putative capsular polysaccharide glycosyltransferase [Carnobacterium sp. AT7] (310 aa)
Score = 126, Expect = 2.3e-05, Identities = 64/219 (29%), Positives = 105/219 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQT----DWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNT 222
           VSVI+P  N  L +I++ + S+  Q  +  ++  +DD ST+   Q     +  +  Q +Q    N G+   R+ G+  A G+Y+ FVDSDD + + AI  L+ +  + + ID I F  +   D   +N   K N +D         K     F  N QT     +    K+E LVKN +S  + + + ED  F +  +V      +     ++YNR   E+S+ T
  S:     8 VSVIVPVYNVEL-YIEECLKSIIKQNYQMLQIIIVDDGSTDTSNQKVKPFLLDSRVQLIQQ--ENKGLSSARNSGLKAAIGKYVLFVDSDDHIELTAIKELV-NLMEEKQIDLIRFNGKAFLDG--LNKPIKQNNYDFSHRLQEGKKYIQDRFKANRQTLASPVYLYMVKREILVKNALSFYEGI-LHEDELFTI--QVFLNSNSMCYVNAFYYNRRYRENSIMT 223
>gi|120400352|gb|ABM21407.1| glycosyltransferase [Lactobacillus johnsonii] (335 aa)
Score = 126, Expect = 2.4e-05, Identities = 58/210 (27%), Positives = 103/210 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF----DKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN 212
           KV+VI+P  N   K+I + +TSL NQT    ++F + D S +  + I     K   +    +  N G G + ++ +     +Y    D DDWL  +AI  L++ F + +N+D ++ +   VF     +K IN F+K  +++    K   + + +  F     +     F+ E  V   I+ P KV+  +         +LY+ +LL SK++ +YN
  S:     4 KVTVIVPTYNVE-KYISKCLTSLINQTYNQIQIFVVSDGSKDNSIQIAQEFEKKDSRVKVLLKENGGYGSVLEFAINKLRTDYFLVCDPDDWLTPNAIKELIE-FAEKENLDLVVGDKYKVFLEDNSQKYINSFNK--KYNISPKKVYTSSTDIQRFAFGEGSPHAKLFRSE--VAKNIAFPHKVSYTD--------TILYEVSLLNSKRVAYYN 204
>gi|153891363|ref|ZP_02012383.1| glycosyl transferase family 2 [Opitutaceae bacterium TAV2] >gi|151582572|gb|EDN46105.1| glycosyl transferase family 2 [Opitutaceae bacterium TAV2] (396 aa)
Score = 126, Expect = 2.4e-05, Identities = 71/230 (30%), Positives = 111/230 (48%)
  Q:     5 SVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV-FDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSII 234
           SVI+P  N   + IK+ + SL  QT +  E+  IDD ST+  + I  D   K+    +  +  N GV   R+ G+ +A+GEYI FVD DD++  D  + L     + ++ D +  E     +D +      KHN+    I KN +       FH+ +   W   ++ EFL KNKI  P  + + +D+ F +    L  +  L S+  Y Y R   E SL++  Y    L + I
  S:    24 SVIVPVYNVAGE-IKRCLDSLLGQTLREIEILCIDDKSTDNSLEILRDYEKKDSRIKIIALEKNCGVSVARNQGLAIASGEYIGFVDPDDFVDPDFYEKLYSCAAETKS-DIVKGEAVVEDYDGRTRAFGPKHNE----IAKNKL------IFHSAF---WSAIYRWEFLKKNKIDFPIGIIVNQDIVFLVKCSALANRIDLVSETKYHYIRR--EGSLDSEIYGKEKLANFI 239
>gi|51243865|ref|YP_063749.1| glycosyltransferase involved capsular polysaccharide biosynthesis [Desulfotalea psychrophila LSv54] >gi|50874902|emb|CAG34742.1| related to glycosyltransferase involved capsular polysaccharide biosynthesis [Desulfotalea psychrophila LSv54] (321 aa)
Score = 126, Expect = 2.4e-05, Identities = 53/213 (24%), Positives = 102/213 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSL--NNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNR 213
           M K+S IIP  N   K+I++ + S+   N   +++E+  ++D + +    I    +  +  ++ I   N G    R+ G+ +A GEY+WF+DSDD++  +++  LL       + D +   Y+ V++ K+     K         +   N   +  F +     W   +++  L +N++S P+ + + ED  F         KAL  +KK+  +NR
  S:     1 MPKLSFIIPLYNAE-KFIEKCLLSILQQNVPIQDYEIIVVNDGTKDDSRKIVSEMQEKFSNIKIIDQENSGPSVTRNRGLRVATGEYVWFIDSDDYIIDNSLQELL-DILTMPSPDILYIGYKKVYENKRD---EKGTGERNGTAQPYTNHQFLKKFKSFPPMVWLYIYRRTMLTENRLSFPEGI-MHEDEEFT-------PKALFFAKKIIHFNR 203
>gi|18029185|gb|AAL56400.1|AF363060_6 CpsI [Streptococcus agalactiae] >gi|18033325|gb|AAL57064.1|AF332894_6 CpsIaI [Streptococcus agalactiae] >gi|18033332|gb|AAL57070.1|AF332895_6 CpsIaI [Streptococcus agalactiae] >gi|18033442|gb|AAL57161.1|AF332914_6 CpsI [Streptococcus agalactiae] (266 aa)
Score = 126, Expect = 2.4e-05, Identities = 72/245 (29%), Positives = 124/245 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFK--KEFLVKNKISHPDKVNIFEDVYFGLIWKVL---YKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLENKLFN 248
           VS+IIP  N+   ++K+ + S+  QT+   EV  IDD ST N     D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+    +N D    +++   ++       K   F ++   NN  K     F +  + +  VC K  K+ ++ N +   + + I ED+ F    K+L   ++  + T+  LY Y R+   S++N  K+  N L  I IF   + L+  KL N
  S:     7 VSIIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGEICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLIT-ENADIAEVDFDISNERDYRK--KKRRNFYKVFKNNNSLKE----FLSGNRVENIVCTKLYKKSIIGN-LRFDENLKIGEDLLFNC--KLLCQEHRIVVDTTSSLYTY-RIVKTSAMNQ-KFNENSLDFITIFNEVSSLVPAKLAN 245
>gi|153812508|ref|ZP_01965176.1| hypothetical protein RUMOBE_02907 [Ruminococcus obeum ATCC 29174] >gi|149831433|gb|EDM86521.1| hypothetical protein RUMOBE_02907 [Ruminococcus obeum ATCC 29174] (259 aa)
Score = 126, Expect = 2.5e-05, Identities = 45/173 (26%), Positives = 90/173 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNI-GVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNK 175
           K+SV++P   T  K I++L+ +L  Q+ K+FE+ F+  +  N ++  D+I K     ++ I  ++ G+ + R+ G+  A+GE +   D D W   +A + ++ +F K Q    ++ +   +FD ++ N+  K+   DE  V+N +            ++   V FKK+ ++  K
  S:     2 KISVLVPTLGTREKEIRRLLETLEKQSYKDFEIIFVTQD--NHEIVKDIIYKYSNLDIKQIEMSVKGLSRARNRGLEQASGEIVVLSDDDCWYPANAFEIVVNAFKKRQCAKIVLSQ---IFDPEK-NIPYKNYTSDEEYVRNKLQLMS--------KSSIEVAFKKDLVMNKK 161
>gi|24637447|gb|AAN63721.1|AF454497_10 Eps6I [Streptococcus thermophilus] (328 aa)
Score = 126, Expect = 2.5e-05, Identities = 62/223 (27%), Positives = 106/223 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY---NRLNVESSLNTYKYK 226
           ++V+IP  N   K++K+ + S+  Q   N+++  +DD ST+  PQ+  D      Y ++  I   N G+   R+ G++ A GEY++F+DSDDW+  +    L +     Q  D I F  E+V  +  I + S   +   +  K  +       F   + TD    ++K    KN I  P     +ED+       +  KK   T++K Y Y   N  ++  S N  K++
  S:     7 LTVVIPVYNVE-KYLKRCVESVLVQEWHNYDILLVDDGSTDSSPQICDDYAKV--YDFISVIHKKNGGLSAARNTGISNAEGEYVYFLDSDDWIEPNTFSDLAEVIESDQ-YDIISFNQEFVKSEHDI-IKSDSKRTKRLTGKEALIDMFSYGFVTGFATD--KIYRKALFTKNTIQFPVG-KYYEDLGTNYKLFLAAKKVYATNQKYYHYLIDNPDSITKSWNEQKFE 227
>gi|17230555|ref|NP_487103.1| hypothetical protein alr3063 [Nostoc sp. PCC 7120] >gi|17132157|dbj|BAB74762.1| alr3063 [Nostoc sp. PCC 7120] (330 aa)
Score = 126, Expect = 2.5e-05, Identities = 38/109 (34%), Positives = 60/109 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           M  +SVIIP  N  L  IK+ I S+  QT  ++E+  I+D ST+    I    K+    + N  N  G+   R+ G+  A+GE+I F+D+DD   VD ++  LK+  ++
  S:     4 MALISVIIPAYNAVLT-IKETIESVQKQTFTDWEIIVINDGSTDGTPEIIQSIKDERLKIFNYKNG-GLPVARNRGILHASGEFIAFLDADDLWAVDKLEMQLKALQQH 110
>gi|18857646|emb|CAC81257.1| putative glycosyl transferase [Streptococcus thermophilus] (229 aa)
Score = 126, Expect = 2.5e-05, Identities = 64/230 (27%), Positives = 112/230 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKA---LLTSKKLYFY-NRLNVESSLN-TYKYKANDLVSI 233
           +S++IP  N    +IK+ + S+ +QT  + E+  +DD ST+    I D  ++N  +       N G  + R+ G+  A  E+I F+DSDD++  D I+YL  +  +  N D  +  + ++  KK I    KH   +  ++       +M          W   ++ E+  K K        +FED    LI   ++ +A   +  +K +YFY NR N  S++N T+  K  DL+ +
  S:     3 ISIVIPVYNVQ-DYIKKCLDSILSQTFSDLEIILVDDGSTDLSGRICDYYSENDKRIKVIHTANGGQSEARNVGIKNATSEWITFIDSDDYVSSDYIEYLY-NLIQVHNADISIASFTYITPKKII----KHGNGEVALMDAKTAIRRMLLNEGFDMGVWGKMYRTEYFNKYKFVSG---KLFED---SLITYQIFSEASTIVFGAKDIYFYVNRKN--STVNGTFNIKKFDLIEM 224
>gi|84496961|ref|ZP_00995815.1| possible glycosyl hydrolase [Janibacter sp. HTCC2649] >gi|84383729|gb|EAP99610.1| possible glycosyl hydrolase [Janibacter sp. HTCC2649] (552 aa)
Score = 126, Expect = 2.5e-05, Identities = 31/105 (29%), Positives = 58/105 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKS 105
           + +VSV+IP  N  + +++Q + S+  QT ++ +V  IDD ST+    + D +     ++     +N G+   R+ G+  A G ++ F+DSDDW     +  L+K+
  S:     5 LHRVSVVIPVYNV-VDYLEQCLDSVAAQTYRSLDVILIDDGSTDGSGPLCDTLAARDPRFRVIHQDNHGLSHARNVGIGAATGTFVTFLDSDDWWEPTFVSSLVKA 109
>gi|116513018|ref|YP_811925.1| glycosyltransferase [Lactococcus lactis subsp. cremoris SK11] >gi|116108672|gb|ABJ73812.1| Glycosyltransferase [Lactococcus lactis subsp. cremoris SK11] (301 aa)
Score = 126, Expect = 2.6e-05, Identities = 65/231 (28%), Positives = 117/231 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS--TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ----NIDFIMF------EYEWVFDKKQINLFSKHNQFD---EIIVKNNVNKSKMPW--FHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLV 231
           M KVSVI+P  N   K +++ + S+ NQ+ ++FE+  IDD S  ++ Q+  +   K+    V +IPN  G    R+ G+    G YI F+DSDD++ +D ++ L +   +Y+    +  +I +      E + +  + Q  ++   N  D   + + K   +    PW  + N Y+T+  +  +  F V  +         FED +F   +    +KA+ TS   Y+Y       +  T+  K  DL+
  S:     1 MPKVSVIVPVYNVE-KLLERCLNSVLNQSFQDFELLLIDDGSKDSSGQICDNYAKKDQRVRVWHIPNG-GQSAARNLGIDNVYGTYIVFIDSDDFVELDYLEQLYQPMVEYEADVVSCRYIAYSEERDEEVKKIIQENQAKVYHFRNNQDVMQDFLEKEFKDDRNFPWESYANLYKTE--LLGEIRFEVGRE---------FEDNFFNYQYFKKVQKAIATSYIGYYYYANPTSKTRITFYEKQFDLI 235
>gi|189462976|ref|ZP_03011761.1| hypothetical protein BACCOP_03678 [Bacteroides coprocola DSM 17136] >gi|189430258|gb|EDU99242.1| hypothetical protein BACCOP_03678 [Bacteroides coprocola DSM 17136] (329 aa)
Score = 126, Expect = 2.6e-05, Identities = 39/102 (38%), Positives = 61/102 (59%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-----QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL---YVDAIDYLLK 104
           + S I+P  N P + + +L+ SL  QT  +FEV  I+D S+ P     + Y  L++ + Y    N PN+ G G+ R++G   + GEY+  +DSD  L   Y+ A+D  LK
  S:     2 RYSFIVPVYNRPDE-VDELLQSLTKQTLGDFEVLVIEDGSSVPCEDVVEKYRTLLDVHYY----NKPNS-GPGQTRNFGAERSRGEYLLILDSDCVLPPGYLAAVDEELK 105
>gi|169827208|ref|YP_001697366.1| putative glycosyltransferase [Lysinibacillus sphaericus C3-41] >gi|168991696|gb|ACA39236.1| Putative glycosyltransferase [Lysinibacillus sphaericus C3-41] (328 aa)
Score = 126, Expect = 2.6e-05, Identities = 35/99 (35%), Positives = 60/99 (60%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           +SVI+P  N    ++ + +TS+ +Q+ K+ E+  I+D S +  + +  +   K+    V +I N  GV K R+ G+  ANG+YI FVD+DDWL +  ++ L
  S:     1 MSVIVPVYNAE-NYLNKCLTSICHQSLKDIEIITINDGSDDQSLSVLKNFAQKDTRITVLDIDNG-GVSKARNLGIEQANGQYITFVDADDWLELTMLEEL 99
>gi|90962544|ref|YP_536460.1| glycosyltransferase [Lactobacillus salivarius UCC118] >gi|90821738|gb|ABE00377.1| Glycosyltransferase [Lactobacillus salivarius UCC118] (333 aa)
Score = 126, Expect = 2.7e-05, Identities = 63/212 (29%), Positives = 99/212 (46%)
  Q:     5 SVIIPFKNTPLKWIKQLITSLNNQTNKN-FEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNV 216
           S IIP  N+  K I + I S+ NQ +K+ +E+  +DD S +  V I  D +  NG  +  +     GV   R+ G+  A GEY+ F+DSDD+ YV+     LK+     N D ++F +E       I L    N   E +     N +K       Y T W   ++ E + +N +   + + + ED  F + +    KK    +  LY Y+  NV
  S:     6 SFIIPTYNSK-KTIIRAIESVTNQLDKSEYEIIIVDDGSQDGTVEIVHDFMKDNGNIHFTSTIG--GVSFARNKGINQAQGEYLLFLDSDDY-YVEGSLKNLKNIVAQSNSDLVIFNFE--HGNTPILLAEVPNTRVEALSVMLSNPTK-------YMTVWGKAYRTETVHENNVRFNEDLKLSEDSEFLVRYVQKCKKITSDNTILYHYSIDNV 207
>gi|167214207|ref|ZP_02284514.1| hypothetical protein LmonoFSL_08291 [Listeria monocytogenes FSL R2-503] (345 aa)
Score = 126, Expect = 2.8e-05, Identities = 54/188 (28%), Positives = 99/188 (52%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI----MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNI-FEDVYF 190
           K+SV++P  NT L+ +K L+ S++ QT  +  +E+ F+DD ST    +   +         V+ I N+    + R+    +A GEYI ++D DD ++ +  + +  +F K  N+D +    +    W +  KQ   FS++N   E +    +    +P   + +       +K+EFL++N I+  D   + +EDVYF
  S:    20 KISVVVPTYNTELEGLKNLMASIDKQTMNSDEYELVFVDDGSTTDTYERLQEFAETRPNMTVKQIENSGWGSRPRNIATKMAKGEYILYLDHDDTVFPETFERVY-NFGKENNLDVVSGKEVRTNGWSWGWKQ---FSENNPHAEEMGIECL----LPMTPHKF-------YKREFLLENDITFDDGARVLWEDVYF 201
>gi|188532241|ref|YP_001906038.1| Predicted glycosyl transferase, family 2 [Erwinia tasmaniensis] >gi|188027283|emb|CAO95126.1| Predicted glycosyl transferase, family 2 [Erwinia tasmaniensis] (326 aa)
Score = 126, Expect = 2.8e-05, Identities = 63/246 (25%), Positives = 112/246 (45%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE-WVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLENKLFNN 249
           +S+I+PF N    +I   + SL  Q +K+ EV  I+D S++   ++    + ++    V  I   N G+   R+ G+  A+G YI F+D DD L    ++ +LK        D + F+Y+ +  D  +++   +  +  E   KNN      P F  +    W   +++E L+ N+   P +   +EDV F        ++       LYFY   ++  + N       D++  I K   +  ENK  N+
  S:     8 LSIIVPFFNNE-AFITPCLESLFAQIDKDIEVILINDGSSDNSAHLASRCVARHPEARVHFISQQNSGIASTRNVGLQQASGRYITFLDGDDVLSPHYVE-ILKPVLLSGQYDLLDFDYQRFTRDLPEVHK-DEQVRVHEYDFKNNGVACLEPLFTRSMWHLWNRVYRRE-LLNNERFEPGRR--YEDVIFTPFIYFKSERIAHLDHTLYFYRDNSLGITRNVKPEDIEDMLFAIGKMVRF-AENKTENS 250
>gi|84489046|ref|YP_447278.1| glycosyltransferase [Methanosphaera stadtmanae DSM 3091] >gi|84372365|gb|ABC56635.1| predicted glycosyltransferase [Methanosphaera stadtmanae DSM 3091] (389 aa)
Score = 126, Expect = 2.9e-05, Identities = 71/243 (29%), Positives = 114/243 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY-EWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQ------TDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLN-----TYKYKANDLVSIIFKNKNYLLE 243
           M K+SVI+P  N    ++++ + S+ NQT K+ EV  I+D ST+  + I +   K   +       N G G  R+ G+  A+G+YI+F D DD++ V+   Y L       N DF++ +   +  D  +I+      + ++I    + N     +    Y         W   ++KEFL        D V  FEDV F +   +  K+     K LY Y R N  S+ N      + +K   LV  I + +N   E
  S:     1 MVKISVILPIYNIA-NFLEESLKSVLNQTLKDIEVICINDGSTDNSLEILNKFAKKDNRIKIIDKKNEGTGVTRNIGLNEASGDYIYFFDPDDYI-VENTLYELYENITLNNSDFVLLKIARFREDTDEIDYSRPGFKLEDIFPNKDFNNFVFNYHDTKYYVLNASFAPWTKLYRKEFLDSYDDFIFDSVPAFEDVPFHVKSMLRAKRISYVPKFLYRY-RYNPNSNSNDPIHGKFIFKICKLVEEILRKENLFEE 253
>gi|16802540|ref|NP_464025.1| hypothetical protein lmo0497 [Listeria monocytogenes EGD-e] >gi|16409873|emb|CAC98576.1| lmo0497 [Listeria monocytogenes] (502 aa)
Score = 126, Expect = 2.9e-05, Identities = 67/211 (31%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQV----YIDLINKNGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M K+SVIIP  N    +I++  +SL NQT     FE+  IDD ST+  +     +  I+KN    + N+  N G   I R+ G+  A G+YI F+D+DD+L  +A++ L     K Q+ + I  +Y  +  +    + F K N+ +  I+ +N+  +  P  H  +QT         FL   KI     + I ED YF +   V  K   + +   Y+Y
