>gi|26553480|ref|NP_757414.1| hypothetical protein MYPE280 [Mycoplasma penetrans HF-2] >gi|26453486|dbj|BAC43818.1| hypothetical protein [Mycoplasma penetrans HF-2] (151 aa)
Score = 601, Expect = 5.2e-61, Identities = 151/151 (100%), Positives = 151/151 (100%)
  Q:     1 MDQKNQTKLNLLKLKEELTNLKWSENHKYDDFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           MDQKNQTKLNLLKLKEELTNLKWSENHKYDDFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN
  S:     1 MDQKNQTKLNLLKLKEELTNLKWSENHKYDDFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
>gi|144575507|gb|AAZ53904.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (278 aa)
Score = 110, Expect = 4.1e-04, Identities = 35/92 (38%), Positives = 52/92 (56%)
  Q:    43 LLEDSEY-FYKDTKTLDLWDTHYEV----------IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL 134
           LLE  +Y FY D+  LD  +   E+          I  FAF    I+ ++LP  I  I K +FA N ++ +D +    LE IE  +FF N+IT    + N++L
  S:   119 LLEIDDYAFYVDSANLDQNEKIQELDFSKAMKLRRIGSFAFQGNNIKTLVLPPSITSIGKQAFAKNSLETVDFSQATKLETIETGAFFDNKITELDLSKNLIL 221
>gi|72080869|ref|YP_287927.1| hypothetical protein MHP7448_0538 [Mycoplasma hyopneumoniae 7448] (283 aa)
Score = 110, Expect = 4.3e-04, Identities = 35/92 (38%), Positives = 52/92 (56%)
  Q:    43 LLEDSEY-FYKDTKTLDLWDTHYEV----------IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL 134
           LLE  +Y FY D+  LD  +   E+          I  FAF    I+ ++LP  I  I K +FA N ++ +D +    LE IE  +FF N+IT    + N++L
  S:   124 LLEIDDYAFYVDSANLDQNEKIQELDFSKAMKLRRIGSFAFQGNNIKTLVLPPSITSIGKQAFAKNSLETVDFSQATKLETIETGAFFDNKITELDLSKNLIL 226
>gi|144227685|gb|AAZ44626.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (278 aa)
Score = 110, Expect = 4.5e-04, Identities = 35/92 (38%), Positives = 52/92 (56%)
  Q:    43 LLEDSEY-FYKDTKTLDLWDTHYEV----------IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL 134
           LLE  +Y FY D+  LD  +   E+          I  FAF    I+ ++LP  I  I K +FA N ++ +D +    LE IE  +FF N+IT    + N++L
  S:   119 LLEIDDYAFYVDSANLDQNEKIQELDFSKAMKLRRIGSFAFQGNNIKTLVLPPSITSIGKQAFAKNSLETVDFSQATKLETIETGAFFDNKITELDLSKNLIL 221
>gi|71893891|ref|YP_279337.1| hypothetical protein MHJ_0540 [Mycoplasma hyopneumoniae J] (283 aa)
Score = 110, Expect = 4.5e-04, Identities = 35/92 (38%), Positives = 52/92 (56%)
  Q:    43 LLEDSEY-FYKDTKTLDLWDTHYEV----------IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL 134
           LLE  +Y FY D+  LD  +   E+          I  FAF    I+ ++LP  I  I K +FA N ++ +D +    LE IE  +FF N+IT    + N++L
  S:   124 LLEIDDYAFYVDSANLDQNEKIQELDFSKAMKLRRIGSFAFQGNNIKTLVLPPSITSIGKQAFAKNSLETVDFSQATKLETIETGAFFDNKITELDLSKNLIL 226
>gi|123427786|ref|XP_001307334.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121888956|gb|EAX94404.1| surface antigen BspA-like [Trichomonas vaginalis G3] (771 aa)
Score = 106, Expect = 1.3e-03, Identities = 24/63 (38%), Positives = 38/63 (60%)
  Q:    65 EVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQ 127
           + I +++F+   I +VI+P  +  IA YSF N+ + +L L N  NL  I D++F YN I N +
