>gi|26553481|ref|NP_757415.1| 30S ribosomal protein S12 [Mycoplasma penetrans HF-2] >gi|52783411|sp|Q8EX21|RS12_MYCPE 30S ribosomal protein S12 >gi|26453487|dbj|BAC43819.1| ribosomal protein S12 [Mycoplasma penetrans HF-2] (140 aa)
Score = 613, Expect = 1.9e-62, Identities = 140/140 (100%), Positives = 140/140 (100%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE
  S:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
>gi|13358089|ref|NP_078363.1| 30S ribosomal protein S12 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167940664|ref|ZP_02527739.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 8] >gi|167959024|ref|ZP_02546096.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167971351|ref|ZP_02553628.1| ribosomal protein S12 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|167973050|ref|ZP_02555327.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974022|ref|ZP_02556299.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975580|ref|ZP_02557857.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988208|ref|ZP_02569879.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168281829|ref|ZP_02689496.1| ribosomal protein S12 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168307976|ref|ZP_02690651.1| ribosomal protein S12 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|168337995|ref|ZP_02694610.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 10] >gi|168362662|ref|ZP_02695841.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808205|ref|ZP_02829264.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 2] >gi|170762391|ref|YP_001752610.1| ribosomal protein S12 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|195867916|ref|ZP_03079914.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|189040487|sp|B1AJG6|RS12_UREP2 30S ribosomal protein S12 >gi|14423925|sp|Q9PPW5|RS12_UREPA 30S ribosomal protein S12 >gi|11276594|pir||A82880 ribosomal protein S12 UU525 [imported] - Ureaplasma urealyticum >gi|6899528|gb|AAF30938.1|AE002151_4 ribosomal protein S12 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827968|gb|ACA33230.1| ribosomal protein S12 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902692|gb|EDT48981.1| ribosomal protein S12 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171903443|gb|EDT49732.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|182675904|gb|EDT87809.1| ribosomal protein S12 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|184209116|gb|EDU06159.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|186701128|gb|EDU19410.1| ribosomal protein S12 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|188019127|gb|EDU57167.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998123|gb|EDU67220.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659875|gb|EDX53255.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660393|gb|EDX53652.1| ribosomal protein S12 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (141 aa)
Score = 500, Expect = 2.3e-49, Identities = 113/138 (81%), Positives = 123/138 (89%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TIAQLIR+ R  K KK+KSPAL++TYNSL KK T NPSP K GVCTRVGTMTPKKPNSALRKYAKV+L+NG+EVLAYIPGEGHNLQEHSVV+I GGRVKDLPGVRYHIVRG  D SGVEKRRQQRS YGAKRPK++
  S:     1 MPTIAQLIRNKRAPKVKKTKSPALLFTYNSLHKKTTKNPSPLKSGVCTRVGTMTPKKPNSALRKYAKVRLSNGFEVLAYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIVRGAGDASGVEKRRQQRSLYGAKRPKKE 138
>gi|31541584|gb|AAP56884.1| RpsL [Mycoplasma gallisepticum R] (145 aa)
Score = 499, Expect = 3.1e-49, Identities = 116/140 (82%), Positives = 123/140 (87%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           MATIAQLIR  R+ K KKSKSPAL    N+L+KK T   SP+KRGVCTRVGTMTPKKPNSALRKYAKVKLTNG EVLAYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLDT+GV+KRRQQRS YGAKRPK  K+
  S:     5 MATIAQLIRKPRRHKVKKSKSPALQVNLNTLEKKVTSKSSPFKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGMEVLAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTTGVDKRRQQRSAYGAKRPKADKK 144
>gi|161511501|ref|NP_853316.2| 30S ribosomal protein S12 [Mycoplasma gallisepticum R] >gi|115305663|sp|Q7NAV1|RS12_MYCGA 30S ribosomal protein S12 (141 aa)
Score = 498, Expect = 5.1e-49, Identities = 116/140 (82%), Positives = 123/140 (87%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           MATIAQLIR  R+ K KKSKSPAL    N+L+KK T   SP+KRGVCTRVGTMTPKKPNSALRKYAKVKLTNG EVLAYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLDT+GV+KRRQQRS YGAKRPK  K+
  S:     1 MATIAQLIRKPRRHKVKKSKSPALQVNLNTLEKKVTSKSSPFKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGMEVLAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTTGVDKRRQQRSAYGAKRPKADKK 140
>gi|12044939|ref|NP_072749.1| 30S ribosomal protein S12 [Mycoplasma genitalium G37] >gi|1350926|sp|P47333|RS12_MYCGE 30S ribosomal protein S12 >gi|3844674|gb|AAC71305.1| ribosomal protein S12 [Mycoplasma genitalium G37] >gi|166078906|gb|ABY79524.1| ribosomal protein S12 [synthetic Mycoplasma genitalium JCVI-1.0] (139 aa)
Score = 480, Expect = 5.3e-47, Identities = 111/138 (80%), Positives = 118/138 (85%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           MATIAQLIR  R+ K  KSKSPAL Y  N L KK T   SP KRGVCTRVGTMTP+KPNSALRKYAKV+LTNG+EVLAYIPGEGHNLQEHSV L+ GGRVKDLPGVRYHIVRGTLDT GV+KRRQQRS YGAK+PK K
  S:     1 MATIAQLIRKPRQKKKVKSKSPALHYNLNLLNKKTTNVYSPLKRGVCTRVGTMTPRKPNSALRKYAKVRLTNGFEVLAYIPGEGHNLQEHSVTLLRGGRVKDLPGVRYHIVRGTLDTVGVDKRRQQRSAYGAKKPKPK 138
>gi|13507964|ref|NP_109913.1| 30S ribosomal protein S12 [Mycoplasma pneumoniae M129] >gi|2500446|sp|P75546|RS12_MYCPN 30S ribosomal protein S12 >gi|1674308|gb|AAB96254.1| ribosomal protein S12 [Mycoplasma pneumoniae M129] (139 aa)
Score = 465, Expect = 3.1e-45, Identities = 113/138 (81%), Positives = 117/138 (84%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           MATIAQLIR  RK K  KSKSPAL Y  N L KK T   SP KRGVCTRVGTMTPKKPNSALRKYAKV+LTNG+EVL YIPGEGHNLQEHSV L+ GGRVKDLPGVRYHIVRGTLDT GVEKRRQQRS YGAK+PK K
  S:     1 MATIAQLIRKPRKKKKVKSKSPALHYNLNLLNKKVTNVYSPLKRGVCTRVGTMTPKKPNSALRKYAKVRLTNGFEVLTYIPGEGHNLQEHSVTLLRGGRVKDLPGVRYHIVRGTLDTVGVEKRRQQRSAYGAKKPKAK 138
>gi|30018375|ref|NP_830006.1| 30S ribosomal protein S12 [Bacillus cereus ATCC 14579] >gi|163938113|ref|YP_001642997.1| 30S ribosomal protein S12 [Bacillus weihenstephanensis KBAB4] >gi|52783399|sp|Q81J45|RS12_BACCR 30S ribosomal protein S12 >gi|29893915|gb|AAP07207.1| SSU ribosomal protein S12P [Bacillus cereus ATCC 14579] >gi|163860310|gb|ABY41369.1| ribosomal protein S12 [Bacillus weihenstephanensis KBAB4] (140 aa)
Score = 461, Expect = 8.8e-45, Identities = 106/140 (75%), Positives = 115/140 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R+ R DK  KSKSPAL   +NSLKKK T   +P KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+KR Q RS YG KRPK  K+
  S:     1 MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKRPKPAKK 140
>gi|30260296|ref|NP_842673.1| 30S ribosomal protein S12 [Bacillus anthracis str. Ames] >gi|42779186|ref|NP_976433.1| 30S ribosomal protein S12 [Bacillus cereus ATCC 10987] >gi|47525361|ref|YP_016710.1| 30S ribosomal protein S12 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183139|ref|YP_026391.1| 30S ribosomal protein S12 [Bacillus anthracis str. Sterne] >gi|49476716|ref|YP_034457.1| 30S ribosomal protein S12 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145112|ref|YP_081716.1| 30S ribosomal protein S12 [Bacillus cereus E33L] >gi|162382788|ref|YP_893025.2| 30S ribosomal protein S12 [Bacillus thuringiensis str. Al Hakam] >gi|166986847|ref|ZP_02258074.1| 30S ribosomal protein S12 [Bacillus cereus AH187] >gi|158512712|sp|A0R8H5|RS12_BACAH 30S ribosomal protein S12 >gi|52783357|sp|Q6HPR3|RS12_BACHK 30S ribosomal protein S12 >gi|52783371|sp|Q73FA1|RS12_BACC1 30S ribosomal protein S12 >gi|52783400|sp|Q81VT5|RS12_BACAN 30S ribosomal protein S12 >gi|60390786|sp|Q63H95|RS12_BACCZ 30S ribosomal protein S12 >gi|30253617|gb|AAP24159.1| ribosomal protein S12 [Bacillus anthracis str. Ames] >gi|42735101|gb|AAS39041.1| ribosomal protein S12 [Bacillus cereus ATCC 10987] >gi|47500509|gb|AAT29185.1| ribosomal protein S12 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177066|gb|AAT52442.1| ribosomal protein S12 [Bacillus anthracis str. Sterne] >gi|49328272|gb|AAT58918.1| ribosomal protein S12 (30S ribosomal protein S12) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978581|gb|AAU20131.1| ribosomal protein S12 (30S ribosomal protein S12) [Bacillus cereus E33L] (140 aa)
Score = 459, Expect = 1.4e-44, Identities = 105/140 (75%), Positives = 115/140 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R+ R DK  KSKSPAL   +NSLKKK T   +P KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+KR Q RS YG K+PK  K+
  S:     1 MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK 140
>gi|118415099|gb|ABK83518.1| SSU ribosomal protein S12P [Bacillus thuringiensis str. Al Hakam] (147 aa)
Score = 457, Expect = 2.2e-44, Identities = 105/140 (75%), Positives = 115/140 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R+ R DK  KSKSPAL   +NSLKKK T   +P KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+KR Q RS YG K+PK  K+
  S:     8 MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK 147
>gi|152973951|ref|YP_001373468.1| 30S ribosomal protein S12 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189040445|sp|A7GK15|RS12_BACCN 30S ribosomal protein S12 >gi|152022703|gb|ABS20473.1| ribosomal protein S12 [Bacillus cereus subsp. cytotoxis NVH 391-98] (140 aa)
Score = 454, Expect = 5.5e-44, Identities = 105/140 (75%), Positives = 114/140 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  R DK  KSKSPAL   +NSLKKK T   +P KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+KR Q RS YG K+PK  K+
  S:     1 MPTINQLVRKGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK 140
>gi|169351746|ref|ZP_02868684.1| hypothetical protein CLOSPI_02527 [Clostridium spiroforme DSM 1552] >gi|169291968|gb|EDS74101.1| hypothetical protein CLOSPI_02527 [Clostridium spiroforme DSM 1552] (156 aa)
Score = 453, Expect = 7.0e-44, Identities = 102/136 (75%), Positives = 110/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R DK  KSKSPAL   YNSL KK T   SP KRGVCTRV TMTPKKPNSALRKYA+V+L+NG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGT+D +GV  R+Q RS YGAK+PK
  S:    20 MPTINQLVRQGRTDKTTKSKSPALNRGYNSLAKKPTITNSPQKRGVCTRVATMTPKKPNSALRKYARVRLSNGMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTMDCAGVNNRKQGRSRYGAKKPK 155
>gi|124524125|ref|ZP_01697841.1| ribosomal protein S12 [Bacillus coagulans 36D1] >gi|124495168|gb|EAY42917.1| ribosomal protein S12 [Bacillus coagulans 36D1] (139 aa)
Score = 452, Expect = 8.7e-44, Identities = 106/139 (76%), Positives = 114/139 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  RK K +KSKSPAL   YNS KK  T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R+Q RS YG K+PKEKK
  S:     1 MPTINQLVRKPRKSKIEKSKSPALNKGYNSFKKINTDLSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDNRKQGRSKYGTKKPKEKK 139
>gi|154684628|ref|YP_001419789.1| 30S ribosomal protein S12 [Bacillus amyloliquefaciens FZB42] >gi|166231845|sp|A7Z0N2|RS12_BACA2 30S ribosomal protein S12 >gi|154350479|gb|ABS72558.1| RpsL [Bacillus amyloliquefaciens FZB42] (138 aa)
Score = 452, Expect = 1.1e-43, Identities = 105/138 (76%), Positives = 110/138 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QLIR  R  K + SKSPAL   YNS KK+ T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R Q RS YG KRPK K
  S:     1 MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKRPKAK 138
>gi|56961927|ref|YP_173649.1| 30S ribosomal protein S12 [Bacillus clausii KSM-K16] >gi|60390773|sp|Q5WLR7|RS12_BACSK 30S ribosomal protein S12 >gi|56908161|dbj|BAD62688.1| 30S ribosomal protein S12 [Bacillus clausii KSM-K16] (139 aa)
Score = 451, Expect = 1.2e-43, Identities = 105/139 (75%), Positives = 112/139 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLIR  R DK KKS SPAL   YNS KK +T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTN  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YG K+PK+KK
  S:     1 MPTINQLIRKGRVDKVKKSDSPALNKGYNSFKKSQTDVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVQNRMQGRSKYGTKKPKDKK 139
>gi|110003982|emb|CAK98322.1| 30s ribosomal protein s12 [Spiroplasma citri] (140 aa)
Score = 451, Expect = 1.4e-43, Identities = 104/139 (74%), Positives = 114/139 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  RKDK  K+K+PAL    NSL+KK T   +P KRGVCTRV TMTPKKPNSALRKYA+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV KR+Q RS YG KRPK  K
  S:     1 MPTINQLVRKPRKDKVWKTKAPALNRGLNSLQKKPTNVKAPQKRGVCTRVATMTPKKPNSALRKYARVRLTNGMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVNKRQQGRSLYGTKRPKATK 139
>gi|58336626|ref|YP_193211.1| 30S ribosomal protein S12 [Lactobacillus acidophilus NCFM] >gi|75358068|sp|Q5FM94|RS12_LACAC 30S ribosomal protein S12 >gi|58253943|gb|AAV42180.1| 30s ribosomal protein S12 [Lactobacillus acidophilus NCFM] (135 aa)
Score = 449, Expect = 1.9e-43, Identities = 99/134 (73%), Positives = 111/134 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R  K  KSKSPAL Y+YNS+KK+  +NP+P  RGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R+Q RS YG K+
  S:     1 MPTINQLVRKGRHSKVTKSKSPALNYSYNSMKKESVFNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVEGRKQSRSKYGTKK 134
>gi|193216665|ref|YP_001999907.1| ribosomal protein S12 [Mycoplasma arthritidis 158L3-1] >gi|193001988|gb|ACF07203.1| ribosomal protein S12 [Mycoplasma arthritidis 158L3-1] (138 aa)
Score = 449, Expect = 2.3e-43, Identities = 99/137 (72%), Positives = 113/137 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QLI H R  K  KSK+PAL   +NSL+KK    PSP+KRGVCTRV TMTPKKPNSA+RKYA+V+L+NG EV AYIPGEGHNLQEHSVVLI GG+VKDLPGVRY IVRGT D +GV+KR+Q RS YG K+PKE
  S:     1 MPTISQLINHGRSAKTSKSKAPALGMMFNSLQKKENKIPSPFKRGVCTRVATMTPKKPNSAIRKYARVRLSNGQEVTAYIPGEGHNLQEHSVVLIRGGKVKDLPGVRYTIVRGTQDAAGVDKRKQGRSIYGTKKPKE 137
>gi|47459204|ref|YP_016066.1| 30S ribosomal protein S12 [Mycoplasma mobile 163K] >gi|52783358|sp|Q6KHS3|RS12_MYCMO 30S ribosomal protein S12 >gi|47458533|gb|AAT27855.1| 30S ribosomal protein s12 [Mycoplasma mobile 163K] (139 aa)
Score = 448, Expect = 3.2e-43, Identities = 99/138 (71%), Positives = 110/138 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+   RK K  K+ SPAL   YNSL KK+T  P+P+KRGVCTRV TMTPKKPNSALRKYA+VKL+NG+EV AYIPGEGHN+QEHSVVLI GGRVKDLPGVRY IVRGT D +GV  R Q RS YG K+PK K
  S:     1 MPTINQLVSQGRKKKVWKTSSPALSLVYNSLNKKQTEIPAPFKRGVCTRVATMTPKKPNSALRKYARVKLSNGFEVTAYIPGEGHNIQEHSVVLIRGGRVKDLPGVRYTIVRGTQDAAGVANRNQSRSRYGTKKPKPK 138
>gi|161506869|ref|YP_001576823.1| 30S ribosomal protein S12 [Lactobacillus helveticus DPC 4571] >gi|172048363|sp|A8YXK1|RS12_LACH4 30S ribosomal protein S12 >gi|160347858|gb|ABX26532.1| 30S ribosomal protein S12 [Lactobacillus helveticus DPC 4571] (135 aa)
Score = 447, Expect = 3.2e-43, Identities = 97/134 (72%), Positives = 111/134 (82%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R  K  KSKSPAL Y+YNS+KK+  +NP+P  RGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GV+ R+Q RS YG K+
  S:     1 MPTINQLVRKGRHSKVTKSKSPALNYSYNSMKKESVFNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRKQSRSKYGTKK 134
>gi|104773538|ref|YP_618518.1| 30S ribosomal protein S12 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513535|ref|YP_812441.1| 30S ribosomal protein S12 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275695|sp|Q04C19|RS12_LACDB 30S ribosomal protein S12 >gi|119366779|sp|Q1GBM2|RS12_LACDA 30S ribosomal protein S12 >gi|103422619|emb|CAI97227.1| 30S ribosomal protein S12 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092850|gb|ABJ58003.1| SSU ribosomal protein S12P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (135 aa)
Score = 447, Expect = 3.4e-43, Identities = 99/134 (73%), Positives = 113/134 (84%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R  K  KSKSPAL Y+YNS+KK++ +NP+P  RGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R+Q RS YGAK+
  S:     1 MPTINQLVRKGRHSKTTKSKSPALNYSYNSMKKEQVFNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLTEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRKQARSKYGAKK 134
>gi|52078604|ref|YP_077395.1| 30S ribosomal protein S12 [Bacillus licheniformis ATCC 14580] >gi|52783966|ref|YP_089795.1| 30S ribosomal protein S12 [Bacillus licheniformis ATCC 14580] >gi|62287412|sp|Q65PB2|RS12_BACLD 30S ribosomal protein S12 >gi|52001815|gb|AAU21757.1| ribosomal protein S12 (BS12) [Bacillus licheniformis ATCC 14580] >gi|52346468|gb|AAU39102.1| RpsL [Bacillus licheniformis DSM 13] (138 aa)
Score = 447, Expect = 3.8e-43, Identities = 104/138 (75%), Positives = 111/138 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R  K + SKSPAL   YNS KK+ T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R Q RS YG KRPK+K
  S:     1 MPTINQLVRKGRVSKVETSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRAQGRSKYGTKRPKKK 138
>gi|167757662|ref|ZP_02429789.1| hypothetical protein CLORAM_03212 [Clostridium ramosum DSM 1402] >gi|167702659|gb|EDS17238.1| hypothetical protein CLORAM_03212 [Clostridium ramosum DSM 1402] (137 aa)
Score = 447, Expect = 3.9e-43, Identities = 101/136 (74%), Positives = 110/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R DK  KSKSPAL   +NSL KK T   SP KRGVCTRV TMTPKKPNSALRKYA+V+L+NG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGT+D +GV  R+Q RS YGAK+PK
  S:     1 MPTINQLVRQGRNDKTTKSKSPALNRGFNSLAKKPTTTNSPQKRGVCTRVATMTPKKPNSALRKYARVRLSNGMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTMDCAGVNDRKQGRSRYGAKKPK 136
>gi|15612692|ref|NP_240995.1| 30S ribosomal protein S12 [Bacillus halodurans C-125] >gi|12643298|sp|Q9Z9L9|RS12_BACHD 30S ribosomal protein S12 >gi|10172741|dbj|BAB03848.1| 30S ribosomal protein S12 [Bacillus halodurans C-125] (139 aa)
Score = 446, Expect = 5.0e-43, Identities = 105/139 (75%), Positives = 112/139 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLIR  RK K KKS SPAL   YNS KK +T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YG KRPK+KK
  S:     1 MPTINQLIRKGRKAKVKKSDSPALNKGYNSFKKVQTDLSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVQDRMQGRSKYGTKRPKDKK 139
>gi|160894092|ref|ZP_02074870.1| hypothetical protein CLOL250_01646 [Clostridium sp. L2-50] >gi|156864125|gb|EDO57556.1| hypothetical protein CLOL250_01646 [Clostridium sp. L2-50] (159 aa)
Score = 444, Expect = 7.4e-43, Identities = 99/140 (70%), Positives = 112/140 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M T  QL+R  R+   KKS +PAL  ++NSLKKK T   SP KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHI+RGTLDT+GV KRRQ RS YGAKRPK+ K+
  S:    20 MPTFNQLVRKGRQTVEKKSTAPALQRSFNSLKKKPTETSSPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGVAKRRQARSKYGAKRPKDAKK 159
>gi|163764783|ref|ZP_02171837.1| Ribosomal protein S12-like protein [Bacillus selenitireducens MLS10] >gi|160354809|gb|EDP81468.1| Ribosomal protein S12-like protein [Bacillus selenitireducens MLS10] (150 aa)
Score = 443, Expect = 1.1e-42, Identities = 102/137 (74%), Positives = 109/137 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK K K   SPAL   YNS KK +T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTN  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LDT+GVE R Q RS YG KRPK+
  S:    14 MPTINQLVRKGRKSKVKSPDSPALNKGYNSFKKHQTDEDSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTAGVEGRMQSRSKYGTKRPKK 150
>gi|194466958|ref|ZP_03072945.1| ribosomal protein S12 [Lactobacillus reuteri 100-23] >gi|194453994|gb|EDX42891.1| ribosomal protein S12 [Lactobacillus reuteri 100-23] (139 aa)
Score = 443, Expect = 1.2e-42, Identities = 103/139 (74%), Positives = 113/139 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  RK    KSKSPAL Y YN+ KK+    PSP KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GVE R Q RS YGAK+PK+KK
  S:     1 MPTINQLVRKGRKSHKGKSKSPALGYVYNTFKKEEIKTPSPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVEGRMQSRSKYGAKKPKDKK 139
>gi|116495954|ref|YP_807688.1| 30S ribosomal protein S12 [Lactobacillus casei ATCC 334] >gi|191639435|ref|YP_001988601.1| 30S ribosomal protein S12 [Lactobacillus casei] >gi|122262646|sp|Q034X6|RS12_LACC3 30S ribosomal protein S12 >gi|116106104|gb|ABJ71246.1| SSU ribosomal protein S12P [Lactobacillus casei ATCC 334] >gi|190713737|emb|CAQ67743.1| 30S ribosomal protein S12 [Lactobacillus casei BL23] (138 aa)
Score = 443, Expect = 1.2e-42, Identities = 102/138 (73%), Positives = 111/138 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  RK    KS SPAL + YNS KK  T NP+P KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YGAKRPK+K
  S:     1 MPTINQLVRQGRKSISTKSDSPALNFGYNSKKKSLTNNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGAKRPKKK 138
>gi|184155995|ref|YP_001844335.1| 30S ribosomal protein S12 [Lactobacillus fermentum IFO 3956] >gi|183227339|dbj|BAG27855.1| 30S ribosomal protein S12 [Lactobacillus fermentum IFO 3956] (137 aa)
Score = 442, Expect = 1.5e-42, Identities = 101/137 (73%), Positives = 112/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK    KSKSPAL + YNS KK+   NPSP KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ R Q RS YGAK+PK+
  S:     1 MPTINQLVRKGRKSHKGKSKSPALGFVYNSFKKEEIKNPSPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVDGRMQSRSKYGAKKPKK 137
>gi|89100355|ref|ZP_01173220.1| 30S ribosomal protein S12 [Bacillus sp. NRRL B-14911] >gi|89084976|gb|EAR64112.1| 30S ribosomal protein S12 [Bacillus sp. NRRL B-14911] (140 aa)
Score = 442, Expect = 1.5e-42, Identities = 105/140 (75%), Positives = 112/140 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  RK K +KSKSPAL   YNS KK +T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R Q RS YG KRPK  K+
  S:     1 MPTINQLVRKPRKTKEEKSKSPALNKGYNSFKKAQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVNNRMQGRSKYGTKRPKAAKK 140
>gi|28377828|ref|NP_784720.1| 30S ribosomal protein S12 [Lactobacillus plantarum WCFS1] >gi|38258536|sp|Q88XZ0|RS12_LACPL 30S ribosomal protein S12 >gi|28270661|emb|CAD63567.1| ribosomal protein S12 [Lactobacillus plantarum WCFS1] (137 aa)
Score = 442, Expect = 1.5e-42, Identities = 100/137 (72%), Positives = 111/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR  RK K  KS +PAL + YNS KK  T NP+P KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYH++RG LDT+GVE RRQ RS YG K+PK+
  S:     1 MPTINQLIRKGRKSKVSKSNAPALNFGYNSYKKVATNNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDTAGVEDRRQSRSKYGTKKPKK 137
>gi|42518425|ref|NP_964355.1| 30S ribosomal protein S12 [Lactobacillus johnsonii NCC 533] >gi|116628959|ref|YP_814131.1| 30S ribosomal protein S12 [Lactobacillus gasseri ATCC 33323] >gi|122274043|sp|Q046C9|RS12_LACGA 30S ribosomal protein S12 >gi|52783375|sp|Q74L92|RS12_LACJO 30S ribosomal protein S12 >gi|41582710|gb|AAS08321.1| 30S ribosomal protein S12 [Lactobacillus johnsonii NCC 533] >gi|116094541|gb|ABJ59693.1| SSU ribosomal protein S12P [Lactobacillus gasseri ATCC 33323] (135 aa)
Score = 441, Expect = 1.7e-42, Identities = 98/134 (73%), Positives = 109/134 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R  K  KS SPAL Y YNS+KKK  YNP+P  RGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GV+ R+Q RS YGAK+
  S:     1 MPTINQLVRKGRHSKTTKSDSPALNYAYNSMKKKMNYNPAPQMRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRKQGRSKYGAKK 134
>gi|157690894|ref|YP_001485356.1| 30S ribosomal protein S12 [Bacillus pumilus SAFR-032] >gi|194017454|ref|ZP_03056065.1| ribosomal protein S12 [Bacillus pumilus ATCC 7061] >gi|166991587|sp|A8F979|RS12_BACP2 30S ribosomal protein S12 >gi|157679652|gb|ABV60796.1| ribosomal protein S12 [Bacillus pumilus SAFR-032] >gi|194010726|gb|EDW20297.1| ribosomal protein S12 [Bacillus pumilus ATCC 7061] (139 aa)
Score = 441, Expect = 1.8e-42, Identities = 102/139 (73%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLIR  R  K + SKSPAL   YNS KK+ T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YG KRPK+ K
  S:     1 MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVTSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKQSK 139
>gi|81429382|ref|YP_396383.1| 30S ribosomal protein S12 [Lactobacillus sakei subsp. sakei 23K] >gi|90111781|sp|Q38UQ7|RS12_LACSS 30S ribosomal protein S12 >gi|78611025|emb|CAI56078.1| 30S ribosomal protein S12 [Lactobacillus sakei subsp. sakei 23K] (137 aa)
Score = 440, Expect = 2.3e-42, Identities = 98/137 (71%), Positives = 112/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK +  KS +PAL + YNS+KKK T NP+P KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYH++RG LDT+GV+ R Q RS YG KRPK+
  S:     1 MPTINQLVRKGRKSRTSKSDAPALNFGYNSMKKKATDNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDTAGVDGRMQSRSKYGTKRPKK 137
>gi|172056135|ref|YP_001812595.1| ribosomal protein S12 [Exiguobacterium sibiricum 255-15] >gi|171988656|gb|ACB59578.1| ribosomal protein S12 [Exiguobacterium sibiricum 255-15] (140 aa)
Score = 440, Expect = 2.6e-42, Identities = 102/140 (72%), Positives = 109/140 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  R+ K  KS SPAL   YNS  K RT   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTN  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YG KRPK  K+
  S:     1 MPTINQLVRKGRQSKVVKSDSPALNKGYNSFIKARTDISSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNTMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKAAKK 140
>gi|148544701|ref|YP_001272071.1| 30S ribosomal protein S12 [Lactobacillus reuteri F275] >gi|184154053|ref|YP_001842394.1| 30S ribosomal protein S12 [Lactobacillus reuteri F275] >gi|166991591|sp|A5VLL0|RS12_LACRF 30S ribosomal protein S12 >gi|148531735|gb|ABQ83734.1| SSU ribosomal protein S12P [Lactobacillus reuteri F275] >gi|183225397|dbj|BAG25914.1| 30S ribosomal protein S12 [Lactobacillus reuteri F275] (139 aa)
Score = 439, Expect = 2.8e-42, Identities = 103/139 (74%), Positives = 112/139 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  RK    KSKSPAL Y YN+ KK+    PSP KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GVE R Q RS YGAK+PK KK
  S:     1 MPTINQLVRKGRKSHKGKSKSPALGYVYNTFKKEEIKTPSPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVEGRMQSRSKYGAKKPKNKK 139
>gi|169830043|ref|YP_001700201.1| 30S ribosomal protein S12 [Lysinibacillus sphaericus C3-41] >gi|168994531|gb|ACA42071.1| 30S ribosomal protein S12 [Lysinibacillus sphaericus C3-41] (139 aa)
Score = 439, Expect = 3.3e-42, Identities = 104/139 (74%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R+ K  KSKSPAL   YNS KK  T   SP KRGVCTRVGTMTP+KPNSALRKYA+V+LTN  EV AYIPGEGHNLQEHSVVLI GGRVKDL GVRYHIVRG LDT+GV  R Q RS YG KRPKEKK
  S:     1 MPTINQLVRKPRQSKITKSKSPALNKGYNSFKKSLTDVKSPQKRGVCTRVGTMTPRKPNSALRKYARVRLTNQIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLAGVRYHIVRGALDTAGVNGRLQSRSKYGTKRPKEKK 139
>gi|115249072|emb|CAJ66883.1| 30S ribosomal protein S12 [Clostridium difficile 630] (143 aa)
Score = 439, Expect = 3.5e-42, Identities = 103/140 (73%), Positives = 114/140 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  RK   KKS +PAL   YNSL KK T   +P KRGVCT V T+TP+KPNSALRK A+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+KRRQ RS YGAKRPKE K+
  S:     4 MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRGVCTSVKTVTPRKPNSALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGVDKRRQSRSKYGAKRPKEAKK 143
>gi|145956380|ref|ZP_01805376.1| hypothetical protein CdifQ_04000076 [Clostridium difficile QCD-32g58] >gi|168696864|ref|ZP_02729141.1| 30S ribosomal protein S12 [Clostridium difficile QCD-37x79] >gi|168715546|ref|ZP_02747823.1| 30S ribosomal protein S12 [Clostridium difficile QCD-63q42] >gi|168726734|ref|ZP_02759011.1| 30S ribosomal protein S12 [Clostridium difficile QCD-76w55] >gi|168730436|ref|ZP_02762713.1| 30S ribosomal protein S12 [Clostridium difficile QCD-97b34] >gi|196127771|ref|ZP_03119520.1| 30S ribosomal protein S12 [Clostridium difficile ATCC 43255] >gi|196160582|ref|ZP_03121143.1| 30S ribosomal protein S12 [Clostridium difficile CIP 107932] >gi|196165505|ref|ZP_03126036.1| 30S ribosomal protein S12 [Clostridium difficile QCD-23m63] (140 aa)
Score = 438, Expect = 4.0e-42, Identities = 104/140 (74%), Positives = 114/140 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  RK   KKS +PAL   YNSL KK T   +P KRGVCT V T+TPKKPNSALRK A+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+KRRQ RS YGAKRPKE K+
  S:     1 MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRGVCTSVKTVTPKKPNSALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGVDKRRQSRSKYGAKRPKEAKK 140