  S:     1 MIKISVIIPIYNAE-NYIEKAFSSLKNQTLAQNEFEILCIDDKSTDNSLGKLKQLSKIHKN--MRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALERLFIQAEKNQS-EVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAP--HKMFQT--------AFLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYY 205
>gi|25011289|ref|NP_735684.1| hypothetical protein gbs1239 [Streptococcus agalactiae NEM316] >gi|23095713|emb|CAD46899.1| Unknown [Streptococcus agalactiae NEM316] (322 aa)
Score = 126, Expect = 2.9e-05, Identities = 73/247 (29%), Positives = 126/247 (51%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFK--KEFLVKNKISHPDKVNIFEDVYFGLIWKVL---YKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLENKLFN 248
           +KV+VIIP  N+   ++K+ + S+  QT+   EV  IDD ST N     D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+    +N D    +++   ++       K   F ++   NN  K     F +  + +  VC K  K+ ++ N +   + + I ED+ F    K+L   ++  + T+  LY Y R+   S++N  K+  N L  I IF   + L+  KL N
  S:     3 EKVTVIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGGICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLIT-ENADIAEVDFDISNERDYRK--KKRRNFYKVFKNNNSLKE----FLSGNRVENIVCTKLYKKSIIGN-LRFDENLKIGEDLLFNC--KLLCQEHRIVVDTTSSLYTY-RIVKTSAMNQ-KFNENSLDFITIFNEVSSLVPAKLAN 243
>gi|167412406|gb|ABZ79860.1| unknown [Campylobacter jejuni] (264 aa)
Score = 126, Expect = 3.0e-05, Identities = 54/206 (26%), Positives = 103/206 (50%)
  Q:     6 VIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN--KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           +IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L +DA +   K   K    D + F+ +      KQ   F +   F++    + ++K +    H  +   W  CF+K+ ++K+  KI   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 IIIPLFNS-CDFISRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTLDACEITFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFLDFLSKQR----HFCWSV-WAKCFRKDIILKSFEKIKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 203
>gi|153834353|ref|ZP_01987020.1| Cps2K [Vibrio harveyi HY01] >gi|148869278|gb|EDL68296.1| Cps2K [Vibrio harveyi HY01] (330 aa)
Score = 126, Expect = 3.0e-05, Identities = 34/91 (37%), Positives = 52/91 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           +SVI+P  N   K+I + + SL NQT  NFEV  +DD S +  + I         +++    +N G+   R++GV  + GEYI F+DSDD+ 
  S:     8 ISVIVPVYNVE-KYIIKCLNSLVNQTYSNFEVIVVDDESPDDSIKIAKAAFSEDSRFIFVSKSNGGLSCARNFGVKYSKGEYISFLDSDDYF 98
>gi|160888552|ref|ZP_02069555.1| hypothetical protein BACUNI_00969 [Bacteroides uniformis ATCC 8492] >gi|156861866|gb|EDO55297.1| hypothetical protein BACUNI_00969 [Bacteroides uniformis ATCC 8492] (336 aa)
Score = 125, Expect = 3.0e-05, Identities = 32/99 (32%), Positives = 54/99 (54%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           +S+I+P  N    ++++ + S+  QT KN E+  IDD S++    + DL  +   +       N G    R+ G+ +A GE + FVDSDDW+  D  ++L
  S:    10 ISIIVPVYNVK-NYLEKCLQSICGQTYKNLEIILIDDGSSDGSGELCDLFAQRDGRIKVIHQTNAGQSAARNRGLAVAQGELLGFVDSDDWIEPDMYEFL 108
>gi|183221379|ref|YP_001839375.1| putative glycosyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911470|ref|YP_001963025.1| Glycosyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776146|gb|ABZ94447.1| Glycosyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779801|gb|ABZ98099.1| Putative glycosyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (254 aa)
Score = 125, Expect = 3.1e-05, Identities = 41/119 (34%), Positives = 69/119 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK---------SFYKYQNIDFIMFEY 119
           M KVSVI+P  N    ++++ + SL +Q+ K++E+  IDD S +  + +        + ++ IP   N G    R+ G+ LA+GEYI F+D+DD    + +D ++          SF  Y+ ID   FE+
  S:     1 MPKVSVIMPAYNAA-SYLEESVNSLLSQSYKDWELLIIDDCSKDHTLDVAKNIAKKDKRIRVIPKEKNSGSADTRNQGIELASGEYIAFLDADDLWESNFLDKMIPFMEENKSSFSFSSYRIIDENGFEF 129
>gi|153165767|ref|ZP_01926458.1| hypothetical protein LMHG_01933 [Listeria monocytogenes FSL N1-017] >gi|133728125|gb|EBA29823.1| hypothetical protein LMHG_01933 [Listeria monocytogenes FSL N1-017] (502 aa)
Score = 125, Expect = 3.1e-05, Identities = 67/211 (31%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQV----YIDLINKNGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M K+SVIIP  N    +I++  +SL NQT     FE+  IDD ST+  +     +  I+KN    + N+  N G   I R+ G+  A G+YI F+D+DD+L  +A++ L     K Q+ + I  +Y  +  +    + F K N+ +  I+ +N+  +  P  H  +QT         FL   KI     + I ED YF +   V  K   + +   Y+Y
  S:     1 MIKISVIIPIYNAE-NYIEKAFSSLKNQTLAQNEFEILCIDDKSTDNSLGKLKQLSKIHKN--MRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALERLFIQAEKNQS-EVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAP--HKMFQT--------AFLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYY 205
>gi|56707909|ref|YP_169805.1| glycosyl transferase family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670380|ref|YP_666937.1| glycosyl transferase family protein [Francisella tularensis subsp. tularensis FSC198] >gi|56604401|emb|CAG45431.1| glycosyl transferase family protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320713|emb|CAL08814.1| glycosyl transferase family protein [Francisella tularensis subsp. tularensis FSC 198] >gi|151568643|gb|EDN34297.1| hypothetical protein FTBG_00164 [Francisella tularensis subsp. tularensis FSC033] (335 aa)
Score = 125, Expect = 3.1e-05, Identities = 35/106 (33%), Positives = 57/106 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + + S+ NQT KN E+  I+D +T+  + I         + V     N G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:    10 ISIIIPIYNTQ-QYLSRCLESVINQTYKNLEIILINDGATDNSLSICQKYKSKDSRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 115
>gi|168830450|gb|ACA34493.1| putative glycosyltransferase [Campylobacter jejuni] (320 aa)
Score = 125, Expect = 3.1e-05, Identities = 38/119 (31%), Positives = 66/119 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           M K+S+I+P  N   K+I + I S  NQT K+ E+  +DD  ++  + I  +   K+    + +   N+G+ + R  GV  A G YI F+D DD+L ++A +  ++     +  DFI F++
  S:     1 MPKISIIMPTFNVE-KYIARAIESCINQTFKDIEIIVVDDCGSDKSIDIAKEYAKKDKRIKIVHNEKNLGLLRARYEGVKAAGGGYIMFLDPDDYLELNACEECVRILNTEKESDFIWFDF 120
>gi|167755077|ref|ZP_02427204.1| hypothetical protein CLORAM_00581 [Clostridium ramosum DSM 1402] >gi|167705127|gb|EDS19706.1| hypothetical protein CLORAM_00581 [Clostridium ramosum DSM 1402] (718 aa)
Score = 125, Expect = 3.1e-05, Identities = 37/112 (33%), Positives = 63/112 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLI---NKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           +S++IP  N   K++ + + S+ NQT +N+EV  +DD STN +    L    NK+    V+    N  + K  +  + +A GE+I  VD+DD L  +A+   +    K+++ DFI
  S:   188 ISILIPVYNVERKFLSECLDSILNQTYQNYEVCIVDDCSTNLETINTLKEYENKDTRIVVKTRLINGHISKASNDALEIARGEFICLVDNDDTLAPNALYENVALLNKHKDADFI 302
>gi|47094723|ref|ZP_00232338.1| glycosyl transferase family protein, putative [Listeria monocytogenes str. 1/2a F6854] >gi|153173350|ref|ZP_01929130.1| hypothetical protein LMIG_02668 [Listeria monocytogenes FSL N3-165] >gi|153178620|ref|ZP_01931907.1| hypothetical protein LMMG_01119 [Listeria monocytogenes F6900] >gi|153186318|ref|ZP_01936659.1| hypothetical protein LMOG_02620 [Listeria monocytogenes J0161] >gi|153189858|ref|ZP_01937333.1| hypothetical protein LMPG_02807 [Listeria monocytogenes J2818] >gi|47016863|gb|EAL07781.1| glycosyl transferase family protein, putative [Listeria monocytogenes str. 1/2a F6854] >gi|126941200|gb|EBA19093.1| hypothetical protein LMOG_02620 [Listeria monocytogenes J0161] >gi|127766506|gb|EBA26843.1| hypothetical protein LMPG_02807 [Listeria monocytogenes J2818] >gi|133731058|gb|EBA32756.1| hypothetical protein LMIG_02668 [Listeria monocytogenes FSL N3-165] >gi|133733308|gb|EBA35006.1| hypothetical protein LMMG_01119 [Listeria monocytogenes F6900] (502 aa)
Score = 125, Expect = 3.1e-05, Identities = 67/211 (31%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQV----YIDLINKNGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M K+SVIIP  N    +I++  +SL NQT     FE+  IDD ST+  +     +  I+KN    + N+  N G   I R+ G+  A G+YI F+D+DD+L  +A++ L     K Q+ + I  +Y  +  +    + F K N+ +  I+ +N+  +  P  H  +QT         FL   KI     + I ED YF +   V  K   + +   Y+Y
  S:     1 MIKISVIIPIYNAE-NYIEKAFSSLKNQTLAQNEFEILCIDDKSTDNSLGKLKQLSKIHKN--MRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALERLFIQAEKNQS-EVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAP--HKMFQT--------AFLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYY 205
>gi|126652521|ref|ZP_01724686.1| predicted glycosyltransferase [Bacillus sp. B14905] >gi|126590649|gb|EAZ84765.1| predicted glycosyltransferase [Bacillus sp. B14905] (329 aa)
Score = 125, Expect = 3.1e-05, Identities = 55/218 (25%), Positives = 99/218 (45%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP----NNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVES 218
           M  VSVI+P  N    ++ + +TS+ +Q+ K+ E+  I+D S +  +    + +N  Q    I     +N GV K R+ G+  A G+YI FVD+DDWL +  ++ L  +  +    + +  +  W  +     L+     +        +NK        ++       +KK F+  +K+   + +N  ED  F     +  +      K+LY+YN  N  S
  S:     1 MVLVSVIVPVYNAE-NYLNKCLTSICHQSLKDIEIITINDGSEDQSL---TVLQNFAQVDARITVLDTDNGGVSKARNLGMEQAKGQYITFVDADDWLELTMLEELFLAC-RLTGSNIVKCDLFWQEEIGSRQLYYPSKTYFTYSATACLNKLFTEIGEKHFGFASCKLYKKSFIDLHKLKFDETMNFAEDTVFLTRAVIKNQSICYVPKQLYYYNVGNQNS 217
>gi|153195131|ref|ZP_01939929.1| hypothetical protein LMRG_00178 [Listeria monocytogenes 10403S] >gi|127634734|gb|EBA24114.1| hypothetical protein LMRG_00178 [Listeria monocytogenes 10403S] (502 aa)
Score = 125, Expect = 3.2e-05, Identities = 67/211 (31%), Positives = 106/211 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQV----YIDLINKNGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M K+SVIIP  N    +I++  +SL NQT     FE+  IDD ST+  +     +  I+KN    + N+  N G   I R+ G+  A G+YI F+D+DD+L  +A++ L     K Q+ + I  +Y  +  +    + F K N+ +  I+ +N+  +  P  H  +QT         FL   KI     + I ED YF +   V  K   + +   Y+Y
  S:     1 MIKISVIIPIYNAE-NYIEKAFSSLKNQTLAQNEFEILCIDDKSTDNSLGKLKQLSKIHKN--MRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALERLFIQAEKNQS-EVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAP--HKMFQT--------AFLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYY 205
>gi|47566054|ref|ZP_00237092.1| glycosyl transferase, group 2 family protein [Bacillus cereus G9241] >gi|47556971|gb|EAL15301.1| glycosyl transferase, group 2 family protein [Bacillus cereus G9241] (266 aa)
Score = 125, Expect = 3.2e-05, Identities = 33/91 (36%), Positives = 56/91 (61%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL 94
           VSVI P  N+ +++I + I S+ NQ+ +N+E+  +DD ST+  +    ++I  +    + ++  N+G  K R+  +  A G YI F+DSDD WL
  S:    14 VSVITPSYNS-IRFIGETILSVQNQSYENWEMIIVDDASTDQSLAKIKEIIEGDSRIRLLSLKENVGAAKARNLAIEEARGRYIAFLDSDDIWL 106
>gi|187932491|ref|YP_001887373.1| glycosyltransferase, GT2 family [Clostridium botulinum B str. Eklund 17B] >gi|187720644|gb|ACD21865.1| glycosyltransferase, GT2 family [Clostridium botulinum B str. Eklund 17B] (327 aa)
Score = 125, Expect = 3.2e-05, Identities = 44/141 (31%), Positives = 73/141 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEII 141
           M KVS+I P  N   + I++ I S+ NQT K FE   IDD S +  + I   L+  +   +      N GV   R+ G+ +A+GEYI F+DSDD++    ++ L+    K    D +  +Y  V +   + + ++ N  ++ I
  S:     1 MFKVSIITPVYNVE-ECIEKSIKSVINQTCKEFEFLLIDDGSKDRSIEIAKSLLENSDINFKIITQENAGVSCARNRGINIASGEYITFLDSDDYIDSRFVE-LMYDKAKKTECDVVFCDYSEVDNNGNVLVKNRTNYLNDFI 141
>gi|77408981|ref|ZP_00785702.1| glycosyl transferase cpsJ [Streptococcus agalactiae COH1] >gi|5823216|gb|AAD53070.1|AF163833_10 CpsI [Streptococcus agalactiae] >gi|18029145|gb|AAL56365.1|AF363055_6 CpsI [Streptococcus agalactiae] >gi|18029153|gb|AAL56372.1|AF363056_6 CpsI [Streptococcus agalactiae] >gi|18033339|gb|AAL57076.1|AF332896_6 CpsI [Streptococcus agalactiae] >gi|39725911|gb|AAR29912.1| Cps2I [Streptococcus agalactiae] >gi|77172404|gb|EAO75552.1| glycosyl transferase cpsJ [Streptococcus agalactiae COH1] (322 aa)
Score = 125, Expect = 3.3e-05, Identities = 47/145 (32%), Positives = 77/145 (53%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ----NIDFIMFEYEWVFDKKQIN---LFSKHNQFDEIIVKNNV 146
           +KV+VIIP  N+   ++K+ + S+  QT+   EV  IDD ST N     D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+          +DF +        KK+ N   +F  +N   E +  N V
  S:     3 EKVTVIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGEICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLITENADIAEVDFDISNERDYRKKKRRNFYKVFKNNNSLKEFLSGNRV 154
>gi|49087184|gb|AAT51426.1| PA1390 [synthetic construct] (345 aa)
Score = 125, Expect = 3.3e-05, Identities = 32/107 (29%), Positives = 55/107 (51%)
  Q:    16 KWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVY--IDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           +++++ + SL  Q+ ++FE+  +DD S +P     ++ + + G   ++  PN  G    R+ GV  A G YI  +D+DDWL   A  YL K     +    +   Y WV
  S:    10 RYLRRALDSLARQSFQDFEIILVDDGSDDPSTLGLLEALQEPGMTILRQ-PNR-GPSAARNAGVARARGRYICCLDADDWL---ASTYLEKCLVLLEGNSGVRLAYSWV 113
>gi|15596587|ref|NP_250081.1| glycosyl transferase [Pseudomonas aeruginosa PAO1] >gi|9947335|gb|AAG04779.1|AE004568_8 probable glycosyl transferase [Pseudomonas aeruginosa PAO1] (344 aa)
Score = 125, Expect = 3.3e-05, Identities = 32/107 (29%), Positives = 55/107 (51%)
  Q:    16 KWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVY--IDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           +++++ + SL  Q+ ++FE+  +DD S +P     ++ + + G   ++  PN  G    R+ GV  A G YI  +D+DDWL   A  YL K     +    +   Y WV
  S:    10 RYLRRALDSLARQSFQDFEIILVDDGSDDPSTLGLLEALQEPGMTILRQ-PNR-GPSAARNAGVARARGRYICCLDADDWL---ASTYLEKCLVLLEGNSGVRLAYSWV 113
>gi|188589853|ref|YP_001922307.1| glycosyltransferase involved in cell wall biogenesis [Clostridium botulinum E3 str. Alaska E43] >gi|188500134|gb|ACD53270.1| glycosyltransferase involved in cell wall biogenesis [Clostridium botulinum E3 str. Alaska E43] (327 aa)
Score = 125, Expect = 3.5e-05, Identities = 44/141 (31%), Positives = 72/141 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEII 141
           M KVS+I P  N   + I++ I S+ NQT K FE   IDD S +  + I   L+  +   +      N GV   R+ G+ +A+GEYI F+DSDD++    ++ L+    K    D +  +Y  V     + + ++ N  ++ I