  S:   262 QAIGDYSFYFCNIPEVIIPNGVKSIASYSFYNSSVSKLVLPN--NLATISDFAFTYNPIKNLE 322
>gi|54020579|ref|YP_116064.1| hypothetical protein mhp555 [Mycoplasma hyopneumoniae 232] >gi|53987752|gb|AAV27953.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (278 aa)
Score = 106, Expect = 1.3e-03, Identities = 35/92 (38%), Positives = 51/92 (55%)
  Q:    43 LLEDSEY-FYKDTKTLDLWDTHYEV----------IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL 134
           LLE  +Y FY D+  LD  +   E+          I  FAF    I+ + LP  I  I K +FA N ++ +D +    LE IE  +FF N+IT    + N++L
  S:   119 LLEIDDYAFYVDSANLDQNEKIQELDFSKAMKLRRIGSFAFQGNNIKTLALPPSITSIGKQAFAKNSLETVDFSQATKLETIETGAFFDNKITALDLSKNLIL 221
>gi|123447910|ref|XP_001312690.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121894546|gb|EAX99760.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1823 aa)
Score = 105, Expect = 1.5e-03, Identities = 26/67 (38%), Positives = 39/67 (58%)
  Q:    61 DTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNM-IKELDLTNYKNLEVIEDYSFFYNRITNFQ 127
           D+  +VI E++F   GIE + +P+ + VI+ Y+FAN + + EL   N  NL  I  YSF    I N +
  S:  1368 DSELKVIGEYSFSETGIENISIPRSVEVISSYAFANCLNLTELVFDNNCNLITIGSYSFSKTNIKNIE 1435
Score = 93, Expect = 4.1e-02, Identities = 24/78 (30%), Positives = 45/78 (57%)
  Q:    49 YFYKDTKTLDLWD---THYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNF 126
           Y Y+ T  ++L+     H   I + +F +  I+K+++PK ++ I  Y+F N  +KE+++     L  I  ++F +  ITNF
  S:   299 YQYRYTNNIELFFLILEHTNEIRKDSFRNCLIDKLLIPKNVIKINDYAFFNCSLKEIEIEENSQLNEIGSFAFSFTNITNF 379
Score = 85, Expect = 3.1e-01, Identities = 22/113 (19%), Positives = 62/113 (54%)
  Q:    28 KYDDFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKAL 140
           K D+   +++ + +E+ +D+ + Y    TL +   +  VI  F+F +  I  +++P+ + +I+ Y+F +++I+ +   +   L  I + +F+Y ++++     ++ +  ++A 
  S:   771 KIDNITFLNNTRLIEISKDA-FSYISVPTLII--PNVSVIGSFSFSNSKINSILIPRTVNIISYYAFRDSIIEMITFQSNSKLLKISEGAFYYCQLSSITIPHSVEIIERRAF 880
>gi|123426027|ref|XP_001306943.1| hypothetical protein TVAG_082200 [Trichomonas vaginalis G3] >gi|121888545|gb|EAX94013.1| hypothetical protein TVAG_082200 [Trichomonas vaginalis G3] (423 aa)
Score = 100, Expect = 6.5e-03, Identities = 23/65 (35%), Positives = 39/65 (60%)
  Q:    62 THYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANN-MIKELDLTNYKNLEVIEDYSFFYNRITNF 126
           +  EVI  FAF    I+++ LP  I VI +Y+F++   +K++  T+ +    IE+Y+F  + I NF
  S:   156 SQIEVIGSFAFWKSNIQEIYLPSSISVIKRYAFSSTKYLKQITFTDSQKHITIEEYAFSESSIPNF 221
>gi|123426024|ref|XP_001306942.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121888544|gb|EAX94012.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1113 aa)
Score = 97, Expect = 1.4e-02, Identities = 23/65 (35%), Positives = 42/65 (64%)
  Q:    62 THYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFAN-NMIKELDLTNYKNLEVIEDYSFFYNRITNF 126
           +  +VI  FAF +  I+++ LP  I VI +Y+F++   +K++   + +N  VIE+Y+F  + I+NF
  S:    99 SQIKVIGSFAFLNSNIQEIHLPSSISVIKRYAFSSPKKLKQIKFADNQNNIVIEEYAFSNSSISNF 164