>gi|187605179|ref|ZP_02991380.1| ribosomal protein S12 [Exiguobacterium sp. AT1b] >gi|187482748|gb|EDU20751.1| ribosomal protein S12 [Exiguobacterium sp. AT1b] (140 aa)
Score = 438, Expect = 4.4e-42, Identities = 102/140 (72%), Positives = 109/140 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  RK K  KS SPAL   YNS  K +T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTN  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YG KRPK  K+
  S:     1 MPTINQLVRKGRKSKVVKSDSPALNKGYNSFIKSQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKAAKK 140
>gi|161723278|ref|NP_975160.2| 30S ribosomal protein S12 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|162316928|ref|YP_424142.2| 30S ribosomal protein S12 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|188159788|ref|ZP_02998890.1| 30S ribosomal protein S12 [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|46577704|sp|Q8VMU2|RS12_MYCMS 30S ribosomal protein S12 >gi|115305662|sp|Q2SSX1|RS12_MYCCT 30S ribosomal protein S12 (139 aa)
Score = 437, Expect = 4.9e-42, Identities = 102/139 (73%), Positives = 112/139 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL++ +RK K  K+K+PAL    N+L KK T   SP KRGVCTRV TMTPKKPNSALRKYA+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYH++RGTLDT GV KR Q RS YG KRPK KK
  S:     1 MPTINQLVKVNRKAKTWKTKAPALNRGINTLIKKVTKIASPQKRGVCTRVATMTPKKPNSALRKYARVRLTNGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGTLDTQGVAKRSQGRSLYGVKRPKVKK 139
>gi|90961182|ref|YP_535098.1| 30S ribosomal protein S12 [Lactobacillus salivarius UCC118] >gi|119366781|sp|Q1WVA2|RS12_LACS1 30S ribosomal protein S12 >gi|90820376|gb|ABD99015.1| SSU ribosomal protein S12P [Lactobacillus salivarius UCC118] (137 aa)
Score = 437, Expect = 5.9e-42, Identities = 102/137 (74%), Positives = 111/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR  RK K  KS SPAL + YNS KK +T N +P KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R Q RS YGAK+PK+
  S:     1 MPTINQLIRKGRKSKGSKSNSPALNFGYNSYKKVQTNNSAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVEGRMQSRSKYGAKKPKK 137
>gi|161723227|ref|YP_001086532.2| 30S ribosomal protein S12 [Clostridium difficile 630] >gi|119366762|sp|Q18CF2|RS12_CLOD6 30S ribosomal protein S12 (140 aa)
Score = 437, Expect = 5.9e-42, Identities = 103/140 (73%), Positives = 114/140 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  RK   KKS +PAL   YNSL KK T   +P KRGVCT V T+TP+KPNSALRK A+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+KRRQ RS YGAKRPKE K+
  S:     1 MPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKRGVCTSVKTVTPRKPNSALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGVDKRRQSRSKYGAKRPKEAKK 140
>gi|169190353|ref|ZP_02850325.1| ribosomal protein S12 [Paenibacillus sp. JDR-2] >gi|169002960|gb|EDS49835.1| ribosomal protein S12 [Paenibacillus sp. JDR-2] (139 aa)
Score = 436, Expect = 7.3e-42, Identities = 101/139 (72%), Positives = 111/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R+ K  KSKSPAL   +N+LK++ T   +P KRGVCTRVGTMTPKKPNSALRKYA+V+LTN  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R Q RS YG KRPK KK
  S:     1 MPTINQLVRKGRQAKVVKSKSPALQRGFNALKREATNISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNRVEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVNNRNQSRSKYGTKRPKVKK 139
>gi|164686522|ref|ZP_02210550.1| hypothetical protein CLOBAR_00089 [Clostridium bartlettii DSM 16795] >gi|164604391|gb|EDQ97856.1| hypothetical protein CLOBAR_00089 [Clostridium bartlettii DSM 16795] (140 aa)
Score = 435, Expect = 7.9e-42, Identities = 99/131 (75%), Positives = 107/131 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI QL+R  RKD  KKS +PAL  +YNSL KK T   SP KRGVCT V T+TPKKPNSALRK A+VKLTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+KR Q RS YG
  S:     1 MPTINQLVRKSRKDLLKKSTAPALQKSYNSLNKKTTDASSPQKRGVCTSVKTVTPKKPNSALRKVARVKLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGTLDTAGVDKRMQARSKYG 131
>gi|16801866|ref|NP_472134.1| 30S ribosomal protein S12 [Listeria innocua Clip11262] >gi|16804693|ref|NP_466178.1| 30S ribosomal protein S12 [Listeria monocytogenes EGD-e] >gi|46908834|ref|YP_015223.1| 30S ribosomal protein S12 [Listeria monocytogenes str. 4b F2365] >gi|47092277|ref|ZP_00230068.1| ribosomal protein S12 [Listeria monocytogenes str. 4b H7858] >gi|47095459|ref|ZP_00233068.1| ribosomal protein S12 [Listeria monocytogenes str. 1/2a F6854] >gi|116874021|ref|YP_850802.1| 30S ribosomal protein S12 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153168819|ref|ZP_01928580.1| ribosomal protein S12 [Listeria monocytogenes FSL N1-017] >gi|153175963|ref|ZP_01931222.1| ribosomal protein S12 [Listeria monocytogenes FSL N3-165] >gi|153180820|ref|ZP_01933816.1| ribosomal protein S12 [Listeria monocytogenes F6900] >gi|153185585|ref|ZP_01936135.1| ribosomal protein S12 [Listeria monocytogenes J0161] >gi|153192414|ref|ZP_01939406.1| ribosomal protein S12 [Listeria monocytogenes J2818] >gi|153204304|ref|ZP_01945101.1| ribosomal protein S12 [Listeria monocytogenes HPB2262] >gi|167015748|ref|ZP_02278281.1| 30S ribosomal protein S12 [Listeria monocytogenes FSL J1-194] >gi|167058726|ref|ZP_02280983.1| 30S ribosomal protein S12 [Listeria monocytogenes FSL F2-515] >gi|167213271|ref|ZP_02283578.1| 30S ribosomal protein S12 [Listeria monocytogenes LO28] >gi|167215317|ref|ZP_02285624.1| 30S ribosomal protein S12 [Listeria monocytogenes FSL R2-503] >gi|167455119|ref|ZP_02321342.1| 30S ribosomal protein S12 [Listeria monocytogenes FSL J2-064] >gi|168266867|ref|ZP_02688832.1| 30S ribosomal protein S12 [Listeria monocytogenes FSL J2-071] >gi|123461458|sp|A0ALZ1|RS12_LISW6 30S ribosomal protein S12 >gi|52783368|sp|Q71WB6|RS12_LISMF 30S ribosomal protein S12 >gi|54039343|sp|P66373|RS12_LISIN 30S ribosomal protein S12 >gi|54042116|sp|P66372|RS12_LISMO 30S ribosomal protein S12 >gi|16412156|emb|CAD00869.1| ribosomal protein S12 [Listeria monocytogenes] >gi|16415341|emb|CAC98031.1| ribosomal protein S12 [Listeria innocua] >gi|46882107|gb|AAT05400.1| ribosomal protein S12 [Listeria monocytogenes str. 4b F2365] >gi|47016069|gb|EAL06993.1| ribosomal protein S12 [Listeria monocytogenes str. 1/2a F6854] >gi|47019256|gb|EAL09998.1| ribosomal protein S12 [Listeria monocytogenes str. 4b H7858] >gi|116742899|emb|CAK22023.1| rpsL [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126941721|gb|EBA19600.1| ribosomal protein S12 [Listeria monocytogenes J0161] >gi|127763918|gb|EBA24736.1| ribosomal protein S12 [Listeria monocytogenes J2818] >gi|133726053|gb|EBA27751.1| ribosomal protein S12 [Listeria monocytogenes FSL N1-017] >gi|133728676|gb|EBA30374.1| ribosomal protein S12 [Listeria monocytogenes FSL N3-165] >gi|133731767|gb|EBA33465.1| ribosomal protein S12 [Listeria monocytogenes F6900] >gi|133734084|gb|EBA35782.1| ribosomal protein S12 [Listeria monocytogenes HPB2262] (137 aa)
Score = 435, Expect = 8.5e-42, Identities = 100/137 (72%), Positives = 110/137 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+ K KKS SPAL    NS K++ T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+NG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R Q RS YG K+PK+
  S:     1 MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK 137
>gi|126654241|ref|ZP_01726035.1| 30S ribosomal protein S12 [Bacillus sp. B14905] >gi|126589299|gb|EAZ83456.1| 30S ribosomal protein S12 [Bacillus sp. B14905] (139 aa)
Score = 435, Expect = 8.9e-42, Identities = 104/139 (74%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R+ K  KSKSPAL   YNS KK  T   SP KRGVCTRVGTMTP+KPNSALRKYA+V+LTN  EV AYIPGEGHNLQEHSVVLI GGRVKDL GVRYHIVRG LDT+GV  R Q RS YG KRPKEKK
  S:     1 MPTINQLVRKPRQSKSTKSKSPALNKGYNSFKKSLTDVKSPQKRGVCTRVGTMTPRKPNSALRKYARVRLTNQIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLAGVRYHIVRGALDTAGVNGRLQSRSKYGTKRPKEKK 139
>gi|29374844|ref|NP_813997.1| 30S ribosomal protein S12 [Enterococcus faecalis V583] >gi|52783402|sp|Q839H1|RS12_ENTFA 30S ribosomal protein S12 >gi|29342302|gb|AAO80068.1| ribosomal protein S12 [Enterococcus faecalis V583] (137 aa)
Score = 435, Expect = 9.0e-42, Identities = 100/136 (73%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KS SPAL   YNS KK +T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG KRPK
  S:     1 MPTINQLVRKPRKSKVEKSDSPALNKGYNSFKKTQTNVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQSRSKYGTKRPK 136
>gi|160946127|ref|ZP_02093338.1| hypothetical protein PEPMIC_00075 [Peptostreptococcus micros ATCC 33270] >gi|158447650|gb|EDP24645.1| hypothetical protein PEPMIC_00075 [Peptostreptococcus micros ATCC 33270] (136 aa)
Score = 435, Expect = 9.3e-42, Identities = 96/136 (70%), Positives = 111/136 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI+  R+    KSK+PAL + +N+LKK+ T + SP KRGVCT V T+TP+KPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV  R+Q RS YGAKRPK
  S:     1 MPTINQLIKQGRQKAVTKSKAPALSFNFNTLKKRSTASESPQKRGVCTAVRTVTPRKPNSALRKVARVRLTNGMEVAAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVANRKQGRSKYGAKRPK 136
>gi|15923535|ref|NP_371069.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926223|ref|NP_373756.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus N315] >gi|21282229|ref|NP_645317.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus MW2] >gi|49482775|ref|YP_039999.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485410|ref|YP_042631.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus MSSA476] >gi|82750253|ref|YP_415994.1| 30S ribosomal protein S12 [Staphylococcus aureus RF122] >gi|87162023|ref|YP_493233.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus USA300] >gi|88194307|ref|YP_499099.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267005|ref|YP_001245948.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus JH9] >gi|150393052|ref|YP_001315727.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus JH1] >gi|151220719|ref|YP_001331541.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978874|ref|YP_001441133.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus Mu3] >gi|161508785|ref|YP_001574444.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728927|ref|ZP_02761204.1| ribosomal protein S12 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166231890|sp|A7WYX1|RS12_STAA1 30S ribosomal protein S12 >gi|172048779|sp|A6QEJ7|RS12_STAAE 30S ribosomal protein S12 >gi|189040483|sp|A6TZ22|RS12_STAA2 30S ribosomal protein S12 >gi|189040484|sp|A5IQ99|RS12_STAA9 30S ribosomal protein S12 >gi|189040485|sp|A8YZP3|RS12_STAAT 30S ribosomal protein S12 >gi|52783355|sp|Q6GBU2|RS12_STAAS 30S ribosomal protein S12 >gi|52783356|sp|Q6GJC3|RS12_STAAR 30S ribosomal protein S12 >gi|60393883|sp|P0A0G7|RS12_STAAM 30S ribosomal protein S12 >gi|60393884|sp|P0A0G8|RS12_STAAN 30S ribosomal protein S12 >gi|60393885|sp|P0A0G9|RS12_STAAW 30S ribosomal protein S12 >gi|60393886|sp|P0A0H0|RS12_STAA8 30S ribosomal protein S12 >gi|110825784|sp|Q2FJ95|RS12_STAA3 30S ribosomal protein S12 >gi|118597396|sp|Q2YSB6|RS12_STAAB 30S ribosomal protein S12 >gi|706921|gb|AAC46353.1| ribosomal protein S12 [Staphylococcus aureus] >gi|13700436|dbj|BAB41734.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus N315] >gi|14246313|dbj|BAB56707.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus Mu50] >gi|21203665|dbj|BAB94365.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus MW2] >gi|49240904|emb|CAG39571.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243853|emb|CAG42278.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus MSSA476] >gi|82655784|emb|CAI80184.1| 30S ribosomal protein S12 [Staphylococcus aureus RF122] >gi|87127997|gb|ABD22511.1| ribosomal protein S12 [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201865|gb|ABD29675.1| ribosomal protein S12 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740074|gb|ABQ48372.1| SSU ribosomal protein S12P [Staphylococcus aureus subsp. aureus JH9] >gi|149945504|gb|ABR51440.1| ribosomal protein S12 [Staphylococcus aureus subsp. aureus JH1] >gi|150373519|dbj|BAF66779.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721009|dbj|BAF77426.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus Mu3] >gi|160367594|gb|ABX28565.1| ribosomal protein S12 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (137 aa)
Score = 435, Expect = 9.5e-42, Identities = 100/136 (73%), Positives = 110/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+ K KKS SPAL   +NS KKK T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+N  E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDTSGV+ RRQ RS YG K+PK
  S:     1 MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPK 136
>gi|50365440|ref|YP_053865.1| 30S ribosomal protein S12 [Mesoplasma florum L1] >gi|52783350|sp|Q6F0J2|RS12_MESFL 30S ribosomal protein S12 >gi|50363996|gb|AAT75981.1| 30S ribosomal protein S12 [Mesoplasma florum L1] (137 aa)
Score = 435, Expect = 1.0e-41, Identities = 101/137 (73%), Positives = 112/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL++ +RK K  K+K+PAL    NSLKKK T   +P KRGVCTRV TMTPKKPNSALRKYA+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT  V  R+Q RS YGAKRPK+
  S:     1 MPTINQLVKTNRKAKTWKTKAPALNRGVNSLKKKVTKVSAPQKRGVCTRVATMTPKKPNSALRKYARVRLTNGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTQAVNNRKQSRSLYGAKRPKK 137
>gi|54020330|ref|YP_115599.1| 30S ribosomal protein S12 [Mycoplasma hyopneumoniae 232] >gi|71893432|ref|YP_278878.1| 30S ribosomal protein S12 [Mycoplasma hyopneumoniae J] >gi|72080419|ref|YP_287477.1| 30S ribosomal protein S12 [Mycoplasma hyopneumoniae 7448] >gi|60390781|sp|Q601W6|RS12_MYCH2 30S ribosomal protein S12 >gi|90111783|sp|Q4A8T5|RS12_MYCH7 30S ribosomal protein S12 >gi|90111784|sp|Q4AAQ4|RS12_MYCHJ 30S ribosomal protein S12 >gi|53987503|gb|AAV27704.1| 30s ribosomal protein S12 [Mycoplasma hyopneumoniae 232] >gi|71851559|gb|AAZ44167.1| 30S ribosomal protein S12 [Mycoplasma hyopneumoniae J] >gi|71913543|gb|AAZ53454.1| 30S ribosomal protein S12 [Mycoplasma hyopneumoniae 7448] (139 aa)
Score = 434, Expect = 1.1e-41, Identities = 99/139 (71%), Positives = 111/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI+QL +  R  K  KSK PAL   YNSL KK     +P+KRGVCTRV TMTPKKPNSALRK+A+VKL+NG EV AYIPGEGHNLQEHS+VLI GG+VKDLPG+RYHIVRGT DT+GV KR Q RS YGAKRPK+ K
  S:     1 MPTISQLAKGCRVKKTWKSKVPALNMLYNSLHKKELKLSAPFKRGVCTRVATMTPKKPNSALRKFARVKLSNGIEVNAYIPGEGHNLQEHSIVLIRGGKVKDLPGIRYHIVRGTQDTTGVAKRSQGRSKYGAKRPKKSK 139
>gi|42492205|emb|CAE76802.1| 30S ribosomal protein S12 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|83283682|gb|ABC01614.1| 30S ribosomal protein S12 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (145 aa)
Score = 434, Expect = 1.2e-41, Identities = 102/139 (73%), Positives = 112/139 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL++ +RK K  K+K+PAL    N+L KK T   SP KRGVCTRV TMTPKKPNSALRKYA+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYH++RGTLDT GV KR Q RS YG KRPK KK
  S:     7 MPTINQLVKVNRKAKTWKTKAPALNRGINTLIKKVTKIASPQKRGVCTRVATMTPKKPNSALRKYARVRLTNGMEVNAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGTLDTQGVAKRSQGRSLYGVKRPKVKK 145
>gi|116491309|ref|YP_810853.1| 30S ribosomal protein S12 [Oenococcus oeni PSU-1] >gi|118586591|ref|ZP_01544032.1| 30S ribosomal protein S12 [Oenococcus oeni ATCC BAA-1163] >gi|122276509|sp|Q04ED4|RS12_OENOB 30S ribosomal protein S12 >gi|116092034|gb|ABJ57188.1| SSU ribosomal protein S12P [Oenococcus oeni PSU-1] >gi|118432970|gb|EAV39695.1| 30S ribosomal protein S12 [Oenococcus oeni ATCC BAA-1163] (137 aa)
Score = 434, Expect = 1.3e-41, Identities = 99/137 (72%), Positives = 112/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK +  KSK PAL + YNS+ +K+T N +P KRGV TRVGTMTPKKPNSALRKYA+V+L+N YEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GVE R   RS YGAKRPK+
  S:     1 MPTINQLVRKPRKPRTFKSKVPALNFGYNSMSRKQTNNTAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNQYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVEGRMNGRSKYGAKRPKK 137
>gi|170017952|ref|YP_001728871.1| ribosomal protein S12 [Leuconostoc citreum KM20] >gi|169804809|gb|ACA83427.1| Ribosomal protein S12 [Leuconostoc citreum KM20] (137 aa)
Score = 434, Expect = 1.3e-41, Identities = 99/137 (72%), Positives = 110/137 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK    KSKSPAL + YNS+KKK T N +P KRGV TRVGTMTPKKPNSALRKYA+V+L+N YEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GV+ R   RS YG K PK+
  S:     1 MPTINQLVRKPRKSNATKSKSPALNFGYNSMKKKATNNVAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRMTSRSKYGTKAPKK 137
>gi|153197685|ref|ZP_01941912.1| ribosomal protein S12 [Listeria monocytogenes 10403S] >gi|127632858|gb|EBA22292.1| ribosomal protein S12 [Listeria monocytogenes 10403S] (137 aa)
Score = 433, Expect = 1.5e-41, Identities = 99/137 (72%), Positives = 110/137 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+ K KKS SPAL    NS K++ T   SP KRGVCTRVGTMTP+KPNSALRKYA+V+L+NG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R Q RS YG K+PK+
  S:     1 MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGTKKPKK 137
>gi|138893780|ref|YP_001124233.1| 30S ribosomal protein S12 [Geobacillus thermodenitrificans NG80-2] >gi|196251029|ref|ZP_03149711.1| ribosomal protein S12 [Geobacillus sp. G11MC16] >gi|158513826|sp|A4IJI4|RS12_GEOTN 30S ribosomal protein S12 >gi|134265293|gb|ABO65488.1| Ribosomal protein S12 [Geobacillus thermodenitrificans NG80-2] >gi|196209501|gb|EDY04278.1| ribosomal protein S12 [Geobacillus sp. G11MC16] (140 aa)
Score = 433, Expect = 1.5e-41, Identities = 99/131 (75%), Positives = 106/131 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI QL+R  R+ K  KSKSPAL   YNS KK++T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R Q RS YG
  S:     1 MPTINQLVRKGRQKKVFKSKSPALNKGYNSFKKEQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVANRMQGRSKYG 131
>gi|192813599|ref|ZP_03042259.1| ribosomal protein S12 [Geobacillus sp. Y412MC10] >gi|192797574|gb|EDV74094.1| ribosomal protein S12 [Geobacillus sp. Y412MC10] (139 aa)
Score = 432, Expect = 1.8e-41, Identities = 99/138 (71%), Positives = 110/138 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R+ K  KSKSPAL   +N+LK++ T   +P KRGVCTRVGTMTPKKPNSALRKYA+V+LTN  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R Q RS YG KRPK K
  S:     1 MPTINQLVRKGRQAKVYKSKSPALQKGFNALKREETDLSAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNRIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGVNNRMQARSKYGTKRPKAK 138
>gi|57651421|ref|YP_185477.1| 30S ribosomal protein S12 [Staphylococcus aureus subsp. aureus COL] >gi|62287352|sp|Q5HID0|RS12_STAAC 30S ribosomal protein S12 >gi|57285607|gb|AAW37701.1| ribosomal protein S12 [Staphylococcus aureus subsp. aureus COL] (137 aa)
Score = 431, Expect = 2.3e-41, Identities = 98/136 (72%), Positives = 110/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+ K KKS SPAL   +NS KKK T   SP KRGVCTRVGTMTP+KPNSALRKYA+V+L+N  E+ AYIPG GHNLQEHSVVL+ GGRV+DLPGVRYHIVRG LDTSGV+ RRQ RS YG K+PK
  S:     1 MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVRDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPK 136
>gi|57866137|ref|YP_187782.1| 30S ribosomal protein S12 [Staphylococcus epidermidis RP62A] >gi|62287354|sp|Q5HRK7|RS12_STAEQ 30S ribosomal protein S12 >gi|57636795|gb|AAW53583.1| ribosomal protein S12 [Staphylococcus epidermidis RP62A] (137 aa)
Score = 431, Expect = 2.9e-41, Identities = 100/136 (73%), Positives = 110/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K K+S SPAL   +NS KK+ T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDTSGV+ RRQ RS YG K+PK
  S:     1 MPTINQLVRKPRKSKTKQSDSPALNRGFNSKKKQFTNLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEVNAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPK 136
>gi|23097569|ref|NP_691035.1| 30S ribosomal protein S12 [Oceanobacillus iheyensis HTE831] >gi|27151672|sp|P59165|RS12_OCEIH 30S ribosomal protein S12 >gi|22775792|dbj|BAC12070.1| 30S ribosomal protein S12 [Oceanobacillus iheyensis HTE831] (137 aa)
Score = 430, Expect = 3.0e-41, Identities = 100/137 (72%), Positives = 110/137 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R  K KKS SPAL   YNS KK+ T   +P KRGVCTRVGT+TPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R+Q RS YG KRPK+
  S:     1 MPTINQLVRKGRVSKTKKSDSPALNKGYNSFKKRMTDQNAPQKRGVCTRVGTLTPKKPNSALRKYARVRLSNNMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVEGRKQGRSKYGTKRPKK 137
>gi|116493167|ref|YP_804902.1| 30S ribosomal protein S12 [Pediococcus pentosaceus ATCC 25745] >gi|122265369|sp|Q03EB2|RS12_PEDPA 30S ribosomal protein S12 >gi|116103317|gb|ABJ68460.1| SSU ribosomal protein S12P [Pediococcus pentosaceus ATCC 25745] (137 aa)
Score = 430, Expect = 3.5e-41, Identities = 96/137 (70%), Positives = 112/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+ +  KSK+PAL Y YNS+KK +  NP+P KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYH++RG LDT+GV  R+Q RS YG K+PK+
  S:     1 MPTINQLVRKGRRSQSSKSKAPALNYGYNSMKKSQVNNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVIRGALDTAGVTDRKQSRSKYGTKKPKK 137
>gi|73663519|ref|YP_302300.1| 30S ribosomal protein S12 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90111805|sp|Q49V55|RS12_STAS1 30S ribosomal protein S12 >gi|72496034|dbj|BAE19355.1| 30S ribosomal protein S12 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (137 aa)
Score = 430, Expect = 3.8e-41, Identities = 100/137 (72%), Positives = 111/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+ K KKS SPAL   +NS KKK T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+N  E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDTSGV+ RRQ RS YG K+PK+
  S:     1 MPTINQLVRKPRQSKSKKSDSPALNRNFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKK 137
>gi|154484487|ref|ZP_02026935.1| hypothetical protein EUBVEN_02201 [Eubacterium ventriosum ATCC 27560] >gi|149734335|gb|EDM50252.1| hypothetical protein EUBVEN_02201 [Eubacterium ventriosum ATCC 27560] (139 aa)
Score = 430, Expect = 3.9e-41, Identities = 97/139 (69%), Positives = 108/139 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL+R  R+   KKS +PAL+ +YNSL KK     SP KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHI+RGTLDT+GV  RRQ RS YGAKRPK  K
  S:     1 MPTFNQLVRKGRQSAVKKSTAPALLKSYNSLNKKMNDTASPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGVANRRQARSKYGAKRPKAGK 139
>gi|171779184|ref|ZP_02920155.1| hypothetical protein STRINF_01032 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282240|gb|EDT47667.1| hypothetical protein STRINF_01032 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (137 aa)
Score = 429, Expect = 4.2e-41, Identities = 101/136 (74%), Positives = 110/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KSKSPAL   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKRPK 136
>gi|16077178|ref|NP_387991.1| 30S ribosomal protein S12 [Bacillus subtilis subsp. subtilis str. 168] >gi|2507326|sp|P21472|RS12_BACSU 30S ribosomal protein S12 (BS12) >gi|1644221|dbj|BAA11001.1| ribosomal protein L12 [Bacillus subtilis] >gi|2632377|emb|CAB11886.1| ribosomal protein S12 (BS12) [Bacillus subtilis subsp. subtilis str. 168] (138 aa)
Score = 429, Expect = 4.4e-41, Identities = 101/138 (73%), Positives = 108/138 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QLIR  R  K + SKSPAL   YNS KK+ T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVK+LP VRYHIVRG LDT+GVE R Q R  YG K+PK K
  S:     1 MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKNLPRVRYHIVRGALDTAGVENRAQGRPKYGTKKPKAK 138
>gi|56418636|ref|YP_145954.1| 30S ribosomal protein S12 [Geobacillus kaustophilus HTA426] >gi|61215783|sp|Q5L402|RS12_GEOKA 30S ribosomal protein S12 >gi|56378478|dbj|BAD74386.1| 30S ribosomal protein S12 [Geobacillus kaustophilus HTA426] (140 aa)
Score = 428, Expect = 5.4e-41, Identities = 97/131 (74%), Positives = 105/131 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI QL+R  R+ K  KSKSPAL   YNS KK++T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LD +GV  R Q RS YG
  S:     1 MPTINQLVRKGREKKVVKSKSPALNKGYNSFKKEQTNVSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDAAGVANRMQGRSKYG 131
>gi|167218443|ref|ZP_02288079.1| 30S ribosomal protein S12 [Listeria monocytogenes FSL J1-175] >gi|167344748|ref|ZP_02290589.1| 30S ribosomal protein S12 [Listeria monocytogenes FSL J1-208] (135 aa)
Score = 428, Expect = 5.6e-41, Identities = 97/134 (72%), Positives = 107/134 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R+ K KKS SPAL    NS K++ T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+L+NG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GVE R Q RS YG ++
  S:     1 MPTINQLVRKPRQSKIKKSTSPALNKGLNSFKRELTDVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVENRGQSRSKYGNEK 134
>gi|150392165|ref|YP_001322214.1| 30S ribosomal protein S12 [Alkaliphilus metalliredigens QYMF] >gi|166991584|sp|A6TWI7|RS12_ALKMQ 30S ribosomal protein S12 >gi|149952027|gb|ABR50555.1| ribosomal protein S12 [Alkaliphilus metalliredigens QYMF] (139 aa)
Score = 427, Expect = 6.8e-41, Identities = 99/139 (71%), Positives = 111/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  RK   +KS +PAL   +NSLK+K T   +P KRGVCT V T+TPKKPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVLI GGR+KDLPGVRYHIVRGTLDT+GV  R Q RS YGAKRPK+KK
  S:     1 MPTINQLVRKGRKAVQEKSTAPALQKGFNSLKRKSTDLSAPQKRGVCTSVKTITPKKPNSALRKVARVRLTNGIEVSAYIPGIGHNLQEHSVVLIRGGRIKDLPGVRYHIVRGTLDTAGVANRMQGRSKYGAKRPKDKK 139
>gi|55821763|ref|YP_140205.1| 30S ribosomal protein S12 [Streptococcus thermophilus LMG 18311] >gi|55823682|ref|YP_142123.1| 30S ribosomal protein S12 [Streptococcus thermophilus CNRZ1066] >gi|116628480|ref|YP_821099.1| 30S ribosomal protein S12 [Streptococcus thermophilus LMD-9] >gi|122266925|sp|Q03IR9|RS12_STRTD 30S ribosomal protein S12 >gi|62287369|sp|Q5LY19|RS12_STRT1 30S ribosomal protein S12 >gi|62287371|sp|Q5M2M4|RS12_STRT2 30S ribosomal protein S12 >gi|55737748|gb|AAV61390.1| 30S ribosomal protein S12 [Streptococcus thermophilus LMG 18311] >gi|55739667|gb|AAV63308.1| 30S ribosomal protein S12 [Streptococcus thermophilus CNRZ1066] >gi|116101757|gb|ABJ66903.1| SSU ribosomal protein S12P [Streptococcus thermophilus LMD-9] (137 aa)
Score = 427, Expect = 7.0e-41, Identities = 100/136 (73%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+ K  KSKSPAL   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRQSKVVKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKRPK 136
>gi|160937576|ref|ZP_02084937.1| hypothetical protein CLOBOL_02467 [Clostridium bolteae ATCC BAA-613] >gi|158439645|gb|EDP17395.1| hypothetical protein CLOBOL_02467 [Clostridium bolteae ATCC BAA-613] (139 aa)
Score = 427, Expect = 8.6e-41, Identities = 99/139 (71%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL+R  R+   KKS +PAL   YNSL+KK T   +P KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRV+DLPG RYHIVRGTLDT+GV  RRQ RS YGAKRPKEKK
  S:     1 MPTFNQLVRKGRQTSVKKSTAPALQRGYNSLQKKATEVSAPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVRDLPGTRYHIVRGTLDTAGVANRRQARSKYGAKRPKEKK 139
>gi|27467227|ref|NP_763864.1| 30S ribosomal protein S12 [Staphylococcus epidermidis ATCC 12228] >gi|38258578|sp|Q8CTS8|RS12_STAES 30S ribosomal protein S12 >gi|27314770|gb|AAO03906.1|AE016745_5 30S ribosomal protein S12 [Staphylococcus epidermidis ATCC 12228] (137 aa)
Score = 426, Expect = 8.8e-41, Identities = 98/136 (72%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K K+S SP L   +NS KK+ T   SP KRGVCTRVGTMTP+KPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDTSGV+ RRQ RS YG K+PK
  S:     1 MPTINQLVRKPRKSKTKQSDSPVLNRGFNSKKKQFTNLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEVNAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPK 136