  S:     1 MFKVSIITPVYNVE-ECIEKSIKSVINQTCKEFEFLLIDDGSKDRSIEIAKSLLEGSDINFKIITQENAGVSCARNRGINIASGEYITFLDSDDYIDSRFVE-LMYEKAKQTECDVVFCDYSEVDSNGNVLVKNRTNYLNDFI 141
>gi|182415268|ref|YP_001820334.1| glycosyl transferase family protein [Opitutus terrae PB90-1] >gi|177842482|gb|ACB76734.1| glycosyl transferase family 2 [Opitutus terrae PB90-1] (313 aa)
Score = 125, Expect = 3.5e-05, Identities = 31/127 (24%), Positives = 61/127 (48%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI 128
           K +S++I   N    W+   + S+ +Q +   +V  +DD ST+    +   +K  +        N G+   R+ G + A G Y+WF+D+DD +   A+  ++    + Q  D I+F  E + +  ++
  S:     3 KLLSIVIAAYNVE-PWVDDCLLSIESQRDDRLDVVIVDDGSTDGTSDVIRAHKKRWALQCVTKKNGGLSSARNAGASAAGGRYLWFIDADDMILPGAVACMIAQC-EQQRFDAIVFGTEEIMEGHRV 127
>gi|27550076|gb|AAO18059.1| Orf34 [Photorhabdus luminescens] (328 aa)
Score = 125, Expect = 3.5e-05, Identities = 59/215 (27%), Positives = 106/215 (49%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIM------FEYEWVFDKKQINLFSKHNQFDEII-----VKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVES 218
           +++IIP  N    +I  L+ S++ Q N NFEV  I+D ST+  +  I+   K   +       N GV   R++G+  A GE++ F+DSDDWL    +   L      Q +D ++       E  ++ + K+I   ++   +  ++     ++  V   + P F       W    KKE ++ N++S  D   + ED+ + +   ++  +     + LY Y R N+ES
  S:     6 ITIIIPLFNNE-SYIACLLDSISVQENVNFEVVIINDGSTDNSLGVINEYKKRDNRIRIFNQENRGVSVARNHGIKYARGEWVLFIDSDDWLKPQILRKWLDQAIA-QKLDVLIGNGVSFTEEPYLQENKRI---TRRQPYGRVLTGKEWIEYCVECREWPHFV------WLQLIKKELIINNQLSFKDN-TLHEDILWTINLSLIANRIGFCEELLYCY-RHNLES 219
>gi|167755076|ref|ZP_02427203.1| hypothetical protein CLORAM_00580 [Clostridium ramosum DSM 1402] >gi|167705126|gb|EDS19705.1| hypothetical protein CLORAM_00580 [Clostridium ramosum DSM 1402] (660 aa)
Score = 125, Expect = 3.5e-05, Identities = 40/113 (35%), Positives = 65/113 (57%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLI-------NKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           K+S+++P  N P K++   I S+  QT +NFE+   DD STN    ID I       NK+    V     N  + +  +  ++LA+GE+I  +D+DD L   A++ ++    + +NIDFI
  S:   153 KISIVMPVYNVPGKYLSYCIESILKQTYQNFEICIADDCSTN----IDTIETLKAYKNKDNRIKVIFREENGHISRATNSALSLASGEFIGLMDNDDTLDPHALNEVVNILNEDKNIDFI 268
>gi|159036189|ref|YP_001535442.1| CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase [Salinispora arenicola CNS-205] >gi|157915024|gb|ABV96451.1| CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase [Salinispora arenicola CNS-205] (729 aa)
Score = 125, Expect = 3.6e-05, Identities = 28/94 (29%), Positives = 50/94 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M  +S ++P       ++++ + S+  Q     EV  +DD S +   ++  +   ++    V  +P N G+G  R+ G+  A G+Y+WFVD DDWL
  S:     1 MALISFVVPAYRVQ-GYLRECLDSILGQPVAEIEVIGVDDCSPDGSGEILTEYAARDQRVRVLRLPANRGLGPARNAGLDQATGDYVWFVDGDDWL 95
>gi|153952408|ref|YP_001397859.1| putative sugar transferase [Campylobacter jejuni subsp. doylei 269.97] >gi|152939854|gb|ABS44595.1| putative sugar transferase [Campylobacter jejuni subsp. doylei 269.97] (448 aa)
Score = 125, Expect = 3.6e-05, Identities = 61/222 (27%), Positives = 104/222 (46%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEII------------VKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKIS-HPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYK 224
           KVSVIIP  N+ + +  + I S+  Q+ K  E+  +D NST+  +  I    K   +    I +    G   + G+  ANGEY+  V+SDD++  +    L  +  K +N+D +  +    +DK++         +DE              V  N   +K     N++  +    F  +FL K+++  H      ++D+ F  I  V   K     K  Y+Y + N+ SS N+ K
  S:     4 KVSVIIPSLNS-IAYYDECIKSVMKQSLKELEIICVDANSTDGTLELIKKYQKEDERIKLIISDKKSYGYQMNLGIAAANGEYVGIVESDDYIKENMYKELY-ALAKNKNLDILRSDIYNFYDKEKREFKYSVISYDEKFYHKDLYFESAGAVCKNTALTKQEILKNSWNMNPPGLFSLDFLRKSRLKFHESAGASYQDLGFWFITIVSACKIYFHKKAYYYYRQDNMGSSCNSKK 237
>gi|29376678|ref|NP_815832.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] >gi|29344142|gb|AAO81902.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] (324 aa)
Score = 125, Expect = 3.6e-05, Identities = 35/108 (32%), Positives = 59/108 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           M K+S+I+P  N   K++++ + S+  QT  +FE+  +DD S +    +        Q V+ I   N G+   R+ G+ +A GEY+ FVDSDD++  D  + L  +  K
  S:     1 MPKISIIVPVYNVE-KYLEKCVRSILAQTFTDFELILVDDGSPDSSGAMCDQFAEQDQRVKVIHKENGGLSDARNAGIEIATGEYLGFVDSDDYIADDMYELLYTNIVK 108
>gi|160944579|ref|ZP_02091807.1| hypothetical protein FAEPRAM212_02093 [Faecalibacterium prausnitzii M21/2] >gi|158444361|gb|EDP21365.1| hypothetical protein FAEPRAM212_02093 [Faecalibacterium prausnitzii M21/2] (328 aa)
Score = 125, Expect = 3.7e-05, Identities = 38/96 (39%), Positives = 55/96 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI---PNNIGVGKIRDYGVTLANGEYIWFVDSDD--------WLYVDAI 99
           +SVI+P      K++   + SL  QT +NFE+  +DD S  P    +++ +   Q  +       N GV   R++G+  A GEYI FVDSDD        WLY DA+
  S:     9 ISVIVPVYKVE-KYLPACLDSLLAQTYQNFELLLVDDGS--PDKCWEILQQYAAQDARVCIFRKENGGVSSARNFGLEQARGEYICFVDSDDLVLPQYLEWLY-DAL 111
>gi|125631997|gb|ABN47399.1| epsM [Lactococcus lactis subsp. cremoris] (331 aa)
Score = 125, Expect = 3.7e-05, Identities = 35/89 (39%), Positives = 51/89 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN-PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           +S+I+P  N+  K+++  I SL NQT +N EV  I+D ST+  Q  I    K   +       N+GV   R+YG+  A+G YI F+D DD
  S:     5 ISIIVPVYNSE-KYLRAAIHSLLNQTYQNIEVILINDGSTDGSQELISSFQKKDKRIKLYNTKNLGVSHARNYGIDRASGSYIMFLDPDD 93
>gi|167768641|ref|ZP_02440694.1| hypothetical protein CLOSS21_03200 [Clostridium sp. SS2/1] >gi|167710165|gb|EDS20744.1| hypothetical protein CLOSS21_03200 [Clostridium sp. SS2/1] (309 aa)
Score = 125, Expect = 3.8e-05, Identities = 73/290 (25%), Positives = 141/290 (48%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI--PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTD------WRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTY----KYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNWLGALNQLNYIDL--INVQKTHNKFIGNNNFYNLETI 292
           K+S+IIP  N   K++ + + S+  QT    EV  IDD S +    I       Y +++ I    N GV K R+ G+ ++NG+Y+ F+D DD L    ++ +L +  K++  D ++  Y            +  +QF+   +KNN+N  K   F             W   FK+  ++ N++   +++ +FED+ F +   V+    ++    + ++ R  ++S+++      +++   ++  I  N+    ++K  NN   FYA  +L +   LN  D   I ++     F   N  YN++ +
  S:     8 KISLIIPVFNIE-KYVYKCLCSVVEQTKMPDEVIIIDDCSQDKTSIICDEFSKKYSFIKTIHLTQNGGVSKARNVGIEVSNGKYLLFIDGDDILSKYYVEKILDNIEKFK-ADLLIGNY--------TTAENYLDQFENCCIKNNINNMKAEEFRTKLALGEKEGYLWNKLFKRNIIIDNQLKFDERLELFEDLKF-VYQYVMNSDTVIEIPDVIYWYRTRIDSAVHQLYSGKRWQQYCVIKYILNNEKQ--DSKELNNLLIFYAWMYLNSSVNLNENDRKKIVLKDIKKIFFKTNIPYNIKQL 298
>gi|146272429|dbj|BAF58179.1| galactosyltransferase [Streptococcus oralis] (322 aa)
Score = 125, Expect = 3.8e-05, Identities = 36/101 (35%), Positives = 56/101 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           +SVI+P  N    +++  + SL NQT K+FEV  +DD ST+    +     + Y +V      N G+   R+YGV  A GE+I F+D DD+    A + L++
  S:     2 ISVIVPIYNVE-AYLRYAMESLVNQTYKDFEVILVDDGSTDDSGKLCDQYASEYDWVSAYHKENGGLSDARNYGVAKAKGEWIVFLDPDDYFEPCAPELLME 102
>gi|57168028|ref|ZP_00367167.1| glycosyl transferase, putative [Campylobacter coli RM2228] >gi|57020402|gb|EAL57071.1| glycosyl transferase, putative [Campylobacter coli RM2228] (273 aa)
Score = 125, Expect = 3.8e-05, Identities = 50/191 (26%), Positives = 96/191 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFG 191
           M ++S+IIP  N+  ++I + + S  NQT ++ E+  +DD S +  V I L      + ++   N  N+G    R+ GV  +  ++I F+DSDD+L ++A +  L      Q  D + F+ +      KQ   F +   F++      + K K   W      + W   F+K+ ++K+     +++N++E + +G
  S:     1 MPQLSIIIPLFNS-CEFITRALQSCINQTLRDIEILVVDDKSEDESVKIALEFAKKDERIRIFHNDENLGTFATRNLGVLKSRADFIMFLDSDDFLALNACELALTKI--KQGFDLLCFDAFVHRVKTKQFYRFKQDEVFNQKEFFEFLGKQKHFCW------SVWAKLFRKDLILKSF----ERINLYERLSYG 182
>gi|187251712|ref|YP_001876194.1| glycosyl transferase family protein [Elusimicrobium minutum Pei191] >gi|186971872|gb|ACC98857.1| glycosyl transferase family 2 [Elusimicrobium minutum Pei191] (335 aa)
Score = 125, Expect = 3.9e-05, Identities = 60/227 (26%), Positives = 101/227 (44%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEI----IVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY--NRLNVE----SSLNTYKYKA 227
           M KVS+IIP  N    ++ Q + S+  QT ++ E   +D+ ST+    I       N    + +     G    R+  +  A+GEY++F+D DDWL    +  L K   K  + D  + +     +   +  F + N F        +K      K P+    Y    ++  ++ F  KN +S P ++   +D    +   VL  +  L   + YFY   R N E    S+ N+Y Y +
  S:     1 MPKVSIIIPVYNLE-NYLPQCLQSVEQQTLEDIEALVVDNASTDNSAEIIKQFAALNSKIRILHCKTK-GAANARNCALKEASGEYLFFLDGDDWLTPQCLAALYKE-AKANDADVTVCDNALYTETTNLMSFPQENMFFSAPKLETLKEKSLLLKAPF--TAYSCAGKL-IRRSFFEKNSLSFPSEMPRGDDWPVSMKITVLANRIKLVPNEYYFYRVGRQNAESANLSAFNSYIYAS 233
>gi|121613674|ref|YP_001000823.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005735|ref|ZP_02271493.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 81-176] >gi|40218028|gb|AAR82937.1| WaaV [Campylobacter jejuni] >gi|87249172|gb|EAQ72133.1| lipooligosaccharide biosynthesis glycosyltransferase [Campylobacter jejuni subsp. jejuni 81-176] (275 aa)
Score = 125, Expect = 3.9e-05, Identities = 56/211 (26%), Positives = 104/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN-------KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L   A +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++KN       K+   ++++  EDV F  I+ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPGACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDGVFNQKEFLEFLSKQRHFCW------SVWAKCFRKDIILKNFEKVKFEKVKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 213
>gi|115374978|ref|ZP_01462249.1| glycosyl transferase, group 2 family protein [Stigmatella aurantiaca DW4/3-1] >gi|115368005|gb|EAU66969.1| glycosyl transferase, group 2 family protein [Stigmatella aurantiaca DW4/3-1] (1091 aa)
Score = 124, Expect = 4.0e-05, Identities = 33/113 (29%), Positives = 60/113 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLIN---KNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           ++S++ P  NTP + +++ I S+  QT  N+E+  +D NS  P V   L N   ++    V+ +  N+G+    +  + +A+GE+I  +D DD L   A+  ++K        D I
  S:   276 RISILTPVYNTPPEVLRETIRSVQAQTYPNWELCLVDGNSPMPHVREILQNFAVQDERVCVRRLDLNLGISGNTNEALAMASGEFIALLDHDDTLAPFALYEIVKHLNAAPRTDMI 391
>gi|117621442|ref|YP_857387.1| glycosyl transferase, group 2 family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117562849|gb|ABK39797.1| glycosyl transferase, group 2 family protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (268 aa)
Score = 124, Expect = 4.1e-05, Identities = 41/113 (36%), Positives = 65/113 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID--LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL---YVDAIDYLLK-----SFYKYQNID 113
           M+KVSVI+P  N+  +++   I S+  Q   N+E+  IDD S +  V I     +++    +  +  N G    R+ G+ +A G +I F+DSDD WL       ID++LK     S+  Y+ ID
  S:     1 MEKVSVIMPLYNSA-RFLAASIDSVLKQQYTNWELILIDDCSVDDCVVIAQAYCDRDSRIKLVRLAENSGAAVARNRGIEIAEGRFIAFLDSDDLWLPEKLNTQIDFMLKNKVAFSYTAYKKID 123
>gi|68644581|emb|CAI34643.1| putative glycosyl transferase [Streptococcus pneumoniae] (332 aa)
Score = 124, Expect = 4.2e-05, Identities = 39/117 (33%), Positives = 64/117 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK----NGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF 117
           M K SVI+P  N   K+I++ + S+  QT  NFE+  ++D S  P   +D+I K    +    + +   N GV   R  G+  A G+Y+ ++D DD L  +A+  +L +    QN D ++F
  S:     1 MLKFSVIVPIYNVE-KYIEECVYSVLRQTYNNFELILVNDAS--PDHSLDIITKIAEKDSRIVIIDKEKNEGVALARSSGLANAKGDYVVYLDGDDQLIPEALK-ILATKIDSQNPDIVIF 117
>gi|148643605|ref|YP_001274118.1| glycosyl transferase family protein [Methanobrevibacter smithii ATCC 35061] >gi|148552622|gb|ABQ87750.1| glycosyltransferase, GT2 family [Methanobrevibacter smithii ATCC 35061] (347 aa)
Score = 124, Expect = 4.2e-05, Identities = 65/206 (31%), Positives = 107/206 (51%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIP----NNIGV-GKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFH---NNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKL 208
           K+SV++P  N   K +   I S+ NQ+   +N E+  +DD ST+     ++I+    +Y   +P     N G+ GK R  G+  A+ +YI F+DSDD    + ++ L  +    Q+ DF++  +    D  ++ +  K  Q DE +V  N  +S+  +     N +   W   FKKE ++ N IS P+   + ED YF       Y KAL+ S K+
  S:     4 KISVVMPVYNAE-KELNAAIDSIINQSLGFENIELIIVDDCSTDNSR--NIISDYANEYDNIVPVFLDENSGLPGKPRSLGIKYASADYISFLDSDDEYLKEGLENLYNTILT-QDSDFVIGSHIINLDGDKVKV--KFLQSDERLVNLNPLESQEIFDSLSLNYFVAPWGKIFKKELILDNNISFPED-TLCEDTYF-------YFKALINSNKI 205
>gi|3721919|dbj|BAA33749.1| N-acetylglucosaminyltransferase [Streptococcus agalactiae] >gi|5381186|dbj|BAA82283.1| CpsIaI [Streptococcus agalactiae] (333 aa)
Score = 124, Expect = 4.3e-05, Identities = 72/245 (29%), Positives = 124/245 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFK--KEFLVKNKISHPDKVNIFEDVYFGLIWKVL---YKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLENKLFN 248
           VS+IIP  N+   ++K+ + S+  QT+   EV  IDD ST N     D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+    +N D    +++   ++       K   F ++   NN  K     F +  + +  VC K  K+ ++ N +   + + I ED+ F    K+L   ++  + T+  LY Y R+   S++N  K+  N L  I IF   + L+  KL N
  S:     7 VSIIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGEICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLIT-ENADIAEVDFDISNERDYRK--KKRRNFYKVFKNNNSLKE----FLSGNRVENIVCTKLYKKSIIGN-LRFDENLKIGEDLLFNC--KLLCQEHRIVVDTTSSLYTY-RIVKTSAMNQ-KFNENSLDFITIFNEVSSLVPAKLAN 245
>gi|186903598|ref|ZP_02976530.1| glycosyl transferase family 2 [Cyanothece sp. PCC 7424] >gi|186689329|gb|EDU13973.1| glycosyl transferase family 2 [Cyanothece sp. PCC 7424] (1067 aa)
Score = 124, Expect = 4.3e-05, Identities = 38/125 (30%), Positives = 63/125 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDL---INKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI 128
           +SVI+P  N P  ++++ I S+ NQ   N+E+   DD ST P V + L   + ++    V    NN  + K  +  + LA GE+I  +D DD L   A   L      +   D I  + +++ D+ Q+
  S:   537 ISVIMPVYNPPENYLREAIESVLNQVYSNWELCIADDASTEPHVKLVLNEYLKQDSRIKVIFRENNGHISKASNSALELATGEFIALLDHDDVLTPHAFYELALLLNSHPEADMIYSDQDYMDDQGQL 664