>gi|123405728|ref|XP_001302666.1| surface antigen Bsp, putative [Trichomonas vaginalis G3] >gi|121883977|gb|EAX89736.1| surface antigen Bsp, putative [Trichomonas vaginalis G3] (488 aa)
Score = 95, Expect = 2.1e-02, Identities = 21/56 (37%), Positives = 33/56 (58%)
  Q:    65 EVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFY 120
           E I EF+F+   I+ VI+P  +  I +Y+F  + I+ +       LE+IE+YSF Y
  S:    31 EEIGEFSFYKSSIKSVIIPSSVKRIKRYAFFKSNIENVAFPEDSMLEIIEEYSFSY 86
>gi|123456164|ref|XP_001315820.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121898508|gb|EAY03597.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1525 aa)
Score = 93, Expect = 3.9e-02, Identities = 23/72 (31%), Positives = 44/72 (61%)
  Q:    50 FYKDTKTLDLW--DTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYN 121
           FYK T T  +   D++ E I ++AF +   + + +P  +  + KY+F  + I+ +D+  Y N+ +IED++F Y+
  S:   459 FYKSTLTSIIISEDSNLESIGDYAFGNTNFKNINIPNSVKTVGKYAFYYSKIESIDI--YPNVSLIEDFTFSYS 530
>gi|154422596|ref|XP_001584310.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121918556|gb|EAY23324.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1363 aa)
Score = 92, Expect = 4.6e-02, Identities = 24/93 (25%), Positives = 46/93 (49%)
  Q:    34 HISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNF 126
           H     ++E +E+  + Y   K + ++    + I++ AF+   +E V+LP  +  I  ++F N  I  + L     +E I  Y+F Y ++ NF
  S:  1041 HFEFPSSVETIENYAFGYTPCKEM-VFKEGLQNINDNAFYYSKVESVVLPSTLKYIGNWAFFNCRILNIVLPENAEIETIGTYAFSYMKVYNF 1132
Score = 91, Expect = 7.5e-02, Identities = 28/103 (27%), Positives = 52/103 (50%)
  Q:    18 LTNLKWSENHKYDDFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFY 120
           +T L++ EN +  D N +SS+K   +   S Y                 I  +AF S  + +++LP+ +  I  Y+F N++I+  +  +  ++E IE+Y+F Y
  S:   974 VTKLEFKENFRTLDSNALSSSKIENVTFKSLY----------------SIGSYAFSSNKVTELVLPEGLQTINGYAFYNSIIEHFEFPS--SVETIENYAFGY 1058
>gi|123478498|ref|XP_001322411.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121905257|gb|EAY10188.1| surface antigen BspA-like [Trichomonas vaginalis G3] (853 aa)
Score = 91, Expect = 6.6e-02, Identities = 21/65 (32%), Positives = 36/65 (55%)
  Q:    61 DTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITN 125
           D   + I ++AF+S  I  ++LP  I+ I  Y+FA  + K + +   + L  I DY F+Y + +N
  S:     2 DEGVKYIKDYAFYSNSITSLVLPSTIISIGNYAFA-QISKLVSVELNEGLTSIGDYCFYYAQFSN 65
Score = 87, Expect = 2.0e-01, Identities = 20/66 (30%), Positives = 35/66 (53%)
  Q:    67 IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNI 132
           I  +AF    ++ + LP R+  I   SF N+ I+ +++T+  NL  I DY+F  + + N    P +
  S:   746 IGNYAFQGSKLQNITLPSRMTSIGYRSFENSGIEYVNVTS--NLTSISDYAFQNSHLRNITYTPTL 809
>gi|116618971|ref|YP_819342.1| subtilisin-like serine protease [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097818|gb|ABJ62969.1| Subtilisin-like serine protease [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (538 aa)
Score = 91, Expect = 7.5e-02, Identities = 20/54 (37%), Positives = 32/54 (59%)
  Q:    79 KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNI 132