>gi|15674450|ref|NP_268624.1| 30S ribosomal protein S12 [Streptococcus pyogenes M1 GAS] >gi|19745403|ref|NP_606539.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS8232] >gi|21909734|ref|NP_664002.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS315] >gi|28895115|ref|NP_801465.1| 30S ribosomal protein S12 [Streptococcus pyogenes SSI-1] >gi|50913608|ref|YP_059580.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS10394] >gi|71902890|ref|YP_279693.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS6180] >gi|71910044|ref|YP_281594.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS5005] >gi|94987863|ref|YP_595964.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS9429] >gi|94989739|ref|YP_597839.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS10270] >gi|94993621|ref|YP_601719.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS10750] >gi|139473088|ref|YP_001127803.1| 30S ribosomal protein S12 [Streptococcus pyogenes str. Manfredo] >gi|158512772|sp|A2RCI0|RS12_STRPG 30S ribosomal protein S12 >gi|54039345|sp|P66377|RS12_STRP3 30S ribosomal protein S12 >gi|54039346|sp|P66378|RS12_STRP8 30S ribosomal protein S12 >gi|54042118|sp|P66376|RS12_STRP1 30S ribosomal protein S12 >gi|60390778|sp|Q5XDW6|RS12_STRP6 30S ribosomal protein S12 >gi|90111825|sp|Q48VB8|RS12_STRPM 30S ribosomal protein S12 >gi|119366812|sp|Q1JNH9|RS12_STRPC 30S ribosomal protein S12 >gi|119366813|sp|Q1JIM8|RS12_STRPD 30S ribosomal protein S12 >gi|119366814|sp|Q1J8I6|RS12_STRPF 30S ribosomal protein S12 >gi|13621546|gb|AAK33345.1| 30S ribosomal protein S12 [Streptococcus pyogenes M1 GAS] >gi|19747512|gb|AAL97038.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS8232] >gi|21903918|gb|AAM78805.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS315] >gi|28810360|dbj|BAC63298.1| 30S ribosomal protein S12 [Streptococcus pyogenes SSI-1] >gi|50902682|gb|AAT86397.1| SSU ribosomal protein S12P [Streptococcus pyogenes MGAS10394] >gi|71801985|gb|AAX71338.1| SSU ribosomal protein S12P [Streptococcus pyogenes MGAS6180] >gi|71852826|gb|AAZ50849.1| SSU ribosomal protein S12P [Streptococcus pyogenes MGAS5005] >gi|94541371|gb|ABF31420.1| SSU ribosomal protein S12P [Streptococcus pyogenes MGAS9429] >gi|94543247|gb|ABF33295.1| SSU ribosomal protein S12P [Streptococcus pyogenes MGAS10270] >gi|94547129|gb|ABF37175.1| SSU ribosomal protein S12P [Streptococcus pyogenes MGAS10750] >gi|134271334|emb|CAM29552.1| 30S ribosomal protein S12 [Streptococcus pyogenes str. Manfredo] (137 aa)
Score = 426, Expect = 9.7e-41, Identities = 99/136 (72%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KS SPAL   YNS KK +T   +P KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPK 136
>gi|70727461|ref|YP_254377.1| 30S ribosomal protein S12 [Staphylococcus haemolyticus JCSC1435] >gi|90111804|sp|Q4L3K6|RS12_STAHJ 30S ribosomal protein S12 >gi|68448187|dbj|BAE05771.1| 30S ribosomal protein S12 [Staphylococcus haemolyticus JCSC1435] (137 aa)
Score = 426, Expect = 9.8e-41, Identities = 97/136 (71%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+ K KKS SP L   +NS KK+ T   SP KRGVCTRVGTMTP+KPNSALRKYA+V+L+N  E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDTSGV+ RRQ RS YG K+PK
  S:     1 MPTINQLVRKPRQSKSKKSDSPVLNRGFNSKKKQFTNLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPK 136
>gi|160914566|ref|ZP_02076781.1| hypothetical protein EUBDOL_00572 [Eubacterium dolichum DSM 3991] >gi|158433724|gb|EDP12013.1| hypothetical protein EUBDOL_00572 [Eubacterium dolichum DSM 3991] (140 aa)
Score = 426, Expect = 1.1e-40, Identities = 94/131 (71%), Positives = 104/131 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI QLIR  R+     SKSPAL   YNS+KK+ T   +P KRGVCTRVGTMTPKKPNSALRKYA+V+L+NG EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLD +GV  R Q RS YG
  S:     1 MPTINQLIRKGREQSENVSKSPALNRGYNSIKKRPTNLSAPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNGMEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDCAGVANRNQSRSLYG 131
>gi|195977413|ref|YP_002122657.1| 30S ribosomal protein S12 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974118|gb|ACG61644.1| 30S ribosomal protein S12 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (137 aa)
Score = 425, Expect = 1.1e-40, Identities = 99/136 (72%), Positives = 108/136 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KS SPAL   YNS KK  T   +P KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVHTKLAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPK 136
>gi|146295989|ref|YP_001179760.1| 30S ribosomal protein S12 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409565|gb|ABP66569.1| SSU ribosomal protein S12P [Caldicellulosiruptor saccharolyticus DSM 8903] (145 aa)
Score = 425, Expect = 1.2e-40, Identities = 97/138 (70%), Positives = 110/138 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R+ K +KSK+PAL   +NSLKKK      P +RGVCT V T+TPKKPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD +GV  RRQ RS YGAKRPK++
  S:     1 MPTINQLVRFGREKKVEKSKAPALQKGFNSLKKKYYDISCPQRRGVCTVVKTVTPKKPNSALRKVARVRLTNGVEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDCAGVANRRQGRSKYGAKRPKQQ 138
>gi|169824187|ref|YP_001691798.1| 30S ribosomal protein S12 [Finegoldia magna ATCC 29328] >gi|167830992|dbj|BAG07908.1| 30S ribosomal protein S12 [Finegoldia magna ATCC 29328] (137 aa)
Score = 424, Expect = 1.6e-40, Identities = 98/137 (71%), Positives = 108/137 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK K  KS SPAL   +NS+KK  T   SP KRGVCT V TMTPKKPNSALRK A+V+LTNG EVL+YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+ V+ R Q RS YGAK+PK+
  S:     1 MPTINQLVRQGRKSKTYKSDSPALSRNFNSIKKSYTEANSPQKRGVCTSVRTMTPKKPNSALRKVARVRLTNGMEVLSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAAVQNRMQGRSKYGAKKPKK 137
>gi|153852623|ref|ZP_01994060.1| hypothetical protein DORLON_00033 [Dorea longicatena DSM 13814] >gi|149754265|gb|EDM64196.1| hypothetical protein DORLON_00033 [Dorea longicatena DSM 13814] (139 aa)
Score = 423, Expect = 2.1e-40, Identities = 99/139 (71%), Positives = 111/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL++  R+   KKS +PAL   YNSLKK+ T   +P KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHIVRGTLDT+GV KRRQ RS YGAKRPK+KK
  S:     1 MPTFNQLVKKGRQTSVKKSTAPALQKGYNSLKKRSTDTSAPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGVAKRRQARSKYGAKRPKDKK 139
>gi|163813880|ref|ZP_02205274.1| hypothetical protein COPEUT_00033 [Coprococcus eutactus ATCC 27759] >gi|158450750|gb|EDP27745.1| hypothetical protein COPEUT_00033 [Coprococcus eutactus ATCC 27759] (139 aa)
Score = 423, Expect = 2.2e-40, Identities = 98/139 (70%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL+R  R+   KKS +PAL  ++NSLKKK     SP KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHI+RGTLDT+GV KRRQ RS YGAKRPK+ K
  S:     1 MPTFNQLVRKGRQTVEKKSTAPALQRSFNSLKKKPVETSSPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGVAKRRQARSKYGAKRPKDAK 139
>gi|162447055|ref|YP_001620187.1| small subunit ribosomal protein S12 [Acholeplasma laidlawii PG-8A] >gi|189040444|sp|A9NEN1|RS12_ACHLI 30S ribosomal protein S12 >gi|161985162|gb|ABX80811.1| small subunit ribosomal protein S12 [Acholeplasma laidlawii PG-8A] (141 aa)
Score = 423, Expect = 2.3e-40, Identities = 94/131 (71%), Positives = 106/131 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI+QL+   R+DK  KSKSPAL Y +NSLKK+ +   SP KRGVCTRV TMTPKKPNSALRKYA+V+L+NG EV AYIPG GH+LQEHSVVL+ GGRVKDLPGVRYHIVRG LD +GV  R Q RS YG
  S:     1 MPTISQLVTTSRQDKNYKSKSPALHYGFNSLKKEDSEYNSPQKRGVCTRVTTMTPKKPNSALRKYARVRLSNGTEVTAYIPGVGHSLQEHSVVLVRGGRVKDLPGVRYHIVRGALDATGVANRMQGRSKYG 131
>gi|116334274|ref|YP_795801.1| 30S ribosomal protein S12 [Lactobacillus brevis ATCC 367] >gi|122269044|sp|Q03PV2|RS12_LACBA 30S ribosomal protein S12 >gi|116099621|gb|ABJ64770.1| SSU ribosomal protein S12P [Lactobacillus brevis ATCC 367] (137 aa)
Score = 423, Expect = 2.5e-40, Identities = 99/136 (72%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K  KS +PAL Y YNS KK +  NP+P KRGV TRVGTMTPKKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GV  RRQ RS YG K+PK
  S:     1 MPTINQLVRKGRKSKSSKSDAPALNYGYNSFKKAQVKNPAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVTDRRQGRSKYGTKKPK 136
>gi|15900205|ref|NP_344809.1| 30S ribosomal protein S12 [Streptococcus pneumoniae TIGR4] >gi|15902292|ref|NP_357842.1| 30S ribosomal protein S12 [Streptococcus pneumoniae R6] >gi|111658317|ref|ZP_01409006.1| hypothetical protein SpneT_02000507 [Streptococcus pneumoniae TIGR4] >gi|116516309|ref|YP_815769.1| 30S ribosomal protein S12 [Streptococcus pneumoniae D39] >gi|148983677|ref|ZP_01816996.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP3-BS71] >gi|148988012|ref|ZP_01819475.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP6-BS73] >gi|148994614|ref|ZP_01823756.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP9-BS68] >gi|148996695|ref|ZP_01824413.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP11-BS70] >gi|149006024|ref|ZP_01829753.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP18-BS74] >gi|149011141|ref|ZP_01832446.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP19-BS75] >gi|149017965|ref|ZP_01834424.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP23-BS72] >gi|168484145|ref|ZP_02709097.1| ribosomal protein S12 [Streptococcus pneumoniae CDC1873-00] >gi|168485962|ref|ZP_02710470.1| ribosomal protein S12 [Streptococcus pneumoniae CDC1087-00] >gi|168489747|ref|ZP_02713946.1| ribosomal protein S12 [Streptococcus pneumoniae SP195] >gi|168490800|ref|ZP_02714943.1| ribosomal protein S12 [Streptococcus pneumoniae CDC0288-04] >gi|168493966|ref|ZP_02718109.1| ribosomal protein S12 [Streptococcus pneumoniae CDC3059-06] >gi|168576302|ref|ZP_02722185.1| ribosomal protein S12 [Streptococcus pneumoniae MLV-016] >gi|182683252|ref|YP_001834999.1| 30S ribosomal protein S12 [Streptococcus pneumoniae CGSP14] >gi|194397766|ref|YP_002036969.1| 30S ribosomal protein S12 [Streptococcus pneumoniae G54] >gi|122279345|sp|Q04MH9|RS12_STRP2 30S ribosomal protein S12 >gi|61236813|sp|P0A4A7|RS12_STRPN 30S ribosomal protein S12 >gi|61236818|sp|P0A4A8|RS12_STRR6 30S ribosomal protein S12 >gi|16660279|gb|AAL27550.1|AF411920_2 ribosomal protein S12 [synthetic construct] >gi|47453|emb|CAA78825.1| ribosomal protein S12 [Streptococcus pneumoniae] >gi|14971742|gb|AAK74449.1| ribosomal protein S12 [Streptococcus pneumoniae TIGR4] >gi|15457797|gb|AAK99052.1| 30S Ribosomal protein S12 [Streptococcus pneumoniae R6] >gi|116076885|gb|ABJ54605.1| ribosomal protein S12 [Streptococcus pneumoniae D39] >gi|147757270|gb|EDK64309.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP11-BS70] >gi|147762380|gb|EDK69341.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP18-BS74] >gi|147764777|gb|EDK71707.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP19-BS75] >gi|147923824|gb|EDK74936.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP3-BS71] >gi|147926476|gb|EDK77549.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP6-BS73] >gi|147927144|gb|EDK78182.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP9-BS68] >gi|147931529|gb|EDK82507.1| 30S ribosomal protein S12 [Streptococcus pneumoniae SP23-BS72] >gi|172042533|gb|EDT50579.1| ribosomal protein S12 [Streptococcus pneumoniae CDC1873-00] >gi|182628586|gb|ACB89534.1| 30S ribosomal protein S12 [Streptococcus pneumoniae CGSP14] >gi|183570908|gb|EDT91436.1| ribosomal protein S12 [Streptococcus pneumoniae CDC1087-00] >gi|183571858|gb|EDT92386.1| ribosomal protein S12 [Streptococcus pneumoniae SP195] >gi|183574791|gb|EDT95319.1| ribosomal protein S12 [Streptococcus pneumoniae CDC0288-04] >gi|183576178|gb|EDT96706.1| ribosomal protein S12 [Streptococcus pneumoniae CDC3059-06] >gi|183577876|gb|EDT98404.1| ribosomal protein S12 [Streptococcus pneumoniae MLV-016] >gi|194357433|gb|ACF55881.1| 30S ribosomal protein S12 [Streptococcus pneumoniae G54] (137 aa)
Score = 422, Expect = 2.6e-40, Identities = 99/136 (72%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KSKSPAL   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG KRPK
  S:     1 MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPK 136
>gi|160878393|ref|YP_001557361.1| 30S ribosomal protein S12 [Clostridium phytofermentans ISDg] >gi|189040453|sp|A9KRZ1|RS12_CLOPH 30S ribosomal protein S12 >gi|160427059|gb|ABX40622.1| ribosomal protein S12 [Clostridium phytofermentans ISDg] (140 aa)
Score = 422, Expect = 2.6e-40, Identities = 99/140 (70%), Positives = 111/140 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M T  QL+R  RK   K S++PAL   +NSL+KK T   +P KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHIVRGTLDT+GV KRRQ RS YGAKRPKE K+
  S:     1 MPTFNQLVRKGRKTMEKNSQAPALQKGFNSLRKKTTDASAPQKRGVCTAVRTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGVAKRRQARSKYGAKRPKEAKK 140
>gi|154503766|ref|ZP_02040826.1| hypothetical protein RUMGNA_01590 [Ruminococcus gnavus ATCC 29149] >gi|153795866|gb|EDN78286.1| hypothetical protein RUMGNA_01590 [Ruminococcus gnavus ATCC 29149] (139 aa)
Score = 422, Expect = 2.8e-40, Identities = 97/139 (69%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL+R  R+   KKS +PAL   +NSL+K+ T   +P KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHIVRGTLDT+GV KRRQ RS YGAKRPK+ K
  S:     1 MPTFNQLVRKGRQTSEKKSTAPALQKGWNSLQKRATDVSAPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGVAKRRQARSKYGAKRPKDAK 139
>gi|167768223|ref|ZP_02440276.1| hypothetical protein CLOSS21_02779 [Clostridium sp. SS2/1] >gi|167709747|gb|EDS20326.1| hypothetical protein CLOSS21_02779 [Clostridium sp. SS2/1] (143 aa)
Score = 422, Expect = 3.1e-40, Identities = 99/138 (71%), Positives = 108/138 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M T  QL+R  RK   KKS +PAL   +NSLKKK T   SP KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHIVRGTLDT+GV  R Q RS YGAKRPK+K
  S:     6 MPTFNQLVRKGRKTSVKKSTAPALQKGFNSLKKKATDTSSPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGVANRMQARSKYGAKRPKKK 143
>gi|166031393|ref|ZP_02234222.1| hypothetical protein DORFOR_01082 [Dorea formicigenerans ATCC 27755] >gi|166028798|gb|EDR47555.1| hypothetical protein DORFOR_01082 [Dorea formicigenerans ATCC 27755] (139 aa)
Score = 422, Expect = 3.2e-40, Identities = 97/139 (69%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL++  R+   KKS +PAL   YNSLKK+ T   +P KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHI+RGTLDT+GV KRRQ RS YGAKRPK+ K
  S:     1 MPTFNQLVKKGRQTSVKKSTAPALQKGYNSLKKRATNESAPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGVAKRRQARSKYGAKRPKDAK 139
>gi|22537910|ref|NP_688761.1| 30S ribosomal protein S12 [Streptococcus agalactiae 2603V/R] >gi|25011853|ref|NP_736248.1| 30S ribosomal protein S12 [Streptococcus agalactiae NEM316] >gi|76788371|ref|YP_330390.1| 30S ribosomal protein S12 [Streptococcus agalactiae A909] >gi|76798255|ref|ZP_00780504.1| ribosomal protein S12 [Streptococcus agalactiae 18RS21] >gi|77406259|ref|ZP_00783326.1| ribosomal protein S12 [Streptococcus agalactiae H36B] >gi|77409030|ref|ZP_00785749.1| ribosomal protein S12 [Streptococcus agalactiae COH1] >gi|77412124|ref|ZP_00788448.1| ribosomal protein S12 [Streptococcus agalactiae CJB111] >gi|77414158|ref|ZP_00790323.1| ribosomal protein S12 [Streptococcus agalactiae 515] >gi|52783409|sp|Q8DXS5|RS12_STRA5 30S ribosomal protein S12 >gi|52783410|sp|Q8E3E5|RS12_STRA3 30S ribosomal protein S12 >gi|90111806|sp|Q3JZB3|RS12_STRA1 30S ribosomal protein S12 >gi|22534808|gb|AAN00634.1|AE014272_5 ribosomal protein S12 [Streptococcus agalactiae 2603V/R] >gi|24413394|emb|CAD47473.1| ribosomal protein S12 [Streptococcus agalactiae NEM316] >gi|76563428|gb|ABA46012.1| ribosomal protein S12 [Streptococcus agalactiae A909] >gi|76586408|gb|EAO62917.1| ribosomal protein S12 [Streptococcus agalactiae 18RS21] >gi|77159781|gb|EAO70927.1| ribosomal protein S12 [Streptococcus agalactiae 515] >gi|77161831|gb|EAO72818.1| ribosomal protein S12 [Streptococcus agalactiae CJB111] >gi|77172371|gb|EAO75521.1| ribosomal protein S12 [Streptococcus agalactiae COH1] >gi|77175112|gb|EAO77914.1| ribosomal protein S12 [Streptococcus agalactiae H36B] (137 aa)
Score = 422, Expect = 3.2e-40, Identities = 98/136 (72%), Positives = 108/136 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KS SPAL   YNS +K  T   +P KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRKSKVEKSDSPALNIGYNSHRKVHTKLSAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRKQGRSKYGAKRPK 136
>gi|133732|sp|P09901|RS12_BACST 30S ribosomal protein S12 (BS12) (140 aa)
Score = 421, Expect = 3.8e-40, Identities = 97/131 (74%), Positives = 105/131 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI QL+R  R+ K  KSKSPAL   YNS KK++T   SP KRGVCTRVGTMTPKKPNSALRKYA+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDL GVRYHI+RG LDT+GV  R Q RS YG
  S:     1 MPTINQLVRKGREKKVFKSKSPALNKGYNSFKKEQTNVASPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLRGVRYHIIRGGLDTAGVANRMQGRSKYG 131
>gi|146320002|ref|YP_001199713.1| 30S ribosomal protein S12 [Streptococcus suis 98HAH33] >gi|158514144|sp|A4VYX4|RS12_STRS2 30S ribosomal protein S12 >gi|145690808|gb|ABP91313.1| Ribosomal protein S12 [Streptococcus suis 98HAH33] (137 aa)
Score = 420, Expect = 4.4e-40, Identities = 99/136 (72%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KSKSPAL   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG KRPK
  S:     1 MPTINQLVRKPRKSKVEKSKSPALNVGYNSRKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPK 136
>gi|157150738|ref|YP_001449524.1| 30S ribosomal protein S12 [Streptococcus gordonii str. Challis substr. CH1] >gi|14423913|sp|Q9F0R4|RS12_STRGC 30S ribosomal protein S12 >gi|11493922|gb|AAG35707.1| ribosomal protein S12 [Streptococcus gordonii] >gi|157075532|gb|ABV10215.1| ribosomal protein S12 [Streptococcus gordonii str. Challis substr. CH1] (137 aa)
Score = 420, Expect = 4.7e-40, Identities = 97/136 (71%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KSKSPAL   YNSLK+  T   +P KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG K+PK
  S:     1 MPTINQLVRKPRKSKVEKSKSPALNVGYNSLKRVPTNESAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVTDRKQGRSKYGTKKPK 136
>gi|116617320|ref|YP_817691.1| 30S ribosomal protein S12 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272479|sp|Q03ZQ4|RS12_LEUMM 30S ribosomal protein S12 >gi|116096167|gb|ABJ61318.1| SSU ribosomal protein S12P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (137 aa)
Score = 420, Expect = 5.0e-40, Identities = 100/137 (72%), Positives = 111/137 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK K  KSKSPAL + YNS+KKK T N +P KRGV TRVGTMTPKKPNSALRKYA+V+L+N YEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GV+ R   RS YG K PK+
  S:     1 MPTINQLVRKPRKSKVSKSKSPALNFGYNSMKKKATNNAAPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVDGRMTSRSKYGTKAPKK 137
>gi|153816277|ref|ZP_01968945.1| hypothetical protein RUMTOR_02526 [Ruminococcus torques ATCC 27756] >gi|145846460|gb|EDK23378.1| hypothetical protein RUMTOR_02526 [Ruminococcus torques ATCC 27756] (139 aa)
Score = 419, Expect = 5.9e-40, Identities = 97/139 (69%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL+R  R+   KKS +PAL   YNSLKK+ T   +P KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVV+I GGRVKDLPG RYHI+RGTLDT+GV KRRQ RS YGAKRPK+ K
  S:     1 MPTFNQLVRKGRQTSEKKSTAPALQKGYNSLKKRATDVSAPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGTRYHIIRGTLDTAGVAKRRQARSKYGAKRPKDAK 139
>gi|71894073|ref|YP_278181.1| 30S ribosomal protein S12 [Mycoplasma synoviae 53] >gi|90111785|sp|Q4A701|RS12_MYCS5 30S ribosomal protein S12 >gi|71850861|gb|AAZ43470.1| 30S ribosomal protein S12 [Mycoplasma synoviae 53] (137 aa)
Score = 419, Expect = 6.8e-40, Identities = 92/137 (67%), Positives = 107/137 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M T  QL+   R  K +K  +PAL ++YNSL K+    PSP+KRGVCTRV TMTPKKPNSALRK+A+VKL+NG EV AYIPGE HN+QEHSVVLI GGRVKDLPGVRYHIVRGT D +GV  R+Q RS YG K+ K+
  S:     1 MPTTNQLVNRGRTSKVQKQNAPALSWSYNSLIKRSKKMPSPFKRGVCTRVATMTPKKPNSALRKFARVKLSNGMEVTAYIPGEKHNIQEHSVVLIRGGRVKDLPGVRYHIVRGTQDVAGVNNRKQGRSLYGTKKDKK 137
>gi|11493924|gb|AAG35708.1| ribosomal protein S12 [Streptococcus gordonii] (137 aa)
Score = 418, Expect = 7.8e-40, Identities = 96/136 (70%), Positives = 108/136 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KSKSPAL   YNSLK+  T   +P KRGV TRVGTMTP KPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG K+PK
  S:     1 MPTINQLVRKPRKSKVEKSKSPALNVGYNSLKRVPTNESAPQKRGVATRVGTMTPTKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVTDRKQGRSKYGTKKPK 136
>gi|153812159|ref|ZP_01964827.1| hypothetical protein RUMOBE_02556 [Ruminococcus obeum ATCC 29174] >gi|149831814|gb|EDM86900.1| hypothetical protein RUMOBE_02556 [Ruminococcus obeum ATCC 29174] (138 aa)
Score = 418, Expect = 7.9e-40, Identities = 95/138 (68%), Positives = 109/138 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M T  QL+R  R+   KKS +PAL  T+NSL+KK     +P KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHI+RGTLDT+GV  R+Q RS YGAKRPK+K
  S:     1 MPTFNQLVRKGRQTAVKKSTAPALQRTFNSLRKKAVEQSAPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGVANRKQARSKYGAKRPKKK 138
>gi|125718896|ref|YP_001036029.1| 30S ribosomal protein S12 [Streptococcus sanguinis SK36] >gi|158513229|sp|A3CQM4|RS12_STRSV 30S ribosomal protein S12 >gi|125498813|gb|ABN45479.1| 30S ribosomal protein S12, putative [Streptococcus sanguinis SK36] (137 aa)
Score = 418, Expect = 8.7e-40, Identities = 98/136 (72%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KSKSPAL   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG K+PK
  S:     1 MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVTDRKQGRSKYGTKKPK 136
>gi|171854024|emb|CAM11997.1| 30S ribosomal protein S12 [Candidatus Phytoplasma australiense] (139 aa)
Score = 417, Expect = 1.1e-39, Identities = 94/139 (67%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T++QLI+  R  K  K+K+PAL Y +N LKKK  +  SP K GVC RV TMTPKKPNSALRK+A+V+L+NG EV AYIPG GH+LQEHS VLI GGRVKDLPGVRYHI+RGTLD +GV  R+Q RS YGAKRPK +K
  S:     1 MPTVSQLIKKRRTSKTTKTKAPALSYGFNILKKKAQHYASPQKMGVCLRVTTMTPKKPNSALRKFARVRLSNGSEVTAYIPGVGHSLQEHSSVLICGGRVKDLPGVRYHIIRGTLDATGVANRKQGRSRYGAKRPKAQK 139
>gi|169832512|ref|YP_001693798.1| ribosomal protein S12 [Streptococcus pneumoniae Hungary19A-6] >gi|168995014|gb|ACA35626.1| ribosomal protein S12 [Streptococcus pneumoniae Hungary19A-6] (137 aa)
Score = 416, Expect = 1.4e-39, Identities = 97/136 (71%), Positives = 108/136 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +K KSPAL   YNS KK +T   SP KRGV TRVGTMTP+KPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG KRPK
  S:     1 MPTINQLVRKPRKSKVEKPKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPRKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPK 136
>gi|24378854|ref|NP_720809.1| 30S ribosomal protein S12 [Streptococcus mutans UA159] >gi|27151674|sp|P59167|RS12_STRMU 30S ribosomal protein S12 >gi|24376732|gb|AAN58115.1|AE014883_1 30S ribosomal protein S12 [Streptococcus mutans UA159] (137 aa)
Score = 416, Expect = 1.6e-39, Identities = 97/136 (71%), Positives = 107/136 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K +KS SPAL   YNS KK  T   +P KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG K+PK
  S:     1 MPTINQLVRKPRKSKVEKSDSPALNIGYNSHKKVHTKLAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVTDRKQGRSKYGTKKPK 136
>gi|167748165|ref|ZP_02420292.1| hypothetical protein ANACAC_02909 [Anaerostipes caccae DSM 14662] >gi|167652157|gb|EDR96286.1| hypothetical protein ANACAC_02909 [Anaerostipes caccae DSM 14662] (137 aa)
Score = 415, Expect = 2.0e-39, Identities = 96/137 (70%), Positives = 107/137 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M T  QL+R  RK   KKS +PAL  ++NSLKK+     SP KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHIVRGTLDT+GV  R Q RS YGAKRPK+
  S:     1 MPTFNQLVRKGRKTSTKKSTAPALQKSFNSLKKRSVNASSPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGVANRMQARSKYGAKRPKK 137
>gi|18077330|emb|CAC87985.1| ribosomal protein S12 [Mycoplasma mycoides subsp. mycoides] >gi|19171201|emb|CAD21851.1| ribosomal protein S12 [Mycoplasma mycoides subsp. mycoides] (139 aa)
Score = 415, Expect = 2.1e-39, Identities = 98/139 (70%), Positives = 108/139 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL++ +RK K  K+K+PAL    N+L KK T   SP KRGVCTRV TMTPKKPNSALRKYA+V LTNG E  AYIPGEGHNL+EH VVLI GGRVKDLPGVRYH++RG LDT GV KR Q RS YG KRPK KK
  S:     1 MPTINQLVKVNRKAKTWKTKAPALNRGINTLIKKVTKIASPQKRGVCTRVATMTPKKPNSALRKYARVILTNGVEGNAYIPGEGHNLREHRVVLIRGGRVKDLPGVRYHVIRGALDTQGVAKRSQGRSLYGVKRPKVKK 139
>gi|154499819|ref|ZP_02037857.1| hypothetical protein BACCAP_03476 [Bacteroides capillosus ATCC 29799] >gi|150271417|gb|EDM98674.1| hypothetical protein BACCAP_03476 [Bacteroides capillosus ATCC 29799] (144 aa)
Score = 414, Expect = 2.6e-39, Identities = 96/139 (69%), Positives = 105/139 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL+R  R+    KS SPA+ +  N+L  + T  PSP KRGVCT V T TPKKPNSALRK A+VKLTNGYEV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT GV  R Q RS YGAKRPK  K
  S:     1 MPTFNQLVRKGREKVTYKSTSPAMQHGLNTLTNRETDLPSPQKRGVCTAVRTSTPKKPNSALRKIARVKLTNGYEVTAYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVNGRMQGRSKYGAKRPKAGK 139
>gi|118047081|ref|ZP_01515723.1| ribosomal protein S12 [Chloroflexus aggregans DSM 9485] >gi|117996398|gb|EAV10597.1| ribosomal protein S12 [Chloroflexus aggregans DSM 9485] (151 aa)
Score = 413, Expect = 3.2e-39, Identities = 99/134 (73%), Positives = 109/134 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNP-SPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  RK   KK+K+PAL +TYNSLK K T    SP KRGVCT+V TMTPKKPNSALRK A+V+L+NG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLDT GV  R+Q RS YG K+
  S:     1 MPTINQLVRKPRKPVVKKTKAPALRFTYNSLKGKLTRGRGSPQKRGVCTKVTTMTPKKPNSALRKIARVRLSNGLEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTQGVSGRKQGRSKYGTKK 135
>gi|15674244|ref|NP_268419.1| 30S ribosomal protein S12 [Lactococcus lactis subsp. lactis Il1403] >gi|116513220|ref|YP_812127.1| 30S ribosomal protein S12 [Lactococcus lactis subsp. cremoris SK11] >gi|125625311|ref|YP_001033794.1| 30S ribosomal protein S12 [Lactococcus lactis subsp. cremoris MG1363] >gi|122939877|sp|Q02VK8|RS12_LACLS 30S ribosomal protein S12 >gi|158512806|sp|A2RP74|RS12_LACLM 30S ribosomal protein S12 >gi|14423911|sp|Q9CDF9|RS12_LACLA 30S ribosomal protein S12 >gi|12725333|gb|AAK06360.1|AE006455_6 30S ribosomal protein S12 [Lactococcus lactis subsp. lactis Il1403] >gi|116108874|gb|ABJ74014.1| SSU ribosomal protein S12P [Lactococcus lactis subsp. cremoris SK11] >gi|124494119|emb|CAL99120.1| 30S ribosomal protein S12 [Lactococcus lactis subsp. cremoris MG1363] (137 aa)
Score = 412, Expect = 3.8e-39, Identities = 96/136 (70%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+ +  KSKSPA+   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YGAK+PK
  S:     1 MPTINQLVRKPRRAQVTKSKSPAMNVGYNSRKKVQTKLASPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLMEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVADRKQSRSKYGAKKPK 136
>gi|148377857|ref|YP_001256733.1| 30S ribosomal protein S12 [Mycoplasma agalactiae PG2] >gi|148291903|emb|CAL59294.1| 30S ribosomal protein S12 [Mycoplasma agalactiae PG2] (137 aa)
Score = 411, Expect = 5.2e-39, Identities = 90/137 (65%), Positives = 108/137 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M T  QL+ + R++K +K  +PAL  ++N+L K     P+P+KRGVCTRV TMTPKKPNSA RKYA+VKL+NG E+ AYI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRGT D +GV  R+Q RS YGAK+ K+
  S:     1 MPTTNQLVVNGRENKVRKQNAPALNLSFNTLTKSARKLPAPFKRGVCTRVATMTPKKPNSASRKYARVKLSNGMEITAYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTQDLAGVANRKQGRSLYGAKKEKK 137
>gi|89893212|ref|YP_516699.1| 30S ribosomal protein S12 [Desulfitobacterium hafniense Y51] >gi|109647474|ref|ZP_01371377.1| ribosomal protein S12 [Desulfitobacterium hafniense DCB-2] >gi|119366767|sp|Q250N7|RS12_DESHY 30S ribosomal protein S12 >gi|89332660|dbj|BAE82255.1| 30S ribosomal protein S12 [Desulfitobacterium hafniense Y51] >gi|109640564|gb|EAT50119.1| ribosomal protein S12 [Desulfitobacterium hafniense DCB-2] (140 aa)
Score = 411, Expect = 5.5e-39, Identities = 97/139 (69%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKR-TYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLIR+ R    KKS +PA+ + YNSL++K+     SP KRGVCTRV T TPKKPNSALRK A+V+LTN  EV +YIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT GV+KR Q RS YGAKRPK+ K
  S:     1 MPTINQLIRNGRSKIAKKSTAPAMQWGYNSLQRKQFASGGSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNTIEVSSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTQGVQKRMQARSKYGAKRPKKGK 140
>gi|167758490|ref|ZP_02430617.1| hypothetical protein CLOSCI_00830 [Clostridium scindens ATCC 35704] >gi|167663686|gb|EDS07816.1| hypothetical protein CLOSCI_00830 [Clostridium scindens ATCC 35704] (140 aa)
Score = 410, Expect = 6.7e-39, Identities = 95/140 (67%), Positives = 110/140 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M T  QL++  R+   KKS + AL   YNSL+K+ T   +P KRGVCT V T TP+KPNSALRK A+V+L+NG EV +YIPGEGHNLQEHSVVLI GGRVKDLPG RYHIVRGTLDT+GV KRRQ RS YGAKRPK+ K+