>gi|168164392|ref|ZP_02599625.1| glycosyl transferase domain protein [Bacillus cereus H3081.97] (117 aa)
Score = 124, Expect = 4.4e-05, Identities = 32/92 (34%), Positives = 57/92 (61%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIR--DYGVTLANGEYIWFVDSDD 92
           M +V+V++P  N    ++++ I S+ NQT ++FE+  I+D ST+    +++IN      ++ + N + +  IR  + G+ LA GEYI  +DSDD
  S:     1 MARVTVLMPVYNGE-SYLREAIESILNQTYEDFELLIINDGSTDKS--LEIINSFQDSRIRLVNNEVNLKLIRTLNKGLDLATGEYIARMDSDD 91
>gi|167412393|gb|ABZ79849.1| unknown [Campylobacter jejuni] >gi|167412421|gb|ABZ79872.1| unknown [Campylobacter jejuni] (351 aa)
Score = 124, Expect = 4.4e-05, Identities = 43/135 (31%), Positives = 70/135 (51%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNID-----FIMFEYEWVFDKKQINLFSKHNQFD 138
           VSVIIP  N   K++++ + S+ NQT +  E+  I+D ST N     D       + +     N G+G   + G+ +A GEYI FV+SDDW+  +  + L   ++K +N D      + ++Y    + K      KH  F+
  S:     8 VSVIIPIYNVE-KYLRECLDSVVNQTLREIEIILINDGSTDNCGKICDEYATKDKRIIVIHKENAGLGAAYNSGLDIAKGEYIGFVESDDWIEFNMYEEL---YFKAKNNDSDLVKCMFYDYNSTREPKDKLYMQKHEDFE 144
>gi|167453206|ref|ZP_02319429.1| hypothetical protein LmonocytoFSL_03486 [Listeria monocytogenes FSL J2-064] (299 aa)
Score = 124, Expect = 4.4e-05, Identities = 67/211 (31%), Positives = 105/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQV----YIDLINKNGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKK-QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M K+SVIIP  N    +I++  +SL NQT     FE+  IDD ST+  +        I+KN    + N+  N G   I R+ G+  A G+YI F+D+DD+L  +A++ L     K Q+ + I  +Y  +  +    + F K N+ +  I+ +N+  +  P  H  +QT         FL   KI     + I ED YF +   V  K   + +   Y+Y
  S:     1 MIKISVIIPIYNAE-NYIEKAFSSLKNQTLAQNEFEILCIDDKSTDNSLGKLKQFSKIHKN--MRIINLHKNSGGPMIPRNKGIKEAKGKYIIFLDNDDYLGEEALERLFIQAEKNQS-EVIFGKYVGINGRGVPQSQFKKGNRNEADILADNLVYTLAP--HKMFQT--------AFLKTKKIYFDPNILIGEDQYFVMKAYVNAKVITVLADYDYYY 205
>gi|160894576|ref|ZP_02075352.1| hypothetical protein CLOL250_02128 [Clostridium sp. L2-50] >gi|156863887|gb|EDO57318.1| hypothetical protein CLOL250_02128 [Clostridium sp. L2-50] (444 aa)
Score = 124, Expect = 4.4e-05, Identities = 63/220 (28%), Positives = 110/220 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ------YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDF---IMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQ--TDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSL 220
           M KVSVI+P  N   K+++Q + S+ NQT +  E+  +DD ST+     D++N+   Q      Y Q    N+  G  R+ G + A GEY+ F D DD+   DA++   K + K + +D    +    +++  K+++  +  +     I   +  N+   P ++ N+     W   FK+ ++ + K+     V    DVYF +    L  +  +  +KL  Y R+N  S L
  S:     1 MIKVSVIVPVYNGE-KYLEQCLDSICNQTLQEIEIICVDDGSTDSS--WDILNRYKDQDDRIQLYRQQ---NLYAGVARNTGKSHATGEYLVFWDCDDFFESDALE---KMYGKAKAVDADVCVCGGNQFLESKQKLYPWPPYLSVKNIPETDTFNRFTNPDYYLNFTNAAAWNKIFKRSYIEQLKLDF-QPVRNGNDVYFTVNAIGLADRITVLDEKLVNY-RVNQASGL 220
>gi|145637005|ref|ZP_01792669.1| hypothetical protein CGSHiHH_04865 [Haemophilus influenzae PittHH] >gi|145269863|gb|EDK09802.1| hypothetical protein CGSHiHH_04865 [Haemophilus influenzae PittHH] (250 aa)
Score = 124, Expect = 4.5e-05, Identities = 35/100 (35%), Positives = 58/100 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAID 100
           M  +S+I+P  N    ++ Q I S  NQ+ +N E+  IDD ST+  + I  ++I+K+    +   P N G    R+ G+  A G+YI F+DSDD++  D ++
  S:     3 MPLISIIMPVYNAEF-YLNQGILSCLNQSYQNIELILIDDGSTDKSIEIINNIIDKDKRVKLFFTPTNQGPAAARNIGLEKAQGDYITFLDSDDFIANDKLE 103
>gi|119026403|ref|YP_910248.1| putative glycosyltransferase [Bifidobacterium adolescentis ATCC 15703] >gi|118765987|dbj|BAF40166.1| putative glycosyltransferase [Bifidobacterium adolescentis ATCC 15703] (346 aa)
Score = 124, Expect = 4.7e-05, Identities = 34/103 (33%), Positives = 54/103 (52%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSF 106
           +SVI+P      +++ + + S+ +QT +N E+  +DD S +  P +    I K+ Y+       N G G  R+ G+  + GE I FVDSDDWL     + L  S 
  S:    20 ISVIVPVYKVE-RYLDRCVQSIVDQTYRNLEIILVDDGSPDSCPDMCDAWIAKD-YRIRVIHQENQGSGAARNNGIESSTGELIGFVDSDDWLEPTMYEALFNSL 122
>gi|148828051|ref|YP_001292804.1| hypothetical protein CGSHiGG_07875 [Haemophilus influenzae PittGG] >gi|148719293|gb|ABR00421.1| hypothetical protein CGSHiGG_07875 [Haemophilus influenzae PittGG] (248 aa)
Score = 124, Expect = 4.8e-05, Identities = 35/100 (35%), Positives = 58/100 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAID 100
           M  +S+I+P  N    ++ Q I S  NQ+ +N E+  IDD ST+  + I  ++I+K+    +   P N G    R+ G+  A G+YI F+DSDD++  D ++
  S:     1 MPLISIIMPVYNAEC-YLNQGILSCLNQSYQNIELILIDDGSTDKSIEIINNIIDKDKRVKLFFTPTNQGPAAARNIGLEKAQGDYITFLDSDDFIANDKLE 101
>gi|38640642|gb|AAR25953.1| Cps7J [Streptococcus agalactiae] (321 aa)
Score = 124, Expect = 4.8e-05, Identities = 45/140 (32%), Positives = 74/140 (52%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYV-DAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEI 140
           MKK+SVIIP  N    ++ + I S+  QT  N E+  +DD ST+    I D  +K   + +    NN G+   R    + A G+YI+ +DSDD+LY  DAI+ ++     Y + D ++  Y     ++ IN+  ++   + I
  S:     1 MKKISVIIPVYNVQ-SFLNECIDSVLAQTYSNLEIILVDDGSTDTSGDICDYYSKKDRRILVFHKNNGGLSDARKKENSRATGDYIYLLDSDDYLYKEDAIEEMVGCSKGYDS-DIVLACYVERIGQRIINIVLENETIETI 140
>gi|68644331|emb|CAI34435.1| putative glycosyl transferase [Streptococcus pneumoniae] (320 aa)
Score = 124, Expect = 4.8e-05, Identities = 49/129 (37%), Positives = 69/129 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF------EYEWVFDKKQINLFS 132
           +SV+IP  N    ++   I SL NQT+KNFEV  I+D ST+    +       Y +++     N G+   R+YGV  A  E+I+F+D DD++     + L     KYQ  D I        EYE  F K+Q NL S
  S:     3 ISVVIPVYNVE-DYLHYAIDSLVNQTHKNFEVLLINDGSTDNSGNLCDKYAQEYDWIRVFHKENGGLSDARNYGVLRATNEWIFFLDPDDYIEYFTFELLSLIQEKYQ-ADLISTKVQTTNEYE-KFSKEQFNLES 135
>gi|167412404|gb|ABZ79858.1| unknown [Campylobacter jejuni] (323 aa)
Score = 124, Expect = 4.8e-05, Identities = 39/119 (32%), Positives = 66/119 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           M K+S+I+P  N   K+I + I S  NQT K+ E+  +DD  ++  + I        + ++ I N  N+G+ + R  GV  AN  YI F+D DD+L ++A +  ++     +  DFI F++
  S:     1 MPKISIILPTFNVE-KYIARAIESCINQTFKDIEIIVVDDCGSDKSIDIAKEYAKKDERIKIIHNEKNLGLLRARYEGVKAANSLYIMFLDPDDYLELNACEECVRILNTEKESDFIWFDF 120
>gi|84489306|ref|YP_447538.1| glycosyltransferase [Methanosphaera stadtmanae DSM 3091] >gi|84372625|gb|ABC56895.1| predicted glycosyltransferase [Methanosphaera stadtmanae DSM 3091] (875 aa)
Score = 124, Expect = 4.9e-05, Identities = 47/132 (35%), Positives = 74/132 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI----DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHN 135
           VSVIIP  N   +++   + S+++Q+ KN E+  IDDNST+  + I      I+K     V +I  N GV   R+ G+  A G+Y+ FVD DDWL   A+D   K   +  N+D   F    ++ KK+  + +K++
  S:   371 VSVIIPVYNGE-RYLNSCLNSIHDQSLKNMEIICIDDNSTDNSLNILKQHSKIDKR--MRVIHIKENHGVSATRNIGIKYAKGKYLTFVDCDDWLDSMALDTATK-ISQENNLDIFFFN-RTLYTKKESKIENKND 501
Score = 96, Expect = 7.8e-02, Identities = 42/126 (33%), Positives = 67/126 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQVYIDLIN--KNGYQYVQNIPNNIGV--GKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQIN 129
           +S+IIP  NT    IK+   SL NQT   +  E+ F++D ST     +DLI   KN Y  V    N      G  R+ G+  A G+Y+ F+D DD    +A ++L  +  + +++D +   Y   +  K++N
  S:    21 ISIIIPVYNTTKDDIKEAFDSLLNQTIGFEKLEIIFVNDKSTKTS-GVDLIKEYKNKYSNVLLFNNKQKKYDGPTRNNGLKHATGKYVMFLDDDDKYLSNACEFLY-NIIEAEDVDVVNGNYIDTYTNKKVN 150
>gi|167769558|ref|ZP_02441611.1| hypothetical protein ANACOL_00892 [Anaerotruncus colihominis DSM 17241] >gi|167668526|gb|EDS12656.1| hypothetical protein ANACOL_00892 [Anaerotruncus colihominis DSM 17241] (337 aa)
Score = 124, Expect = 4.9e-05, Identities = 34/103 (33%), Positives = 56/103 (54%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSF 106
           VSVI+P  N   ++++Q + SL +QT    E+  +++ S +    I      ++    V  I  N+  G  R+ G+  A GEYI FVD DDW+  + I+ LL++ 
  S:    12 VSVIVPIYNQE-RYLEQCVKSLLHQTYPYLEIILVNNGSKDRSGAICKKFARQDRRVRVLEIKENLSAGNGRNTGLDAAAGEYISFVDGDDWVRPEFIEKLLRAL 115
>gi|161506735|ref|YP_001576685.1| putative polysaccharide biosynthesis protein [Lactobacillus helveticus DPC 4571] >gi|160347724|gb|ABX26398.1| putative polysaccharide biosynthesis protein [Lactobacillus helveticus DPC 4571] (271 aa)
Score = 124, Expect = 4.9e-05, Identities = 50/209 (23%), Positives = 95/209 (45%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF--DKKQINLFSKHNQF----DEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           K+++I+P  NT  +++ +   +L  Q NK F++  +DD ST+  V +     + + Y + I   N G    R+ G+   +  Y+ F D DDW+      + + +F ++ N++ +   Y W+   DKK+  +      F    +  I   NV  S M  +       W   +K   + K  +     +++ ED  F + +  + +    T K  Y Y
  S:     6 KLTIIMPVYNTA-QYLPRAFDALLKQVNKAFKLIVVDDGSTDNSVEVAQSYASRFPYFKLIQKENGGPSDARNVGIKYIDTPYVTFHDGDDWVDPGYTAFFINAFEEHPNVNLVSCGY-WIDYPDKKERVIGHPEGGFLTRGETYIKLTNVFGSPMKGY------SWNKAYKTAIINKYHLRFDCDISLLEDQIFNVKYTSVARGVYYTQKPYYHY 213
>gi|167940027|ref|ZP_02527102.1| Glycosyltransferase [Bacillus cereus AH1134] (643 aa)
Score = 124, Expect = 5.0e-05, Identities = 56/187 (29%), Positives = 96/187 (51%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQY--VQNIPNNIGVGKIRDY---GVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKS--KMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDV 188
           KK+SVIIP  N   K++   I S+ NQT   +E+ F+DD ST+  V  +  L++K    +  VQ I N+   G +      GV+ A G+YIW  ++DD      +  +++ FY   NI     + + +   +Q N+ + H     +   N+++K   K P+F    +       K   L+KN I +   V +F+++
  S:   367 KKISVIIPNYNYE-KYLPDRIESILNQTYPLYELIFLDDASTDHSVSTFKKLLSKENKNHLKVQQIINDKNSGSVFKQWIKGVSAATGDYIWIAEADDLCDKTFLQEVIQGFYINNNITLSYTQSKQI--DEQGNVLANH----YLNYTNDIDKEKWKAPYFRKGVEE-----IKDTLLIKNTIPNVSSV-VFKNI 549
>gi|29347058|ref|NP_810561.1| putative glycosyltransferase [Bacteroides thetaiotaomicron VPI-5482] >gi|29338956|gb|AAO76755.1| glycoside transferase family 2 [Bacteroides thetaiotaomicron VPI-5482] (330 aa)
Score = 124, Expect = 5.0e-05, Identities = 61/245 (24%), Positives = 111/245 (45%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQY--------VQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNN----------YQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKA-NDLVSIIFKNKNYLLENKLF 247
           ++SVI+P  N  L +I++ + SL  QT +N E  F++D    P   +D+++    +Y        +     N G+  +R+ G+  A G+YI + DSDDW+  +  + LL    +  + D +  ++                 FD+ +  + + K   P               +   W     K    + KI  P+ +N++EDV   +       K     + LY Y   NV S   +   K+  +LV+ I   +++ L N+ F
  S:     8 RISVIVPIYNVKL-YIERCVRSLMEQTLENIEFIFVND--CTPDDSMDILHYVLEEYPKRREQIKIIEHETNRGISAVRNTGLKNATGQYIIYCDSDDWVEKNMYEKLLVKALE-TSADIVGCDF-----------------FDDYVAHSTIRKQLFPQQSEKCVKKMLRGELHCGTWNKLVIKSLYERTKIDFPEGINMWEDVSTIIPLCFHATKIDYIPEALYHYIHHNVSSYTYSVTEKSLENLVASIQLLESFFLTNQCF 250
>gi|145629940|ref|ZP_01785722.1| hypothetical protein CGSHi22421_07813 [Haemophilus influenzae 22.4-21] >gi|144984221|gb|EDJ91644.1| hypothetical protein CGSHi22421_07813 [Haemophilus influenzae R3021] (250 aa)
Score = 123, Expect = 5.1e-05, Identities = 35/100 (35%), Positives = 58/100 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAID 100
           M  +S+I+P  N    ++ Q I S  NQ+ +N E+  IDD ST+  + I  ++I+K+    +   P N G    R+ G+  A G+YI F+DSDD++  D ++
  S:     3 MPLISIIMPVYNAEC-YLNQGILSCLNQSYQNIELILIDDGSTDKSIEIINNIIDKDKRVKLFFTPTNQGPAAARNIGLEKAQGDYITFLDSDDFIANDKLE 103
>gi|145632239|ref|ZP_01787974.1| hypothetical protein CGSHi3655_07289 [Haemophilus influenzae 3655] >gi|145634029|ref|ZP_01789740.1| hypothetical protein CGSHiAA_08295 [Haemophilus influenzae PittAA] >gi|144987146|gb|EDJ93676.1| hypothetical protein CGSHi3655_07289 [Haemophilus influenzae 3655] >gi|145268473|gb|EDK08466.1| hypothetical protein CGSHiAA_08295 [Haemophilus influenzae PittAA] (250 aa)
Score = 123, Expect = 5.2e-05, Identities = 35/100 (35%), Positives = 58/100 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAID 100
           M  +S+I+P  N    ++ Q I S  NQ+ +N E+  IDD ST+  + I  ++I+K+    +   P N G    R+ G+  A G+YI F+DSDD++  D ++
  S:     3 MPLISIIMPVYNAEC-YLNQGILSCLNQSYQNIELILIDDGSTDKSIEIINNIIDKDKRVKLFFTPTNQGPAAARNIGLEKAQGDYITFLDSDDFIANDKLE 103
>gi|16272808|ref|NP_439028.1| hypothetical protein HI0868 [Haemophilus influenzae Rd KW20] >gi|145628214|ref|ZP_01784015.1| hypothetical protein CGSHi22121_04215 [Haemophilus influenzae 22.1-21] >gi|145638314|ref|ZP_01793924.1| hypothetical protein CGSHiII_06069 [Haemophilus influenzae PittII] >gi|148826488|ref|YP_001291241.1| hypothetical protein CGSHiEE_07695 [Haemophilus influenzae PittEE] >gi|3123077|sp|Q57022|Y868_HAEIN Uncharacterized glycosyltransferase HI0868 >gi|1573885|gb|AAC22526.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20] >gi|144979989|gb|EDJ89648.1| hypothetical protein CGSHi22121_04215 [Haemophilus influenzae 22.1-21] >gi|145272643|gb|EDK12550.1| hypothetical protein CGSHiII_06069 [Haemophilus influenzae PittII] >gi|148716648|gb|ABQ98858.1| hypothetical protein CGSHiEE_07695 [Haemophilus influenzae PittEE] (250 aa)
Score = 123, Expect = 5.2e-05, Identities = 35/100 (35%), Positives = 58/100 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAID 100
           M  +S+I+P  N    ++ Q I S  NQ+ +N E+  IDD ST+  + I  ++I+K+    +   P N G    R+ G+  A G+YI F+DSDD++  D ++
  S:     3 MPLISIIMPVYNAEC-YLNQGILSCLNQSYQNIELILIDDGSTDKSIEIINNIIDKDKRVKLFFTPTNQGPAAARNIGLEKAQGDYITFLDSDDFIANDKLE 103
>gi|169180946|ref|ZP_02841586.1| glycosyl transferase family 2 [Thauera sp. MZ1T] >gi|169011801|gb|EDS58557.1| glycosyl transferase family 2 [Thauera sp. MZ1T] (268 aa)
Score = 123, Expect = 5.3e-05, Identities = 33/99 (33%), Positives = 51/99 (51%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           +SV+I   N   +++ + + S+  QT    E+ FIDD ST+  + I       Y        N GV   R+     A+GEY+ F+DSDD LY D+++ L
  S:     5 ISVVIANYNYG-RYLAETLESVLAQTYAPVEIVFIDDGSTDDSLEI----ARSYPITVLAQQNQGVSAARNNAAQYAHGEYVLFLDSDDLLYPDSLEVL 98
>gi|168525649|ref|ZP_02719288.1| glycosyl transferase (lgtD) [Borrelia burgdorferi 118a] (358 aa)