           KV++P  +  IA  +F N  I  +D ++  NL+ I D++F  NR+T  Q  PN+
  S:    69 KVVIPNNVTSIASTAFYNQGIASVDFSSATNLKSIGDFAFAKNRLTAVQ-YPNL 121
>gi|21910105|ref|NP_664373.1| putative surface antigen [Streptococcus pyogenes MGAS315] >gi|21904297|gb|AAM79176.1| putative surface antigen [Streptococcus pyogenes MGAS315] (999 aa)
Score = 90, Expect = 8.5e-02, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   224 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 307
Score = 83, Expect = 6.1e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   247 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 358
>gi|28896197|ref|NP_802547.1| hypothetical protein SPs1285 [Streptococcus pyogenes SSI-1] >gi|28811448|dbj|BAC64380.1| hypothetical protein [Streptococcus pyogenes SSI-1] (1008 aa)
Score = 90, Expect = 8.8e-02, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 83, Expect = 6.4e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|56808440|ref|ZP_00366186.1| COG0556: Helicase subunit of the DNA excision repair complex [Streptococcus pyogenes M49 591] (1008 aa)
Score = 90, Expect = 9.8e-02, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.1e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|71903298|ref|YP_280101.1| cell surface protein [Streptococcus pyogenes MGAS6180] >gi|71802393|gb|AAX71746.1| cell surface protein [Streptococcus pyogenes MGAS6180] (1008 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.1e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|94990219|ref|YP_598319.1| cell surface protein [Streptococcus pyogenes MGAS10270] >gi|94543727|gb|ABF33775.1| Cell surface protein [Streptococcus pyogenes MGAS10270] (1008 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.1e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|94988337|ref|YP_596438.1| cell surface protein [Streptococcus pyogenes MGAS9429] >gi|94992216|ref|YP_600315.1| cell surface protein [Streptococcus pyogenes MGAS2096] >gi|94541845|gb|ABF31894.1| cell surface protein [Streptococcus pyogenes MGAS9429] >gi|94545724|gb|ABF35771.1| Cell surface protein [Streptococcus pyogenes MGAS2096] (1008 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.2e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|50914016|ref|YP_059988.1| cell surface protein [Streptococcus pyogenes MGAS10394] >gi|50903090|gb|AAT86805.1| Cell surface protein [Streptococcus pyogenes MGAS10394] (1008 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.1e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|139473983|ref|YP_001128699.1| putative surface-anchored protein [Streptococcus pyogenes str. Manfredo] >gi|134272230|emb|CAM30482.1| putative surface-anchored protein [Streptococcus pyogenes str. Manfredo] (1008 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.1e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|15674877|ref|NP_269051.1| hypothetical protein SPy_0843 [Streptococcus pyogenes M1 GAS] >gi|71910464|ref|YP_282014.1| cell surface protein [Streptococcus pyogenes MGAS5005] >gi|13622014|gb|AAK33772.1| hypothetical protein SPy_0843 [Streptococcus pyogenes M1 GAS] >gi|71853246|gb|AAZ51269.1| cell surface protein [Streptococcus pyogenes MGAS5005] (1008 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.2e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|19745918|ref|NP_607054.1| hypothetical protein spyM18_0903 [Streptococcus pyogenes MGAS8232] >gi|19748073|gb|AAL97553.1| hypothetical protein [Streptococcus pyogenes MGAS8232] (1008 aa)