  S:     1 MPTFNQLVKKGRQTSVKKSTASALQKGYNSLRKRSTNESAPQKRGVCTAVKTATPRKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIVRGTLDTAGVAKRRQARSKYGAKRPKDAKK 140
>gi|160945275|ref|ZP_02092501.1| hypothetical protein FAEPRAM212_02794 [Faecalibacterium prausnitzii M21/2] >gi|158443006|gb|EDP20011.1| hypothetical protein FAEPRAM212_02794 [Faecalibacterium prausnitzii M21/2] (142 aa)
Score = 410, Expect = 7.8e-39, Identities = 96/136 (70%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T  QL+R  R+    KS +PAL  TYNS KK+ +   SP KRGVCT V TMTPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT GV  R Q RS YGAKRPK
  S:     1 MPTFNQLVRKGREVLTTKSTAPALQKTYNSQKKQYSDLSSPQKRGVCTAVRTMTPKKPNSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTQGVAGRNQARSKYGAKRPK 136
>gi|85057739|ref|YP_456655.1| 30S ribosomal protein S12 [Aster yellows witches'-broom phytoplasma AYWB] >gi|115305654|sp|Q2NJ17|RS12_AYWBP 30S ribosomal protein S12 >gi|84789844|gb|ABC65576.1| SSU ribosomal protein S12P [Aster yellows witches'-broom phytoplasma AYWB] (139 aa)
Score = 409, Expect = 9.5e-39, Identities = 92/139 (66%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M+T++QLI+  R  K  K+K+PAL Y +N L+KK  +  SP K GVC RV TMTPKKPNSALRK+A+V+L+NG EV AYIPG GH+LQEHS VL+ GGRVKDLPGVRYHIVRG LD +GV  R+Q RS YG+K PKEKK
  S:     1 MSTVSQLIKKRRSSKTSKTKAPALSYGFNVLQKKNKHYSSPQKMGVCLRVTTMTPKKPNSALRKFARVRLSNGSEVTAYIPGVGHSLQEHSSVLVRGGRVKDLPGVRYHIVRGALDATGVANRKQGRSKYGSKLPKEKK 139
>gi|163847917|ref|YP_001635961.1| 30S ribosomal protein S12 [Chloroflexus aurantiacus J-10-fl] >gi|187599470|ref|ZP_02985704.1| ribosomal protein S12 [Chloroflexus sp. Y-400-fl] >gi|163669206|gb|ABY35572.1| ribosomal protein S12 [Chloroflexus aurantiacus J-10-fl] >gi|187488902|gb|EDU26869.1| ribosomal protein S12 [Chloroflexus sp. Y-400-fl] (146 aa)
Score = 409, Expect = 1.0e-38, Identities = 99/134 (73%), Positives = 109/134 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNP-SPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  RK   KK+K+PAL +TYNSLK K T    SP KRGVCT+V TMTPKKPNSALRK A+V+L+NG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLDT GV  R+Q RS YG K+
  S:     1 MPTINQLVRKPRKPVVKKTKAPALRFTYNSLKGKLTRGRGSPQKRGVCTKVTTMTPKKPNSALRKIARVRLSNGLEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTQGVNGRKQGRSKYGTKK 135
>gi|39938748|ref|NP_950514.1| 30S ribosomal protein S12 [Onion yellows phytoplasma OY-M] >gi|52783367|sp|Q6YQW1|RS12_ONYPE 30S ribosomal protein S12 >gi|39721857|dbj|BAD04347.1| ribosomal protein S12 [Onion yellows phytoplasma OY-M] (139 aa)
Score = 408, Expect = 1.1e-38, Identities = 92/139 (66%), Positives = 110/139 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M+T++QLI+  R  K  K+K+PAL Y +N L+KK  +  SP K GVC RV TMTPKKPNSALRK+A+V+L+NG EV AYIPG GH+LQEHS VL+ GGRVKDLPGVRYHIVRG LD +GV  R+Q RS YG+K PKEKK
  S:     1 MSTVSQLIKKRRSSKTSKTKAPALSYGFNVLQKKAKHYSSPQKMGVCLRVTTMTPKKPNSALRKFARVRLSNGSEVTAYIPGVGHSLQEHSSVLVRGGRVKDLPGVRYHIVRGALDATGVANRKQGRSKYGSKLPKEKK 139
>gi|125975209|ref|YP_001039119.1| 30S ribosomal protein S12 [Clostridium thermocellum ATCC 27405] >gi|196253510|ref|ZP_03152134.1| ribosomal protein S12 [Clostridium thermocellum DSM 4150] >gi|158513258|sp|A3DIZ7|RS12_CLOTH 30S ribosomal protein S12 >gi|125715434|gb|ABN53926.1| SSU ribosomal protein S12P [Clostridium thermocellum ATCC 27405] >gi|196197051|gb|EDX91924.1| ribosomal protein S12 [Clostridium thermocellum DSM 4150] (142 aa)
Score = 408, Expect = 1.4e-38, Identities = 97/136 (71%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T  QL+R  RK   KKS +PAL   +NSLKK +T    P KRGVCT V T TPKKPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD +GV KR Q RS YGAKRPK
  S:     1 MPTFNQLVRKGRKAAKKKSTAPALQKGFNSLKKVQTDISCPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAAGVAKRMQGRSKYGAKRPK 136
>gi|4512399|dbj|BAA75266.1| rpsL homologue (identity of 82% to B. subtilis ) [Bacillus halodurans] (139 aa)
Score = 407, Expect = 1.6e-38, Identities = 99/139 (71%), Positives = 106/139 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLIR  RK K KKS SPAL   YNS KK +T   SP KRGVCTR      KKPNSALRKYA+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YG KRPK+KK
  S:     1 MPTINQLIRKGRKAKVKKSDSPALNKGYNSFKKVQTDLSSPQKRGVCTRGRYDDTKKPNSALRKYARVRLSNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVQDRMQGRSKYGTKRPKDKK 139
>gi|15828901|ref|NP_326261.1| 30S ribosomal protein S12 [Mycoplasma pulmonis UAB CTIP] >gi|20140194|sp|Q98QD6|RS12_MYCPU 30S ribosomal protein S12 >gi|14089844|emb|CAC13603.1| 30S RIBOSOMAL PROTEIN S12 [Mycoplasma pulmonis] (137 aa)
Score = 405, Expect = 2.6e-38, Identities = 96/137 (70%), Positives = 108/137 (78%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+   RK K  K+KSPAL  +YNSL KK     +P+KRGVCTRV TMTPKKPNSALRKYA+VKL+NG EV AYIPGEGHNLQEHSVVLI+G  VKDLPGVRY I+RGT D +GV KR Q RS YGAK+ K+
  S:     1 MPTINQLVTKGRKRKASKTKSPALNQSYNSLHKKYKKLSAPFKRGVCTRVATMTPKKPNSALRKYARVKLSNGMEVTAYIPGEGHNLQEHSVVLIKGASVKDLPGVRYSIIRGTQDAAGVNKRNQARSRYGAKKAKK 137
>gi|71899534|ref|ZP_00681690.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella fastidiosa Ann-1] >gi|71730663|gb|EAO32738.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella fastidiosa Ann-1] (165 aa)
Score = 404, Expect = 3.5e-38, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+    KS SPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:    42 MATINQLVRKPRQASTYKSASPAL-------------DKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVVKRRQGRSKYGAKRPK 164
>gi|194246784|ref|YP_002004423.1| 30S ribosomal protein S12 [Candidatus Phytoplasma mali] >gi|193807141|emb|CAP18579.1| 30S ribosomal protein S12 [Candidatus Phytoplasma mali] (137 aa)
Score = 404, Expect = 4.0e-38, Identities = 93/136 (68%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QLIR  R DK  K+K+PAL Y +N+LK K     SP K GVC RV TMTPKKPNSALRKYA+V+L+NG EV AYIPG GH LQEHSVVLI GGRVKDLPGVRYHI+RG LD  GV  R+Q RS YG+K+ K
  S:     1 MPTISQLIRKRRVDKIVKTKAPALSYGFNNLKNKVQKYKSPQKSGVCIRVTTMTPKKPNSALRKYARVRLSNGTEVNAYIPGIGHTLQEHSVVLIRGGRVKDLPGVRYHIIRGILDAKGVINRKQSRSKYGSKKNK 136
>gi|168333599|ref|ZP_02691864.1| 30S ribosomal protein S12 [Epulopiscium sp. 'N.t. morphotype B'] (125 aa)
Score = 402, Expect = 5.7e-38, Identities = 95/122 (77%), Positives = 101/122 (82%)
  Q:    17 KKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           KKS +PAL   YNSLKKK T   SP KRGVCT V T TPKKPNSALRK A+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPG RYHI+RGTLDT+GV KR Q RS YGAKRPK+K
  S:     4 KKSTAPALQKGYNSLKKKSTDISSPQKRGVCTAVKTATPKKPNSALRKIARVRLTNGIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGTRYHIIRGTLDTAGVAKREQSRSKYGAKRPKKK 125
>gi|163796925|ref|ZP_02190882.1| Ribosomal protein S12 [alpha proteobacterium BAL199] >gi|159177914|gb|EDP62463.1| Ribosomal protein S12 [alpha proteobacterium BAL199] (123 aa)
Score = 401, Expect = 8.4e-38, Identities = 93/136 (68%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI H RK   K++K PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV++YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTINQLINHGRKVPVKRNKVPAL-------------QACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVISYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVKDRRQRRSKYGAKRPK 123
>gi|159899793|ref|YP_001546040.1| 30S ribosomal protein S12 [Herpetosiphon aurantiacus ATCC 23779] >gi|159892832|gb|ABX05912.1| ribosomal protein S12 [Herpetosiphon aurantiacus ATCC 23779] (146 aa)
Score = 400, Expect = 9.0e-38, Identities = 97/134 (72%), Positives = 108/134 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTY-NPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QLIR  RK   KK+K+PAL + YNSLK K T  N +P KRGVCT+V TMTPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD+ GV  R+Q RS YG K+
  S:     1 MPTINQLIRKPRKPVVKKTKAPALRFIYNSLKGKLTRGNGAPQKRGVCTQVKTMTPKKPNSALRKVARVRLSNQMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSQGVNNRKQGRSKYGTKK 135
>gi|167749852|ref|ZP_02421979.1| hypothetical protein EUBSIR_00820 [Eubacterium siraeum DSM 15702] >gi|167657164|gb|EDS01294.1| hypothetical protein EUBSIR_00820 [Eubacterium siraeum DSM 15702] (142 aa)
Score = 399, Expect = 1.3e-37, Identities = 94/136 (69%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T  QL+R  R    KKSK+PAL  + N+LKK+     SP KRGVCT V T TPKKPNSA+RK A+V+L+NGYEV AYIPG GH LQEHSVVLI GGRVKDLPGVRYHIVRGTLD  GV+ R Q RS YGAKRPK
  S:     1 MPTFNQLVRKGRAVAEKKSKAPALQKSMNTLKKETVDMSSPQKRGVCTAVRTATPKKPNSAMRKIARVRLSNGYEVTAYIPGIGHKLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAQGVDGRMQGRSKYGAKRPK 136
>gi|160935068|ref|ZP_02082454.1| hypothetical protein CLOLEP_03944 [Clostridium leptum DSM 753] >gi|156866521|gb|EDO59893.1| hypothetical protein CLOLEP_03944 [Clostridium leptum DSM 753] (141 aa)
Score = 399, Expect = 1.3e-37, Identities = 92/136 (67%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T  QL+R  R+   KK+K+PAL+  +NS K+      SP KRGVCT V T TPKKPNSALRK A+V+L+NG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD  GV KR Q RS YGAKRPK
  S:     1 MPTFNQLVRKGREVSEKKAKAPALLKGWNSKKRVAIDQNSPQKRGVCTSVKTATPKKPNSALRKIARVRLSNGIEVSSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVAKRMQARSKYGAKRPK 136
>gi|167769917|ref|ZP_02441970.1| hypothetical protein ANACOL_01258 [Anaerotruncus colihominis DSM 17241] >gi|167667908|gb|EDS12038.1| hypothetical protein ANACOL_01258 [Anaerotruncus colihominis DSM 17241] (141 aa)
Score = 398, Expect = 1.6e-37, Identities = 90/136 (66%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T  QL+R  R+   KKS +PAL+  +N+ K+      SP KRGVCT + T TPKKPNSALRK A+V+L+NG+EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD  GV KR Q RS YGAKRPK
  S:     1 MPTFNQLVRKGREVTAKKSTAPALLKGWNAKKRVAIDQTSPQKRGVCTAIRTSTPKKPNSALRKVARVRLSNGFEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVAKRMQARSKYGAKRPK 136
>gi|171913930|ref|ZP_02929400.1| 30S ribosomal protein S12 [Verrucomicrobium spinosum DSM 4136] (135 aa)
Score = 398, Expect = 1.7e-37, Identities = 94/136 (69%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+RH RKDK  KSKSPAL                P +RGVC +V T TPKKPNSALRK AKV+LTNG+EV+AYI GEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLD  GV+KRR+ RS YGAKRPK
  S:     1 MPTINQLVRHGRKDKAVKSKSPALA-------------NCPQRRGVCLQVMTRTPKKPNSALRKVAKVRLTNGFEVIAYIGGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDCLGVDKRRRGRSKYGAKRPK 123
>gi|94987384|ref|YP_595317.1| 30S ribosomal protein S12 [Lawsonia intracellularis PHE/MN1-00] >gi|119366782|sp|Q1MPT1|RS12_LAWIP 30S ribosomal protein S12 >gi|94731633|emb|CAJ54996.1| 30S ribosomal protein S12 [Lawsonia intracellularis PHE/MN1-00] (123 aa)
Score = 397, Expect = 2.2e-37, Identities = 96/136 (70%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIRH+RK   K+ K+PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDTSGV+ RRQ+RS YGAKRPK
  S:     1 MPTINQLIRHERKKVVKRKKTPAL-------------QGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGLEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTSGVQDRRQRRSKYGAKRPK 123
>gi|57234696|ref|YP_181214.1| 30S ribosomal protein S12 [Dehalococcoides ethenogenes 195] >gi|163812930|ref|ZP_02204579.1| ribosomal protein S12 [Dehalococcoides sp. VS] >gi|90111778|sp|Q3Z985|RS12_DEHE1 30S ribosomal protein S12 >gi|57225144|gb|AAW40201.1| ribosomal protein S12 [Dehalococcoides ethenogenes 195] >gi|157403456|gb|EDO69527.1| ribosomal protein S12 [Dehalococcoides sp. VS] (144 aa)
Score = 396, Expect = 2.8e-37, Identities = 88/130 (67%), Positives = 103/130 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTY-NPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGY 130
           M T+ QL+R  R    KK K+PAL Y++NSL+ K  + + SP KRGVCT+V T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHSVVLI GGRV DLPGVRYHI+RGTLDT+GV  R+Q RS Y
  S:     1 MPTVNQLVRKGRSSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKRGVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDLPGVRYHIIRGTLDTAGVANRQQGRSRY 131
>gi|73748312|ref|YP_307551.1| 30S ribosomal protein S12 [Dehalococcoides sp. CBDB1] >gi|147669092|ref|YP_001213910.1| 30S ribosomal protein S12 [Dehalococcoides sp. BAV1] >gi|189040456|sp|A5FS00|RS12_DEHSB 30S ribosomal protein S12 >gi|90111779|sp|Q3ZZM8|RS12_DEHSC 30S ribosomal protein S12 >gi|73660028|emb|CAI82635.1| ribosomal protein S12 [Dehalococcoides sp. CBDB1] >gi|146270040|gb|ABQ17032.1| SSU ribosomal protein S12P [Dehalococcoides sp. BAV1] (144 aa)
Score = 396, Expect = 3.1e-37, Identities = 88/130 (67%), Positives = 103/130 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTY-NPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGY 130
           M T+ QL+R  R    KK K+PAL Y++NSL+ K  + + SP KRGVCT+V T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHSVVLI GGRV DLPGVRYHI+RGTLDT+GV  R+Q RS Y
  S:     1 MPTVNQLVRKGRTSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKRGVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDLPGVRYHIIRGTLDTAGVANRQQGRSRY 131
>gi|58038859|ref|YP_190823.1| 30S ribosomal protein S12 [Gluconobacter oxydans 621H] >gi|62287346|sp|Q5FTX9|RS12_GLUOX 30S ribosomal protein S12 >gi|58001273|gb|AAW60167.1| SSU ribosomal protein S12P [Gluconobacter oxydans 621H] (123 aa)
Score = 395, Expect = 3.7e-37, Identities = 93/136 (68%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI + R+   K++K PAL                P KRGVCTRV T+TPKKPNSALRK AKV+LTNGYEV++YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT G+ KRRQ+RS YGAKRPK
  S:     1 MPTINQLIANGREPAAKRNKVPAL-------------QGCPQKRGVCTRVYTVTPKKPNSALRKVAKVRLTNGYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGLAKRRQRRSLYGAKRPK 123
>gi|148655342|ref|YP_001275547.1| 30S ribosomal protein S12 [Roseiflexus sp. RS-1] >gi|156743953|ref|YP_001434082.1| 30S ribosomal protein S12 [Roseiflexus castenholzii DSM 13941] >gi|166231885|sp|A5USJ4|RS12_ROSS1 30S ribosomal protein S12 >gi|189040475|sp|A7NR68|RS12_ROSCS 30S ribosomal protein S12 >gi|148567452|gb|ABQ89597.1| SSU ribosomal protein S12P [Roseiflexus sp. RS-1] >gi|156235281|gb|ABU60064.1| ribosomal protein S12 [Roseiflexus castenholzii DSM 13941] (144 aa)
Score = 395, Expect = 4.3e-37, Identities = 95/134 (70%), Positives = 106/134 (79%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNP-SPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  RK   KK K+PAL ++ N LK K T    SP+KRGVCT+V TMTPKKPNSALRK A+V+L+NG EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD  GV  R+Q RS YG K+
  S:     1 MPTINQLVRKPRKRVTKKVKAPALRFSLNVLKGKLTRGKGSPFKRGVCTQVRTMTPKKPNSALRKIARVRLSNGMEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAQGVANRKQGRSKYGTKK 135
>gi|153891572|ref|ZP_02012575.1| ribosomal protein S12 [Opitutaceae bacterium TAV2] >gi|151582371|gb|EDN45921.1| ribosomal protein S12 [Opitutaceae bacterium TAV2] (163 aa)
Score = 394, Expect = 5.1e-37, Identities = 89/140 (63%), Positives = 106/140 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  R+    KSKSPAL             + +P++RGVC +V T TPKKPNSA+RK AKV+LTNG EV++YIP EGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLD +GVEKRR+ RS YG KRPK+ K+
  S:    37 MPTINQLVRKGRRQIRVKSKSPAL-------------DGNPFRRGVCVQVMTRTPKKPNSAIRKVAKVRLTNGSEVISYIPDEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDATGVEKRRRSRSKYGVKRPKKDKK 163
>gi|33575063|emb|CAE30526.1| 30S ribosomal protein S12 [Bordetella bronchiseptica RB50] (146 aa)
Score = 394, Expect = 5.7e-37, Identities = 91/137 (66%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R+    KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:    22 MPTISQLVRKPREVSIIKSKSPAL-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKRPKK 145
>gi|24216116|ref|NP_713597.1| 30S ribosomal protein S12 [Leptospira interrogans serovar Lai str. 56601] >gi|45656649|ref|YP_000735.1| 30S ribosomal protein S12 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|116327518|ref|YP_797238.1| 30S ribosomal protein S12 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331869|ref|YP_801587.1| 30S ribosomal protein S12 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122280396|sp|Q04QJ1|RS12_LEPBJ 30S ribosomal protein S12 >gi|122284682|sp|Q054E0|RS12_LEPBL 30S ribosomal protein S12 >gi|27151671|sp|P59164|RS12_LEPIN 30S ribosomal protein S12 >gi|52783370|sp|Q72UA6|RS12_LEPIC 30S ribosomal protein S12 >gi|24197359|gb|AAN50615.1|AE011500_2 ribosomal protein S12 [Leptospira interrogans serovar Lai str. 56601] >gi|45599885|gb|AAS69372.1| 30S ribosomal protein S12 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|116120262|gb|ABJ78305.1| 30S Ribosomal protein S12 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125558|gb|ABJ76829.1| 30S Ribosomal protein S12 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (124 aa)
Score = 393, Expect = 5.9e-37, Identities = 94/136 (69%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QLIRH R+ + K++KSPAL               SP +RGVCTRV T TPKKPNSALRK A+V+LT G EV AYIPGEGHNLQEH+VVLI GGRVKDLPGVRYHI+RGTLDT GV+KRR  RS YGAKRPK
  S:     1 MPTISQLIRHGRQKQKKRTKSPAL-------------KSSPQRRGVCTRVMTFTPKKPNSALRKVARVRLTTGIEVTAYIPGEGHNLQEHNVVLIRGGRVKDLPGVRYHIIRGTLDTLGVDKRRNGRSKYGAKRPK 123
>gi|182682616|ref|YP_001830776.1| ribosomal protein S12 [Xylella fastidiosa M23] >gi|182632726|gb|ACB93502.1| ribosomal protein S12 [Xylella fastidiosa M23] (154 aa)
Score = 393, Expect = 6.4e-37, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+    KS SPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:    31 MATINQLVRKPRQASTYKSASPAL-------------DKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGAKRPK 153
>gi|183221352|ref|YP_001839348.1| 30S ribosomal protein S12 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911445|ref|YP_001963000.1| 30S Ribosomal protein S12 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|52783787|sp|P63198|RS12_LEPBI 30S ribosomal protein S12 >gi|193806433|sp|B0SSI2|RS12_LEPBP 30S ribosomal protein S12 >gi|149625|gb|AAA63276.1| ribosomal protein S12 >gi|14627096|emb|CAC44029.1| putative ribosomal protein S12 [Leptospira biflexa serovar Patoc] >gi|14627098|emb|CAC44030.1| putative ribosomal protein S12 [Leptospira biflexa serovar Patoc] >gi|167776121|gb|ABZ94422.1| 30S Ribosomal protein S12 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779774|gb|ABZ98072.1| 30S ribosomal protein S12 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (124 aa)
Score = 393, Expect = 6.8e-37, Identities = 93/136 (68%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+D+ K++KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT G EV AYIPGEGHNLQEH+VVLI GGRVKDLPGVRYHI+RGTLDT GV+KRR+ RS YGAKRPK
  S:     1 MPTINQLIRIGREDQKKRTKSPAL-------------KACPQRRGVCTRVMTFTPKKPNSALRKVARVRLTTGIEVTAYIPGEGHNLQEHNVVLIRGGRVKDLPGVRYHIIRGTLDTLGVDKRRKGRSKYGAKRPK 123
>gi|158319538|ref|YP_001512045.1| 30S ribosomal protein S12 [Alkaliphilus oremlandii OhILAs] >gi|166991585|sp|A8MLD5|RS12_ALKOO 30S ribosomal protein S12 >gi|158139737|gb|ABW18049.1| ribosomal protein S12 [Alkaliphilus oremlandii OhILAs] (140 aa)
Score = 393, Expect = 7.6e-37, Identities = 90/131 (68%), Positives = 101/131 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI QL+R  R  +  KS +PAL    N+L+KK T   +P KRGVCT V T+TPKKPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG
  S:     1 MPTINQLVRKGRYVEEYKSTAPALQKGMNTLRKKATDISAPQKRGVCTSVKTVTPKKPNSALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVANRQQSRSKYG 131
>gi|83858571|ref|ZP_00952093.1| 30S ribosomal protein S12 [Oceanicaulis alexandrii HTCC2633] >gi|83853394|gb|EAP91246.1| 30S ribosomal protein S12 [Oceanicaulis alexandrii HTCC2633] (123 aa)
Score = 392, Expect = 8.1e-37, Identities = 95/136 (69%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  RKDK K++K PAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTVNQLIRKPRKDKPKRNKVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGAKRPK 123
>gi|149001613|ref|ZP_01826586.1| ribosomal protein S12 [Streptococcus pneumoniae SP14-BS69] >gi|147760071|gb|EDK67060.1| ribosomal protein S12 [Streptococcus pneumoniae SP14-BS69] (123 aa)
Score = 392, Expect = 8.2e-37, Identities = 89/122 (72%), Positives = 99/122 (81%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEK 122
           M TI QL+R  RK K +KSKSPAL   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV +
  S:     1 MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNE 122
>gi|94991745|ref|YP_599844.1| 30S ribosomal protein S12 [Streptococcus pyogenes MGAS2096] >gi|119366811|sp|Q1JDK8|RS12_STRPB 30S ribosomal protein S12 >gi|94545253|gb|ABF35300.1| SSU ribosomal protein S12P [Streptococcus pyogenes MGAS2096] (147 aa)
Score = 392, Expect = 8.4e-37, Identities = 91/139 (65%), Positives = 103/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  RK K +KS SPAL   YNS KK +T   +P KRGV TRVGTMTPKKPNSALRK+A+V+L+N  EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT+GV  R +     G    K+ +
  S:     1 MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVADRNKAVLNTGRNVQKDNR 139
>gi|78484635|ref|YP_390560.1| 30S ribosomal protein S12 [Thiomicrospira crunogena XCL-2] >gi|118597403|sp|Q31IY7|RS12_THICR 30S ribosomal protein S12 >gi|78362921|gb|ABB40886.1| SSU ribosomal protein S12P [Thiomicrospira crunogena XCL-2] (124 aa)
Score = 390, Expect = 1.4e-36, Identities = 92/136 (67%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RKDK KKS  PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTNGYEV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG+LD +GV+ R+Q RS YGAKRPK
  S:     1 MATINQLVRKPRKDKMKKSNVPAL-------------EACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGSLDCAGVDGRKQGRSKYGAKRPK 123
>gi|162149178|ref|YP_001603639.1| 30S ribosomal protein S12 [Gluconacetobacter diazotrophicus PAl 5] >gi|187596885|ref|ZP_02983146.1| ribosomal protein S12 [Gluconacetobacter diazotrophicus PAl 5] >gi|189040462|sp|A9H3R9|RS12_GLUDA 30S ribosomal protein S12 >gi|161787755|emb|CAP57351.1| putative 30S ribosomal protein S12 [Gluconacetobacter diazotrophicus PAl 5] >gi|187491243|gb|EDU29183.1| ribosomal protein S12 [Gluconacetobacter diazotrophicus PAl 5] (123 aa)
Score = 390, Expect = 1.5e-36, Identities = 93/136 (68%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R+   K++K PAL                P KRGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT G+ KRRQ+RS YGAKRPK
  S:     1 MPTINQLIAKGREPAAKRNKVPAL-------------QGCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRQRRSLYGAKRPK 123
>gi|148260943|ref|YP_001235070.1| 30S ribosomal protein S12 [Acidiphilium cryptum JF-5] >gi|166231843|sp|A5FZW9|RS12_ACICJ 30S ribosomal protein S12 >gi|146402624|gb|ABQ31151.1| SSU ribosomal protein S12P [Acidiphilium cryptum JF-5] (123 aa)
Score = 390, Expect = 1.7e-36, Identities = 93/136 (68%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R+ + K++K PAL                P KRGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT G+ KRRQ+RS YGAKRPK
  S:     1 MPTINQLIAKGREVRAKRNKVPAL-------------QGCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRQRRSLYGAKRPK 123
>gi|119947043|ref|YP_944723.1| 30S ribosomal protein S12 [Psychromonas ingrahamii 37] >gi|158513124|sp|A1T059|RS12_PSYIN 30S ribosomal protein S12 >gi|119865647|gb|ABM05124.1| SSU ribosomal protein S12P [Psychromonas ingrahamii 37] (124 aa)
Score = 389, Expect = 1.7e-36, Identities = 91/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI+QL+R+ RKDK +K+  PAL                P KRGVCTRV T TPKKPNSA+RK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LDTSGV  RR+ RS YGAKRPK
  S:     1 MATISQLVRNPRKDKVQKTSVPAL-------------EACPQKRGVCTRVYTTTPKKPNSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDTSGVTARRKGRSKYGAKRPK 123
>gi|56313632|emb|CAI08277.1| 30S ribosomal protein S12 [Azoarcus sp. EbN1] (137 aa)
Score = 389, Expect = 2.0e-36, Identities = 91/137 (66%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+    KSK PAL             +  P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:    13 MPTINQLVRKPRQLAVIKSKVPAL-------------DACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKK 136
>gi|148243266|ref|YP_001228423.1| 30S ribosomal protein S12 [Synechococcus sp. RCC307] >gi|166231892|sp|A5GW11|RS12_SYNR3 30S ribosomal protein S12 >gi|147851576|emb|CAK29070.1| 30S ribosomal protein S12 [Synechococcus sp. RCC307] (124 aa)
Score = 389, Expect = 2.2e-36, Identities = 92/137 (67%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERQTLSRKTKSPAL-------------RSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPKE 124
>gi|94312258|ref|YP_585468.1| 30S ribosomal protein S12 [Ralstonia metallidurans CH34] >gi|119366793|sp|Q1LI27|RS12_RALME 30S ribosomal protein S12 >gi|93356110|gb|ABF10199.1| SSU ribosomal protein S12P [Ralstonia metallidurans CH34] (125 aa)
Score = 388, Expect = 2.3e-36, Identities = 92/136 (67%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ RRQ RS YGAKRPK
  S:     1 MPTINQLVRKPRVSEVIKSKSPAL-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRRQARSKYGAKRPK 123
>gi|118591189|ref|ZP_01548588.1| 30S ribosomal protein S12 [Stappia aggregata IAM 12614] >gi|118436265|gb|EAV42907.1| 30S ribosomal protein S12 [Stappia aggregata IAM 12614] (123 aa)
Score = 388, Expect = 2.4e-36, Identities = 91/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  RKD  K++K PA+                P KRGVCTRV T TPKKPNSALRK AK++LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIRKPRKDPPKRNKVPAM-------------EACPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|146317808|ref|YP_001197520.1| 30S ribosomal protein S12 [Streptococcus suis 05ZYH33] >gi|158514127|sp|A4VSN1|RS12_STRSY 30S ribosomal protein S12 >gi|145688614|gb|ABP89120.1| Ribosomal protein S12 [Streptococcus suis 05ZYH33] (137 aa)
Score = 387, Expect = 3.0e-36, Identities = 100/136 (73%), Positives = 109/136 (80%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK K KKSKSPAL   YNS KK +T   SP KRGV TRVGTMTPKKPNSALRK+A+V+LTN  EV AYIPG GHNLQ+HSVVL+ GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YG KRPK
  S:     1 MPTINQLVRKPRKSKVKKSKSPALNVGYNSRKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLTNLIEVTAYIPGIGHNLQKHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPK 136
>gi|193214795|ref|YP_001995994.1| ribosomal protein S12 [Chloroherpeton thalassium ATCC 35110] >gi|193088272|gb|ACF13547.1| ribosomal protein S12 [Chloroherpeton thalassium ATCC 35110] (128 aa)
Score = 387, Expect = 3.1e-36, Identities = 93/137 (67%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R  K  K+ SPAL             +  P KRGVCTRV T TPKKPNSALRK A+V+L+NG EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  RR  RS YGAKRPKE
  S:     1 MPTIQQLVRDGRYTKSFKTASPAL-------------DRCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNGIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRNGRSKYGAKRPKE 124
>gi|87125019|ref|ZP_01080866.1| 30S ribosomal protein S12 [Synechococcus sp. RS9917] >gi|86167339|gb|EAQ68599.1| 30S ribosomal protein S12 [Synechococcus sp. RS9917] (124 aa)
Score = 387, Expect = 3.1e-36, Identities = 92/137 (67%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIRH+R+    K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRHERQSLKAKTKSPAL-------------RACPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKTPKE 124
>gi|56750662|ref|YP_171363.1| 30S ribosomal protein S12 [Synechococcus elongatus PCC 6301] >gi|81299696|ref|YP_399904.1| 30S ribosomal protein S12 [Synechococcus elongatus PCC 7942] >gi|52783788|sp|P63199|RS12_SYNP6 30S ribosomal protein S12 >gi|52783789|sp|P63200|RS12_SYNP7 30S ribosomal protein S12 >gi|79685|pir||S04427 ribosomal protein S12 - Synechococcus sp. (PCC 6301) >gi|1405430|emb|CAA35493.1| rps12 [Synechococcus elongatus PCC 6301] >gi|56685621|dbj|BAD78843.1| 30S ribosomal protein S12 [Synechococcus elongatus PCC 6301] >gi|81168577|gb|ABB56917.1| SSU ribosomal protein S12P [Synechococcus elongatus PCC 7942] (124 aa)
Score = 387, Expect = 3.5e-36, Identities = 92/136 (67%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R+   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAKRPK
  S:     1 MPTIQQLIRDEREKITKKTKSPAL-------------KNCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKRPK 123
>gi|78186065|ref|YP_374108.1| 30S ribosomal protein S12 [Pelodictyon luteolum DSM 273] >gi|115305665|sp|Q3B6G6|RS12_PELLD 30S ribosomal protein S12 >gi|78165967|gb|ABB23065.1| SSU ribosomal protein S12P [Pelodictyon luteolum DSM 273] (129 aa)