Score = 123, Expect = 5.3e-05, Identities = 61/220 (27%), Positives = 105/220 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVF-----DKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNY--QTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNT 222
           KVSVII F N+  + +  +I    NQT K+ E+  IDD S +  + I     N Y +++     NIG+   RD G++ A GEY+ + DSDD +    ++ L     K  N D +  ++   F      +K +  F  +    +   KN +      +   N+   T W    ++E ++KN I   + V  FED+ F  + ++  K + ++    YFY       S+++
  S:     9 KVSVIICFFNSA-ETLDAIIKDAVNQTLKDKEIILIDDGSYDGSLKIAEKYANKYSFIKIFSQKNIGLSASRDKGLSEAQGEYVIYWDSDDSVESTMLEVLYNR-AKADNSDIVCSQFYIYFLAINVKRKSLLPFPNYPLTGKEAFKNLLFTVYATFGRKNFVVGTLWDKLIRRELILKNNIRQQNVV--FEDIVF--VMQIFLKASKVSFVNNYFYTNFQRMGSMSS 230
>gi|60682266|ref|YP_212410.1| putative glycosyltransferase protein [Bacteroides fragilis NCTC 9343] >gi|60493700|emb|CAH08489.1| putative glycosyltransferase protein [Bacteroides fragilis NCTC 9343] (360 aa)
Score = 123, Expect = 5.4e-05, Identities = 51/210 (24%), Positives = 101/210 (48%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNY--QTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN 212
           KVS+I+P  +   K + + + +L  QT  ++E+  IDD ST N     +   KN          N GV   R+ G+ +A GE+I F+DSDD++  D +  L++     Q  D ++  +        I+ F+   Q+   ++ ++++K+      N+Y   + W   F+++ + K++     ++ + ED  F   + +      + +   YFY+
  S:     2 KVSIIVPCYSVASK-LPRCVHNLLAQTFTDWELILIDDGSTDNTWDICNSFTKNNAHIHAVHKENGGVSSARNTGIEIAKGEFITFIDSDDYVKPDYLQKLVEG----QEADLVLCGFR---SSTGID-FTPEPQY---LIGDDLSKNIQAIVENDYLLYSPWCKLFRRDIIQKHQHRFDPEIRLGEDTIFCYKYLLYCSSIKVVASNSYFYD 202
>gi|15718495|gb|AAL05996.1|AF401528_13 putative glycosyltransferase [Campylobacter jejuni] >gi|73672627|gb|AAZ80468.1| putative glycosyltransferase [Campylobacter jejuni] >gi|75911798|gb|ABA29489.1| putative glycosyltransferase [Campylobacter jejuni] (275 aa)
Score = 123, Expect = 5.5e-05, Identities = 55/211 (26%), Positives = 104/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN-------KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L   A +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++KN       K+   ++++  EDV F  ++ +  +K  +    +Y Y
  S:     1 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPGACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDGVFNQKEFLEFLSKQRHFCW------SVWAKCFRKDIILKNFEKVKFEKVKIDERLSYGEDVLFCYVYFMFCEKIAVFKTCIYHY 213
>gi|153854319|ref|ZP_01995618.1| hypothetical protein DORLON_01613 [Dorea longicatena DSM 13814] >gi|149753094|gb|EDM63025.1| hypothetical protein DORLON_01613 [Dorea longicatena DSM 13814] (323 aa)
Score = 123, Expect = 5.5e-05, Identities = 39/116 (33%), Positives = 59/116 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           +S+IIP      K++ + I S+ +QT  N E+  +DD S +    I D       +       N G G  R+  + LA GE+I FVDSDD+L V+    LL  F   ++ID +  E+
  S:     5 ISIIIPVYKVE-KYLDKCIKSIVSQTYSNLEIILVDDGSPDKSGLICDKWATLDSRIRVVHQKNAGAGAARNVALKLAQGEFISFVDSDDYLSVNMFKNLLSYF--EEDIDIVECEF 118
>gi|159029172|emb|CAO87532.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (325 aa)
Score = 123, Expect = 5.6e-05, Identities = 41/144 (28%), Positives = 69/144 (47%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNV 146
           +VSVIIP  N   +++   I S+  QT +N E+  IDD ST P+    L N    +       N GV   R+ G+  A G YI  +D+DD +    ++  +      Q +  +  E E+  D++      ++ +F +I+V N +
  S:     6 QVSVIIPCYNQG-RYLDHAIASVLVQTYQNLEILVIDDGSTEPETIEVLQNYQQPKTRIIRTENQGVAAARNLGIAQAQGTYILPLDADDKIADSYLEKAVTLLESNQQLGIVYCEAEYFGDRQGTWPLPEY-KFPDILVDNMI 147
>gi|186901704|ref|ZP_02974654.1| glucosyltransferase [Cyanothece sp. PCC 7424] >gi|186691270|gb|EDU15896.1| glucosyltransferase [Cyanothece sp. PCC 7424] (126 aa)
Score = 123, Expect = 5.7e-05, Identities = 35/94 (37%), Positives = 52/94 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL 94
           MKK SVIIP  N   K+I + I S+  QT +NFE+  ++D S +  + I      +  + +     N G+   R+ G+  + GEYI F+D DD WL
  S:     1 MKKFSVIIPAYNVE-KYIAKTIQSVLEQTYQNFELLIVNDGSLDRTLEICQQFTDSRLKIISQ--KNTGLSGARNTGIRHSQGEYIAFLDGDDLWL 93
>gi|171916002|ref|ZP_02931472.1| glycosyl transferase, group 1 [Verrucomicrobium spinosum DSM 4136] (1982 aa)
Score = 123, Expect = 5.8e-05, Identities = 31/99 (31%), Positives = 56/99 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQY-VQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAI 99
           + K+SV++P  NTPL  +++ + S+  Q   N+++   DD ST P +  Y+  +  +  +  V  +  N G+    +    LA GE++ F+D DD L +DA+
  S:   787 LPKISVVMPVYNTPLWALQKAVQSVTAQIYDNWQLCIADDCSTEPDIRQYLQALQASDSRISVTFLEQNSGISAATNAAAALAEGEFLAFLDHDDELTIDAL 888
>gi|90410709|ref|ZP_01218724.1| glycosyltransferase [Photobacterium profundum 3TCK] >gi|90328340|gb|EAS44638.1| glycosyltransferase [Photobacterium profundum 3TCK] (334 aa)
Score = 123, Expect = 5.8e-05, Identities = 36/100 (36%), Positives = 62/100 (62%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQ---YVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           K+SVIIP  N+ ++++ + + SL NQT K+ E+  I+D S +  + I    K+ +     V ++  N   G  R+ G+ +A+GEY+ FVDSDDW+ +   ++L
  S:     6 KISVIIPVYNS-VEYLDRCLNSLLNQTLKDIEIICINDASKDESLTILNKYKDNHPEVIKVIDLKENKKQGGARNAGLDIASGEYVAFVDSDDWVELHMFEHL 107
>gi|75760271|ref|ZP_00740323.1| Glycosyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168142085|ref|ZP_02585314.1| putative N-acetylgalactosaminyl-diphosphoundecaprenol glucuronosyltransferase [Bacillus cereus G9842] >gi|74492240|gb|EAO55404.1| Glycosyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] (266 aa)
Score = 123, Expect = 5.8e-05, Identities = 40/119 (33%), Positives = 64/119 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WLYVDAIDYLLKSFYKYQNIDFIMFEYEWV 122
           VSVI P  N+ +++I + I S+ NQ+ +N+E+  +DD ST+       ++I  +    + ++  N+G  K R+  +  A G YI F+DSDD WL       LL  F +  NI F    Y  +
  S:    14 VSVITPSYNS-IRFIGETILSVQNQSYENWEMIIVDDCSTDQSAAKIKEIIEGDSRIRLLSLKENVGAAKARNLAIQEARGRYIAFLDSDDIWLPHKLKTQLL--FMEEMNIAFSYASYSLI 132
>gi|168183225|ref|ZP_02617889.1| glycosyltransferase [Clostridium botulinum Bf] >gi|182673578|gb|EDT85539.1| glycosyltransferase [Clostridium botulinum Bf] (376 aa)
Score = 123, Expect = 6.1e-05, Identities = 71/244 (29%), Positives = 124/244 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDY--GVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY-QNIDFI---MFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNYLLEN 244
           M K + IIP  N   K++KQ I S+ NQ+ KNF +  IDD ST+  V I  + KN    V+ I +   +GK   +  G   A G+YI  + SDD++ ++A++ + +   +  Q IDFI    + YE   +K +    SK    +E++   N+  + +  F++    +    F +EF V+ +             Y  +I  + Y  ++   K+L FY R+ + +S+  +   AN+   I+ KNK+  L++
  S:     1 MYKYTFIIPNYNKA-KYLKQCIDSIINQSYKNFNLIIIDDCSTDDSVKIINLYKN-MNNVKIIKHKTNMGKSYTFNEGFKNAEGDYITIMGSDDYIKLNALENIDRFLSQQNQKIDFIYTDFYIYENEENKIKNGYISKDITIEELLFGCNI--TSLCTFYSKDLINNVTGFDEEFAVRGQ------------DYDFIIRALCYGNSIYLDKRLAFY-RVGLNNSVPDFSILANNYHEILLKNKDIFLKH 233
>gi|167010469|ref|ZP_02275400.1| glycosyl transferase family protein [Francisella tularensis subsp. holarctica FSC200] (328 aa)
Score = 123, Expect = 6.1e-05, Identities = 35/106 (33%), Positives = 56/106 (52%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +S+IIP  NT  +++ + +  + NQT KN E+  I+D ST+  + I         + V     N G    R+  + +A G+YI F+DSDDW+ +D I  L    + Y
  S:     3 ISIIIPIYNTQ-QYLSRCLEFVINQTYKNLEIILINDGSTDNSLSICQKYKSKDSRIVLLNQQNSGQALARNNALDIAKGDYIAFIDSDDWVSLDYIQALYNHVFSY 108
>gi|148264386|ref|YP_001231092.1| glycosyl transferase family protein [Geobacter uraniireducens Rf4] >gi|146397886|gb|ABQ26519.1| glycosyl transferase, family 2 [Geobacter uraniireducens Rf4] (310 aa)
Score = 123, Expect = 6.1e-05, Identities = 44/131 (33%), Positives = 69/131 (52%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKH 134
           +SVIIP  N+  K+I + I S+  QT  ++E+  IDD ST+   ++  D      Y YV+N     GV   R+YG++ A G+ I F+D+DD    D ++     F+    +  + F   + FD+  I   SKH
  S:     2 ISVIIPTYNSD-KYICEAIDSVLCQTYTDYEIVIIDDGSTDDTKRIIEDRYPTVRYFYVENK----GVASARNYGISKAQGDLIAFLDADDRWLPDKLEKQAVLFHNCNELGLV-FTENYFFDEHGI---SKH 125
>gi|169342986|ref|ZP_02864014.1| UDP-galactose phosphate transferase [Clostridium perfringens C str. JGS1495] >gi|169298895|gb|EDS80969.1| UDP-galactose phosphate transferase [Clostridium perfringens C str. JGS1495] (500 aa)
Score = 123, Expect = 6.2e-05, Identities = 40/117 (34%), Positives = 67/117 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYE 120
           VS+I P  NT  ++I + I S+ NQT +N+E+F +DD ST+   +V    ++ +  +Y++N  N+ G    R+  +  ANG +I F+DSDD    + ++  ++ F K  N  F    YE
  S:   249 VSIITPSYNTG-RYISKTIESVLNQTYENWEMFIVDDGSTDNTDEVVKGYLHDSRIRYLKNEKNS-GAAISRNRALREANGRWIAFLDSDDLWSTEKLEKQIR-FMKDNNYHFSYTNYE 364
>gi|150008821|ref|YP_001303564.1| glycosyl transferase family protein [Parabacteroides distasonis ATCC 8503] >gi|149937245|gb|ABR43942.1| glycosyltransferase family 2 [Parabacteroides distasonis ATCC 8503] (329 aa)
Score = 123, Expect = 6.3e-05, Identities = 62/210 (29%), Positives = 108/210 (51%)
  Q:     5 SVIIPFKNTPLKWIKQLITSLNNQTNKN-FEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLF-------SKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRL 214
           S+IIP  N      K L + LN + + N FE+  IDD S +  + I  +  + N   ++Q +   N G  + R++G+  A+G+YI ++DSDD+   + I  +L +    Q +D + F+++ V   +  NL         KH   D +   + + K+      N+    W+  F+K+FL+KN I   D + I +D+ + L  + LYK   +    +  YN L
  S:     8 SIIIPCYNAEKYIHKCLESCLNQRLDYNTFEIIAIDDGSEDNTLNILHEFAHNNPQLHMQILTQKNAGQSRARNHGLEYAHGKYILYLDSDDFFVDNTISEILYTAIDNQ-LDMLWFDHQHV--DENYNLLPLPQADCKKHVPTDIMSGIDFIKKA-----FNHSGMVWQFIFRKDFLIKNNILFFDGI-IMQDIVYTL--QCLYKCKRVQYYPICAYNYL 217
>gi|63029665|gb|AAY27724.1| beta-1,3-galactosyltransferase [Campylobacter jejuni subsp. jejuni] (301 aa)
Score = 123, Expect = 6.3e-05, Identities = 63/229 (27%), Positives = 109/229 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF----EYEWVFDKK---QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN----KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKAND 229
           M K+S+I+P  N   K+I + + S  NQT KN E+  +DD  ++  + I  +   K+    + +   N+ + + R  GV +AN  YI F+D DD+L ++A +  +K   +   +D + F    E   +  KK       +SK     +II K N+           Y T W    +K+  ++     ++    K+N+ EDV       +LY   L  ++K+ + N        N Y Y  N+
  S:     1 MSKISIILPTFNVE-KYIAKALESCINQTFKNIEIIVVDDCGSDKSINIAKEYAKKDDRIKIIHNEENLKLLRARYEGVKVANSPYIMFLDPDDYLELNACEECIKFLDEQDEVDLVFFNAIVESNVISYKKFDFNSGFYSKKEFVKKIIAKKNL-----------YWTMWGKLIRKKLYLEAFSSLRLEKDVKINMAEDV-------LLYYPMLSQAQKIAYMN-------CNLYHYAPNN 216
>gi|150026503|ref|YP_001297329.1| glycosyl transferase, group 2 family protein [Flavobacterium psychrophilum JIP02/86] >gi|149773044|emb|CAL44528.1| Glycosyl transferase, group 2 family protein [Flavobacterium psychrophilum JIP02/86] (257 aa)
Score = 123, Expect = 6.4e-05, Identities = 39/122 (31%), Positives = 66/122 (54%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDK 125
           VS+I P  N+  ++I + I S+ NQ+  ++E+  +DD S +  V I  + I+++   Y+  +  N G G  R+  +  A G YI F+DSDD    D +   +K F +  NI F    Y+ + +K
  S:     5 VSIITPTYNSE-QFIAEAIKSVQNQSYSHWEIIIVDDCSKDKTVNIIQNFIDEDHRIYLIQLDKNSGAGVARNNAINNAKGRYIAFLDSDDLWKPDKLSKQIK-FMQRHNIPFTFSFYDCINEK 126
>gi|148643383|ref|YP_001273896.1| glycosyl transferase family protein [Methanobrevibacter smithii ATCC 35061] >gi|148552400|gb|ABQ87528.1| glycosyltransferase, GT2 family [Methanobrevibacter smithii ATCC 35061] (348 aa)
Score = 123, Expect = 6.5e-05, Identities = 62/210 (29%), Positives = 106/210 (50%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNPQVYIDLINKNGYQY----VQNIPNNIGV-GKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKN---NVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYN 212
           K+SVI+   N+   ++ + + S+ +Q+   ++ EV F+DD ST+    +DL+N     Y    V  +  N G  G  R+ G+ LA GEY+ F D DD    +A + +   + K    D ++  +  VFD K +   S +     + VKN   + N  ++P         W   F+K+FLV+N I   +++ + EDVY   +   L  + ++     Y YN
  S:     4 KISVIVATYNSG-DFLNEFLDSIKSQSLGFEDIEVIFVDDASTDDYT-LDLLNNFNESYPNVSVIFLDENSGFPGTGRNRGLDLAGGEYVIFADHDDSYVENAFEVM---YDKINENDMLISNFNQVFDDKVVKFKSLYKDTPTVCVKNIDEDRNLLRIP------AAIWTRLFRKDFLVENNIRFLERM-LCEDVYVATL-GCLKAEGIIYLNDFYSYN 210
>gi|48474152|dbj|BAD22623.1| N-acetylgalactosamine transferase [Streptococcus oralis] (321 aa)
Score = 123, Expect = 6.5e-05, Identities = 34/99 (34%), Positives = 55/99 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           +SVI+P  N    ++   + SL +QT K+ EV  IDD S++   ++       Y +V +    N G+   R+YGV  A G++I F+D DD+L   A++ L
  S:     2 ISVIVPVYNVE-DYLHYAMESLEHQTYKDMEVLLIDDGSSDGSGHLCDQYAQQYDWVTSYHKVNGGLSDARNYGVLKAKGDWITFLDPDDYLEPCALELL 100
>gi|167461790|ref|ZP_02326879.1| hypothetical protein Plarl_04420 [Paenibacillus larvae subsp. larvae BRL-230010] (239 aa)
Score = 123, Expect = 6.6e-05, Identities = 36/93 (38%), Positives = 50/93 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLY 95
           +V++IIP  N P  ++ Q I S  NQT  + EV  IDD ST   +Y + I     Q       N G     +YG++LA+GEYI ++ SDD  Y
  S:     4 RVTIIIPVYNCP--YVHQAIESALNQTYPHKEVLVIDDGST---LYKERIEPYLSQIHYIGKANGGTASALNYGISLASGEYIAWLSSDDQFY 91
>gi|76787453|ref|YP_329868.1| capsular polysaccharide biosythesis protein CpsI [Streptococcus agalactiae A909] >gi|77412816|ref|ZP_00789021.1| glycosyl transferase cpsJ [Streptococcus agalactiae 515] >gi|18029161|gb|AAL56379.1|AF363057_6 CpsI [Streptococcus agalactiae] >gi|18029169|gb|AAL56386.1|AF363058_6 CpsI [Streptococcus agalactiae] >gi|18029177|gb|AAL56393.1|AF363059_6 CpsI [Streptococcus agalactiae] >gi|18033317|gb|AAL57057.1|AF332893_6 CpsIaI [Streptococcus agalactiae] >gi|76562510|gb|ABA45094.1| capsular polysaccharide biosythesis protein CpsI [Streptococcus agalactiae A909] >gi|77161112|gb|EAO72218.1| glycosyl transferase cpsJ [Streptococcus agalactiae 515] (324 aa)
Score = 123, Expect = 6.6e-05, Identities = 72/245 (29%), Positives = 124/245 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFK--KEFLVKNKISHPDKVNIFEDVYFGLIWKVL---YKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSI-IFKNKNYLLENKLFN 248
           VS+IIP  N+   ++K+ + S+  QT+   EV  IDD ST N     D +++   + +     N GV   R+ G+  + GE+I FVDSDD++  + I+ +LK+    +N D    +++   ++       K   F ++   NN  K     F +  + +  VC K  K+ ++ N +   + + I ED+ F    K+L   ++  + T+  LY Y R+   S++N  K+  N L  I IF   + L+  KL N