Score = 90, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   233 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 316
Score = 82, Expect = 7.2e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   256 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 367
>gi|94994138|ref|YP_602236.1| Cell surface protein [Streptococcus pyogenes MGAS10750] >gi|94547646|gb|ABF37692.1| Cell surface protein [Streptococcus pyogenes MGAS10750] (1013 aa)
Score = 89, Expect = 1.0e-01, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:    62 THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL-FTKKALHKNPV 145
           T Y+ I + AF  +K I +V LP+ +  I+ Y+FA+  +K++DL +  NL+ I + +FF N+IT   + P  L+   ++A   N +
  S:   238 TGYKHIGQDAFVDNKNIAEVNLPESLETISDYAFAHLALKQIDLPD--NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHI 321
Score = 82, Expect = 7.2e-01, Identities = 30/113 (26%), Positives = 58/113 (51%)
  Q:    39 KALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE-KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTEQFKN 151
           ++LE + D  + +   K +DL D + + I E AF    I  K+ LP++++ +A+ +F +N IK ++     +L+VI + SF  N ++       +     +A   NP  + + N
  S:   261 ESLETISDYAFAHLALKQIDLPD-NLKAIGELAFFDNQITGKLSLPRQLMRLAERAFKSNHIKTIEFRG-NSLKVIGEASFQDNDLSQLMLPDGLEKIESEAFTGNPGDDHYNN 372
>gi|123405732|ref|XP_001302667.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121883978|gb|EAX89737.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1049 aa)
Score = 88, Expect = 1.7e-01, Identities = 18/67 (26%), Positives = 40/67 (59%)
  Q:    60 WDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFAN-NMIKELDLTNYKNLEVIEDYSFFYNRITNF 126
           +D+H  +I     ++  I  +++P  ++ I + +F+  + ++++ +T+   L +IED +F Y  ITNF
  S:   129 YDSHLTIISNHMLYNSKISSILIPSSVIKIEENAFSGCSHLRDVKITDDSQLTIIEDEAFKYTSITNF 196
>gi|123455825|ref|XP_001315653.1| Leucine Rich Repeat family protein [Trichomonas vaginalis G3] >gi|121898336|gb|EAY03430.1| Leucine Rich Repeat family protein [Trichomonas vaginalis G3] (659 aa)
Score = 87, Expect = 1.8e-01, Identities = 18/66 (27%), Positives = 36/66 (54%)
  Q:    67 IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNI 132
           I  + F+   I +V++P  +  I  Y+F  N +K++ L+  KN+ ++ +  F   +IT  +  PN+
  S:   108 IGTYVFYRTPISEVVIPDSVTDIGSYAFCTNYLKKVTLS--KNITILHEACFSGAQITEIEIPPNV 171
>gi|163788186|ref|ZP_02182632.1| cell surface protein [Flavobacteriales bacterium ALC-1] >gi|159876506|gb|EDP70564.1| cell surface protein [Flavobacteriales bacterium ALC-1] (700 aa)
Score = 87, Expect = 1.9e-01, Identities = 28/123 (22%), Positives = 55/123 (44%)