Score = 387, Expect = 3.6e-36, Identities = 93/136 (68%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIRH R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRGTLDTSGV  R+Q RS YGAK+PK
  S:     1 MPTIQQLIRHGRSVKVSKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGTLDTSGVSDRKQSRSKYGAKQPK 123
>gi|113955318|ref|YP_729616.1| 30S ribosomal protein S12 [Synechococcus sp. CC9311] >gi|119366815|sp|Q0ID56|RS12_SYNS3 30S ribosomal protein S12 >gi|113882669|gb|ABI47627.1| ribosomal protein S12 [Synechococcus sp. CC9311] (124 aa)
Score = 387, Expect = 3.7e-36, Identities = 92/137 (67%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIRH+R+    K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRHERQTLKAKTKSPAL-------------RACPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPKE 124
>gi|114570350|ref|YP_757030.1| 30S ribosomal protein S12 [Maricaulis maris MCS10] >gi|119366783|sp|Q0ANP5|RS12_MARMM 30S ribosomal protein S12 >gi|114340812|gb|ABI66092.1| SSU ribosomal protein S12P [Maricaulis maris MCS10] (123 aa)
Score = 387, Expect = 3.7e-36, Identities = 94/136 (69%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  RKDK K++K PAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIRKPRKDKPKRNKVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGHEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|145219056|ref|YP_001129765.1| 30S ribosomal protein S12 [Prosthecochloris vibrioformis DSM 265] >gi|189040472|sp|A4SCQ4|RS12_PROVI 30S ribosomal protein S12 >gi|145205220|gb|ABP36263.1| SSU ribosomal protein S12P [Prosthecochloris vibrioformis DSM 265] (132 aa)
Score = 386, Expect = 3.8e-36, Identities = 94/137 (68%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIRH R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  RRQ RS YGAK+PKE
  S:     1 MPTIQQLIRHGRSVKASKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRQSRSKYGAKQPKE 124
>gi|119485453|ref|ZP_01619781.1| 30S ribosomal protein S12 [Lyngbya sp. PCC 8106] >gi|119457209|gb|EAW38335.1| 30S ribosomal protein S12 [Lyngbya sp. PCC 8106] (123 aa)
Score = 386, Expect = 4.1e-36, Identities = 92/136 (67%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAKRPK
  S:     1 MPTIQQLIRSAREKALKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQGRSKYGAKRPK 123
>gi|156451187|ref|ZP_02057564.1| ribosomal protein S12 [Methylobacterium chloromethanicum CM4] >gi|163851580|ref|YP_001639623.1| 30S ribosomal protein S12 [Methylobacterium extorquens PA1] >gi|188581370|ref|YP_001924815.1| ribosomal protein S12 [Methylobacterium populi BJ001] >gi|156189950|gb|EDO22142.1| ribosomal protein S12 [Methylobacterium chloromethanicum CM4] >gi|163663185|gb|ABY30552.1| ribosomal protein S12 [Methylobacterium extorquens PA1] >gi|179344868|gb|ACB80280.1| ribosomal protein S12 [Methylobacterium populi BJ001] (123 aa)
Score = 386, Expect = 4.4e-36, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   RK +  ++K PAL             N  P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIAQPRKAQKARNKVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|17982691|gb|AAL51933.1| SSU ribosomal protein S12P [Brucella melitensis 16M] (134 aa)
Score = 386, Expect = 4.5e-36, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:    12 MPTVNQLIRKPRTAPVKRNKVPAL-------------QANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 134
>gi|158334960|ref|YP_001516132.1| 30S ribosomal protein S12 [Acaryochloris marina MBIC11017] >gi|189040443|sp|B0CCD3|RS12_ACAM1 30S ribosomal protein S12 >gi|158305201|gb|ABW26818.1| 30S ribosomal protein S12 [Acaryochloris marina MBIC11017] (124 aa)
Score = 386, Expect = 4.7e-36, Identities = 92/137 (67%), Positives = 105/137 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R +  KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAKRPK+
  S:     1 MPTIQQLIRSERYNTKKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQGRSKYGAKRPKD 124
>gi|177666112|ref|ZP_02941908.1| ribosomal protein S12 [Cyanothece sp. PCC 8801] >gi|196245265|ref|ZP_03143989.1| ribosomal protein S12 [Cyanothece sp. PCC 8802] >gi|172074796|gb|EDT60213.1| ribosomal protein S12 [Cyanothece sp. PCC 8801] >gi|196206794|gb|EDY01589.1| ribosomal protein S12 [Cyanothece sp. PCC 8802] (147 aa)
Score = 386, Expect = 4.9e-36, Identities = 90/137 (65%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD  GV+ R+Q RS YG KRPK+
  S:    23 MPTIQQLIRSERSKLKKKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVKDRKQGRSKYGTKRPKK 146
>gi|124268632|ref|YP_001022636.1| 30S ribosomal protein S12 [Methylibium petroleiphilum PM1] >gi|158512809|sp|A2SLG2|RS12_METPP 30S ribosomal protein S12 >gi|124261407|gb|ABM96401.1| SSU ribosomal protein S12P [Methylibium petroleiphilum PM1] (125 aa)
Score = 386, Expect = 4.9e-36, Identities = 90/137 (65%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+RH R+ +  KSKSPA+                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTINQLVRHGRQTEVTKSKSPAM-------------QGGPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKK 124
>gi|163752496|ref|ZP_02159684.1| 30S ribosomal protein S12 [Shewanella benthica KT99] >gi|161327615|gb|EDP98811.1| 30S ribosomal protein S12 [Shewanella benthica KT99] (124 aa)
Score = 385, Expect = 5.2e-36, Identities = 88/136 (64%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R+ R  K  K+  PAL             +  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH +RG LD +GV  RRQ RS YGAKRPK
  S:     1 MATINQLVRNPRSPKVVKTNVPAL-------------DSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTIRGALDCAGVSDRRQGRSKYGAKRPK 123
>gi|87301863|ref|ZP_01084697.1| 30S ribosomal protein S12 [Synechococcus sp. WH 5701] >gi|87283431|gb|EAQ75386.1| 30S ribosomal protein S12 [Synechococcus sp. WH 5701] (124 aa)
Score = 385, Expect = 5.2e-36, Identities = 92/136 (67%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDTSGV+ RRQ RS YGAK PK
  S:     1 MPTIQQLIRTERQHLTRKTKSPAL-------------RGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTSGVKDRRQSRSKYGAKTPK 123
>gi|113474341|ref|YP_720402.1| 30S ribosomal protein S12 [Trichodesmium erythraeum IMS101] >gi|119366817|sp|Q118Z5|RS12_TRIEI 30S ribosomal protein S12 >gi|110165389|gb|ABG49929.1| SSU ribosomal protein S12P [Trichodesmium erythraeum IMS101] (124 aa)
Score = 385, Expect = 5.3e-36, Identities = 90/136 (66%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+D  K++KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ R+Q RS YGAK+PK
  S:     1 MPTIQQLIRSARQDTEKQTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQSRSKYGAKKPK 123
>gi|114327214|ref|YP_744371.1| 30S ribosomal protein S12 [Granulibacter bethesdensis CGDNIH1] >gi|119366773|sp|Q0BUQ4|RS12_GRABC 30S ribosomal protein S12 >gi|114315388|gb|ABI61448.1| SSU ribosomal protein S12P [Granulibacter bethesdensis CGDNIH1] (123 aa)
Score = 385, Expect = 5.8e-36, Identities = 92/136 (67%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R+    ++K PAL                P KRGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT G+ KRRQ+RS YGAKRPK
  S:     1 MPTINQLIAKGREPNKARNKVPAL-------------QGCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVVSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGIAKRRQRRSLYGAKRPK 123
>gi|170729014|ref|YP_001763040.1| ribosomal protein S12 [Shewanella woodyi ATCC 51908] >gi|169814361|gb|ACA88945.1| ribosomal protein S12 [Shewanella woodyi ATCC 51908] (124 aa)
Score = 385, Expect = 5.8e-36, Identities = 89/136 (65%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV +RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVSERRQGRSKYGAKRPK 123
>gi|113869441|ref|YP_727930.1| 30S ribosomal protein S12 [Ralstonia eutropha H16] >gi|194291032|ref|YP_002006939.1| 30S ribosomal subunit protein S12 [Cupriavidus taiwanensis] >gi|122946534|sp|Q0K609|RS12_RALEH 30S ribosomal protein S12 >gi|113528217|emb|CAJ94562.1| SSU ribosomal protein S12 [Ralstonia eutropha H16] >gi|193224867|emb|CAQ70878.1| 30S ribosomal subunit protein S12 [Cupriavidus taiwanensis] (125 aa)
Score = 384, Expect = 6.5e-36, Identities = 91/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRVSEVVKSKSPAL-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKRPK 123
>gi|73542869|ref|YP_297389.1| 30S ribosomal protein S12 [Ralstonia eutropha JMP134] >gi|90111797|sp|Q46WD8|RS12_RALEJ 30S ribosomal protein S12 >gi|72120282|gb|AAZ62545.1| SSU ribosomal protein S12P [Ralstonia eutropha JMP134] (125 aa)
Score = 384, Expect = 6.5e-36, Identities = 91/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRVSEVIKSKSPAL-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKRPK 123
>gi|170738708|ref|YP_001767363.1| ribosomal protein S12 [Methylobacterium sp. 4-46] >gi|168192982|gb|ACA14929.1| ribosomal protein S12 [Methylobacterium sp. 4-46] (123 aa)
Score = 384, Expect = 6.7e-36, Identities = 90/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI + RK +  ++K PAL             +  P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIANPRKIQKSRNKVPAL-------------DACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|170748631|ref|YP_001754891.1| ribosomal protein S12 [Methylobacterium radiotolerans JCM 2831] >gi|170655153|gb|ACB24208.1| ribosomal protein S12 [Methylobacterium radiotolerans JCM 2831] (123 aa)
Score = 384, Expect = 7.0e-36, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   RK +  ++K PAL             +  P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIAQPRKIQRSRNKVPAL-------------DACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|23011450|ref|ZP_00051805.1| COG0048: Ribosomal protein S12 [Magnetospirillum magnetotacticum MS-1] (123 aa)
Score = 384, Expect = 7.0e-36, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R+ +  ++K PAL             N  P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIAQPRRAQKARNKVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|196189961|gb|EDX84925.1| ribosomal protein S12 [Synechococcus sp. PCC 7335] (124 aa)
Score = 384, Expect = 7.3e-36, Identities = 92/137 (67%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK+PKE
  S:     1 MPTIQQLIRTERSKATKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKKPKE 124
>gi|24371824|ref|NP_715866.1| 30S ribosomal protein S12 [Shewanella oneidensis MR-1] >gi|113968539|ref|YP_732332.1| 30S ribosomal protein S12 [Shewanella sp. MR-4] >gi|114045702|ref|YP_736252.1| 30S ribosomal protein S12 [Shewanella sp. MR-7] >gi|27151673|sp|P59166|RS12_SHEON 30S ribosomal protein S12 >gi|119366807|sp|Q0HNU2|RS12_SHESM 30S ribosomal protein S12 >gi|119366808|sp|Q0I0B0|RS12_SHESR 30S ribosomal protein S12 >gi|24345633|gb|AAN53311.1|AE015472_3 ribosomal protein S12 [Shewanella oneidensis MR-1] >gi|113883223|gb|ABI37275.1| ribosomal protein S12 [Shewanella sp. MR-4] >gi|113887144|gb|ABI41195.1| ribosomal protein S12 [Shewanella sp. MR-7] (124 aa)
Score = 384, Expect = 7.3e-36, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVTSRRQSRSKYGAKRPK 123
>gi|161350049|ref|YP_159178.2| 30S ribosomal protein S12 [Azoarcus sp. EbN1] >gi|62287381|sp|Q5P337|RS12_AZOSE 30S ribosomal protein S12 (125 aa)
Score = 384, Expect = 7.6e-36, Identities = 91/137 (66%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+    KSK PAL             +  P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTINQLVRKPRQLAVIKSKVPAL-------------DACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKK 124
>gi|120596984|ref|YP_961558.1| 30S ribosomal protein S12 [Shewanella sp. W3-18-1] >gi|124550259|ref|ZP_01707980.1| ribosomal protein S12 [Shewanella putrefaciens 200] >gi|146294846|ref|YP_001185270.1| 30S ribosomal protein S12 [Shewanella putrefaciens CN-32] >gi|158512971|sp|A1REA9|RS12_SHESW 30S ribosomal protein S12 >gi|166231887|sp|A4YBY8|RS12_SHEPC 30S ribosomal protein S12 >gi|120557077|gb|ABM23004.1| ribosomal protein S12 [Shewanella sp. W3-18-1] >gi|124507547|gb|EAY51679.1| ribosomal protein S12 [Shewanella putrefaciens 200] >gi|145566536|gb|ABP77471.1| ribosomal protein S12 [Shewanella putrefaciens CN-32] (124 aa)
Score = 384, Expect = 7.6e-36, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVSSRRQGRSKYGAKRPK 123
>gi|126090322|ref|YP_001041765.1| 30S ribosomal protein S12 [Shewanella baltica OS155] >gi|149117650|ref|ZP_01844327.1| ribosomal protein S12 [Shewanella baltica OS223] >gi|152998744|ref|YP_001364425.1| 30S ribosomal protein S12 [Shewanella baltica OS185] >gi|160873321|ref|YP_001552637.1| 30S ribosomal protein S12 [Shewanella baltica OS195] >gi|166231886|sp|A6WHS3|RS12_SHEB8 30S ribosomal protein S12 >gi|189040478|sp|A9KW97|RS12_SHEB9 30S ribosomal protein S12 >gi|125999942|gb|ABN64010.1| ribosomal protein S12 [Shewanella baltica OS155] >gi|146862243|gb|EDK47961.1| ribosomal protein S12 [Shewanella baltica OS223] >gi|151363362|gb|ABS06362.1| ribosomal protein S12 [Shewanella baltica OS185] >gi|160858843|gb|ABX47377.1| ribosomal protein S12 [Shewanella baltica OS195] (124 aa)
Score = 384, Expect = 7.9e-36, Identities = 88/136 (64%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH +RG LD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTIRGALDCAGVTSRRQSRSKYGAKRPK 123
>gi|117918652|ref|YP_867844.1| 30S ribosomal protein S12 [Shewanella sp. ANA-3] >gi|158512309|sp|A0KRL9|RS12_SHESA 30S ribosomal protein S12 >gi|117610984|gb|ABK46438.1| ribosomal protein S12 [Shewanella sp. ANA-3] (124 aa)
Score = 384, Expect = 8.0e-36, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVNTRRQGRSKYGAKRPK 123
>gi|152977966|ref|YP_001343595.1| 30S ribosomal protein S12 [Actinobacillus succinogenes 130Z] >gi|150839689|gb|ABR73660.1| ribosomal protein S12 [Actinobacillus succinogenes 130Z] (142 aa)
Score = 383, Expect = 8.6e-36, Identities = 88/136 (64%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +++LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:    19 MATINQLVRKPRVKKVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTNGYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQARSKYGVKRPK 141
>gi|91791534|ref|YP_561185.1| 30S ribosomal protein S12 [Shewanella denitrificans OS217] >gi|119366805|sp|Q12SW4|RS12_SHEDO 30S ribosomal protein S12 >gi|91713536|gb|ABE53462.1| ribosomal protein S12 [Shewanella denitrificans OS217] (124 aa)
Score = 383, Expect = 9.0e-36, Identities = 89/136 (65%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K +K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVEKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVNTRRQGRSKYGAKRPK 123
>gi|83594025|ref|YP_427777.1| 30S ribosomal protein S12 [Rhodospirillum rubrum ATCC 11170] >gi|118597394|sp|Q2RQV5|RS12_RHORT 30S ribosomal protein S12 >gi|83576939|gb|ABC23490.1| SSU ribosomal protein S12P [Rhodospirillum rubrum ATCC 11170] (123 aa)
Score = 383, Expect = 9.3e-36, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  RK   K++K PA+                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTINQLIRKPRKAVVKRNKVPAM-------------QACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKDRRQRRSKYGAKRPK 123
>gi|46579709|ref|YP_010517.1| 30S ribosomal protein S12 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602814|ref|YP_967214.1| 30S ribosomal protein S12 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|158513914|sp|A1VEC1|RS12_DESVV 30S ribosomal protein S12 >gi|52783369|sp|Q72CI5|RS12_DESVH 30S ribosomal protein S12 >gi|46449124|gb|AAS95776.1| ribosomal protein S12 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563043|gb|ABM28787.1| SSU ribosomal protein S12P [Desulfovibrio vulgaris subsp. vulgaris DP4] (123 aa)
Score = 383, Expect = 9.3e-36, Identities = 95/136 (69%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +RK   K+ K+PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPGEGHNLQEHSVV+I GGRVKDLPGVRYHIVRGTLDTSGV+ RRQ RS YGAKRPK
  S:     1 MPTINQLIRKERKKVVKRKKTPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGLEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDTSGVQDRRQGRSKYGAKRPK 123
>gi|119478602|ref|ZP_01618524.1| 30S ribosomal protein S12 [marine gamma proteobacterium HTCC2143] >gi|119448437|gb|EAW29687.1| 30S ribosomal protein S12 [marine gamma proteobacterium HTCC2143] (123 aa)
Score = 383, Expect = 9.3e-36, Identities = 93/136 (68%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV  RRQ RS YGAKRPK
  S:     1 MATINQLVRKPRKRKVQKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVTDRRQGRSKYGAKRPK 123
>gi|150396202|ref|YP_001326669.1| 30S ribosomal protein S12 [Sinorhizobium medicae WSM419] >gi|159184987|ref|NP_354927.2| 30S ribosomal protein S12 [Agrobacterium tumefaciens str. C58] >gi|166231888|sp|A6U854|RS12_SINMW 30S ribosomal protein S12 >gi|22096128|sp|Q8UE13|RS12_AGRT5 30S ribosomal protein S12 >gi|150027717|gb|ABR59834.1| ribosomal protein S12 [Sinorhizobium medicae WSM419] >gi|159140262|gb|AAK87712.2| 30S ribosomal protein S12 [Agrobacterium tumefaciens str. C58] (123 aa)
Score = 383, Expect = 9.7e-36, Identities = 89/136 (65%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R+ + K++K PAL               +P KRGVCTRV T TPKKPNSALRK AK++LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRQAQVKRNKVPAL-------------QENPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|127511087|ref|YP_001092284.1| 30S ribosomal protein S12 [Shewanella loihica PV-4] >gi|158513463|sp|A3Q977|RS12_SHELP 30S ribosomal protein S12 >gi|126636382|gb|ABO22025.1| ribosomal protein S12 [Shewanella loihica PV-4] (124 aa)
Score = 383, Expect = 1.0e-35, Identities = 89/136 (65%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV +RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRSPKVIKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVSERRQGRSKYGAKRPK 123
>gi|167358141|ref|ZP_02292800.1| ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|169198840|ref|ZP_02858149.1| ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|190891350|ref|YP_001977892.1| 30S ribosomal protein S12 [Rhizobium etli CIAT 652] >gi|167074975|gb|EDR78792.1| ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|169087969|gb|EDS67684.1| ribosomal protein S12 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|190696629|gb|ACE90714.1| 30S ribosomal protein S12 [Rhizobium etli CIAT 652] (123 aa)
Score = 383, Expect = 1.1e-35, Identities = 89/136 (65%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R+   K++K PAL               +P KRGVCTRV T TPKKPNSALRK AK++LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRQANVKRNKVPAL-------------QENPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|33594474|ref|NP_882118.1| 30S ribosomal protein S12 [Bordetella pertussis Tohama I] >gi|33594746|ref|NP_882389.1| 30S ribosomal protein S12 [Bordetella parapertussis 12822] >gi|161609284|ref|NP_886577.2| 30S ribosomal protein S12 [Bordetella bronchiseptica RB50] >gi|187476534|ref|YP_784558.1| 30S ribosomal protein S12 [Bordetella avium 197N] >gi|52783396|sp|Q7VTD7|RS12_BORPE 30S ribosomal protein S12 >gi|52783397|sp|Q7W2G0|RS12_BORPA 30S ribosomal protein S12 >gi|52783398|sp|Q7WRC9|RS12_BORBR 30S ribosomal protein S12 >gi|110825781|sp|Q2L2H8|RS12_BORA1 30S ribosomal protein S12 >gi|33564549|emb|CAE43866.1| 30S ribosomal protein S12 [Bordetella pertussis Tohama I] >gi|33564822|emb|CAE39765.1| 30S ribosomal protein S12 [Bordetella parapertussis] >gi|115421120|emb|CAJ47604.1| 30S ribosomal protein S12 [Bordetella avium 197N] (125 aa)
Score = 382, Expect = 1.1e-35, Identities = 91/137 (66%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R+    KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTISQLVRKPREVSIIKSKSPAL-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKRPKK 124
>gi|124003866|ref|ZP_01688714.1| ribosomal protein S12 [Microscilla marina ATCC 23134] >gi|123990921|gb|EAY30388.1| ribosomal protein S12 [Microscilla marina ATCC 23134] (126 aa)
Score = 382, Expect = 1.2e-35, Identities = 94/139 (67%), Positives = 103/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  RK    KSKSPAL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHI+RG LDT+GVE R Q RS YGAKRPK KK
  S:     1 MPTIQQLVRKGRKTLTSKSKSPAL-------------DRCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGALDTAGVEGRSQGRSKYGAKRPKSKK 126
>gi|78357306|ref|YP_388755.1| 30S ribosomal protein S12 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|90111780|sp|Q30Z36|RS12_DESDG 30S ribosomal protein S12 >gi|78219711|gb|ABB39060.1| SSU ribosomal protein S12P [Desulfovibrio desulfuricans G20] (123 aa)
Score = 382, Expect = 1.2e-35, Identities = 93/136 (68%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +RK   K+ K+PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTN  EV AYIPGEGHNLQEHSVV+I GGRVKDLPGVRYHIVRGTLDT+GV+ RRQ RS YGAKRPK
  S:     1 MPTINQLIRKERKKVAKRKKTPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNAIEVTAYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDTAGVQDRRQGRSKYGAKRPK 123
>gi|153952856|ref|YP_001393621.1| 30S ribosomal protein S12 [Clostridium kluyveri DSM 555] >gi|189040452|sp|A5N4P2|RS12_CLOK5 30S ribosomal protein S12 >gi|146345737|gb|EDK32273.1| RpsL [Clostridium kluyveri DSM 555] (125 aa)
Score = 382, Expect = 1.2e-35, Identities = 93/138 (67%), Positives = 100/138 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI+QLIR  RK    KS +PAL                P KRGVCT V T TPKKPNSALRK A+V+LTNGYEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD++GV  R Q RS YGAKRPK+K
  S:     1 MPTISQLIRKGRKTVASKSTAPAL-------------KECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVSAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSAGVADRLQGRSKYGAKRPKQK 125
>gi|169181075|ref|ZP_02841668.1| ribosomal protein S12 [Thauera sp. MZ1T] >gi|169011574|gb|EDS58331.1| ribosomal protein S12 [Thauera sp. MZ1T] (125 aa)
Score = 382, Expect = 1.3e-35, Identities = 91/137 (66%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+ +  KSK PAL                P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTINQLVRKPRQLEVAKSKVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKK 124
>gi|114561331|ref|YP_748844.1| 30S ribosomal protein S12 [Shewanella frigidimarina NCIMB 400] >gi|119366806|sp|Q089Q9|RS12_SHEFN 30S ribosomal protein S12 >gi|114332624|gb|ABI70006.1| SSU ribosomal protein S12P [Shewanella frigidimarina NCIMB 400] (124 aa)
Score = 382, Expect = 1.3e-35, Identities = 89/136 (65%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K +K+  PAL             N  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRTPKVEKTNVPAL-------------NACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVTSRRQGRSKYGAKRPK 123
>gi|83312234|ref|YP_422498.1| 30S ribosomal protein S12 [Magnetospirillum magneticum AMB-1] >gi|115305658|sp|Q2W2I6|RS12_MAGMM 30S ribosomal protein S12 >gi|82947075|dbj|BAE51939.1| Ribosomal protein S12 [Magnetospirillum magneticum AMB-1] (123 aa)
Score = 382, Expect = 1.3e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+    ++K PA+                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTINQLIRKPRQPVAARNKVPAM-------------EACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVKDRRQRRSKYGAKRPK 123
>gi|15896389|ref|NP_349738.1| 30S ribosomal protein S12 [Clostridium acetobutylicum ATCC 824] >gi|20140168|sp|Q97EH2|RS12_CLOAB 30S ribosomal protein S12 >gi|15026206|gb|AAK81078.1|AE007809_4 Ribosomal protein S12 [Clostridium acetobutylicum ATCC 824] (125 aa)
Score = 382, Expect = 1.4e-35, Identities = 92/138 (66%), Positives = 101/138 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI+QL+R  RK    KS +PAL                P KRGVCT V T TPKKPNSALRK A+V+LTNGYEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD +GV  R+Q RS YGAK+PK+K
  S:     1 MPTISQLVRKGRKTLAAKSTAPAL-------------KECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAAGVADRKQARSKYGAKKPKQK 125
>gi|53723859|ref|YP_104171.1| 30S ribosomal protein S12 [Burkholderia mallei ATCC 23344] >gi|121601470|ref|YP_994461.1| 30S ribosomal protein S12 [Burkholderia mallei SAVP1] >gi|124385891|ref|YP_001027890.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10229] >gi|126450225|ref|YP_001082985.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10247] >gi|167003559|ref|ZP_02269345.1| 30S ribosomal protein S12 [Burkholderia mallei PRL-20] >gi|194317026|ref|YP_002012530.1| 30S ribosomal protein S12 [Burkholderia mallei ATCC 10399] >gi|194523126|ref|YP_002058658.1| 30S ribosomal protein S12 [Burkholderia mallei FMH] >gi|194528115|ref|YP_002063637.1| 30S ribosomal protein S12 [Burkholderia mallei JHU] >gi|194575864|ref|YP_002110747.1| 30S ribosomal protein S12 [Burkholderia mallei 2002721280] >gi|166231848|sp|A3MRU9|RS12_BURM7 30S ribosomal protein S12 >gi|166231849|sp|A2S7H1|RS12_BURM9 30S ribosomal protein S12 >gi|166231850|sp|A1V8A8|RS12_BURMS 30S ribosomal protein S12 >gi|60390783|sp|Q62GK0|RS12_BURMA 30S ribosomal protein S12 >gi|52427282|gb|AAU47875.1| ribosomal protein S12 [Burkholderia mallei ATCC 23344] >gi|121230280|gb|ABM52798.1| 30S ribosomal protein S12 [Burkholderia mallei SAVP1] >gi|124293911|gb|ABN03180.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10229] >gi|126243095|gb|ABO06188.1| 30S ribosomal protein S12 [Burkholderia mallei NCTC 10247] >gi|147747136|gb|EDK54212.1| 30S ribosomal protein S12 [Burkholderia mallei FMH] >gi|147752125|gb|EDK59191.1| 30S ribosomal protein S12 [Burkholderia mallei JHU] >gi|148026185|gb|EDK84270.1| 30S ribosomal protein S12 [Burkholderia mallei 2002721280] >gi|160696181|gb|EDP86151.1| 30S ribosomal protein S12 [Burkholderia mallei ATCC 10399] (126 aa)
Score = 382, Expect = 1.4e-35, Identities = 92/139 (66%), Positives = 102/139 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG+LDT GV+ RRQ RS YGAKR K  K
  S:     1 MPTINQLVRKGRASETTKSKSPAL-------------QDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRRQARSKYGAKRAKAAK 126
>gi|123969246|ref|YP_001010104.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. AS9601] >gi|157414112|ref|YP_001484978.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9215] >gi|166991592|sp|A8G711|RS12_PROM2 30S ribosomal protein S12 >gi|156637364|sp|A2BT86|RS12_PROMS 30S ribosomal protein S12 >gi|123199356|gb|ABM70997.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. AS9601] >gi|157388687|gb|ABV51392.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9215] (124 aa)
Score = 381, Expect = 1.5e-35, Identities = 90/137 (65%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+  +RK   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK+
  S:     1 MPTISQLVGSERKRLTKKTKSPAL-------------KACPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPKD 124
>gi|157377454|ref|YP_001476054.1| 30S ribosomal protein S12 [Shewanella sediminis HAW-EB3] >gi|189040481|sp|A8G1F3|RS12_SHESH 30S ribosomal protein S12 >gi|157319828|gb|ABV38926.1| ribosomal protein S12 [Shewanella sediminis HAW-EB3] (124 aa)
Score = 381, Expect = 1.5e-35, Identities = 88/136 (64%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL             +  P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV +RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPAL-------------DACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVSERRQGRSKYGAKRPK 123
>gi|153009281|ref|YP_001370496.1| 30S ribosomal protein S12 [Ochrobactrum anthropi ATCC 49188] >gi|166231874|sp|A6X0B3|RS12_OCHA4 30S ribosomal protein S12 >gi|151561169|gb|ABS14667.1| ribosomal protein S12 [Ochrobactrum anthropi ATCC 49188] (123 aa)
Score = 381, Expect = 1.6e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRIAPVKRNKVPAL-------------QANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|15965104|ref|NP_385457.1| 30S ribosomal protein S12 [Sinorhizobium meliloti 1021] >gi|20140129|sp|Q92QH4|RS12_RHIME 30S ribosomal protein S12 >gi|15074284|emb|CAC45930.1| Probable 30S ribosomal protein S12 [Sinorhizobium meliloti 1021] (123 aa)
Score = 381, Expect = 1.6e-35, Identities = 88/136 (64%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R+ + K++K PAL               +P KRGVCTRV T TP+KPNSALRK AK++LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRQAQVKRNKVPAL-------------QENPQKRGVCTRVYTTTPRKPNSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|189501216|ref|YP_001960686.1| ribosomal protein S12 [Chlorobium phaeobacteroides BS1] >gi|189496657|gb|ACE05205.1| ribosomal protein S12 [Chlorobium phaeobacteroides BS1] (128 aa)
Score = 381, Expect = 1.6e-35, Identities = 94/137 (68%), Positives = 100/137 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR  RK K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  RR  RS YGAKRPKE