  S:     7 VSIIIPIYNSE-AYLKECVQSVLQQTHPLIEVILIDDGSTDNSGEICDNLSQEDNRILVFHKKNGGVSSARNLGLDKSTGEFITFVDSDDFVAPNMIEIMLKNLIT-ENADIAEVDFDISNERDYRK--KKRRNFYKVFKNNNSLKE----FLSGNRVENIVCTKLYKKSIIGN-LRFDENLKIGEDLLFNC--KLLCQEHRIVVDTTSSLYTY-RIVKTSAMNQ-KFNENSLDFITIFNEVSSLVPAKLAN 245
>gi|14389020|gb|AAK61902.1|AF373595_11 EpsG [Streptococcus thermophilus] >gi|22218138|gb|AAM94589.1|AF448502_10 epsG [Streptococcus thermophilus] >gi|24636997|gb|AAN63513.1|AF410175_10 putative glucosyl transferase [Streptococcus thermophilus] (322 aa)
Score = 122, Expect = 6.8e-05, Identities = 59/230 (25%), Positives = 106/230 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKA---LLTSKKLYFYNRLNVESSLNTYKYKANDLVSI 233
           +S++IP  N    +IK+ + S+ +QT  + E+  +DD ST+    I D  ++N  +       N G  + R+ G+  A  E+I F+DSDD++  D I+YL  +  +  N D  +  + ++  KK I    KH   +  ++       +M          W   ++ E+  K K        +FED    LI   ++ +A   +  +K +YFY      +   T+  K  DL+ +
  S:     3 ISIVIPVYNVQ-DYIKKCLDSILSQTFSDLEIILVDDGSTDLSGRICDYYSENDKRIKVIHTANGGQSEARNVGIKNATSEWITFIDSDDYVSSDYIEYLY-NLIQVHNADISIASFTYITPKKII----KHGNGEVALMDAKTAIRRMLLNEGFDMGVWGKMYRTEYFNKYKFVSG---KLFED---SLITYQIFSEASTIVFGAKDIYFYVNRKNSTVNGTFNIKKFDLIEM 224
>gi|50429213|gb|AAT77197.1| putative glycosyltransferase [Campylobacter jejuni] (288 aa)
Score = 122, Expect = 6.8e-05, Identities = 74/259 (28%), Positives = 121/259 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFL---VKNKISHPDKVNIFEDV--YFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTY---KYKANDLVSIIFKNKNYLLENKLFNNNWYFYASNWL 259
           M K+S+I+P  N   K+I + I S  NQ+ K+ E+  +DD  ++  + I        + ++ I N  N+G    R+ GV  +NGEY+ F+D DD+L +DA + L+   + Y+   F            QI+   K     +  +KN      +  F   Y   W +  KK+F    +K   +   K+ + ED+  +F LI  +   + L     LY YN ++   S+      K K  D +   F    Y+ ENK+   N   YA  +L
  S:     1 MPKISIIMPTFNVE-KYIARAIESCVNQSFKDIEIIIVDDCGSDKSINIAKEYAKKDERIKIIHNEKNLGTFAARNNGVKHSNGEYLMFLDPDDYLELDACEKLILLIHTYKICQFSF---------TQISNGVKLKSVFKDTLKN------LEEFKGMYWNIWTLFVKKDFYLDSLKELFAIDKKLLVAEDMLAFFFLINNLNDDEYLQVD--LYLYNYVDNSFSITKRRKNKEKIQDCLDDYFYILKYIKENKILKENLKSYALIYL 251
>gi|113476765|ref|YP_722826.1| glycosyl transferase family protein [Trichodesmium erythraeum IMS101] >gi|110167813|gb|ABG52353.1| glycosyl transferase, family 2 [Trichodesmium erythraeum IMS101] (703 aa)
Score = 122, Expect = 6.8e-05, Identities = 36/126 (28%), Positives = 67/126 (53%)
  Q:     3 KVSVIIP-FKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKI---RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI 128
           +VSVI+P + + P  ++++ + S+ +QT  +FEV  +DD S++    I    K        +PN    G +    + GV+LA GEYIW  +SDD+   D +  L+    ++  +  + +   W+ D + +
  S:   424 RVSVIVPNYNHAP--YLRKRLDSVYSQTYTDFEVILLDDCSSDNSRDILASYKEEKPNTIFVPNESNSGSVFRQWEKGVSLARGEYIWIAESDDFASPDFLKQLVTVMDEHPEVG-LAYSQSWLVDSQDV 550
>gi|15718510|gb|AAL06010.1|AF401529_13 putative glycosyltransferase [Campylobacter jejuni] (284 aa)
Score = 122, Expect = 6.9e-05, Identities = 56/211 (26%), Positives = 104/211 (49%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE-YEWVFDKKQINLFSKHNQFDEIIVKNNVNKSK-MPWFHNNYQTDWRVCFKKEFLVKN-------KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY 211
           M ++S+IIP  N+   +I + + S  NQT K+ E+  IDD S +  +   ++   K+    +     N+G    R+ GV  ++ ++I F+DSDD+L   A +   K   K    D + F+ +      KQ   F +   F++      ++K +   W      + W  CF+K+ ++KN       K+   ++++  EDV F  I+ +  +K  +    +Y Y
  S:    29 MPQLSIIIPLFNS-CDFILRALQSCINQTLKDIEILIIDDKSKDNSLNMVLEFAKKDPRIKIFQNEENLGTFASRNLGVLHSSSDFIMFLDSDDFLTPGACEIAFKEMKK--GFDLLCFDAFVHRVKTKQFYRFKQDGVFNQKEFLEFLSKQRHFCW------SVWAKCFRKDIILKNFEKVKFEKVKIDERLSYGEDVLFCYIYFMFCEKIAVFKTCIYHY 241
>gi|37527612|ref|NP_930956.1| hypothetical protein plu3750 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36787047|emb|CAE16122.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] (329 aa)
Score = 122, Expect = 6.9e-05, Identities = 38/91 (41%), Positives = 52/91 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           +++IIP  N     I  L+ S+  Q N NFEV  I+D ST+   +V  +   K+    + N  N  GV   R+YG+  A GE+I FVDSDDWL
  S:     6 ITIIIPVFNDENN-ITYLLDSIFAQENVNFEVIIINDGSTDNSLEVIKEYERKDNRIRIFNQENR-GVSIARNYGIKYARGEWILFVDSDDWL 96
>gi|48474174|dbj|BAD22644.1| galactosyltransferase [Streptococcus mitis] (322 aa)
Score = 122, Expect = 7.1e-05, Identities = 35/101 (34%), Positives = 56/101 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           +SVI+P  N    ++   + SL NQT K+FEV  +DD ST+    +     + + +V      N G+   R+YGV  A GE+I F+D DD+    A++ L++
  S:     2 ISVIVPIYNVE-DYLHYAMESLVNQTYKDFEVILVDDGSTDDSGKLCDQYASEHDWVSAYHKENGGLSDARNYGVAKAKGEWIVFLDPDDYFEPCALELLVE 102
>gi|154494109|ref|ZP_02033429.1| hypothetical protein PARMER_03454 [Parabacteroides merdae ATCC 43184] >gi|154086369|gb|EDN85414.1| hypothetical protein PARMER_03454 [Parabacteroides merdae ATCC 43184] (329 aa)
Score = 122, Expect = 7.2e-05, Identities = 36/117 (30%), Positives = 65/117 (55%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQY--------VQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           KVS+I+P      ++I++   SL  QT  + E  F+DD S  P   ++++ +   +Y        ++ + +N G   +R  G+ LA+G+Y    DSDDW+ V AI  L  +F    + D + +++
  S:     5 KVSIIVPIYRVE-EYIERCAESLFAQTFDDIEYIFVDDCS--PDKSVEILQRTLEKYPHRKRLTRIERLSSNSGQAAVRRQGIQLASGDYTVHCDSDDWMDVHAIKELY-TFALSGHYDMVFYDF 125
>gi|84489307|ref|YP_447539.1| glycosyltransferase [Methanosphaera stadtmanae DSM 3091] >gi|84372626|gb|ABC56896.1| predicted glycosyltransferase [Methanosphaera stadtmanae DSM 3091] (817 aa)
Score = 122, Expect = 7.3e-05, Identities = 40/115 (34%), Positives = 68/115 (59%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFE 118
           VS+IIP  N+  K+I++ + +   QT KN E+  IDD ST+  + I  + +  +    V     N+G G  R+ G+  A G+YI F+D+DDWL  + ++ +LK   +  N+D ++F+
  S:    22 VSIIIPAYNSD-KYIEKCLNTARKQTLKNIEIICIDDASTDKTLEIINNHVRFDKRVCVFTNTTNLGPGASRNIGIKHARGKYITFLDADDWLDENTLECVLKK-SEENNLDLLLFK 136
>gi|167632336|ref|ZP_02390663.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0442] >gi|167532634|gb|EDR95270.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0442] (851 aa)
Score = 122, Expect = 7.5e-05, Identities = 40/128 (31%), Positives = 71/128 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK-NGYQYVQNIPNNIG-VGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI 128
           + KVS++IP  N P  +++  + S  NQT +N E+  I D+STN +V + +      Y Y+  + N +  V +  +  + LA GEYI F+  DD  + + I+ ++K F + +NI F+    E + +  +I
  S:   319 LPKVSILIPAYNRP-HYLELALKSALNQTYENIEII-ISDDSTNDEVKVMIQPYLKEYNYITYVKNEMPLVAENFNQCIELATGEYINFLLDDDLFHHEKIERMMKYFLELENISFVTSYRELIDENGEI 446
>gi|153806442|ref|ZP_01959110.1| hypothetical protein BACCAC_00706 [Bacteroides caccae ATCC 43185] >gi|149131119|gb|EDM22325.1| hypothetical protein BACCAC_00706 [Bacteroides caccae ATCC 43185] (321 aa)
Score = 122, Expect = 7.5e-05, Identities = 67/227 (29%), Positives = 109/227 (48%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP-QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWV--------FDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRL--NVESSLNTYKYKANDL 230
           +SVI+P  N   ++I + I S+ +Q+ KN E+  +DD S +     ID  ++   +      +N G+   R+ G+ +A+G++I FVDSDDW+     + +L SF + + +D +      V         +K  I L  K      +  KN   +S +P         W   FKKEF   N+    +   I ED  + L  K LY+   +   +    N L  N  S +NT K+ + DL
  S:     2 ISVIVPIYNVE-RYINKCIDSIIHQSYKNLEIILVDDGSPDKCGEIIDEYSRIDKRIHVIHKSNGGLSSARNAGLDIASGDFIGFVDSDDWIEPTMYEEML-SFMEKEQLDLVECGINLVTNNISNKYIEKPSIVLSGKDALIRHLDSKNRTVQS-LP-----RTAVWSKLFKKEFWKTNRFPVGE---IHED--YLLTCKALYEAKSVGLLRRGLLNHLTDNPNSIVNT-KFNSKDL 225
>gi|170689103|ref|ZP_02880302.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0465] >gi|170666970|gb|EDT17734.1| glycosyl transferase, group 2 family protein [Bacillus anthracis str. A0465] (851 aa)
Score = 122, Expect = 7.6e-05, Identities = 40/128 (31%), Positives = 71/128 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK-NGYQYVQNIPNNIG-VGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI 128
           + KVS++IP  N P  +++  + S  NQT +N E+  I D+STN +V + +      Y Y+  + N +  V +  +  + LA GEYI F+  DD  + + I+ ++K F + +NI F+    E + +  +I
  S:   319 LPKVSILIPAYNRP-HYLELALKSALNQTYENIEII-ISDDSTNDEVKVMIQPYLKEYNYITYVKNEMPLVAENFNQCIELATGEYINFLLDDDLFHHEKIERMMKYFLELENISFVTSYRELIDENGEI 446
>gi|113200402|gb|ABI32317.1| beta-1,3-galactosyltransferase [Campylobacter jejuni] (301 aa)
Score = 122, Expect = 8.0e-05, Identities = 75/276 (27%), Positives = 130/276 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF----EYEWVFDKK---QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN----KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNK--------NYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKT 276
           M K+S+I+P  N   ++I + I S  NQT K+ E+  +DD   +  + I        + ++ I N  N+G+ + R  GV +AN  YI F+D DD+L ++A +  +K   +   +D + F    E   +  KK       +SK     +II K N+           Y T W    +K+  ++     ++    K+N+ EDV       +LY   L  ++K+ + N  N+   +       N    ++ KN         NYL +N + N     Y S     +  L YI +  +++T
  S:     1 MFKISIILPTYNVE-QYIARAIESCINQTFKDIEIIVVDDCGNDNSINIAKEYSKKDERIKIIHNEKNLGLLRARYEGVKVANSPYIMFLDPDDYLELNACEECIKILDEQDEVDLVFFNAIVESNVISYKKFDFNSGFYSKKEFVKKIIAKKNL-----------YWTMWGKLIRKKLYLEAFASLRLEKDVKINMAEDV-------LLYYPMLSQAQKIAYMN-CNLYHYVPNNNSICNTKNEVLVKNNIQELQLVLNYLRQNYILNK----YCSVLYVLIKYLLYIQIYKIKRT 273
>gi|30409752|gb|AAP32727.1| EpsN [Lactococcus lactis subsp. cremoris] (351 aa)
Score = 122, Expect = 8.0e-05, Identities = 34/106 (32%), Positives = 61/106 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS--TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +SV++P  N   K++ +   S++ QT  N E+  +DD S  T+ ++  DL   +    V +   N G+G  R+ G+ +A+G+Y+ FVDSDD++  + +  L +   KY
  S:     5 ISVVVPVYNVE-KYLLKCFESISKQTYTNLEIILVDDGSKDTSGKMCDDLKLLDDRVIVVH-KKNAGLGYARNTGLEMASGKYVLFVDSDDYIEENMVSRLYQRIVKY 110
>gi|125624417|ref|YP_001032900.1| hypothetical protein llmg_1617 [Lactococcus lactis subsp. cremoris MG1363] >gi|124493225|emb|CAL98191.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] (995 aa)
Score = 122, Expect = 8.1e-05, Identities = 60/217 (27%), Positives = 108/217 (49%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI---PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY-EWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQT----DWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVL-YKKALLTSKKLYFYNRLNVESS 219
           KVSV++P  N   ++++  + SL  QT +  E   I+D S +    ID++N+   +  + I     N GVGK  + G+ +A GEYI  +DSDD+   D  + L +   K  ++D +      ++ + + +N++ K    +EI  K   N+   P       T     W   +++E L  NKI   + V+ + D   G  W+ +   K++   +  + Y+R + E S
  S:     5 KVSVVVPIYNQE-RYLRDCLDSLEAQTLEEIEFILINDGSKDSS--IDIMNEYAAKNPKFIIVDKGNDGVGKTINIGIDMAKGEYIAELDSDDFAAADMYEKLYE-VAKKNDVDIVKSSVNNFIGEGENLNVYFK----EEIARKGYYNRVINPLEEKEVFTFKMYAWCSLYRRELLQDNKIIWNEDVSAYNDN--GFYWQTMSLAKSVYYVEDYFNYHRRDNEHS 220
Score = 103, Expect = 1.3e-02, Identities = 34/93 (36%), Positives = 55/93 (59%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGV---GKIRDYGVTLANGEYIWFVDSDDWLY 95
           KVSV++P  N+   +I+Q I SL  QT    E+  +++ ST+  + I L    G  +   + ++IG    G  R+YG+  A+G+YI F+D+DD  Y
  S:   331 KVSVVVPVHNSA-NYIRQTIESLLTQTLYGLEIILVENGSTDNTLEI-LKEYEGRDWRIQL-HSIGASDAGTARNYGLERAHGQYIIFLDADDIFY 423
>gi|15927576|ref|NP_375109.1| ss-1,3-N-acetylglucosaminyltransferase [Staphylococcus aureus subsp. aureus N315] >gi|30043988|ref|NP_835519.1| probable ss-1,3-N-acetylglucosaminyltransferase [Staphylococcus phage phiN315] >gi|13701795|dbj|BAB43088.1| probable ss-1,3-N-acetylglucosaminyltransferase [Staphylococcus aureus subsp. aureus N315] (327 aa)
Score = 122, Expect = 8.1e-05, Identities = 72/245 (29%), Positives = 123/245 (50%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNK--NFEVFFIDDNSTNPQVYIDLINK-NGYQYVQNIPNNIGVGKI-RDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI--NLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFY--------NRLNV-ESSLNTYKYKANDLVSIIFKNKNYLLENK 245
           MKKVSVI+P  N   K + + I+S+ NQT K  ++E+  IDD+S +    +++I K  G    + +  N G   + R+ G+ ++  EY++F+DSDD L+  A++ L  ++ K  N D I+ +Y      + +   +F K N     I+ N++           Y       FKK  + KNKI         ED  F + + +  K   + +   Y+         N L+V +S+ N Y    N++   I+K+  Y  + K
  S:     1 MKKVSVIMPTFNNGEK-LHRTISSVLNQTMKSTDYELIIIDDHSNDNGETLNVIKKYKGLVRFKQLKKNSGNASVPRNTGLKMSKAEYVFFLDSDDLLHERALEDLY-NYGKENNSDLIIGKYGVEGKGRSVPKAIFEKGNVAKADIIDNSI----------FYALSVLKMFKKSVIDKNKIKFKTFSKTAEDQLFTIEFLMNSKNYSIKTDYEYYIVVNDFESSNHLSVNKSTGNQYFATINEIYKAIYKSPIYKNQEK 248
>gi|157371128|ref|YP_001479117.1| glycosyl transferase family protein [Serratia proteamaculans 568] >gi|157322892|gb|ABV41989.1| glycosyl transferase family 2 [Serratia proteamaculans 568] (247 aa)
Score = 122, Expect = 8.5e-05, Identities = 35/92 (38%), Positives = 53/92 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           M+KVSVI+P  N    +IKQ I  + NQT +++ ++ IDD ST+     +     +   Y++N  N  GV + R+  +  A G+YI F DSDD
  S:     1 MEKVSVIMPAYNAA-GFIKQSILGVLNQTYQDYHLYVIDDASTDQTAEVVKPFIHDRLTYIRNNTNQ-GVAETRNIAIEAARGDYIAFCDSDD 91
>gi|29345461|ref|NP_808964.1| putative glycosyltransferase [Bacteroides thetaiotaomicron VPI-5482] >gi|29337353|gb|AAO75158.1| glycoside transferase family 2 [Bacteroides thetaiotaomicron VPI-5482] (326 aa)
Score = 122, Expect = 8.5e-05, Identities = 34/100 (34%), Positives = 55/100 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQ------NIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLL 103
           VS+I P       +I +   SL  Q+    E  F+DD S++  V + L     Y  +Q      +  +N GV   R+ G+  A GEY+++VD+DDW+  DAI+ ++
  S:     3 VSIITPLYKVE-DFIARCADSLFRQSYTEIEYIFVDDCSSDRSVEVLLQVAERYPQLQQQIRILHHESNRGVAAARETGLAAATGEYVYWVDADDWIEPDAIEKMV 107
>gi|15430482|gb|AAK96000.1| putative beta-1,3-galactosyltransferase [Campylobacter jejuni] (301 aa)
Score = 122, Expect = 8.6e-05, Identities = 74/276 (26%), Positives = 128/276 (46%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY---EWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN----KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNK--------NYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKT 276