  Q:    25 ENHKYDDFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTE 147
           E  K +    I+    + ++ DS ++     T+++ +     I+  AF    I  V  P  I  I   +F+ N +  +++ N  ++  IE  +FF N++T+     N+      A   NP+T+
  S:   440 EAFKNNLLTSITIPGNITIISDSAFYNNQLTTVNILNG-VTTIESAAFSQNQITSVTFPDSITTIGSNAFSFNQLTSVNIPN--SVTTIEQVAFFTNQLTSVIIPENVTSIGFWAFDANPLTD 559
Score = 84, Expect = 3.9e-01, Identities = 22/64 (34%), Positives = 35/64 (54%)
  Q:    71 AFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILL 134
           AF++ GI  V +P  +  I   +F NN +  + L   + L VI++  FF N++TN    PN +L
  S:    81 AFYNMGITSVTIPTSVTSIGTDAFRNNSLTTVILP--EGLTVIKNSCFFNNQLTNTITIPNSVL 142
>gi|123456789|ref|XP_001316127.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121898825|gb|EAY03904.1| surface antigen BspA-like [Trichomonas vaginalis G3] (651 aa)
Score = 87, Expect = 1.9e-01, Identities = 22/65 (33%), Positives = 34/65 (52%)
  Q:    67 IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPN 131
           I ++AF++  I K+ +P  + VI  YSF N  IK L      N  +I  Y F + ++ N  + PN
  S:   360 ISDYAFYNSSITKINIPSSVQVIGSYSFYNAPIKSLIFPETLNSALIGQYCFAFLKLVNI-SIPN 423
>gi|154420125|ref|XP_001583078.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121917317|gb|EAY22092.1| surface antigen BspA-like [Trichomonas vaginalis G3] (556 aa)
Score = 86, Expect = 2.5e-01, Identities = 20/62 (32%), Positives = 34/62 (54%)
  Q:    62 THYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRI 123
           T+ + ID +AF    IE V +P+ +  I +Y+F  +M++  +L  Y N   I  Y+F   R+
  S:   197 TNVKTIDSYAFSYSAIENVTIPENLTTINQYAFEYSMLQSFEL--YGNKTNINSYAFQGTRL 256
>gi|123449451|ref|XP_001313444.1| hypothetical protein TVAG_350110 [Trichomonas vaginalis G3] >gi|121895328|gb|EAY00515.1| hypothetical protein TVAG_350110 [Trichomonas vaginalis G3] (666 aa)
Score = 86, Expect = 2.5e-01, Identities = 14/56 (25%), Positives = 31/56 (55%)
  Q:    69 EFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRIT 124
           E+ FH   I ++I+P  +  I K SF++  + E       ++  I+D++F+ + ++
  S:   414 EWCFHESMISRIIIPVFVETIGKMSFSSTNLDEFSFARGSSISTIDDFAFYNSSLS 469
>gi|154422582|ref|XP_001584303.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121918549|gb|EAY23317.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1117 aa)
Score = 86, Expect = 2.5e-01, Identities = 29/72 (40%), Positives = 42/72 (58%)
  Q:    50 FYKDTKTLDLWDTHYEVID--EF---------AFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYN 121
           F ++ KTLD +   Y  I   EF         AF    + ++++P+ +V I   SF N  IK  D    K+LE+IE YSF Y+
  S:   733 FKENFKTLDDYALAYSNITTVEFRSLVNVNIEAFKGNKVSRLVIPEGLVRIYSQSFQNCKIKYFDFP--KSLEIIESYSFRYS 813
>gi|123509282|ref|XP_001329821.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121912870|gb|EAY17686.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1122 aa)
Score = 86, Expect = 2.8e-01, Identities = 30/85 (35%), Positives = 51/85 (60%)
  Q:    34 HISSAKALELLEDSE-YFY---KDTKTLDLWD--THYEVIDEFAF-HSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSF 118