  S:     1 MPTIQQLIRRGRKTKASKTASPAL-------------ERCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRNSRSKYGAKRPKE 124
>gi|163859278|ref|YP_001633576.1| 30S ribosomal protein S12 [Bordetella petrii DSM 12804] >gi|163263006|emb|CAP45309.1| 30S ribosomal protein S12 [Bordetella petrii] (125 aa)
Score = 381, Expect = 1.6e-35, Identities = 91/137 (66%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R+    KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTISQLVRKPREVSVIKSKSPAL-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKRPKK 124
>gi|119899711|ref|YP_934924.1| 30S ribosomal protein S12 [Azoarcus sp. BH72] >gi|158512918|sp|A1KB32|RS12_AZOSB 30S ribosomal protein S12 >gi|119672124|emb|CAL96038.1| 30S ribosomal protein S12 [Azoarcus sp. BH72] (125 aa)
Score = 381, Expect = 1.6e-35, Identities = 91/137 (66%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+    KSK PAL                P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTINQLVRKPRQMDVVKSKVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKK 124
>gi|86357300|ref|YP_469192.1| 30S ribosomal protein S12 [Rhizobium etli CFN 42] >gi|116251535|ref|YP_767373.1| 30S ribosomal protein S12 [Rhizobium leguminosarum bv. viciae 3841] >gi|119366794|sp|Q2K9M1|RS12_RHIEC 30S ribosomal protein S12 >gi|119366795|sp|Q1MIE6|RS12_RHIL3 30S ribosomal protein S12 >gi|86281402|gb|ABC90465.1| 30S ribosomal protein S12 [Rhizobium etli CFN 42] >gi|115256183|emb|CAK07264.1| putative 30S ribosomal protein S12 [Rhizobium leguminosarum bv. viciae 3841] (123 aa)
Score = 381, Expect = 1.6e-35, Identities = 88/136 (64%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R+   K++K PAL               +P KRGVCTRV T TP+KPNSALRK AK++LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRQANVKRNKVPAL-------------QENPQKRGVCTRVYTTTPRKPNSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|78779987|ref|YP_398099.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9312] >gi|115305666|sp|Q318N2|RS12_PROM9 30S ribosomal protein S12 >gi|78713486|gb|ABB50663.1| SSU ribosomal protein S12P [Prochlorococcus marinus str. MIT 9312] (124 aa)
Score = 381, Expect = 1.6e-35, Identities = 90/137 (65%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QLI  +RK   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK+
  S:     1 MPTISQLIGSERKRLTRKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPKD 124
>gi|49475799|ref|YP_033840.1| 30S ribosomal protein S12 [Bartonella henselae str. Houston-1] >gi|27151676|sp|Q8KNX8|RS12_BARHE 30S ribosomal protein S12 >gi|22450089|emb|CAC51476.1| putative ribosomal protein S12 [Bartonella henselae str. Houston-1] >gi|49238606|emb|CAF27847.1| 30S ribosomal protein s12 [Bartonella henselae str. Houston-1] (123 aa)
Score = 381, Expect = 1.7e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRITPIKRNKVPAL-------------QSNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGAKRPK 123
>gi|163705862|ref|ZP_02123853.1| 30S ribosomal subunit protein S12 [Methylobacterium nodulans ORS 2060] >gi|162428722|gb|EDQ39366.1| 30S ribosomal subunit protein S12 [Methylobacterium nodulans ORS 2060] (123 aa)
Score = 381, Expect = 1.7e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI + RK +  ++K PAL                P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIANPRKIQKSRNKVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|193211846|ref|YP_001997799.1| ribosomal protein S12 [Chlorobaculum parvum NCIB 8327] >gi|193085323|gb|ACF10599.1| ribosomal protein S12 [Chlorobaculum parvum NCIB 8327] (129 aa)
Score = 381, Expect = 1.7e-35, Identities = 92/136 (67%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIRH R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  R+Q RS YGAK+PK
  S:     1 MPTIQQLIRHGRSMKASKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPK 123
>gi|123961725|gb|ABM76508.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. NATL1A] (136 aa)
Score = 381, Expect = 1.7e-35, Identities = 92/137 (67%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +RK    K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLDT+GV+ RRQ RS YGAK PKE
  S:    13 MPTIQQLIRTERKTLKTKTKSPAL-------------RGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGTLDTAGVKDRRQSRSKYGAKSPKE 136
>gi|186684012|ref|YP_001867208.1| ribosomal protein S12/S23 [Nostoc punctiforme PCC 73102] >gi|186466464|gb|ACC82265.1| ribosomal protein S12/S23 [Nostoc punctiforme PCC 73102] (127 aa)
Score = 381, Expect = 1.8e-35, Identities = 91/140 (65%), Positives = 107/140 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QLIR++R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ R+Q RS YG KRPKE K+
  S:     1 MPTIQQLIRNEREQARQKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGTKRPKEAKK 127
>gi|23502115|ref|NP_698242.1| 30S ribosomal protein S12 [Brucella suis 1330] >gi|62290149|ref|YP_221942.1| 30S ribosomal protein S12 [Brucella abortus bv. 1 str. 9-941] >gi|82700072|ref|YP_414646.1| 30S ribosomal protein S12 [Brucella melitensis biovar Abortus 2308] >gi|148560102|ref|YP_001259158.1| 30S ribosomal protein S12 [Brucella ovis ATCC 25840] >gi|161511151|ref|NP_539669.2| 30S ribosomal protein S12 [Brucella melitensis 16M] >gi|161619194|ref|YP_001593081.1| 30S ribosomal protein S12 [Brucella canis ATCC 23365] >gi|163843504|ref|YP_001627908.1| 30S ribosomal protein S12 [Brucella suis ATCC 23445] >gi|189024387|ref|YP_001935155.1| Ribosomal protein S12 [Brucella abortus S19] >gi|166231847|sp|A5VR11|RS12_BRUO2 30S ribosomal protein S12 >gi|189040447|sp|A9M5Q5|RS12_BRUC2 30S ribosomal protein S12 >gi|189040448|sp|B0CH37|RS12_BRUSI 30S ribosomal protein S12 >gi|52783783|sp|P63194|RS12_BRUSU 30S ribosomal protein S12 >gi|52783790|sp|Q8GH23|RS12_BRUME 30S ribosomal protein S12 >gi|75496679|sp|Q57CQ3|RS12_BRUAB 30S ribosomal protein S12 >gi|90111769|sp|Q2YLZ8|RS12_BRUA2 30S ribosomal protein S12 >gi|23348075|gb|AAN30157.1| ribosomal protein S12 [Brucella suis 1330] >gi|62196281|gb|AAX74581.1| RpsL, ribosomal protein S12 [Brucella abortus biovar 1 str. 9-941] >gi|82616173|emb|CAJ11216.1| Ribosomal protein S12, bacterial and chloroplast forms:Ribosomal protein S12/S23 [Brucella melitensis biovar Abortus 2308] >gi|148371359|gb|ABQ61338.1| ribosomal protein S12 [Brucella ovis ATCC 25840] >gi|161336005|gb|ABX62310.1| ribosomal protein S12 [Brucella canis ATCC 23365] >gi|163674227|gb|ABY38338.1| ribosomal protein S12 [Brucella suis ATCC 23445] >gi|189019959|gb|ACD72681.1| Ribosomal protein S12 [Brucella abortus S19] (123 aa)
Score = 381, Expect = 1.8e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRTAPVKRNKVPAL-------------QANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|126697040|ref|YP_001091926.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9301] >gi|156637360|sp|A3PF00|RS12_PROM0 30S ribosomal protein S12 >gi|126544083|gb|ABO18325.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9301] (124 aa)
Score = 380, Expect = 1.9e-35, Identities = 90/137 (65%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+  +RK   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK+
  S:     1 MPTISQLVGSERKRLTKKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPKD 124
>gi|186460533|ref|ZP_02970831.1| ribosomal protein S12 [bacterium Ellin514] >gi|184202872|gb|EDT99932.1| ribosomal protein S12 [bacterium Ellin514] (131 aa)
Score = 380, Expect = 1.9e-35, Identities = 90/139 (64%), Positives = 103/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R    +KSKSPAL               +P++RGVC +V T TPKKPNSA+RK AKV+LTNG+EV+AYIP EGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLD +GVEKRR  RS YG KRPK  K
  S:     1 MPTINQLVRKGRNKLKRKSKSPAL-------------EVAPFRRGVCIQVMTRTPKKPNSAMRKVAKVRLTNGFEVIAYIPDEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDAAGVEKRRVSRSKYGVKRPKAAK 126
>gi|144900879|emb|CAM77743.1| 30S ribosomal protein S12 [Magnetospirillum gryphiswaldense MSR-1] (123 aa)
Score = 380, Expect = 1.9e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+    ++K PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIRKPRQPLATRNKVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTQGVKDRKQRRSKYGAKRPK 123
>gi|33862067|ref|NP_893628.1| 30S ribosomal protein S12 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|52783391|sp|Q7UZY4|RS12_PROMP 30S ribosomal protein S12 >gi|33634285|emb|CAE19970.1| 30S ribosomal protein S12 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|91070535|gb|ABE11441.1| 30S ribosomal protein S12 [uncultured Prochlorococcus marinus clone HOT0M-5C8] (125 aa)
Score = 380, Expect = 2.0e-35, Identities = 90/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QLI  +RK   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK
  S:     1 MPTISQLIGSERKRLTRKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPK 123
>gi|116075714|ref|ZP_01472973.1| 30S ribosomal protein S12 [Synechococcus sp. RS9916] >gi|116067029|gb|EAU72784.1| 30S ribosomal protein S12 [Synechococcus sp. RS9916] (124 aa)
Score = 380, Expect = 2.0e-35, Identities = 91/137 (66%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR++R+    K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRNERQSVKAKTKSPAL-------------RSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKTPKE 124
>gi|142850157|gb|ABO88478.1| ribosomal protein S12 [Aeromonas salmonicida subsp. salmonicida A449] (153 aa)
Score = 380, Expect = 2.1e-35, Identities = 87/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R     KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:    30 MATINQLVRKPRIKLVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQARSKYGVKRPK 152
>gi|114778829|ref|ZP_01453636.1| Ribosomal protein S12 [Mariprofundus ferrooxydans PV-1] >gi|114550960|gb|EAU53524.1| Ribosomal protein S12 [Mariprofundus ferrooxydans PV-1] (123 aa)
Score = 380, Expect = 2.1e-35, Identities = 93/136 (68%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  RKDK K +K PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPGEGH LQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GVE R+Q RS YGAKRPK
  S:     1 MPTVNQLIRKSRKDKRKINKVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGQEVTAYIPGEGHKLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTTGVESRKQARSKYGAKRPK 123
>gi|91774630|ref|YP_544386.1| 30S ribosomal protein S12 [Methylobacillus flagellatus KT] >gi|119366786|sp|Q1H4P2|RS12_METFK 30S ribosomal protein S12 >gi|91708617|gb|ABE48545.1| SSU ribosomal protein S12P [Methylobacillus flagellatus KT] (125 aa)
Score = 380, Expect = 2.1e-35, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+    KSK PAL                P KRGVCTRV T TPKKPNSALRK AKV+LTNGYEV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYH+VRG+LDT+GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRQKVVAKSKVPAL-------------ESCPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGYEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGSLDTAGVKDRKQARSKYGAKRPK 123
>gi|145620220|ref|ZP_01776256.1| ribosomal protein S12 [Geobacter bemidjiensis Bem] >gi|191163798|ref|ZP_03025669.1| ribosomal protein S12 [Geobacter sp. M21] >gi|144943446|gb|EDJ78535.1| ribosomal protein S12 [Geobacter bemidjiensis Bem] >gi|190994963|gb|EDV70420.1| ribosomal protein S12 [Geobacter sp. M21] >gi|197086678|gb|ACH37949.1| ribosomal protein S12 [Geobacter bemidjiensis Bem] (123 aa)
Score = 380, Expect = 2.1e-35, Identities = 92/136 (67%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIRH R+ K  KS +PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD+ GV+ R + RS YGAKRPK
  S:     1 MPTINQLIRHGRESKGDKSTAPAL-------------RSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGVEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKGRMKSRSKYGAKRPK 123
>gi|163726939|ref|ZP_02134443.1| ribosomal protein S12 [Desulfatibacillum alkenivorans AK-01] >gi|161399818|gb|EDQ24082.1| ribosomal protein S12 [Desulfatibacillum alkenivorans AK-01] (123 aa)
Score = 380, Expect = 2.2e-35, Identities = 91/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+RH RK   KK+ +PAL               SP KRGVCTRV T TPKKPNSALRK A+V+LT G EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD+ GV+ R+Q RS YGAK+PK
  S:     1 MPTINQLVRHGRKRSVKKTNTPAL-------------KASPQKRGVCTRVYTTTPKKPNSALRKVARVRLTTGMEVTAYIPGVGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSIGVQDRKQGRSHYGAKKPK 123
>gi|146298165|ref|YP_001192756.1| 30S ribosomal protein S12 [Flavobacterium johnsoniae UW101] >gi|189040459|sp|A5FMY5|RS12_FLAJO 30S ribosomal protein S12 >gi|146152583|gb|ABQ03437.1| SSU ribosomal protein S12P [Flavobacterium johnsoniae UW101] (127 aa)
Score = 380, Expect = 2.2e-35, Identities = 93/140 (66%), Positives = 103/140 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDTSGV  R Q+RS YGAKRPKE K+
  S:     1 MPTIQQLVRTGRTQITKKSKSVAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGNEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTSGVAGRTQRRSKYGAKRPKEAKK 127
>gi|121601641|ref|YP_988992.1| 30S ribosomal protein S12 [Bartonella bacilliformis KC583] >gi|121602315|ref|YP_988962.1| 30S ribosomal protein S12 [Bartonella bacilliformis KC583] >gi|158513081|sp|A1USK9|RS12_BARBK 30S ribosomal protein S12 >gi|120613818|gb|ABM44419.1| ribosomal protein S12 [Bartonella bacilliformis KC583] >gi|120614492|gb|ABM45093.1| ribosomal protein S12 [Bartonella bacilliformis KC583] (123 aa)
Score = 380, Expect = 2.4e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRVVPVKRNKVPAL-------------QANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVVIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGAKRPK 123
>gi|160895835|ref|YP_001561417.1| 30S ribosomal protein S12 [Delftia acidovorans SPH-1] >gi|160361419|gb|ABX33032.1| ribosomal protein S12 [Delftia acidovorans SPH-1] (125 aa)
Score = 380, Expect = 2.4e-35, Identities = 89/138 (64%), Positives = 102/138 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R  +  KSKSPA+                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAK+PK K
  S:     1 MPTINQLVRQGRTVEVVKSKSPAM-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKKPKAK 125
>gi|67157003|ref|ZP_00418365.1| Ribosomal protein S12, bacterial and chloroplast form [Azotobacter vinelandii AvOP] >gi|67085680|gb|EAM05152.1| Ribosomal protein S12, bacterial and chloroplast form [Azotobacter vinelandii AvOP] (123 aa)
Score = 380, Expect = 2.4e-35, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK   +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R+Q RS YGAKRPK
  S:     1 MATINQLVRQPRKRLVEKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGAKRPK 123
>gi|121592707|ref|YP_984603.1| 30S ribosomal protein S12 [Acidovorax sp. JS42] >gi|158513892|sp|A1W2Q2|RS12_ACISJ 30S ribosomal protein S12 >gi|120604787|gb|ABM40527.1| SSU ribosomal protein S12P [Acidovorax sp. JS42] (125 aa)
Score = 379, Expect = 2.6e-35, Identities = 89/138 (64%), Positives = 102/138 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R  +  KSKSPA+                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAK+PK K
  S:     1 MPTINQLVRQGRTVEVVKSKSPAM-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKKPKAK 125
>gi|159904175|ref|YP_001551519.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9211] >gi|159889351|gb|ABX09565.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9211] (123 aa)
Score = 379, Expect = 2.6e-35, Identities = 91/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +RK   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK
  S:     1 MPTIQQLIRTERKRLTRKTKSPAL-------------RSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKVPK 123
>gi|148381426|ref|YP_001255967.1| ribosomal protein S12 [Clostridium botulinum A str. ATCC 3502] >gi|153932301|ref|YP_001385801.1| 30S ribosomal protein S12 [Clostridium botulinum A str. ATCC 19397] >gi|153935598|ref|YP_001389208.1| 30S ribosomal protein S12 [Clostridium botulinum A str. Hall] >gi|153940164|ref|YP_001392839.1| 30S ribosomal protein S12 [Clostridium botulinum F str. Langeland] >gi|168178827|ref|ZP_02613491.1| ribosomal protein S12 [Clostridium botulinum NCTC 2916] >gi|168181859|ref|ZP_02616523.1| ribosomal protein S12 [Clostridium botulinum Bf] >gi|170754555|ref|YP_001783126.1| ribosomal protein S12 [Clostridium botulinum B1 str. Okra] >gi|170761310|ref|YP_001788826.1| ribosomal protein S12 [Clostridium botulinum A3 str. Loch Maree] >gi|187776571|ref|ZP_02993044.1| hypothetical protein CLOSPO_00085 [Clostridium sporogenes ATCC 15579] >gi|166231857|sp|A7FZ74|RS12_CLOB1 30S ribosomal protein S12 >gi|166231858|sp|A5I7L1|RS12_CLOBH 30S ribosomal protein S12 >gi|166231859|sp|A7GJ79|RS12_CLOBL 30S ribosomal protein S12 >gi|148290910|emb|CAL85046.1| 30S ribosomal protein S12 [Clostridium botulinum A str. ATCC 3502] >gi|152928345|gb|ABS33845.1| ribosomal protein S12 [Clostridium botulinum A str. ATCC 19397] >gi|152931512|gb|ABS37011.1| ribosomal protein S12 [Clostridium botulinum A str. Hall] >gi|152936060|gb|ABS41558.1| ribosomal protein S12 [Clostridium botulinum F str. Langeland] >gi|169119767|gb|ACA43603.1| ribosomal protein S12 [Clostridium botulinum B1 str. Okra] >gi|169408299|gb|ACA56710.1| ribosomal protein S12 [Clostridium botulinum A3 str. Loch Maree] >gi|182670272|gb|EDT82248.1| ribosomal protein S12 [Clostridium botulinum NCTC 2916] >gi|182674802|gb|EDT86763.1| ribosomal protein S12 [Clostridium botulinum Bf] >gi|187775230|gb|EDU39032.1| hypothetical protein CLOSPO_00085 [Clostridium sporogenes ATCC 15579] (125 aa)
Score = 379, Expect = 2.6e-35, Identities = 90/138 (65%), Positives = 98/138 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI+QL+R  RK     S SPAL                P KRGVCT V T TPKKPNSALRK A+++LTNGYEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD +GV  R Q RS YGAK+PK+K
  S:     1 MPTISQLVRKGRKTIASASDSPAL-------------KECPQKRGVCTVVKTTTPKKPNSALRKVARIRLTNGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDAAGVANRMQSRSKYGAKKPKQK 125
>gi|123966924|ref|YP_001012005.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9515] >gi|156637363|sp|A2BYN7|RS12_PROM5 30S ribosomal protein S12 >gi|123201290|gb|ABM72898.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9515] (125 aa)
Score = 379, Expect = 2.6e-35, Identities = 90/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QLI  +RK   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK
  S:     1 MPTISQLIGSERKRLTRKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPK 123
>gi|78064919|ref|YP_367688.1| 30S ribosomal protein S12 [Burkholderia sp. 383] >gi|107024308|ref|YP_622635.1| 30S ribosomal protein S12 [Burkholderia cenocepacia AU 1054] >gi|115350317|ref|YP_772156.1| 30S ribosomal protein S12 [Burkholderia ambifaria AMMD] >gi|116688367|ref|YP_833990.1| 30S ribosomal protein S12 [Burkholderia cenocepacia HI2424] >gi|134294438|ref|YP_001118173.1| 30S ribosomal protein S12 [Burkholderia vietnamiensis G4] >gi|161523424|ref|YP_001578436.1| 30S ribosomal protein S12 [Burkholderia multivorans ATCC 17616] >gi|167587776|ref|ZP_02380164.1| ribosomal protein S12 [Burkholderia ubonensis Bu] >gi|170701423|ref|ZP_02892381.1| ribosomal protein S12 [Burkholderia ambifaria IOP40-10] >gi|170731677|ref|YP_001763624.1| ribosomal protein S12 [Burkholderia cenocepacia MC0-3] >gi|171319363|ref|ZP_02908473.1| ribosomal protein S12 [Burkholderia ambifaria MEX-5] >gi|172059336|ref|YP_001806988.1| ribosomal protein S12 [Burkholderia ambifaria MC40-6] >gi|189351803|ref|YP_001947431.1| small subunit ribosomal protein S12 [Burkholderia multivorans ATCC 17616] >gi|194564506|ref|YP_002099529.1| 30S ribosomal protein S12 [Burkholderia dolosa AUO158] >gi|122324271|sp|Q0BJ51|RS12_BURCM 30S ribosomal protein S12 >gi|158512276|sp|A0K3M0|RS12_BURCH 30S ribosomal protein S12 >gi|166231852|sp|A4JAN5|RS12_BURVG 30S ribosomal protein S12 >gi|90111771|sp|Q39KH2|RS12_BURS3 30S ribosomal protein S12 >gi|119366758|sp|Q1BRU3|RS12_BURCA 30S ribosomal protein S12 >gi|77965664|gb|ABB07044.1| SSU ribosomal protein S12P [Burkholderia sp. 383] >gi|86370996|gb|ABC94636.1| ribosomal S12 protein [Burkholderia cenocepacia] >gi|105894497|gb|ABF77662.1| SSU ribosomal protein S12P [Burkholderia cenocepacia AU 1054] >gi|115280305|gb|ABI85822.1| SSU ribosomal protein S12P [Burkholderia ambifaria AMMD] >gi|116646456|gb|ABK07097.1| SSU ribosomal protein S12P [Burkholderia cenocepacia HI2424] >gi|124896130|gb|EAY70010.1| 30S ribosomal protein S12 [Burkholderia dolosa AUO158] >gi|134137595|gb|ABO53338.1| SSU ribosomal protein S12P [Burkholderia vietnamiensis G4] >gi|160340853|gb|ABX13939.1| ribosomal protein S12 [Burkholderia multivorans ATCC 17616] >gi|169814919|gb|ACA89502.1| ribosomal protein S12 [Burkholderia cenocepacia MC0-3] >gi|170133675|gb|EDT02045.1| ribosomal protein S12 [Burkholderia ambifaria IOP40-10] >gi|171095434|gb|EDT40406.1| ribosomal protein S12 [Burkholderia ambifaria MEX-5] >gi|171991853|gb|ACB62772.1| ribosomal protein S12 [Burkholderia ambifaria MC40-6] >gi|189335825|dbj|BAG44895.1| small subunit ribosomal protein S12 [Burkholderia multivorans ATCC 17616] (126 aa)
Score = 379, Expect = 2.6e-35, Identities = 91/139 (65%), Positives = 103/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R+ +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG+LDT GV+ R+Q RS YGAKR K  K
  S:     1 MPTINQLVRKGRQSETTKSKSPAL-------------QDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGAKRAKAAK 126
>gi|194334866|ref|YP_002016726.1| ribosomal protein S12 [Prosthecochloris aestuarii DSM 271] >gi|194312684|gb|ACF47079.1| ribosomal protein S12 [Prosthecochloris aestuarii DSM 271] (128 aa)
Score = 379, Expect = 2.7e-35, Identities = 93/136 (68%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  RRQ RS YGAKRPK
  S:     1 MPTIQQLIRRGRTTKASKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRRQGRSKYGAKRPK 123
>gi|163868655|ref|YP_001609864.1| 30S ribosomal protein S12 [Bartonella tribocorum CIP 105476] >gi|189040446|sp|A9IW34|RS12_BART1 30S ribosomal protein S12 >gi|161018311|emb|CAK01869.1| 30S ribosomal protein S12 [Bartonella tribocorum CIP 105476] (123 aa)
Score = 379, Expect = 2.7e-35, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AK++LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRVAPVKRNKVPAL-------------QSNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGAKRPK 123
>gi|89902560|ref|YP_525031.1| 30S ribosomal protein S12 [Rhodoferax ferrireducens T118] >gi|119366796|sp|Q21RV3|RS12_RHOFD 30S ribosomal protein S12 >gi|89347297|gb|ABD71500.1| SSU ribosomal protein S12P [Rhodoferax ferrireducens T118] (125 aa)
Score = 379, Expect = 2.8e-35, Identities = 90/138 (65%), Positives = 104/138 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R+ +  KSKSPA+               SP +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAK+PK K
  S:     1 MPTINQLVRQGREVETIKSKSPAM-------------QNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKKPKAK 125
>gi|192359064|ref|YP_001981203.1| ribosomal protein S12 [Cellvibrio japonicus Ueda107] >gi|190685229|gb|ACE82907.1| ribosomal protein S12 [Cellvibrio japonicus Ueda107] (128 aa)
Score = 379, Expect = 2.8e-35, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK    KS  PAL               +P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV KR+Q RS YGAKRPK
  S:     6 MPTINQLVRKPRKRIVDKSDVPAL-------------QGNPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVAKRKQGRSKYGAKRPK 128
>gi|33241116|ref|NP_876058.1| 30S ribosomal protein S12 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|52783393|sp|Q7VA02|RS12_PROMA 30S ribosomal protein S12 >gi|33238646|gb|AAQ00711.1| Ribosomal protein S12 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (124 aa)
Score = 379, Expect = 2.8e-35, Identities = 90/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK
  S:     1 MPTIQQLIRTERQRLTRKTKSPAL-------------RSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQARSKYGAKAPK 123
>gi|150025411|ref|YP_001296237.1| 30S ribosomal protein S12 [Flavobacterium psychrophilum JIP02/86] >gi|166231860|sp|A6GZA3|RS12_FLAPJ 30S ribosomal protein S12 >gi|149771952|emb|CAL43426.1| 30S ribosomal protein S12 [Flavobacterium psychrophilum JIP02/86] (127 aa)
Score = 379, Expect = 2.9e-35, Identities = 93/140 (66%), Positives = 103/140 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDTSGV  R Q+RS YGAKRPKE K+
  S:     1 MPTIQQLVRIGRTKMTKKSKSVAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGNEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTSGVAGRTQRRSKYGAKRPKEAKK 127
>gi|157960009|ref|YP_001500043.1| 30S ribosomal protein S12 [Shewanella pealeana ATCC 700345] >gi|167626044|ref|YP_001676338.1| 30S ribosomal protein S12 [Shewanella halifaxensis HAW-EB4] >gi|189040479|sp|B0TM17|RS12_SHEHH 30S ribosomal protein S12 >gi|189040480|sp|A8GYX1|RS12_SHEPA 30S ribosomal protein S12 >gi|157845009|gb|ABV85508.1| ribosomal protein S12 [Shewanella pealeana ATCC 700345] >gi|167356066|gb|ABZ78679.1| ribosomal protein S12 [Shewanella halifaxensis HAW-EB4] (124 aa)
Score = 379, Expect = 2.9e-35, Identities = 88/136 (64%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD +GV +RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPALA-------------ACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCAGVSERRQGRSKYGAKRPK 123
>gi|78221841|ref|YP_383588.1| 30S ribosomal protein S12 [Geobacter metallireducens GS-15] >gi|115305656|sp|Q39Y11|RS12_GEOMG 30S ribosomal protein S12 >gi|78193096|gb|ABB30863.1| SSU ribosomal protein S12P [Geobacter metallireducens GS-15] (123 aa)
Score = 379, Expect = 2.9e-35, Identities = 94/136 (69%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  RK K +KS SPAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD+ GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLIRIGRKSKKEKSNSPAL-------------KSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIEVSSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKQARSKYGAKRPK 123
>gi|149072034|ref|YP_001293605.1| ribosomal protein S12 [Rhodomonas salina] >gi|134302985|gb|ABO70789.1| ribosomal protein S12 [Rhodomonas salina] (124 aa)
Score = 379, Expect = 2.9e-35, Identities = 93/137 (67%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +RK   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHN+QEHSVVL+ GGRVKDLPGVRYHIVRGTLD SGV+ RRQ RS YGAK+PKE
  S:     1 MPTIQQLIRSERKKIKKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNIQEHSVVLLRGGRVKDLPGVRYHIVRGTLDASGVKDRRQARSKYGAKKPKE 124
>gi|133752|sp|P13576|RS12_SPIPL 30S ribosomal protein S12 >gi|47448|emb|CAA33670.1| unnamed protein product [Arthrospira platensis] (124 aa)
Score = 379, Expect = 3.0e-35, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ RR  RS YGAKRPK
  S:     1 MPTIQQLIRSAREKTDKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRNGRSKYGAKRPK 123
>gi|171060531|ref|YP_001792880.1| ribosomal protein S12 [Leptothrix cholodnii SP-6] >gi|170777976|gb|ACB36115.1| ribosomal protein S12 [Leptothrix cholodnii SP-6] (125 aa)
Score = 379, Expect = 3.1e-35, Identities = 88/137 (64%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+ +  KSKSPA+                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YG+KRPK+
  S:     1 MPTINQLVRQGREVEVTKSKSPAM-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGSKRPKK 124
>gi|119468173|ref|ZP_01611299.1| 30S ribosomal protein S12 [Alteromonadales bacterium TW-7] >gi|119448166|gb|EAW29430.1| 30S ribosomal protein S12 [Alteromonadales bacterium TW-7] (124 aa)
Score = 379, Expect = 3.1e-35, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+ K  KS S AL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVR+H VRG LD +GV  RRQ RS YGAKRPK
  S:     1 MATINQLVRKPRRSKVTKSNSAAL-------------KACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDCAGVSDRRQARSKYGAKRPK 123
>gi|17547743|ref|NP_521145.1| 30S ribosomal protein S12 [Ralstonia solanacearum GMI1000] >gi|83749346|ref|ZP_00946342.1| SSU ribosomal protein S12P [Ralstonia solanacearum UW551] >gi|153887294|ref|ZP_02008446.1| ribosomal protein S12 [Ralstonia pickettii 12D] >gi|187930369|ref|YP_001900856.1| ribosomal protein S12 [Ralstonia pickettii 12J] >gi|20140043|sp|Q8XV08|RS12_RALSO 30S ribosomal protein S12 >gi|17430048|emb|CAD16733.1| probable 30s ribosomal protein s12. [Ralstonia solanacearum] >gi|83723971|gb|EAP71153.1| SSU ribosomal protein S12P [Ralstonia solanacearum UW551] >gi|151576382|gb|EDN40786.1| ribosomal protein S12 [Ralstonia pickettii 12D] >gi|187727259|gb|ACD28424.1| ribosomal protein S12 [Ralstonia pickettii 12J] (125 aa)