           M K+S+I+P  N   ++I + I S  NQT K+ E+  +DD   +  + I        + ++ I N  N+G+ + R  GV +AN  YI F+D DD+L ++A +  +K   +   +D + F       V   K+ +  S      E + K   NK       N Y T W    +K+  ++     ++    K+N+ EDV       +LY   L  ++K+ + N  N+   +       N    ++ KN         NYL +N + N     Y S     +  L YI +  +++T
  S:     1 MFKISIILPTYNVE-QYIARAIESCINQTFKDIEIIVVDDCGNDNSINIAKEYSKKDKRIKIIHNEKNLGLLRARYEGVKVANSPYIMFLDPDDYLELNACEECIKILDEQDEVDLVFFNAIVESNVISYKKFDFNSGFYSKKEFVKKIIANK-------NLYWTMWGKLIRKKLYLEAFASLRLEKDVKINMAEDV-------LLYYPMLSQAQKIAYMN-CNLYHYVPNNNSICNTKNEVLVKNNIQELQLVLNYLRQNYILNK----YCSVLYVLIKYLLYIQIYKIKRT 273
>gi|12004281|gb|AAG43978.1|AF215659_6 beta-1,3-galactosyltransferase [Campylobacter jejuni] >gi|99866977|gb|ABF67965.1| beta-1,3-galactosyltransferase [Campylobacter jejuni] >gi|118153461|gb|ABK63955.1| CgtB [Campylobacter jejuni] >gi|123255356|gb|ABM74176.1| beta-1,3-galactosyltransferase [Campylobacter jejuni] (301 aa)
Score = 122, Expect = 8.7e-05, Identities = 76/276 (27%), Positives = 130/276 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF----EYEWVFDKK---QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN----KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNK--------NYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKT 276
           M K+S+I+P  N   ++I + I S  NQT K+ E+  +DD   +  + I        + ++ I N  N+G+ + R  GV +AN  YI F+D DD+L ++A +  +K   +   +D + F    E   +  KK       +SK     +II K N+           Y T W    +K+  ++     K+    K+N+ EDV       +LY   L  ++K+ + N  N+   +       N    ++ KN         NYL +N + N     Y S     +  L YI +  +++T
  S:     1 MFKISIILPTYNVE-QYIARAIESCINQTFKDIEIIVVDDCGNDNSINIAKEYSKKDKRIKIIHNEKNLGLLRARYEGVKVANSPYIMFLDPDDYLELNACEECIKILDEQDEVDLVFFNAIVESNVISYKKFDFNSGFYSKKEFVKKIIAKKNL-----------YWTMWGKLIRKKLYLEAFASLKLEKDVKINMAEDV-------LLYYPMLSQAQKIAYMN-CNLYHYVPNNNSICNTKNEVLVKNNIQELQLVLNYLRQNYILNK----YCSVLYVLIKYLLYIQIYKIKRT 273
>gi|160915647|ref|ZP_02077855.1| hypothetical protein EUBDOL_01654 [Eubacterium dolichum DSM 3991] >gi|158432123|gb|EDP10412.1| hypothetical protein EUBDOL_01654 [Eubacterium dolichum DSM 3991] (330 aa)
Score = 121, Expect = 9.0e-05, Identities = 40/135 (29%), Positives = 72/135 (53%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ-NIDFIMFEYEWVFDKKQINLFSKHNQFD 138
           VS+I+P  N   K++ + + +L  QT  N E+  ++D ST+  + +          +Q I   N GV   R+ G+ LA G+Y+ FVD+DD++  +  + LLK+  + + +I+   +  E    ++ I L  K + FD
  S:     9 VSIIVPIYNAE-KYLSRTVETLRRQTLTNIEILLVNDGSTDDSLKLCREFAEIDPRIQVIDKQNGGVSSARNIGLKLAKGQYVLFVDADDYVEANYAEILLKTLQENKSDIEMCGYFREDKKSEQIITLMEKDHVFD 144
>gi|167854579|ref|ZP_02477360.1| putative glycosyltransferase [Haemophilus parasuis 29755] >gi|167854334|gb|EDS25567.1| putative glycosyltransferase [Haemophilus parasuis 29755] (294 aa)
Score = 121, Expect = 9.0e-05, Identities = 43/142 (30%), Positives = 70/142 (49%)
  Q:     5 SVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI---PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNV 146
           S+IIP  N   + I  L+TSL  QT  NFEV  +DD+S  P V I    K+ Y +  N+     N+G  + R+ G   A  E++ F+D DD       + L K+  +   I+FI    E V   +  +  ++  + ++ +   N+
  S:     3 SIIIPSYNRKNE-IPALLTSLEYQTEYNFEVIIVDDHSVEP-VEI----KHLYPFPANVIRNEQNLGAAESRNVGARFAENEWLLFLDDDDRFAHPKCEILAKTINENPTINFIYHPAECVMVNEGFSYITRPYENEQAVTLENI 141
>gi|119509830|ref|ZP_01628974.1| glycosyl transferase [Nodularia spumigena CCY9414] >gi|119465565|gb|EAW46458.1| glycosyl transferase [Nodularia spumigena CCY9414] (705 aa)
Score = 121, Expect = 9.0e-05, Identities = 33/113 (29%), Positives = 61/113 (53%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           KVSVIIP  N   K+I++ I S+   T KN E+  ++D S   +      N +G   ++    N G+   R+ G+ +++GE+I  +DSDD ++ + ++  + +    Q + +I
  S:   401 KVSVIIPLYNQG-KYIEETIQSIKESTYKNVEIIVVNDGSNESETNEVFQNLSGV--IKIFKPNGGLSSARNAGLKVSSGEFIMLLDSDDKIHPEYLEKAIIALINNQELSYI 510
>gi|15923248|ref|NP_370782.1| hypothetical protein SAV0258 [Staphylococcus aureus subsp. aureus Mu50] >gi|15925961|ref|NP_373494.1| hypothetical protein SA0248 [Staphylococcus aureus subsp. aureus N315] >gi|148266683|ref|YP_001245626.1| glycosyl transferase family protein [Staphylococcus aureus subsp. aureus JH9] >gi|150392723|ref|YP_001315398.1| glycosyl transferase family protein [Staphylococcus aureus subsp. aureus JH1] >gi|156978588|ref|YP_001440847.1| hypothetical protein SAHV_0257 [Staphylococcus aureus subsp. aureus Mu3] >gi|13700174|dbj|BAB41472.1| SA0248 [Staphylococcus aureus subsp. aureus N315] >gi|14246025|dbj|BAB56420.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|147739752|gb|ABQ48050.1| glycosyl transferase, family 2 [Staphylococcus aureus subsp. aureus JH9] >gi|149945175|gb|ABR51111.1| glycosyl transferase family 2 [Staphylococcus aureus subsp. aureus JH1] >gi|156720723|dbj|BAF77140.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (573 aa)
Score = 121, Expect = 9.0e-05, Identities = 38/94 (40%), Positives = 54/94 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M K SVI+P  N+  K+I +L+ SL  Q      FEV  +DD ST+   Q+     NK   +  Q   N+ G GK R+  +  A GE++ FVDSDD++
  S:     1 MMKFSVIVPTYNSE-KYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNLKVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYI 97
>gi|21281963|ref|NP_645049.1| hypothetical protein MW0234 [Staphylococcus aureus subsp. aureus MW2] >gi|49485138|ref|YP_042359.1| putative glycosyl transferase [Staphylococcus aureus subsp. aureus MSSA476] >gi|21203398|dbj|BAB94099.1| MW0234 [Staphylococcus aureus subsp. aureus MW2] >gi|49243581|emb|CAG42005.1| putative glycosyl transferase [Staphylococcus aureus subsp. aureus MSSA476] (573 aa)
Score = 121, Expect = 9.3e-05, Identities = 38/94 (40%), Positives = 54/94 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M K SVI+P  N+  K+I +L+ SL  Q      FEV  +DD ST+   Q+     NK   +  Q   N+ G GK R+  +  A GE++ FVDSDD++
  S:     1 MMKFSVIVPTYNSE-KYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNLKVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYI 97
>gi|163757152|ref|ZP_02164254.1| hypothetical protein KAOT1_00765 [Kordia algicida OT-1] >gi|161322880|gb|EDP94227.1| hypothetical protein KAOT1_00765 [Kordia algicida OT-1] (313 aa)
Score = 121, Expect = 9.4e-05, Identities = 36/106 (33%), Positives = 62/106 (58%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV-YIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL--YVDAIDYLLKSF 106
           M   SVIIP  N   K+++Q + S+  QT  +FE+  ++D ST+  V  +   +    + ++N P N+G+   R++G++ A G  I  +D+DD WL  +++ I  L  SF
  S:     1 MPLFSVIIPLYNKE-KYVQQTVQSVLQQTFVDFELLIVNDASTDDSVAVVSQFSDERIRLIEN-PKNLGLSATRNHGISKAKGTIIALLDADDLWLPTFLETIKSLYDSF 108
>gi|60682272|ref|YP_212416.1| putative glycosyltransferase protein [Bacteroides fragilis NCTC 9343] >gi|60493706|emb|CAH08495.1| putative glycosyltransferase protein [Bacteroides fragilis NCTC 9343] (342 aa)
Score = 121, Expect = 9.4e-05, Identities = 39/102 (38%), Positives = 57/102 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPN-------NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           + KVSVI+P  N   K++ Q + +L  QT  + E+  IDD S +  P++  D        Y    PN       N G+G   + G+ +A GEY+ F DSDD  YVD+  Y+
  S:     2 IPKVSVIVPIYNVE-KYLDQCVQALLAQTLSDIEIILIDDESPDNCPKICDD--------YAAQYPNIKVIHKKNAGLGMACNSGLDVATGEYVAFCDSDD--YVDSDMYM 101
>gi|160936323|ref|ZP_02083692.1| hypothetical protein CLOBOL_01215 [Clostridium bolteae ATCC BAA-613] >gi|158440606|gb|EDP18344.1| hypothetical protein CLOBOL_01215 [Clostridium bolteae ATCC BAA-613] (364 aa)
Score = 121, Expect = 9.5e-05, Identities = 34/101 (33%), Positives = 56/101 (55%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK 104
           VS+I+P       ++ Q I S+  QT +N E+  IDD S++  P++      ++    V +  N  G    R+ G+  A GE+I+FVDSDDW+  + I  L++
  S:     8 VSIIVPVYGVE-AYLDQCINSIVEQTYQNIELILIDDGSSDRCPEICDAWATRDCRIQVLHKENG-GQSSARNIGLDTAKGEWIFFVDSDDWIEPECISVLVE 108
>gi|82749963|ref|YP_415704.1| glycosyl transferase [Staphylococcus aureus RF122] >gi|82655494|emb|CAI79885.1| probable glycosyl transferase [Staphylococcus aureus RF122] (573 aa)
Score = 121, Expect = 9.6e-05, Identities = 38/94 (40%), Positives = 54/94 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M K SVI+P  N+  K+I +L+ SL  Q      FEV  +DD ST+   Q+     NK   +  Q   N+ G GK R+  +  A GE++ FVDSDD++
  S:     1 MMKFSVIVPTYNSE-KYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNLKVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYI 97
>gi|194272071|ref|ZP_03056826.1| glycosyltransferase [Enterococcus faecalis OG1RF] >gi|194268249|gb|EDX18721.1| glycosyltransferase [Enterococcus faecalis OG1RF] (326 aa)
Score = 121, Expect = 9.7e-05, Identities = 32/108 (29%), Positives = 62/108 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYK 108
           M ++S+I+P  N    ++K+ + S+ +QT  +FE+  +DD ST+    +    K   + ++ I   N G+   R+ G+ +A G+Y+ FVDSDD++    ++ L K+  +
  S:     1 MSEISIIVPVYNVE-NYLKKCVESILSQTFTDFELLLVDDGSTDSSGEMCDELKRLDERIKVIHKENGGLSSARNAGIDVAKGKYLTFVDSDDYIDTHMLEVLYKNMVQ 108
>gi|49482494|ref|YP_039718.1| putative glycosyl transferase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49240623|emb|CAG39281.1| putative glycosyl transferase [Staphylococcus aureus subsp. aureus MRSA252] (574 aa)
Score = 121, Expect = 9.7e-05, Identities = 38/94 (40%), Positives = 54/94 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M K SVI+P  N+  K+I +L+ SL  Q      FEV  +DD ST+   Q+     NK   +  Q   N+ G GK R+  +  A GE++ FVDSDD++
  S:     1 MMKFSVIVPTYNSE-KYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNLKVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYI 97
>gi|163764939|ref|ZP_02171990.1| cytochrome c, class I [Bacillus selenitireducens MLS10] >gi|160354612|gb|EDP81274.1| cytochrome c, class I [Bacillus selenitireducens MLS10] (297 aa)
Score = 121, Expect = 9.8e-05, Identities = 37/92 (40%), Positives = 54/92 (58%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTN--PQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD 92
           MK VS+IIP  N     IK+ I S+ NQT K +EV  +DD ST+  P + +  I  +  Q +Q +  N GV   R+ GV+ A  + + F+D+DD
  S:     1 MKNVSIIIPLYNKE-PHIKRTILSVLNQTYKYYEVIVVDDGSTDRGPDI-VKSIQDSRIQLIQQM--NAGVSAARNKGVSHAKSDLVAFLDADD 90
>gi|150009627|ref|YP_001304370.1| glycosyl transferase family protein [Parabacteroides distasonis ATCC 8503] >gi|149938051|gb|ABR44748.1| glycosyltransferase family 2 [Parabacteroides distasonis ATCC 8503] (328 aa)
Score = 121, Expect = 9.8e-05, Identities = 35/109 (32%), Positives = 56/109 (51%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           M+  S+IIP  N P + +  L++SL  QT  +FEV  ++D ST P   I    +        + +N G G  R++G   A+GEY+  +DSD  L    ++++  S   Y
  S:    17 MRLYSIIIPVYNRPDE-LDDLLSSLCKQTYVHFEVIVVEDGSTIPAKEIVRRYQERLDLHYCVISNSGPGMARNHGARQAHGEYLLILDSDVVLPSTWLEHIHDSLNHY 124
>gi|60682267|ref|YP_212411.1| putative glycosyltransferase [Bacteroides fragilis NCTC 9343] >gi|60493701|emb|CAH08490.1| putative glycosyltransferase [Bacteroides fragilis NCTC 9343] (329 aa)
Score = 121, Expect = 9.8e-05, Identities = 47/187 (25%), Positives = 87/187 (46%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNI-----PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVY 189
           K+S+IIP       ++ + + S+  QT  ++E+  +DD S  P    +L  K    Y   I     PN  GV   R++G+  A GEY   VD DDW+  + ++ L +   K Q  D ++ ++   +  +QI+   K    D     + + + +       + +      + E   K ++  P+K+  +ED+Y
  S:     5 KISIIIPVYMAE-SYLHRCVDSIITQTFTDWELLLVDDGS--PDHSGELCEKYASAYKSRIKAFHKPNG-GVASAREFGMQQARGEYSIHVDPDDWIDSNTLEELYQQAVKEQ-ADMVICDFMMEYPNRQIHNCQKPQLLDSSSFMHQLLQQE------RHGSLCNKLIRTELYHKYQLHFPEKMICWEDLY 185
>gi|154492998|ref|ZP_02032624.1| hypothetical protein PARMER_02640 [Parabacteroides merdae ATCC 43184] >gi|154087303|gb|EDN86348.1| hypothetical protein PARMER_02640 [Parabacteroides merdae ATCC 43184] (323 aa)
Score = 121, Expect = 9.9e-05, Identities = 34/106 (32%), Positives = 53/106 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +SV+IP  N   K I Q +  + NQT K+FEV  +DD S  N    +          ++    N GV   R+ G+  A G+Y+ F+D+DD    D ++ L+    +Y
  S:     2 ISVVIPLYNKE-KSIAQTLECVLNQTYKDFEVIVVDDGSKDNSAAIVAQFTDTRIHLIRQ--ENGGVSAARNRGIEEAQGKYVAFLDADDVWLTDHLESLVNLIRQY 105
>gi|167938500|ref|ZP_02525575.1| glycosyl transferase, group 2 family protein [Bacillus cereus AH1134] (852 aa)
Score = 121, Expect = 1.0e-04, Identities = 40/115 (34%), Positives = 66/115 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID----LINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFI 115
           + KVS++IP  N P  +++  + S  NQT +N E+  I D+STN +V       L       YV+N   N  V +  +  + LA GEYI F+  DD  +++ I+ ++K F++ +NI F+
  S:   320 LPKVSILIPAYNRP-HYLELALKSALNQTYENIEII-ISDDSTNDEVKTMIQPYLKEHECITYVKN--ENPLVAENFNQCIELATGEYINFLLDDDLFHLEKIERMMKYFFELENIAFV 434
>gi|125381172|gb|ABN41502.1| putative glycosyltransferase [Campylobacter jejuni] >gi|125381182|gb|ABN41510.1| putative glycosyltransferase [Campylobacter jejuni] (288 aa)
Score = 121, Expect = 1.0e-04, Identities = 38/114 (33%), Positives = 64/114 (56%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDF 114
           M K+S+I+P  N   K+I + I S  NQ+ K+ E+  +DD  ++  + I        + ++ I N  N+G    R+ GV  +NGEY+ F+D DD+L +DA + L+   + Y+   F
  S:     1 MPKISIIMPTFNVE-KYIARAIESCVNQSFKDIEIIIVDDCGSDKSINIAKEYAKKDERIKIIHNEKNLGTFAARNNGVKHSNGEYLMFLDPDDYLELDACEKLILLIHTYKICQF 115
>gi|18309483|ref|NP_561417.1| capsular polysaccharide biosynthsis protein [Clostridium perfringens str. 13] >gi|18144160|dbj|BAB80207.1| capsular polysaccharide biosynthsis protein [Clostridium perfringens str. 13] (326 aa)
Score = 121, Expect = 1.0e-04, Identities = 61/210 (29%), Positives = 102/210 (48%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK--NGYQYVQNI-PNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFH---NNYQTDWRVC---FKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYF 210
           M KVS+IIP  N    ++ + + +  NQT    E+  IDD ST+     D++NK    Y +++ I   N G+   R+ G+  A GEYI+F+DSDD++  D++    +   K   +D + F+ E   D +      K  ++D   + +   K    +F     N       C   +++EFL+ N +   D + + ED  + +    L  K      KLYF
  S:     1 MVKVSIIIPIYNVE-NYLDKCLDTAVNQTLGCIEIIGIDDGSTDKSR--DILNKYAKKYSFIKIINKENGGLSSARNTGIINAKGEYIYFLDSDDYIEYDSMKICYEIATK-NKLDIVSFDAESFVDGEGFT--KKLKKYDRKDILDGNIKMGCEYFCELIKNKCYTASACLNFYRREFLIDNNLFFYDGI-LHEDELYTVKAYTLANKVRYIPYKLYF 212