           H +S + LE+  DS   FY   +D K L   +  T ++ I + +F +++ +E+V+LP  I  I  Y+F  NM  +L   N +N+ V  +Y+F
  S:   593 HSTSIEKLEISFDSNATFYMGVRDNKKLKFINISTQFDKIGDNSFSNNENLEEVVLPSTITEIGNYAF--NMCPKLKTINIENVSVFGEYAF 682
>gi|154412407|ref|XP_001579236.1| Leucine Rich Repeat family protein [Trichomonas vaginalis G3] >gi|121913441|gb|EAY18250.1| Leucine Rich Repeat family protein [Trichomonas vaginalis G3] (692 aa)
Score = 85, Expect = 3.2e-01, Identities = 20/66 (30%), Positives = 36/66 (54%)
  Q:    67 IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNI 132
           I  +AF +  + +VI+P  +  I  Y+F    +K++ L+  KNL V+ +  F   +IT  +  PN+
  S:   141 IGSYAFLATTLNEVIIPDSVTFIDMYAFCTPYLKKVTLS--KNLTVLTEACFKGTQITEIEIPPNV 204
>gi|154422600|ref|XP_001584312.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121918558|gb|EAY23326.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1424 aa)
Score = 85, Expect = 3.8e-01, Identities = 22/84 (26%), Positives = 41/84 (48%)
  Q:    63 HYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQNAPNILLFTKKALHKNPVT 146
           H   I+ +AF +  I K+I+P+ I  I  Y+F N  ++E+ L +   L+ I  Y+F+   ++      N+    + A     +T
  S:   504 HGNSINSYAFQNTLIRKIIIPEGIQSIGSYAFNNCPLREIKLPS--TLKYINSYAFYNTSLSEINFPANLYSIGESAFQLTFIT 585
>gi|123431370|ref|XP_001308141.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121889806|gb|EAX95211.1| surface antigen BspA-like [Trichomonas vaginalis G3] (675 aa)
Score = 84, Expect = 5.1e-01, Identities = 19/52 (36%), Positives = 35/52 (67%)
  Q:    67 IDEFAFH-SKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSF 118
           ID+ AF+ ++ + ++ LP RI VI  Y FA + ++ + + N  N+ +IE++SF
  S:   142 IDDHAFYNTQQLTEITLPSRITVIRNYLFARSKLRRITIPN--NVTLIEEFSF 192
>gi|54020110|ref|YP_115767.1| hypothetical protein mhp254 [Mycoplasma hyopneumoniae 232] >gi|53987283|gb|AAV27484.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (263 aa)
Score = 83, Expect = 5.1e-01, Identities = 29/88 (32%), Positives = 51/88 (57%)
  Q:    40 ALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIE--KVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRITNFQ 127
           A++++++ E+F    K LDL   ++E I +FAF   G+E  K+ILP  ++ I + +F  N I+++      NLE I D +F  N +   +
  S:    11 AIKIIKNQEFF--SGKILDLSSLNFEEIADFAFSGMGLEIKKLILPDSLLKIGESAFMLNKIEKIVFG--ANLETILDSAFESNMVKKIE 96
>gi|169825152|ref|YP_001692763.1| putative N-acetylmuramoyl-L-alanine amidase [Finegoldia magna ATCC 29328] >gi|167831957|dbj|BAG08873.1| putative N-acetylmuramoyl-L-alanine amidase [Finegoldia magna ATCC 29328] (1190 aa)
Score = 83, Expect = 5.7e-01, Identities = 27/81 (33%), Positives = 50/81 (61%)
  Q:    43 LLEDSEYFYKDT--KTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRI 123
           +++ S+Y + D   KT+ L D    + D+  F+++   K+ILPK +  + + SF +N I EL+  N + LE+I++ +F  N+I
  S:   155 IIKISDYAFADLSLKTIKLPDNLEFLGDQVFFYNQIEGKLILPKNLTNLGERSFKSNQITELEF-NCEKLEIIKEQAFEDNKI 236
>gi|124001063|ref|XP_001276952.1| Leucine Rich Repeat family protein [Trichomonas vaginalis G3] >gi|121918938|gb|EAY23704.1| Leucine Rich Repeat family protein [Trichomonas vaginalis G3] (743 aa)