Score = 378, Expect = 3.2e-35, Identities = 91/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRVSEKLKSKSPAL-------------ENCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKRPK 123
>gi|121603115|ref|YP_980444.1| 30S ribosomal protein S12 [Polaromonas naphthalenivorans CJ2] >gi|158513919|sp|A1VIP5|RS12_POLNA 30S ribosomal protein S12 >gi|120592084|gb|ABM35523.1| SSU ribosomal protein S12P [Polaromonas naphthalenivorans CJ2] (125 aa)
Score = 378, Expect = 3.3e-35, Identities = 90/138 (65%), Positives = 104/138 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R+ +  KSKSPA+               SP +RGVCTRV T TPKKPNSALRK AKV+LTNG+E+++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK K
  S:     1 MPTINQLVRQGREVEKIKSKSPAM-------------ENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEIISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKAK 125
>gi|120609036|ref|YP_968714.1| 30S ribosomal protein S12 [Acidovorax avenae subsp. citrulli AAC00-1] >gi|158513022|sp|A1TJ02|RS12_ACIAC 30S ribosomal protein S12 >gi|120587500|gb|ABM30940.1| SSU ribosomal protein S12P [Acidovorax avenae subsp. citrulli AAC00-1] (125 aa)
Score = 378, Expect = 3.3e-35, Identities = 90/138 (65%), Positives = 104/138 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R+ +  KSKSPA+               SP +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAK+PK K
  S:     1 MPTINQLVRQGREVETTKSKSPAM-------------QNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKKPKAK 125
>gi|83755699|gb|ABC43812.1| ribosomal protein S12 [Salinibacter ruber DSM 13855] (150 aa)
Score = 378, Expect = 3.3e-35, Identities = 88/135 (65%), Positives = 101/135 (74%)
  Q:     3 TIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           T  QLIR  RK + + S +PAL               SP +RGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GVE+RRQ RS YG K+P+E
  S:    29 TTQQLIRKGRKTEEETSDAPAL-------------EGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGNEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVEERRQGRSKYGTKKPRE 150
>gi|71280149|ref|YP_271411.1| 30S ribosomal protein S12 [Colwellia psychrerythraea 34H] >gi|90111775|sp|Q47UW1|RS12_COLP3 30S ribosomal protein S12 >gi|71145889|gb|AAZ26362.1| ribosomal protein S12 [Colwellia psychrerythraea 34H] (124 aa)
Score = 378, Expect = 3.4e-35, Identities = 89/136 (65%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  +  KS  PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV  RRQ RS YGAKRPK
  S:     1 MATINQLVRKPRVRQVTKSNVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVSDRRQGRSKYGAKRPK 123
>gi|169830431|ref|YP_001716413.1| ribosomal protein S12 [Candidatus Desulforudis audaxviator MP104C] >gi|169637275|gb|ACA58781.1| ribosomal protein S12 [Candidatus Desulforudis audaxviator MP104C] (124 aa)
Score = 378, Expect = 3.4e-35, Identities = 91/137 (66%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QLIR  R+   +KS SPAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNGYEV  YIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV+ R + RS YGAKRPK+
  S:     1 MPTISQLIRRGRETVAQKSASPAL-------------RECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGYEVTTYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTAGVQNRNRGRSKYGAKRPKK 124
>gi|53720826|ref|YP_109812.1| 30S ribosomal protein S12 [Burkholderia pseudomallei K96243] >gi|76809886|ref|YP_335146.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1710b] >gi|83719839|ref|YP_443577.1| 30S ribosomal protein S12 [Burkholderia thailandensis E264] >gi|126439365|ref|YP_001060755.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 668] >gi|126454808|ref|YP_001068039.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1106a] >gi|134283192|ref|ZP_01769893.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 305] >gi|161358178|ref|ZP_02104051.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1106b] >gi|161375468|ref|ZP_02114998.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1710a] >gi|167582627|ref|ZP_02375501.1| 30S ribosomal protein S12 [Burkholderia thailandensis TXDOH] >gi|167620741|ref|ZP_02389372.1| 30S ribosomal protein S12 [Burkholderia thailandensis Bt4] >gi|167721581|ref|ZP_02404817.1| 30S ribosomal protein S12 [Burkholderia pseudomallei DM98] >gi|167740555|ref|ZP_02413329.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 14] >gi|167817760|ref|ZP_02449440.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 91] >gi|167826157|ref|ZP_02457628.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 9] >gi|167838216|ref|ZP_02465075.1| 30S ribosomal protein S12 [Burkholderia thailandensis MSMB43] >gi|167847669|ref|ZP_02473177.1| 30S ribosomal protein S12 [Burkholderia pseudomallei B7210] >gi|167896241|ref|ZP_02483643.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 7894] >gi|167904623|ref|ZP_02491828.1| 30S ribosomal protein S12 [Burkholderia pseudomallei NCTC 13177] >gi|167912888|ref|ZP_02499979.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 112] >gi|167920848|ref|ZP_02507939.1| 30S ribosomal protein S12 [Burkholderia pseudomallei BCC215] >gi|194504988|ref|YP_002034559.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1655] >gi|194508599|ref|YP_002021132.1| 30S ribosomal protein S12 [Burkholderia pseudomallei Pasteur 52237] >gi|194514216|ref|YP_002049737.1| 30S ribosomal protein S12 [Burkholderia pseudomallei S13] >gi|194567764|ref|YP_002102772.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 406e] >gi|158513538|sp|A3P0B8|RS12_BURP0 30S ribosomal protein S12 >gi|166231851|sp|A3NEI4|RS12_BURP6 30S ribosomal protein S12 >gi|60390787|sp|Q63Q06|RS12_BURPS 30S ribosomal protein S12 >gi|90111770|sp|Q3JMQ7|RS12_BURP1 30S ribosomal protein S12 >gi|115305655|sp|Q2SU22|RS12_BURTA 30S ribosomal protein S12 >gi|52211240|emb|CAH37229.1| 30S ribosomal protein S12 [Burkholderia pseudomallei K96243] >gi|76579339|gb|ABA48814.1| ribosomal protein S12 [Burkholderia pseudomallei 1710b] >gi|83653664|gb|ABC37727.1| ribosomal protein S12 [Burkholderia thailandensis E264] >gi|126218858|gb|ABN82364.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 668] >gi|126228450|gb|ABN91990.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1106a] >gi|134245387|gb|EBA45480.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 305] >gi|157810594|gb|EDO87764.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 406e] >gi|157937975|gb|EDO93645.1| 30S ribosomal protein S12 [Burkholderia pseudomallei Pasteur 52237] >gi|169655263|gb|EDS87956.1| 30S ribosomal protein S12 [Burkholderia pseudomallei S13] >gi|184210875|gb|EDU07918.1| 30S ribosomal protein S12 [Burkholderia pseudomallei 1655] (126 aa)
Score = 378, Expect = 3.4e-35, Identities = 91/139 (65%), Positives = 102/139 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG+LDT GV+ R+Q RS YGAKR K  K
  S:     1 MPTINQLVRKGRASETTKSKSPAL-------------QDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGAKRAKAAK 126
>gi|163759413|ref|ZP_02166499.1| 30S ribosomal protein S12 [Hoeflea phototrophica DFL-43] >gi|162283817|gb|EDQ34102.1| 30S ribosomal protein S12 [Hoeflea phototrophica DFL-43] (123 aa)
Score = 378, Expect = 3.5e-35, Identities = 89/136 (65%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R+   K++K PAL               +P KRGVCTRV T TPKKPNSALRK AK++LTNGYEV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYH++RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRQAPVKRNKVPAL-------------EQNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTNGYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHVIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|120553647|ref|YP_957998.1| 30S ribosomal protein S12 [Marinobacter aquaeolei VT8] >gi|158513042|sp|A1TYJ2|RS12_MARAV 30S ribosomal protein S12 >gi|120323496|gb|ABM17811.1| SSU ribosomal protein S12P [Marinobacter aquaeolei VT8] (124 aa)
Score = 378, Expect = 3.5e-35, Identities = 92/136 (67%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLDT GV+ R+Q RS YGAKRPK
  S:     1 MATINQLVRKPRKRKVAKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTQGVQNRKQGRSKYGAKRPK 123
>gi|110833241|ref|YP_692100.1| 30S ribosomal protein S12 [Alcanivorax borkumensis SK2] >gi|119366754|sp|Q0VSM0|RS12_ALCBS 30S ribosomal protein S12 >gi|110646352|emb|CAL15828.1| 30S ribosomal protein S12. [Alcanivorax borkumensis SK2] (123 aa)
Score = 378, Expect = 3.6e-35, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  RK K +KS S AL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLDT+GV+ R+Q+RS YGAKRPK
  S:     1 MATVNQLVRKPRKSKVEKSDSVAL-------------QGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTAGVQDRKQRRSKYGAKRPK 123
>gi|88861462|ref|ZP_01136089.1| 30S ribosomal protein S12 [Pseudoalteromonas tunicata D2] >gi|88816544|gb|EAR26372.1| 30S ribosomal protein S12 [Pseudoalteromonas tunicata D2] (124 aa)
Score = 378, Expect = 3.6e-35, Identities = 88/136 (64%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+ K  KS S AL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVR+H +RG LD +GV  RRQ RS YGAKRPK
  S:     1 MATINQLVRKPRRSKVVKSNSAAL-------------KACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTIRGALDCAGVSARRQARSKYGAKRPK 123
>gi|92112549|ref|YP_572477.1| 30S ribosomal protein S12 [Chromohalobacter salexigens DSM 3043] >gi|119366761|sp|Q1R0I0|RS12_CHRSD 30S ribosomal protein S12 >gi|91795639|gb|ABE57778.1| SSU ribosomal protein S12P [Chromohalobacter salexigens DSM 3043] (124 aa)
Score = 378, Expect = 3.6e-35, Identities = 92/136 (67%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK    KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LDTSGV+ RRQ RS YG KRPK
  S:     1 MATINQLVRKPRKRPVAKSDVPAL-------------QSCPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDTSGVQNRRQGRSKYGTKRPK 123
>gi|194477019|ref|YP_002049198.1| 30S ribosomal protein S12 [Paulinella chromatophora] >gi|171192026|gb|ACB42988.1| 30S ribosomal protein S12 [Paulinella chromatophora] (124 aa)
Score = 378, Expect = 3.7e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI+ +R    +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PK
  S:     1 MPTIQQLIQTERTRLTRKTKSPAL-------------RACPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKNRRQSRSKYGAKTPK 123
>gi|18311392|ref|NP_563326.1| 30S ribosomal protein S12 [Clostridium perfringens str. 13] >gi|110799165|ref|YP_697099.1| 30S ribosomal protein S12 [Clostridium perfringens ATCC 13124] >gi|110802980|ref|YP_699668.1| 30S ribosomal protein S12 [Clostridium perfringens SM101] >gi|168208046|ref|ZP_02634051.1| ribosomal protein S12 [Clostridium perfringens E str. JGS1987] >gi|168211999|ref|ZP_02637624.1| ribosomal protein S12 [Clostridium perfringens B str. ATCC 3626] >gi|168218310|ref|ZP_02643935.1| ribosomal protein S12 [Clostridium perfringens NCTC 8239] >gi|169344018|ref|ZP_02865008.1| ribosomal protein S12 [Clostridium perfringens C str. JGS1495] >gi|20140037|sp|Q8XHR9|RS12_CLOPE 30S ribosomal protein S12 >gi|119366763|sp|Q0TMP1|RS12_CLOP1 30S ribosomal protein S12 >gi|119366764|sp|Q0SQD9|RS12_CLOPS 30S ribosomal protein S12 >gi|18146076|dbj|BAB82116.1| 30S ribosomal protein S12 [Clostridium perfringens str. 13] >gi|110673812|gb|ABG82799.1| ribosomal protein S12 [Clostridium perfringens ATCC 13124] >gi|110683481|gb|ABG86851.1| ribosomal protein S12 [Clostridium perfringens SM101] >gi|169297842|gb|EDS79938.1| ribosomal protein S12 [Clostridium perfringens C str. JGS1495] >gi|170660662|gb|EDT13345.1| ribosomal protein S12 [Clostridium perfringens E str. JGS1987] >gi|170710069|gb|EDT22251.1| ribosomal protein S12 [Clostridium perfringens B str. ATCC 3626] >gi|182379685|gb|EDT77164.1| ribosomal protein S12 [Clostridium perfringens NCTC 8239] (126 aa)
Score = 378, Expect = 3.7e-35, Identities = 92/139 (66%), Positives = 101/139 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI+QL+R  RK    KS +PAL                P KRGVCT V T TPKKPNSALRK A+V+LTNGYEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD++GV  R Q RS YGAK+PK+KK
  S:     1 MPTISQLVRKGRKTVASKSTAPAL-------------KECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSAGVANRMQGRSKYGAKKPKQKK 126
>gi|187925621|ref|YP_001897263.1| ribosomal protein S12 [Burkholderia phytofirmans PsJN] >gi|187716815|gb|ACD18039.1| ribosomal protein S12 [Burkholderia phytofirmans PsJN] (126 aa)
Score = 378, Expect = 3.8e-35, Identities = 91/139 (65%), Positives = 103/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R+ +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG+LDT GV+ R+Q RS YGAKR K  K
  S:     1 MPTINQLVRKGRQSETTKSKSPAL-------------QDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGAKRAKAGK 126
>gi|34499646|ref|NP_903861.1| 30S ribosomal protein S12 [Chromobacterium violaceum ATCC 12472] >gi|52783386|sp|Q7NQE8|RS12_CHRVO 30S ribosomal protein S12 >gi|34105496|gb|AAQ61851.1| 30S ribosomal protein S12 [Chromobacterium violaceum ATCC 12472] (123 aa)
Score = 378, Expect = 3.8e-35, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R     KSK PAL                P KRGVCTRV T TPKKPNSALRK  KV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDT+GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKGRVAITAKSKVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGAKRPK 123
>gi|157363437|ref|YP_001470204.1| 30S ribosomal protein S12 [Thermotoga lettingae TMO] >gi|166991594|sp|A8F4Q6|RS12_THELT 30S ribosomal protein S12 >gi|157314041|gb|ABV33140.1| ribosomal protein S12 [Thermotoga lettingae TMO] (124 aa)
Score = 378, Expect = 3.8e-35, Identities = 90/137 (65%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR  R+ K +K K+PAL               +P KRGVC RV TMTPKKPNSALRK A+V+L+NG EV AYIPG GHNLQEHSVVL+ GGRVKDLPG+RY I+RGTLDT+GVE R+Q RS YGAKRPK+
  S:     1 MPTINQLIRLGRERKVEKPKAPAL-------------QGNPQKRGVCVRVTTMTPKKPNSALRKIARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGIRYKIIRGTLDTAGVENRKQSRSKYGAKRPKK 124
>gi|33864046|ref|NP_895606.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9313] >gi|124024052|ref|YP_001018359.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9303] >gi|52783392|sp|Q7V503|RS12_PROMM 30S ribosomal protein S12 >gi|156637362|sp|A2CC84|RS12_PROM3 30S ribosomal protein S12 >gi|33635630|emb|CAE21954.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9313] >gi|123964338|gb|ABM79094.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. MIT 9303] (125 aa)
Score = 378, Expect = 3.8e-35, Identities = 89/137 (64%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ R Q RS YGAK  K+
  S:     1 MPTIQQLIRTERQHLTRKTKSPAL-------------RACPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRSQSRSKYGAKASKQ 124
>gi|114319614|ref|YP_741297.1| 30S ribosomal protein S12 [Alkalilimnicola ehrlichei MLHE-1] >gi|119366755|sp|Q0ABI0|RS12_ALHEH 30S ribosomal protein S12 >gi|114226008|gb|ABI55807.1| SSU ribosomal protein S12P [Alkalilimnicola ehrlichei MLHE-1] (124 aa)
Score = 378, Expect = 4.0e-35, Identities = 93/136 (68%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK +  KS  PAL               SP KRGVCTRV T TPKKPNSALRK A+V+LTN YEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG  DT+GV+KRRQ RS YGAKRPK
  S:     1 MATINQLVRKGRKRRVAKSNVPAL-------------EASPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNNYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGAADTAGVDKRRQGRSKYGAKRPK 123
>gi|146281165|ref|YP_001171318.1| 30S ribosomal protein S12 [Pseudomonas stutzeri A1501] >gi|158514169|sp|A4VHM5|RS12_PSEU5 30S ribosomal protein S12 >gi|145569370|gb|ABP78476.1| 30S ribosomal protein S12 [Pseudomonas stutzeri A1501] (123 aa)
Score = 378, Expect = 4.0e-35, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK   +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRV+DLPGVRYH VRG+LDTSGV+ R+Q RS YGAKRPK
  S:     1 MATINQLVRQPRKRVVEKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVASYIGGEGHNLQEHSVVLIRGGRVRDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGAKRPK 123
>gi|83591281|ref|YP_431290.1| 30S ribosomal protein S12 [Moorella thermoacetica ATCC 39073] >gi|115305661|sp|Q2RFP2|RS12_MOOTA 30S ribosomal protein S12 >gi|83574195|gb|ABC20747.1| SSU ribosomal protein S12P [Moorella thermoacetica ATCC 39073] (124 aa)
Score = 378, Expect = 4.1e-35, Identities = 91/137 (66%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+   +KS +PAL               SP KRGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD +GV+ R Q RS YGAKRPK+
  S:     1 MPTIQQLVRQAREKVVRKSTAPAL-------------KESPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAAGVQNRNQGRSKYGAKRPKK 124
>gi|21675003|ref|NP_663068.1| 30S ribosomal protein S12 [Chlorobium tepidum TLS] >gi|25009158|sp|Q8KAG8|RS12_CHLTE 30S ribosomal protein S12 >gi|21648237|gb|AAM73410.1| ribosomal protein S12 [Chlorobium tepidum TLS] (132 aa)
Score = 378, Expect = 4.1e-35, Identities = 90/133 (67%), Positives = 97/133 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAK 133
           M TI QLIRH R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  R+Q RS YGAK
  S:     1 MPTIQQLIRHGRSMKASKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAK 120
>gi|88807941|ref|ZP_01123452.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7805] >gi|148238718|ref|YP_001224105.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7803] >gi|158513312|sp|A5GIP3|RS12_SYNPW 30S ribosomal protein S12 >gi|88787980|gb|EAR19136.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7805] >gi|147847257|emb|CAK22808.1| 30S ribosomal protein S12 [Synechococcus sp. WH 7803] (124 aa)
Score = 378, Expect = 4.2e-35, Identities = 91/137 (66%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R+    K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERQSSKAKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKTPKE 124
>gi|167564421|ref|ZP_02357337.1| 30S ribosomal protein S12 [Burkholderia oklahomensis EO147] >gi|167571567|ref|ZP_02364441.1| 30S ribosomal protein S12 [Burkholderia oklahomensis C6786] (126 aa)
Score = 377, Expect = 4.2e-35, Identities = 91/139 (65%), Positives = 102/139 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG+LDT GV+ R+Q RS YGAKR K  K
  S:     1 MPTINQLVRKGRTSETTKSKSPAL-------------QDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGAKRAKAAK 126
>gi|91785470|ref|YP_560676.1| 30S ribosomal protein S12 [Burkholderia xenovorans LB400] >gi|119366759|sp|Q13TG5|RS12_BURXL 30S ribosomal protein S12 >gi|91689424|gb|ABE32624.1| SSU ribosomal protein S12P [Burkholderia xenovorans LB400] (126 aa)
Score = 377, Expect = 4.2e-35, Identities = 91/139 (65%), Positives = 102/139 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG+LDT GV+ R+Q RS YGAKR K  K
  S:     1 MPTINQLVRKGRASETTKSKSPAL-------------QDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGAKRAKAGK 126
>gi|196242038|ref|ZP_03140796.1| ribosomal protein S12 [Cyanothece sp. PCC 7425] >gi|196213914|gb|EDY08575.1| ribosomal protein S12 [Cyanothece sp. PCC 7425] (136 aa)
Score = 377, Expect = 4.3e-35, Identities = 91/136 (66%), Positives = 105/136 (77%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R++  KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ R+Q RS YGAKRPK
  S:     1 MPTIQQLIRSERQELKKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGAKRPK 123
>gi|154249822|ref|YP_001410647.1| 30S ribosomal protein S12 [Fervidobacterium nodosum Rt17-B1] >gi|171769381|sp|A7HM57|RS12_FERNB 30S ribosomal protein S12 >gi|154153758|gb|ABS60990.1| ribosomal protein S12 [Fervidobacterium nodosum Rt17-B1] (134 aa)
Score = 377, Expect = 4.3e-35, Identities = 89/135 (65%), Positives = 99/135 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRP 135
           M TI QL++H R+   +KSKSPAL                P KRGVC RV TMTPKKPNSALRK AKV+L+NG EV AYIPG GHNLQEHS+VL+ GGRVKDLPGVRY I+RG LD +GVE RRQ RS YGAKRP
  S:     1 MPTINQLVKHGREKVKEKSKSPAL-------------QGHPQKRGVCVRVSTMTPKKPNSALRKIAKVRLSNGIEVTAYIPGIGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVENRRQSRSKYGAKRP 122
>gi|26110368|gb|AAN82554.1|AE016767_314 30S ribosomal protein S12 [Escherichia coli CFT073] >gi|91074392|gb|ABE09273.1| 30S ribosomal subunit protein S12 [Escherichia coli UTI89] (144 aa)
Score = 377, Expect = 4.5e-35, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:    21 MATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 143
>gi|469218|dbj|BAA03487.1| altered ribosomal protein S12 [Cloning vector pKF2] >gi|469221|dbj|BAA03489.1| altered ribosomal protein S12 [Cloning vector pKF3] >gi|1199493|dbj|BAA08267.1| altered ribosomal protein S12 [Cloning vector pKF4] >gi|1707359|dbj|BAA01520.1| altered ribosomal protein S12 [unidentified cloning vector] >gi|1711293|dbj|BAA01521.1| altered ribosomal protein S12 [unidentified cloning vector] (124 aa)
Score = 377, Expect = 4.5e-35, Identities = 86/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRG+CTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPG+RYH VRG LD SGV+ RRQ RS YG KRPK
  S:     1 MATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGICTRVYTTTPKKPNSALRKLCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGIRYHTVRGALDCSGVKDRRQDRSKYGVKRPK 123
>gi|58427806|gb|AAW76843.1| 30S ribosomal protein S12 [Xanthomonas oryzae pv. oryzae KACC10331] (163 aa)
Score = 377, Expect = 4.6e-35, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+    KS SPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:    40 MTTINQLVRKPRQATTYKSASPAL-------------DKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGAKRPK 162
>gi|183597110|ref|ZP_02958603.1| hypothetical protein PROSTU_00351 [Providencia stuartii ATCC 25827] >gi|188023773|gb|EDU61813.1| hypothetical protein PROSTU_00351 [Providencia stuartii ATCC 25827] (124 aa)
Score = 377, Expect = 4.6e-35, Identities = 89/136 (65%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YGAK+PK
  S:     1 MATINQLVRKSRSSKVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGAKKPK 123
>gi|13470547|ref|NP_102115.1| 30S ribosomal protein S12 [Mesorhizobium loti MAFF303099] >gi|20140189|sp|Q98N61|RS12_RHILO 30S ribosomal protein S12 >gi|14021288|dbj|BAB47901.1| 30S ribosomal protein S12 [Mesorhizobium loti MAFF303099] (123 aa)
Score = 377, Expect = 4.8e-35, Identities = 88/136 (64%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PA+               +P KRGVCTRV T TPKKPNSALRK AK++LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRIAPVKRNKVPAM-------------QQNPQKRGVCTRVYTTTPKKPNSALRKVAKIRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|119502917|ref|ZP_01625002.1| 30S ribosomal protein S12 [marine gamma proteobacterium HTCC2080] >gi|119461263|gb|EAW42353.1| 30S ribosomal protein S12 [marine gamma proteobacterium HTCC2080] (123 aa)
Score = 377, Expect = 4.8e-35, Identities = 91/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  RK K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRKRKVMKSGVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVSARRQGRSKYGAKRPK 123
>gi|153868767|ref|ZP_01998512.1| Ribosomal protein S12/S23 [Beggiatoa sp. PS] >gi|152074644|gb|EDN71479.1| Ribosomal protein S12/S23 [Beggiatoa sp. PS] (127 aa)
Score = 377, Expect = 4.9e-35, Identities = 93/136 (68%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK +  KS +PAL                P KRGVCTRV T TPKKPNSA+RK A+V+LTNG EV  YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLDTSGV+ RRQ RS YGAKRPK
  S:     1 MATINQLVRKPRKRQQSKSTTPAL-------------EGCPQKRGVCTRVYTTTPKKPNSAMRKVARVRLTNGMEVTTYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTSGVDVRRQGRSKYGAKRPK 123
>gi|116227369|gb|ABJ86078.1| SSU ribosomal protein S12P [Solibacter usitatus Ellin6076] (144 aa)
Score = 377, Expect = 4.9e-35, Identities = 86/134 (64%), Positives = 96/134 (71%)
  Q:     3 TIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           T  QL+R+ RK    K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV  YIPG GHNLQEHS+VLI GGRVKDLPGVRYH++RG LDT+GV  R+Q RS YGAKRPK
  S:    23 TFNQLVRNGRKPPRWKTSSPAL-------------ESCPQKRGVCTRVYTSTPKKPNSALRKVARVRLTNGIEVTTYIPGVGHNLQEHSIVLIRGGRVKDLPGVRYHVIRGALDTAGVANRKQSRSKYGAKRPK 143
>gi|52840569|ref|YP_094368.1| 30S ribosomal protein S12 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54293316|ref|YP_125731.1| 30S ribosomal protein S12 [Legionella pneumophila str. Lens] >gi|54296360|ref|YP_122729.1| 30S ribosomal protein S12 [Legionella pneumophila str. Paris] >gi|148361058|ref|YP_001252265.1| 30S ribosomal protein S12 [Legionella pneumophila str. Corby] >gi|166231867|sp|A5IHR9|RS12_LEGPC 30S ribosomal protein S12 >gi|60390774|sp|Q5WZL7|RS12_LEGPL 30S ribosomal protein S12 >gi|60390775|sp|Q5X864|RS12_LEGPA 30S ribosomal protein S12 >gi|60390780|sp|Q5ZYP8|RS12_LEGPH 30S ribosomal protein S12 >gi|52627680|gb|AAU26421.1| 30S ribosomal protein S12 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53750145|emb|CAH11537.1| 30S ribosomal protein S12 [Legionella pneumophila str. Paris] >gi|53753148|emb|CAH14595.1| 30S ribosomal protein S12 [Legionella pneumophila str. Lens] >gi|148282831|gb|ABQ56919.1| hypothetical protein LPC_3019 [Legionella pneumophila str. Corby] (126 aa)
Score = 377, Expect = 4.9e-35, Identities = 91/139 (65%), Positives = 102/139 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           MATI QL+R  R D  KKS  PAL                P +RGVCTRV T TPKKPNSA+RK A+V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV  R+Q RS YG K+PK+KK
  S:     1 MATINQLVRKPRVDVKKKSNVPAL-------------ESCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVNDRKQGRSKYGTKKPKDKK 126
>gi|170696807|ref|ZP_02887913.1| ribosomal protein S12 [Burkholderia graminis C4D1M] >gi|186477593|ref|YP_001859063.1| ribosomal protein S12 [Burkholderia phymatum STM815] >gi|170138285|gb|EDT06507.1| ribosomal protein S12 [Burkholderia graminis C4D1M] >gi|184194052|gb|ACC72017.1| ribosomal protein S12 [Burkholderia phymatum STM815] (126 aa)
Score = 377, Expect = 5.0e-35, Identities = 91/139 (65%), Positives = 102/139 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R  +  KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG+LDT GV+ R+Q RS YGAKR K  K
  S:     1 MPTINQLVRKGRTSETTKSKSPAL-------------QDCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHMVRGSLDTQGVKDRKQARSKYGAKRAKAGK 126
>gi|170078668|ref|YP_001735306.1| 30S ribosomal protein S12 [Synechococcus sp. PCC 7002] >gi|169886337|gb|ACB00051.1| 30S ribosomal protein S12 [Synechococcus sp. PCC 7002] (124 aa)
Score = 377, Expect = 5.2e-35, Identities = 93/137 (67%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD +GV+ R+Q RS YGAKRPKE
  S:     1 MPTIQQLIRSERYKLKKKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDATGVKDRKQGRSKYGAKRPKE 124
>gi|78776556|ref|YP_392871.1| 30S ribosomal protein S12 [Sulfurimonas denitrificans DSM 1251] >gi|118597404|sp|Q30TP5|RS12_THIDN 30S ribosomal protein S12 >gi|78497096|gb|ABB43636.1| SSU ribosomal protein S12P [Sulfurimonas denitrificans DSM 1251] (126 aa)
Score = 377, Expect = 5.2e-35, Identities = 89/139 (64%), Positives = 103/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLIR +R+   KKSKSPAL+               P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGR+KDLPGV+YHIVRG LDT+GV  R   RS YG KRPK KK
  S:     1 MPTINQLIRKERQKVVKKSKSPALV-------------SCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIMGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDTAGVANRTVSRSKYGTKRPKVKK 126
>gi|149376691|ref|ZP_01894450.1| 30S ribosomal protein S12 [Marinobacter algicola DG893] >gi|149359064|gb|EDM47529.1| 30S ribosomal protein S12 [Marinobacter algicola DG893] (124 aa)
Score = 377, Expect = 5.3e-35, Identities = 92/136 (67%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLDT GV+ R+Q RS YGAKRPK
  S:     1 MATINQLVRKPRKRKAAKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTQGVQNRKQGRSKYGAKRPK 123
>gi|87122759|ref|ZP_01078633.1| 30S ribosomal protein S12 [Marinomonas sp. MED121] >gi|86161987|gb|EAQ63278.1| 30S ribosomal protein S12 [Marinomonas sp. MED121] (123 aa)
Score = 376, Expect = 5.7e-35, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRKRKVAKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVQNRKQGRSKYGTKRPK 123
>gi|150020840|ref|YP_001306194.1| 30S ribosomal protein S12 [Thermosipho melanesiensis BI429] >gi|166231893|sp|A6LLK8|RS12_THEM4 30S ribosomal protein S12 >gi|149793361|gb|ABR30809.1| ribosomal protein S12 [Thermosipho melanesiensis BI429] (124 aa)