>gi|182416996|ref|ZP_02948376.1| glycosyl transferase, group 2 family protein [Clostridium butyricum 5521] >gi|182379172|gb|EDT76674.1| glycosyl transferase, group 2 family protein [Clostridium butyricum 5521] (326 aa)
Score = 121, Expect = 1.1e-04, Identities = 60/218 (27%), Positives = 102/218 (46%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNK-SKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLN 221
           +SV+IP  N   K++ + I S+ NQT  N ++  +DD ST N     D   K   + +     N G+   R+ G+  + G+YI FVDSDD++     + ++++    +    I+  Y +VF+  Q   F +++  + I V +N+    +M  F       W   ++KE    N I  P    + ED Y   +     K+ +  S  LY+Y + N   S N
  S:     7 ISVVIPVYNVE-KYLPKCIESIINQTYTNLQIILVDDGSTDNSGSICDEYKKKDTRIMVIHKKNGGLSDARNVGIKYSKGKYIGFVDSDDYINKKMYEIMMENMVNNKANISIVNRY-YVFEDGQ--EFLRYSINESIKVMSNLEAIEEMNNFSTFDMAAWDKLYEKELF--NDIEFPVG-KLSEDFYIMYLLFEKCKRIVYDSSPLYYYYQRNNSISRN 219
>gi|29376684|ref|NP_815838.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] >gi|29344148|gb|AAO81908.1| glycosyl transferase, group 2 family protein [Enterococcus faecalis V583] (252 aa)
Score = 121, Expect = 1.1e-04, Identities = 34/91 (37%), Positives = 56/91 (61%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDL--INKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL 94
           VS+I+P  N   K++ + I S+  QT +N+E+  IDD S +  + I L  + K+   ++     N+G+ K R+ G+  + G+YI F+DSDD WL
  S:     6 VSIIMPMYNAG-KFLSKSIESVLEQTYQNWELLLIDDGSKDDSIDIALAFMEKDSRIFLLKNEQNMGIAKTRNKGIEASKGQYIAFLDSDDLWL 98
>gi|194272074|ref|ZP_03056829.1| glycosyltransferase [Enterococcus faecalis OG1RF] >gi|194268252|gb|EDX18724.1| glycosyltransferase [Enterococcus faecalis OG1RF] (252 aa)
Score = 121, Expect = 1.1e-04, Identities = 34/91 (37%), Positives = 56/91 (61%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDL--INKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDD-WL 94
           VS+I+P  N   K++ + I S+  QT +N+E+  IDD S +  + I L  + K+   ++     N+G+ K R+ G+  + G+YI F+DSDD WL
  S:     6 VSIIMPMYNAG-KFLSKSIESVLEQTYQNWELLLIDDGSKDDSIDIALAFMEKDSRIFLLKNEQNMGIAKTRNKGIEASKGQYIAFLDSDDLWL 98
>gi|87160407|ref|YP_492966.1| glycosyl transferase, group 2 family protein [Staphylococcus aureus subsp. aureus USA300] >gi|88194035|ref|YP_498823.1| hypothetical protein SAOUHSC_00228 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|161508520|ref|YP_001574179.1| glycosyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168729005|ref|ZP_02761282.1| glycosyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87126381|gb|ABD20895.1| glycosyl transferase, group 2 family protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201593|gb|ABD29403.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|160367329|gb|ABX28300.1| glycosyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (574 aa)
Score = 121, Expect = 1.1e-04, Identities = 38/94 (40%), Positives = 54/94 (57%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQT--NKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWL 94
           M K SVI+P  N+  K+I +L+ SL  Q      FEV  +DD ST+   Q+     NK   +  Q   N+ G GK R+  +  A GE++ FVDSDD++
  S:     1 MMKFSVIVPTYNSE-KYITELLNSLAKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLNLKVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYI 97
>gi|39725925|gb|AAR29925.1| Cps8J [Streptococcus agalactiae] (325 aa)
Score = 121, Expect = 1.1e-04, Identities = 58/227 (25%), Positives = 108/227 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNST-NPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQN----IDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDL 230
           VS+I+P  N    +I+  + S+ +Q+  +FEV  ++D ST N   Y + I     ++     +N G+   R+ G+  A G+YI FVDSDD++  + + +L+     Y+      D + F      +  + N+F KH+     ++ N     ++ +      + W   +KK     + I  P K  +FED     +      K + ++ KLY Y  ++ + S+ T ++   DL
  S:     5 VSIILPVYNVE-NYIENCLNSIISQSYFHFEVIIVNDGSTDNSMSYCEKIVCEDLRFRIINKDNGGLSDARNVGLEAAKGDYIIFVDSDDFISPNLVSHLMACLENYEADLAICDPVHFYLGGNQETHEKNIFKKHSNIH--LLTNEEAICELFYQKTFLVSAWGKVYKKSIF--DNIRFP-KGKLFEDSAVMHLLFEKSNKIVYSNAKLYAY--VHRKDSITTSQFSERDL 228
>gi|150005948|ref|YP_001300692.1| glycosyl transferase family protein [Bacteroides vulgatus ATCC 8482] >gi|149934372|gb|ABR41070.1| glycosyltransferase family 2 [Bacteroides vulgatus ATCC 8482] (344 aa)
Score = 121, Expect = 1.1e-04, Identities = 47/141 (33%), Positives = 79/141 (56%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNS--------TNPQVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL-LKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVK 143
           KVS+I+P  N   K++ + + SL  QT K  E+  +DD S         N +   D ++    + +  I  N G+G  R+ G+ +A GEYI F+DSDD++ V+  + L LK+  K ++ID +        DKK I  + + +  +E+I +
  S:     5 KVSIIVPVYNVE-KYLDRCMQSLLGQTLKELEIILVDDGSPDNSPALCDNYESASDNLHWPIIKVIHKI--NEGLGFARNSGLEIATGEYIAFLDSDDFVDVNMYEQLYLKA--KAKDIDVVYCNCNIYKDKKHI--YPRKDVEEEVIFR 147
>gi|167217278|ref|ZP_02286914.1| hypothetical protein LmonocFSL_08793 [Listeria monocytogenes FSL J1-175] (240 aa)
Score = 120, Expect = 1.1e-04, Identities = 36/106 (33%), Positives = 57/106 (53%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSF 106
           M K+SV+I   N   ++I+  +TS+  Q  KN E+  ++D ST+          +G+  V  I   N GV  +R+ GV +A G+Y+ FVD DD +  D    ++ SF
  S:     1 MHKLSVVIAVYNVS-EYIEACLTSVLEQNYKNVELIIVNDGSTDDTFQKVEKLVDGHSNVILIDQENQGVSAVRNNGVKVATGDYLGFVDGDDIIAKDMFQKMMDSF 106
>gi|166995244|ref|ZP_02261704.1| glycosyl transferase family 2 [Bacillus cereus AH820] (643 aa)
Score = 120, Expect = 1.1e-04, Identities = 38/106 (35%), Positives = 64/106 (60%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYID---LINKNGYQY-VQNIPNNIGVGKIRDY---GVTLANGEYIWFVDSDDWLYVDAIDYLLKSFY 107
           KK+SVI+P  N   K++ + +TS+ NQT   +E+ F+DD ST+  V I    L N+N +   +Q I N+   G +      GV+ A G+YIW  ++DD      ++ +++ F+
  S:   367 KKISVIVPNYNYE-KYLSERVTSILNQTYPLYELIFLDDASTDNSVSIFEKLLSNENKHHLKIQQIINDKNSGSVFKQWIKGVSAATGDYIWIAEADDLCDQTFLEEVIQGFH 478
>gi|113200430|gb|ABI32343.1| beta-1,3-galactosyltransferase [Campylobacter jejuni] (301 aa)
Score = 120, Expect = 1.1e-04, Identities = 74/276 (26%), Positives = 130/276 (47%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMF----EYEWVFDKK---QINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKN----KISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNK--------NYLLENKLFNNNWYFYASNWLGALNQLNYIDLINVQKT 276
           M K+S+I+P  N   ++I + I S  NQT K+ E+  +DD   +  + I        + ++ I N  N+G+ + R  GV +AN  YI F+D DD+L ++A +  +K   +   +D + F    E   +  KK       +SK     +II K N+           Y T W    +++  ++     ++    K+N+ EDV       +LY   L  ++K+ + N  N+   +       N    ++ KN         NYL +N + N     Y S     +  L YI +  +++T
  S:     1 MFKISIILPTYNVE-QYIARAIESCINQTFKDIEIIVVDDCGNDNSINIAKEYSKKDKRIKIIHNEKNLGLLRARYEGVKVANSPYIMFLDPDDYLELNACEECIKILDEQDEVDLVFFNAIVESNVISYKKFDFNSGFYSKKEFVKKIIAKKNL-----------YWTMWGKLIRRKLYLEAFASLRLEKDVKINMAEDV-------LLYYPMLSQAQKIAYMN-CNLYHYVPNNNSICNTKNEVLVKNNIQELQLVLNYLRQNYILNK----YCSALYVLIKYLLYIQIYKIKRT 273
>gi|28849811|gb|AAN64567.1| glycosyltransferase [Streptococcus gordonii] (320 aa)
Score = 120, Expect = 1.1e-04, Identities = 54/186 (29%), Positives = 88/186 (47%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN-NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLK------------------SFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVY 189
           +SVI+P  N    ++   + SL +QT K+ EV  IDD S++    +       Y +V +    N G+   R+YGV  A G++I F+D DD+L   A++ L +                   +++YQN            D  Q+ ++ K     E++  + V  S                ++KE L   K S P K  I+ED+Y
  S:     2 ISVIVPVYNVE-DYLHYAMESLEHQTYKDMEVLLIDDGSSDGSGLLCDQYAQQYDWVTSYHKVNGGLSDARNYGVLKAKGDWITFLDPDDYLEPCALELLAELQGRTQADMVSGKVEPTAHYHRYQNFHLDQ------LDLDQVKVYDKAKALTEMLYGDLVTVSACGKL-----------YRKELL--EKASFP-KGRIYEDLY 185
>gi|30018528|ref|NP_830159.1| glycosyltransferase [Bacillus cereus ATCC 14579] >gi|29894068|gb|AAP07360.1| Glycosyltransferase [Bacillus cereus ATCC 14579] (643 aa)
Score = 120, Expect = 1.1e-04, Identities = 55/187 (29%), Positives = 96/187 (51%)
  Q:     2 KKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQV--YIDLINKNGYQY--VQNIPNNIGVGKIRDY---GVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKM--PWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDV 188
           KK+SVIIP  N   K++   I S+ NQT   +E+ F+DD ST+  V  +  L++K    +  VQ I N+   G +      GV+ A G+YIW  ++DD      +  +++ FY   NI     + + +   +Q N+ + H     +   N+++K K   P+F    +       +   L+KN I +   V +F+++
  S:   367 KKISVIIPNYNYE-KYLPARIESILNQTYPLYELIFLDDASTDHSVSTFKKLLSKENKPHLKVQQIINDKNSGSVFKQWIKGVSAATGDYIWIAEADDLCDKTFLQEVIQGFYINNNITLSYTQSKQI--DEQGNVLANH----YLNYTNDIDKEKWKGPYFRKGVEE-----IQDTLLIKNTIPNVSSV-VFKNI 549
>gi|148643388|ref|YP_001273901.1| glycosyl transferase family protein [Methanobrevibacter smithii ATCC 35061] >gi|148552405|gb|ABQ87533.1| glycosyltransferase, GT2 family [Methanobrevibacter smithii ATCC 35061] (320 aa)
Score = 120, Expect = 1.2e-04, Identities = 36/100 (36%), Positives = 62/100 (62%)
  Q:     3 KVSVIIPFKNTPLKWIKQLITSLNNQT-NKNFEVFFIDDNSTNPQVYI--DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYL 102
           KVSVI+P  N   K+I+  I+S+ NQ  ++N+E+  +DD S +  + I  +L++K+   Y      N GV   R+ G+ ++ G+Y+ FVDSDD++  + +  L
  S:     5 KVSVIVPVYNGE-KYIQTSISSIINQEFSENYEIIVVDDGSDDNSLDIAQELLSKSDIPYKLVHQRNSGVSVARNNGIEVSRGDYLVFVDSDDYVLTNHLSEL 106
>gi|68643056|emb|CAI33368.1| putative glycosyl transferase [Streptococcus pneumoniae] >gi|68643083|emb|CAI33391.1| putative glycosyl transferase [Streptococcus pneumoniae] >gi|68643109|emb|CAI33414.1| putative glycosyl transferase [Streptococcus pneumoniae] (318 aa)
Score = 120, Expect = 1.2e-04, Identities = 34/110 (30%), Positives = 62/110 (56%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYI-DLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNID 113
           +S+++P  N   K++K+ I S+ NQT +N E+  +DD ST+    I +  +K   +       N G+   R++G+    G+Y+ F+DSDD++   + DY+ K +   +N D
  S:     5 ISIVVPVYNVE-KYLKKSIESILNQTYQNIEILLVDDGSTDSSGKICESFSKVDPRIRVFHKENGGLSDARNFGIEQMKGQYVAFIDSDDYI---SKDYVWKLYSSIKNND 111
>gi|57238019|ref|YP_179268.1| lipooligosaccharide biosynthesis galactosyltransferase, putative [Campylobacter jejuni RM1221] >gi|22086359|gb|AAM90646.1|AF400669_7 putative galactosyltransferase [Campylobacter jejuni] >gi|57166823|gb|AAW35602.1| lipooligosaccharide biosynthesis galactosyltransferase, putative [Campylobacter jejuni RM1221] >gi|121592420|gb|ABM63329.1| putative glycosyltransferase [Campylobacter jejuni] >gi|167412413|gb|ABZ79865.1| unknown [Campylobacter jejuni] (323 aa)
Score = 120, Expect = 1.2e-04, Identities = 37/119 (31%), Positives = 66/119 (55%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINKNGYQYVQNIPN--NIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEY 119
           M K+S+I+P  N   K+I + + S  NQ+ K+ E+  +DD  ++  + I        + ++ I N  N+G+ + R  GV  A G YI F+D DD+L ++A +  ++     +  DFI F++
  S:     1 MPKISIILPTFNVE-KYIAKALESCINQSFKDIEIIVVDDCGSDKSIDIAKEYAKKDERIKIIHNEENLGLLRARYEGVKAAGGGYIMFLDPDDYLELNACEECVRILNTEKESDFIWFDF 120
>gi|196042625|ref|ZP_03109864.1| glycosyl transferase, group 2 family protein [Bacillus cereus 03BB108] >gi|196026109|gb|EDX64777.1| glycosyl transferase, group 2 family protein [Bacillus cereus 03BB108] (851 aa)
Score = 120, Expect = 1.2e-04, Identities = 40/128 (31%), Positives = 70/128 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK-NGYQYVQNIPNNIG-VGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI 128
           + KVS++IP  N P  +++  + S  NQT +N E+  I D+STN +V + +      Y Y+  + N    V +  +  + LA GEYI F+  DD  + + I+ ++K F + +NI F+    E + +  +I
  S:   319 LPKVSILIPAYNRP-HYLELALKSALNQTYENIEII-ISDDSTNDEVKVMIQPYLKEYNYITYVKNETPLVAENFNQCIELATGEYINFLLDDDLFHHEKIERMMKYFLELENISFVTSYRELIDENGEI 446
>gi|125717151|ref|YP_001034284.1| glycosyl transferase family protein [Streptococcus sanguinis SK36] >gi|125497068|gb|ABN43734.1| Glycosyltransferase, family 2/glycosyltransferase family 8, putative [Streptococcus sanguinis SK36] (289 aa)
Score = 120, Expect = 1.2e-04, Identities = 31/106 (29%), Positives = 61/106 (57%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNP--QVYIDLINKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKY 109
           +SVIIP  N   +++ + + S+  QT +N E+  ++D ST+   Q+  +L +++    + +  +N G+   R+ G+  ++ +Y+ FVDSDDWL    +  L +   +Y
  S:     6 ISVIIPVYNVE-QYLAECVNSVCRQTYQNLEIILVNDGSTDASGQICQELADQDARIRLIH-QDNQGLSGARNTGIEHSSADYLIFVDSDDWLPEQHVARLYEKLKEY 111
>gi|196038548|ref|ZP_03105857.1| glycosyl transferase, group 2 family protein [Bacillus cereus NVH0597-99] >gi|196030956|gb|EDX69554.1| glycosyl transferase, group 2 family protein [Bacillus cereus NVH0597-99] (851 aa)
Score = 120, Expect = 1.2e-04, Identities = 40/128 (31%), Positives = 70/128 (54%)
  Q:     1 MKKVSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDLINK-NGYQYVQNIPNNIG-VGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQNIDFIMFEYEWVFDKKQI 128
           + KVS++IP  N P  +++  + S  NQT +N E+  I D+STN +V + +      Y Y+  + N    V +  +  + LA GEYI F+  DD  + + I+ ++K F + +NI F+    E + +  +I
  S:   319 LPKVSILIPAYNRP-HYLELALKSALNQTYENIEII-ISDDSTNDEVKVMIQPYLKEYNYITYVKNETPLVAENFNQCIELATGEYINFLLDDDLFHHEKIERMMKYFLELENISFVTSYRELIDENGEI 446
>gi|6601343|gb|AAF18944.1|AF155804_5 Cps1I [Streptococcus suis] (322 aa)
Score = 120, Expect = 1.2e-04, Identities = 67/237 (28%), Positives = 120/237 (50%)
  Q:     4 VSVIIPFKNTPLKWIKQLITSLNNQTNKNFEVFFIDDNSTNPQVYIDL---INKNGYQYVQNIPNNIGVGKIRDYGVTLANGEYIWFVDSDDWLYVDAIDYLLKSFYKYQ----NIDFIMFEYEWVFDKKQINLFSKHNQFDEIIVKNNVNKSKMPWFHNNYQTDWRVCFKKEFLVKNKISHPDKVNIFEDVYFGLIWKVLYKKALLTSKKLYFYNRLNVESSLNTYKYKANDLVSIIFKNKNY 240
           +SVI+P  N    ++ + I S+ NQT  N EV  ++D ST+    I L    N    +Y + I  N G+   R++G+  A G+YI FVDSDD++ V   + +  +  +Y      IDF + +      KK+ + F  H    E  VK  ++ S +    NN    W   + ++ ++K+     +  +I ED+ F L       + ++ +++ Y+YN +   SSL   K+  N+ + ++ + +NY
  S:     5 ISVIVPIYNVQ-DYLDKCINSIINQTYTNLEVILVNDGSTDDSEKICLNYMKNDGRIKYYKKI--NGGLADARNFGLEHATGKYIAFVDSDDYIEVAMFERMHDNITEYNADIAEIDFCLVDENGYTKKKRNSNF--HVLTREETVKEFLSGSNI---ENNV---WCKLYSRD-IIKDIKFQINNRSIGEDLLFNLEVLNNVTRVVVDTRE-YYYNYVIRNSSLINQKFSINN-IDLVTRLENY 234