Score = 82, Expect = 6.7e-01, Identities = 16/53 (30%), Positives = 35/53 (66%)
  Q:    73 HSKGIEKVILPKRIVVIAKYSFAN-NMIKELDLTNYKNLEVIEDYSFFYNRITN 125
           +++ +E + LP  I +I +Y+FAN  +I ++ ++   NL  I  Y+F+Y+ +++
  S:   414 NNQNLEHITLPSSIEIIGEYAFANCPLIGDIGISGMTNLISIGAYAFYYSGLSS 467
>gi|159904625|ref|YP_001548287.1| hypothetical protein MmarC6_0234 [Methanococcus maripaludis C6] >gi|159886118|gb|ABX01055.1| hypothetical protein MmarC6_0234 [Methanococcus maripaludis C6] (203 aa)
Score = 81, Expect = 9.1e-01, Identities = 21/84 (25%), Positives = 50/84 (59%)
  Q:    40 ALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSFFYNRI 123
           +L+++ D  +     KT+ + D+    I + AF +  ++ V++P  I  I + +F+NN +K + + +  ++++IED +F +N++
  S:    93 SLKIIGDGAFSNNPLKTVVISDS-VTSIGKGAFSNNQLKSVVIPNSITSIGRGTFSNNQLKSVVIPD--SVKIIEDGAFSHNQL 173
>gi|154422594|ref|XP_001584309.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121918555|gb|EAY23323.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1434 aa)
Score = 81, Expect = 9.4e-01, Identities = 19/79 (24%), Positives = 42/79 (53%)
  Q:    24 SENHKYDDFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKEL 102
           SE   Y +  +I++  +L+++ +  + Y   + +DLW+     I ++AF +  I  + LP  I  I + +F N+ ++ +
  S:   737 SEAFMYSNIVNITTPPSLQIIYNDVFAYCPVQHVDLWEG-MTYIYQYAFRNSNITNITLPSTITYIDREAFFNSTLQSI 814
>gi|154422592|ref|XP_001584308.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121918554|gb|EAY23322.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1474 aa)
Score = 81, Expect = 9.5e-01, Identities = 21/54 (38%), Positives = 34/54 (62%)
  Q:    65 EVIDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSF 118
           E I E+AF S GI  +I+ +R+  I +Y+FA+N    + + +  NL VI+D+ F
  S:   226 ESIGEYAFFSLGITTLIVNERLKNIDRYAFAHNSFTNVTIPS-PNLTVIKDHVF 278
>gi|167761049|ref|ZP_02433176.1| hypothetical protein CLOSCI_03447 [Clostridium scindens ATCC 35704] >gi|167661283|gb|EDS05413.1| hypothetical protein CLOSCI_03447 [Clostridium scindens ATCC 35704] (1984 aa)
Score = 81, Expect = 9.7e-01, Identities = 26/81 (32%), Positives = 48/81 (59%)
  Q:    67 IDEFAFHSKGIEKVILPKRIVVIAKYSFANNMIKELDLT---------------NYKNLEV------IEDYSFFYNRITNFQNAPNILLFTKKALHKNPVTE 147
           I E AF+S  +EK+ILP  I  +   +F+ N++ E+ L+               N  ++E+      I+D++F   R+       ++    +KA H + +TE
  S:  1567 IGESAFNSNKLEKLILPDTITEVKDGAFSTNVLTEITLSDGMTRIAQAVFSMNINLTHIEIPDTITEIDDFAFAGARLETLDIPESVERIGRKAFHLHHLTE 1668
>gi|123384552|ref|XP_001298988.1| surface antigen BspA-like [Trichomonas vaginalis G3] >gi|121879719|gb|EAX86058.1| surface antigen BspA-like [Trichomonas vaginalis G3] (1094 aa)
Score = 81, Expect = 9.8e-01, Identities = 25/88 (28%), Positives = 41/88 (46%)
  Q:    31 DFNHISSAKALELLEDSEYFYKDTKTLDLWDTHYEVIDEFAFHS-KGIEKVILPKRIVVIAKYSFANNMIKELDLTNYKNLEVIEDYSF 118
           D  HI   K L  LE   + Y      D  +     I   AF+S   ++K+IL +   +I   +FA+  + E+ +  Y +LE +E+  F
  S:   109 DIAHIKIPKQLTKLETEAFAYSGFHEFDFSECQLTEIPPKAFYSCHKVQKIILSQSTTIIRANAFADCSVSEIGI--YSSLETLEEGCF 195