>gi|26553726|ref|NP_757660.1| hypothetical protein MYPE2720 [Mycoplasma penetrans HF-2] >gi|26453733|dbj|BAC44064.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (152 aa)
Score = 585, Expect = 3.3e-59, Identities = 152/152 (100%), Positives = 152/152 (100%)
  Q:     1 MYEFLNKQTKLFLFSLIYFFKNKKDIRSEYENKFTEESLNKYYAIDNINYQKDIFLKTVYQNAAIMVFGFSLGFILHTTAFNNDVLKPLVTDLNSNLVLFLCLLLTSGIAFISCLINSIILSYKMYKKGYFNKKEMKLNCLPFVNWISVFFI 152
           MYEFLNKQTKLFLFSLIYFFKNKKDIRSEYENKFTEESLNKYYAIDNINYQKDIFLKTVYQNAAIMVFGFSLGFILHTTAFNNDVLKPLVTDLNSNLVLFLCLLLTSGIAFISCLINSIILSYKMYKKGYFNKKEMKLNCLPFVNWISVFFI
  S:     1 MYEFLNKQTKLFLFSLIYFFKNKKDIRSEYENKFTEESLNKYYAIDNINYQKDIFLKTVYQNAAIMVFGFSLGFILHTTAFNNDVLKPLVTDLNSNLVLFLCLLLTSGIAFISCLINSIILSYKMYKKGYFNKKEMKLNCLPFVNWISVFFI 152
>gi|188534642|ref|YP_001908439.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia tasmaniensis] >gi|188029684|emb|CAO97563.1| Cytochrome o ubiquinol oxidase subunit III [Erwinia tasmaniensis] (204 aa)
Score = 86, Expect = 2.3e-01, Identities = 29/87 (33%), Positives = 45/87 (51%)
  Q:    66 MVFGFSLGFI-LHTTAFNNDVLKPLVTDLNSNLVLFLCLLLTSGIAFISCLINSIILSYKMYKKGYFNKKEMKLNCLPF------VNWISVFFI 152
           M F F LGFI +    F++ + +    D +  L  F  L+ T G+   S LI  ++L Y++ K+G  +    ++ CL        V WI VF I
  S:   104 MTFLFGLGFIGMEIYEFHHLIAEGFGPDRSGFLSAFFTLVGTHGLHVTSGLIWMLVLMYQVAKRGLSDSNRTRIMCLSLFWHFLDVVWICVFTI 197