Score = 376, Expect = 5.7e-35, Identities = 90/137 (65%), Positives = 100/137 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+RH RK   +KSKSPAL                P KRGVC RV TMTPKKPNSALRK A+V+L+NG EV AYIPG GHNLQEHSVVL+ GGRVKDLPG+RY I+RG LDT GVE R+Q RS YG KRPK+
  S:     1 MPTINQLVRHGRKVIKEKSKSPAL-------------QGHPQKRGVCVRVSTMTPKKPNSALRKIARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGIRYKIIRGALDTDGVENRKQSRSKYGTKRPKK 124
>gi|121534754|ref|ZP_01666575.1| ribosomal protein S12 [Thermosinus carboxydivorans Nor1] >gi|121306774|gb|EAX47695.1| ribosomal protein S12 [Thermosinus carboxydivorans Nor1] (124 aa)
Score = 376, Expect = 5.7e-35, Identities = 92/137 (67%), Positives = 100/137 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+   KKS +PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GV KR Q RS YGAKRPK+
  S:     1 MPTINQLVRKGRETVEKKSTAPAL-------------KECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGALDTAGVAKRNQGRSKYGAKRPKK 124
>gi|108796842|ref|YP_636364.1| ribosomal protein S12 [Staurastrum punctulatum] >gi|122245553|sp|Q32S12|RR12_STAPU Chloroplast 30S ribosomal protein S12 >gi|61393610|gb|AAX45751.1| ribosomal protein S12 [Staurastrum punctulatum] (123 aa)
Score = 376, Expect = 5.7e-35, Identities = 88/136 (64%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+    ++KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSV+L+ GGRVKDLPGVRYHIVRGTLD  GV+ RRQ RS YG KRPK
  S:     1 MPTIQQLIRNSRQPAENRTKSPAL-------------RACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVILVRGGRVKDLPGVRYHIVRGTLDAVGVKDRRQGRSKYGVKRPK 123
>gi|115519537|gb|ABJ07521.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris BisA53] (140 aa)
Score = 376, Expect = 5.9e-35, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI + R  +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:    18 MPTINQLIANPRVVQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 140
>gi|188992859|ref|YP_001904869.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris] >gi|167734619|emb|CAP52829.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris] (164 aa)
Score = 376, Expect = 6.0e-35, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+    KS SPAL             +  P +RGVCTRV T TP+KPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:    41 MATINQLVRKPRQATTYKSASPAL-------------DKCPQRRGVCTRVYTTTPRKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGAKRPK 163
>gi|62129585|gb|AAX67288.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (144 aa)
Score = 376, Expect = 6.0e-35, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:    21 MATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 143
>gi|90020573|ref|YP_526400.1| 30S ribosomal protein S12 [Saccharophagus degradans 2-40] >gi|119366804|sp|Q21M91|RS12_SACD2 30S ribosomal protein S12 >gi|89950173|gb|ABD80188.1| SSU ribosomal protein S12P [Saccharophagus degradans 2-40] (123 aa)
Score = 376, Expect = 6.3e-35, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV  R+Q RS YG KRPK
  S:     1 MATINQLVRKPRKRKVQKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVSDRKQGRSKYGTKRPK 123
>gi|154253172|ref|YP_001413996.1| 30S ribosomal protein S12 [Parvibaculum lavamentivorans DS-1] >gi|171769623|sp|A7HWQ6|RS12_PARL1 30S ribosomal protein S12 >gi|154157122|gb|ABS64339.1| ribosomal protein S12 [Parvibaculum lavamentivorans DS-1] (123 aa)
Score = 376, Expect = 6.4e-35, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  RK   K++K PA+                P KRGVCTRV T TPKKPNSALRK A+V+LTN +EV +YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTVNQLIRKPRKPLVKRNKVPAM-------------QACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNQFEVTSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGVLDTQGVKDRRQRRSKYGAKRPK 123
>gi|91786162|ref|YP_547114.1| 30S ribosomal protein S12 [Polaromonas sp. JS666] >gi|119366790|sp|Q12GX6|RS12_POLSJ 30S ribosomal protein S12 >gi|91695387|gb|ABE42216.1| SSU ribosomal protein S12P [Polaromonas sp. JS666] (125 aa)
Score = 376, Expect = 6.5e-35, Identities = 89/137 (64%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R+ +  KSKSPA+               SP +RGVCTRV T TPKKPNSALRK AKV+LTNG+E+++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTINQLVRQGREVEKIKSKSPAM-------------ENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEIISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKK 124
>gi|116072133|ref|ZP_01469401.1| 30S ribosomal protein S12 [Synechococcus sp. BL107] >gi|116065756|gb|EAU71514.1| 30S ribosomal protein S12 [Synechococcus sp. BL107] (124 aa)
Score = 376, Expect = 6.6e-35, Identities = 92/137 (67%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R     K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDTSGV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERSRLKVKTKSPAL-------------KACPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTSGVKDRRQSRSKYGAKAPKE 124
>gi|145588237|ref|YP_001154834.1| 30S ribosomal protein S12 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189040471|sp|A4SUV6|RS12_POLSQ 30S ribosomal protein S12 >gi|145046643|gb|ABP33270.1| SSU ribosomal protein S12P [Polynucleobacter sp. QLW-P1DMWA-1] (126 aa)
Score = 376, Expect = 6.7e-35, Identities = 92/137 (67%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR  R     KSKSPAL               SP +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKR K+
  S:     1 MPTINQLIRKPRSRLIVKSKSPAL-------------ENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRAKK 124
>gi|163752921|ref|ZP_02160045.1| 30S ribosomal protein S12 [Kordia algicida OT-1] >gi|161326653|gb|EDP97978.1| 30S ribosomal protein S12 [Kordia algicida OT-1] (124 aa)
Score = 376, Expect = 6.7e-35, Identities = 91/137 (66%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDT+GVE R Q+RS YGAKRPK+
  S:     1 MPTISQLVRKGRAKITKKSKSAAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGNEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVEGRTQRRSKYGAKRPKK 124
>gi|11466414|ref|NP_038418.1| ribosomal protein S12 [Mesostigma viride] >gi|14423922|sp|Q9MUP2|RR12_MESVI Chloroplast 30S ribosomal protein S12 >gi|7259557|gb|AAF43858.1|AF166114_70 ribosomal protein S12 [Mesostigma viride] (122 aa)
Score = 376, Expect = 6.7e-35, Identities = 88/134 (65%), Positives = 99/134 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QLIR +RK  + K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT+GV+ R Q RS YG KR
  S:     1 MPTIQQLIRSERKRVYNKTKSPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGILDTAGVKDRAQSRSKYGVKR 121
>gi|84703913|ref|ZP_01017741.1| 30S ribosomal protein S12 [Parvularcula bermudensis HTCC2503] >gi|84690347|gb|EAQ16188.1| 30S ribosomal protein S12 [Parvularcula bermudensis HTCC2503] (123 aa)
Score = 376, Expect = 6.7e-35, Identities = 93/136 (68%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  RK K K +K P L               +P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRKPKRKINKVPHL-------------QGNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|119773349|ref|YP_926089.1| 30S ribosomal protein S12 [Shewanella amazonensis SB2B] >gi|158513006|sp|A1S213|RS12_SHEAM 30S ribosomal protein S12 >gi|119765849|gb|ABL98419.1| ribosomal protein S12 [Shewanella amazonensis SB2B] (124 aa)
Score = 376, Expect = 6.9e-35, Identities = 86/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  K+  PAL                P KRGVCTRV T  PKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH +RG LD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRAPKVDKTNVPAL-------------EACPQKRGVCTRVYTTAPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTIRGALDCAGVNARRQARSKYGAKRPK 123
>gi|162135923|ref|YP_892465.2| 30S ribosomal protein S12 [Campylobacter fetus subsp. fetus 82-40] >gi|158512706|sp|A0RQI2|RS12_CAMFF 30S ribosomal protein S12 (127 aa)
Score = 376, Expect = 6.9e-35, Identities = 90/140 (64%), Positives = 104/140 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R +RK    KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK+ K+
  S:     1 MPTINQLVRKERKKVIVKSKSPAL-------------KECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKDAKK 127
>gi|196254765|ref|ZP_03153304.1| ribosomal protein S12 [Cyanothece sp. PCC 7822] >gi|196203962|gb|EDX98778.1| ribosomal protein S12 [Cyanothece sp. PCC 7822] (123 aa)
Score = 376, Expect = 7.0e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD++GV+ R+Q RS YG KRPK
  S:     1 MPTIQQLIRSERSQIQKKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDSTGVKDRKQGRSKYGTKRPK 123
>gi|17231832|ref|NP_488380.1| 30S ribosomal protein S12 [Nostoc sp. PCC 7120] >gi|75907513|ref|YP_321809.1| 30S ribosomal protein S12 [Anabaena variabilis ATCC 29413] >gi|119510865|ref|ZP_01629989.1| 30S ribosomal protein S12 [Nodularia spumigena CCY9414] >gi|20140061|sp|Q8YP60|RS12_ANASP 30S ribosomal protein S12 >gi|115305653|sp|Q3MDM2|RS12_ANAVT 30S ribosomal protein S12 >gi|17133476|dbj|BAB76039.1| 30S ribosomal protein S12 [Nostoc sp. PCC 7120] >gi|75701238|gb|ABA20914.1| SSU ribosomal protein S12P [Anabaena variabilis ATCC 29413] >gi|119464474|gb|EAW45387.1| 30S ribosomal protein S12 [Nodularia spumigena CCY9414] (127 aa)
Score = 376, Expect = 7.0e-35, Identities = 91/140 (65%), Positives = 106/140 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QLIR +R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ R+Q RS YG KRPKE K+
  S:     1 MPTIQQLIRTEREKARQKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGTKRPKEAKK 127
>gi|118579114|ref|YP_900364.1| 30S ribosomal protein S12 [Pelobacter propionicus DSM 2379] >gi|158512560|sp|A1ALT6|RS12_PELPD 30S ribosomal protein S12 >gi|118501824|gb|ABK98306.1| SSU ribosomal protein S12P [Pelobacter propionicus DSM 2379] (123 aa)
Score = 376, Expect = 7.0e-35, Identities = 91/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R++K  KS +PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD+ GV+ R++ RS YGAKRPK
  S:     1 MPTINQLIRIGRENKRDKSTAPAL-------------KCCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKKSRSKYGAKRPK 123
>gi|88704388|ref|ZP_01102102.1| 30S ribosomal protein S12 [gamma proteobacterium KT 71] >gi|88701439|gb|EAQ98544.1| 30S ribosomal protein S12 [Congregibacter litoralis KT71] (123 aa)
Score = 375, Expect = 7.2e-35, Identities = 91/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV  R+  RS YGAKRPK
  S:     1 MATINQLVRKPRKRKIEKSDVPAL-------------QGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVADRKNGRSKYGAKRPK 123
>gi|37523494|ref|NP_926871.1| 30S ribosomal protein S12 [Gloeobacter violaceus PCC 7421] >gi|52783385|sp|Q7NEF4|RS12_GLOVI 30S ribosomal protein S12 >gi|35214498|dbj|BAC91866.1| 30S ribosomal protein S12 [Gloeobacter violaceus PCC 7421] (135 aa)
Score = 375, Expect = 7.3e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TIAQLIR +R    +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ R Q RS YG KRPK
  S:     1 MPTIAQLIRRERGIAQRKTKSPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKNRMQSRSKYGTKRPK 123
>gi|56459458|ref|YP_154739.1| 30S ribosomal protein S12 [Idiomarina loihiensis L2TR] >gi|61215801|sp|Q5QWB6|RS12_IDILO 30S ribosomal protein S12 >gi|56178468|gb|AAV81190.1| Ribosomal protein S12 [Idiomarina loihiensis L2TR] (124 aa)
Score = 375, Expect = 7.3e-35, Identities = 89/136 (65%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R+    KS  PAL                P KRGVCTRV T TPKKPNSA+RK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD SGV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKGRQKPVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSAMRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCSGVNDRRQGRSKYGAKRPK 123
>gi|49077832|gb|AAT49722.1| PA4268 [synthetic construct] (124 aa)
Score = 375, Expect = 7.4e-35, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK    KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R+Q RS YGAKRPK
  S:     1 MATINQLVRKPRKRMVDKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGAKRPK 123
>gi|154245618|ref|YP_001416576.1| 30S ribosomal protein S12 [Xanthobacter autotrophicus Py2] >gi|154159703|gb|ABS66919.1| ribosomal protein S12 [Xanthobacter autotrophicus Py2] (123 aa)
Score = 375, Expect = 7.5e-35, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ +  + K+PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTN YEV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIRKPREAQKARDKAPAL-------------QASPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNSYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|89053066|ref|YP_508517.1| 30S ribosomal protein S12 [Jannaschia sp. CCS1] >gi|119366778|sp|Q28UX0|RS12_JANSC 30S ribosomal protein S12 >gi|88862615|gb|ABD53492.1| SSU ribosomal protein S12P [Jannaschia sp. CCS1] (123 aa)
Score = 375, Expect = 7.6e-35, Identities = 92/136 (67%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  +                P KRGVCTRV T TPKKPNSA+RK AKV+LTNGYEV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKIKRSKSQHM-------------EGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGAKRPK 123
>gi|158424183|ref|YP_001525475.1| 30S ribosomal protein S12 [Azorhizobium caulinodans ORS 571] >gi|172047989|sp|A8IAT8|RS12_AZOC5 30S ribosomal protein S12 >gi|158331072|dbj|BAF88557.1| ribosomal protein S12 [Azorhizobium caulinodans ORS 571] (123 aa)
Score = 375, Expect = 7.7e-35, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ +  + K+PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTN YEV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIRKPREAQKARDKAPAL-------------QSSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNSYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|196228451|ref|ZP_03127318.1| ribosomal protein S12 [Chthoniobacter flavus Ellin428] >gi|196227854|gb|EDY22357.1| ribosomal protein S12 [Chthoniobacter flavus Ellin428] (137 aa)
Score = 375, Expect = 7.8e-35, Identities = 89/135 (65%), Positives = 98/135 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRP 135
           M TI QL+R  R     KSKSPAL                P +RGVC +V T TPKKPNSALRK AKV+LTNG EV+AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLD  GV+ RR+ RS YGAKRP
  S:     1 MPTINQLVRKGRSKVTVKSKSPAL-------------TNCPQRRGVCVQVMTRTPKKPNSALRKVAKVRLTNGQEVIAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDALGVDGRRRSRSKYGAKRP 122
>gi|78185586|ref|YP_378020.1| 30S ribosomal protein S12 [Synechococcus sp. CC9902] >gi|118597401|sp|Q3AW56|RS12_SYNS9 30S ribosomal protein S12 >gi|78169880|gb|ABB26977.1| SSU ribosomal protein S12P [Synechococcus sp. CC9902] (124 aa)
Score = 375, Expect = 7.8e-35, Identities = 92/137 (67%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R     K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDTSGV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERSRLKVKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTSGVKDRRQSRSKYGAKAPKE 124
>gi|23013729|ref|ZP_00053593.1| COG0048: Ribosomal protein S12 [Magnetospirillum magnetotacticum MS-1] (123 aa)
Score = 375, Expect = 7.8e-35, Identities = 88/136 (64%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+    ++K PA+                P KRGVCTRV T TPKKP+SALRK A+V+LTNG+EV +YIPGEGHNLQEHSVV+I GGRV+DLPGVRYHI+RGTLDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTINQLIRKPRQPVAARNKVPAM-------------EACPQKRGVCTRVYTTTPKKPSSALRKVARVRLTNGFEVTSYIPGEGHNLQEHSVVMIRGGRVRDLPGVRYHIIRGTLDTQGVKDRRQRRSKYGAKRPK 123
>gi|182412055|ref|YP_001817121.1| ribosomal protein S12 [Opitutus terrae PB90-1] >gi|177839269|gb|ACB73521.1| ribosomal protein S12 [Opitutus terrae PB90-1] (126 aa)
Score = 375, Expect = 8.0e-35, Identities = 89/139 (64%), Positives = 104/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QL+R  R+    KSKSPAL             + +P++RGVC +V T TPKKPNSA+RK AKV+LTNG EV++YIP EGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLD +GVEKRR+ RS YG KRPK  K
  S:     1 MPTINQLVRKGRRKVRTKSKSPAL-------------DGNPFRRGVCVQVMTRTPKKPNSAIRKVAKVRLTNGNEVISYIPDEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDATGVEKRRRSRSKYGVKRPKAAK 126
>gi|15599464|ref|NP_252958.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa PAO1] >gi|107103780|ref|ZP_01367698.1| hypothetical protein PaerPA_01004851 [Pseudomonas aeruginosa PACS2] >gi|116052303|ref|YP_788851.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa UCBPP-PA14] >gi|152989554|ref|YP_001346218.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa PA7] >gi|122261452|sp|Q02T85|RS12_PSEAB 30S ribosomal protein S12 >gi|166231877|sp|A6UZI3|RS12_PSEA7 30S ribosomal protein S12 >gi|14423918|sp|Q9HWD0|RS12_PSEAE 30S ribosomal protein S12 >gi|9950486|gb|AAG07656.1|AE004842_5 30S ribosomal protein S12 [Pseudomonas aeruginosa PAO1] >gi|115587524|gb|ABJ13539.1| 30S ribosomal protein S12 [Pseudomonas aeruginosa UCBPP-PA14] >gi|150964712|gb|ABR86737.1| ribosomal protein S12 [Pseudomonas aeruginosa PA7] (123 aa)
Score = 375, Expect = 8.0e-35, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK    KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R+Q RS YGAKRPK
  S:     1 MATINQLVRKPRKRMVDKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGAKRPK 123
>gi|152972235|ref|YP_001337381.1| 30S ribosomal protein S12 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166231866|sp|A6TEY0|RS12_KLEP7 30S ribosomal protein S12 >gi|150957084|gb|ABR79114.1| 30S ribosomal protein S12 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (124 aa)
Score = 375, Expect = 8.1e-35, Identities = 88/136 (64%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 123
>gi|126666818|ref|ZP_01737795.1| 30S ribosomal protein S12 [Marinobacter sp. ELB17] >gi|126628863|gb|EAZ99483.1| 30S ribosomal protein S12 [Marinobacter sp. ELB17] (124 aa)
Score = 375, Expect = 8.2e-35, Identities = 90/136 (66%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLDT GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRRPRKRKVAKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTQGVQNRKQGRSKYGTKRPK 123
>gi|161986639|ref|YP_445162.2| 30S ribosomal protein S12 [Salinibacter ruber DSM 13855] >gi|115502081|sp|Q2S3R9|RS12_SALRD 30S ribosomal protein S12 (124 aa)
Score = 375, Expect = 8.4e-35, Identities = 89/137 (64%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M T  QLIR  RK + + S +PAL               SP +RGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GVE+RRQ RS YG K+P+E
  S:     1 MPTTQQLIRKGRKTEEETSDAPAL-------------EGSPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGNEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVEERRQGRSKYGTKKPRE 124
>gi|110681141|ref|YP_684148.1| 30S ribosomal protein S12 [Roseobacter denitrificans OCh 114] >gi|163732883|ref|ZP_02140328.1| 30S ribosomal protein S12 [Roseobacter litoralis Och 149] >gi|119366802|sp|Q160Y1|RS12_ROSDO 30S ribosomal protein S12 >gi|109457257|gb|ABG33462.1| ribosomal protein S12 [Roseobacter denitrificans OCh 114] >gi|161394243|gb|EDQ18567.1| 30S ribosomal protein S12 [Roseobacter litoralis Och 149] (123 aa)
Score = 375, Expect = 8.4e-35, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKIKRSKSMHL-------------QECPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|86605980|ref|YP_474743.1| 30S ribosomal protein S12 [Synechococcus sp. JA-3-3Ab] >gi|110825785|sp|Q2JUX7|RS12_SYNJA 30S ribosomal protein S12 >gi|86554522|gb|ABC99480.1| ribosomal protein S12 [Synechococcus sp. JA-3-3Ab] (135 aa)
Score = 375, Expect = 8.7e-35, Identities = 89/136 (65%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +RK   +K+K+PAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLD +GV+ R+Q RS YGAKRPK
  S:     1 MPTIQQLIREERKAAVRKTKAPAL-------------KGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDAAGVKDRKQGRSKYGAKRPK 123
>gi|117924150|ref|YP_864767.1| 30S ribosomal protein S12 [Magnetococcus sp. MC-1] >gi|158512331|sp|A0L5W8|RS12_MAGSM 30S ribosomal protein S12 >gi|117607906|gb|ABK43361.1| SSU ribosomal protein S12P [Magnetococcus sp. MC-1] (123 aa)
Score = 375, Expect = 8.7e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QL+R  RK + KK+  PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTNG+EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG+LDT GV+ R+Q RS YGAKRPK
  S:     1 MPTVNQLVRLGRKPQKKKTNVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGHEVSAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGSLDTQGVKDRKQGRSKYGAKRPK 123
>gi|118413983|gb|ABK82403.1| ribosomal protein S12 [Campylobacter fetus subsp. fetus 82-40] (132 aa)
Score = 375, Expect = 8.7e-35, Identities = 89/138 (64%), Positives = 103/138 (74%)
  Q:     3 TIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           TI QL+R +RK    KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK+ K+
  S:     8 TINQLVRKERKKVIVKSKSPAL-------------KECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKDAKK 132
>gi|152990019|ref|YP_001355741.1| 30S ribosomal protein S12 [Nitratiruptor sp. SB155-2] >gi|166231873|sp|A6Q1M5|RS12_NITSB 30S ribosomal protein S12 >gi|151421880|dbj|BAF69384.1| 30S ribosomal protein S12 [Nitratiruptor sp. SB155-2] (124 aa)
Score = 375, Expect = 8.8e-35, Identities = 88/136 (64%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R +RK   KKSKSPAL+               P +RGVCTRV T TPKKPNSALRK AKV+LT+GYEV++YIPGEGHNLQEHS+VL+ GGRVKDLPGV+YHI+RG LDT+GV  R++ RS YG K+PK
  S:     1 MPTINQLVRKERKKVIKKSKSPALV-------------KCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGYEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIIRGALDTAGVANRKKSRSKYGTKKPK 123
>gi|71842335|ref|YP_277423.1| ribosomal protein S12 [Emiliania huxleyi] >gi|122233601|sp|Q4G344|RR12_EMIHU Chloroplast 30S ribosomal protein S12 >gi|60101578|gb|AAX13922.1| ribosomal protein S12 [Emiliania huxleyi] (125 aa)
Score = 375, Expect = 8.9e-35, Identities = 87/136 (63%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R +R+   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHN+QEHSVVLI GGRVKDLPG RYH+VRG+LD SGV+ R+Q RS YG KRPK
  S:     1 MPTIQQLVRFERQTSEKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNIQEHSVVLIRGGRVKDLPGCRYHVVRGSLDASGVKDRKQGRSKYGGKRPK 123
>gi|85060264|ref|YP_455966.1| 30S ribosomal protein S12 [Sodalis glossinidius str. 'morsitans'] >gi|118597395|sp|Q2NQL4|RS12_SODGM 30S ribosomal protein S12 >gi|84780784|dbj|BAE75561.1| 30S ribosomal protein S12 [Sodalis glossinidius str. 'morsitans'] (124 aa)
Score = 375, Expect = 9.0e-35, Identities = 87/136 (63%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL             +  P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATINQLVRKPRSMKVAKSNVPAL-------------DACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGVKKPK 123
>gi|77359195|ref|YP_338770.1| 30S ribosomal protein S12 [Pseudoalteromonas haloplanktis TAC125] >gi|90111794|sp|Q3ILP7|RS12_PSEHT 30S ribosomal protein S12 >gi|76874106|emb|CAI85327.1| 30S ribosomal protein S12 [Pseudoalteromonas haloplanktis TAC125] (124 aa)
Score = 375, Expect = 9.0e-35, Identities = 88/136 (64%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+ K  KS S AL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVR+H VRG LD +GV  RRQ RS YG KRPK
  S:     1 MATINQLVRKPRRSKVTKSNSAAL-------------KACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDCAGVSDRRQARSKYGTKRPK 123
>gi|33151838|ref|NP_873191.1| 30S ribosomal protein S12 [Haemophilus ducreyi 35000HP] >gi|7388118|sp|Q9Z6D2|RS12_HAEDU 30S ribosomal protein S12 >gi|4322482|gb|AAD16057.1| 30S ribosomal protein S12 [Haemophilus ducreyi] >gi|33148059|gb|AAP95580.1| 30S ribosomal protein S12 [Haemophilus ducreyi 35000HP] (124 aa)
Score = 375, Expect = 9.0e-35, Identities = 87/136 (63%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +++LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRVKKVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGVKRPK 123
>gi|161407968|ref|YP_001015772.2| 30S ribosomal protein S12 [Prochlorococcus marinus str. NATL1A] >gi|156637361|sp|A2C4U8|RS12_PROM1 30S ribosomal protein S12 (124 aa)
Score = 375, Expect = 9.3e-35, Identities = 92/137 (67%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +RK    K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERKTLKTKTKSPAL-------------RGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGTLDTAGVKDRRQSRSKYGAKSPKE 124
>gi|148256397|ref|YP_001240982.1| 30S ribosomal protein S12 [Bradyrhizobium sp. BTAi1] >gi|161353768|ref|YP_001205100.2| 30S ribosomal protein S12 [Bradyrhizobium sp. ORS278] >gi|158513288|sp|A5ELN2|RS12_BRASB 30S ribosomal protein S12 >gi|158514335|sp|A4YSI7|RS12_BRASO 30S ribosomal protein S12 >gi|146408570|gb|ABQ37076.1| SSU ribosomal protein S12P [Bradyrhizobium sp. BTAi1] (123 aa)
Score = 375, Expect = 9.3e-35, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI + R+ +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIANPREVQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|15791855|ref|NP_281678.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237543|ref|YP_178557.1| 30S ribosomal protein S12 [Campylobacter jejuni RM1221] >gi|86149000|ref|ZP_01067232.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151580|ref|ZP_01069794.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153738|ref|ZP_01071941.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88596896|ref|ZP_01100132.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 84-25] >gi|121613664|ref|YP_001000187.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148925867|ref|ZP_01809554.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni CG8486] >gi|153952294|ref|YP_001398477.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. doylei 269.97] >gi|167005144|ref|ZP_02270902.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 81-176] >gi|158513883|sp|A1VYJ6|RS12_CAMJJ 30S ribosomal protein S12 >gi|166231855|sp|A7H4P7|RS12_CAMJD 30S ribosomal protein S12 >gi|14423924|sp|Q9PI18|RS12_CAMJE 30S ribosomal protein S12 >gi|62287356|sp|Q5HVX8|RS12_CAMJR 30S ribosomal protein S12 >gi|57166347|gb|AAW35126.1| ribosomal protein S12 [Campylobacter jejuni RM1221] >gi|85840358|gb|EAQ57615.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841209|gb|EAQ58457.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842699|gb|EAQ59911.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87250243|gb|EAQ73201.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190585|gb|EAQ94558.1| ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359852|emb|CAL34639.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844853|gb|EDK21957.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni CG8486] >gi|152939740|gb|ABS44481.1| ribosomal protein S12 [Campylobacter jejuni subsp. doylei 269.97] (128 aa)
Score = 375, Expect = 9.3e-35, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R +RK   +KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK
  S:     1 MPTINQLVRKERKKVLEKSKSPAL-------------KNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPK 123
>gi|86137192|ref|ZP_01055770.1| 30S ribosomal protein S12 [Roseobacter sp. MED193] >gi|85826516|gb|EAQ46713.1| 30S ribosomal protein S12 [Roseobacter sp. MED193] (123 aa)
Score = 374, Expect = 9.4e-35, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKIKRSKSMHL-------------EQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|49474409|ref|YP_032451.1| 30S ribosomal protein S12 [Bartonella quintana str. Toulouse] >gi|52783354|sp|Q6FZB7|RS12_BARQU 30S ribosomal protein S12 >gi|49239913|emb|CAF26311.1| 30s ribosomal protein s12 [Bartonella quintana str. Toulouse] (123 aa)
Score = 374, Expect = 9.5e-35, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AKV+LT+G+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRVTPVKRNKVPAL-------------QSNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGAKRPK 123
>gi|118442937|ref|YP_877193.1| 30S ribosomal protein S12 [Clostridium novyi NT] >gi|168187819|ref|ZP_02622454.1| ribosomal protein S12 [Clostridium botulinum C str. Eklund] >gi|158512397|sp|A0PXU1|RS12_CLONN 30S ribosomal protein S12 >gi|118133393|gb|ABK60437.1| ribosomal protein S12 [Clostridium novyi NT] >gi|169294321|gb|EDS76454.1| ribosomal protein S12 [Clostridium botulinum C str. Eklund] (125 aa)
Score = 374, Expect = 9.7e-35, Identities = 92/138 (66%), Positives = 98/138 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  RK    KS SPAL                P KRGVCT V T TPKKPNSALRK A+V+LTNGYEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD +GV  R Q RS YGAK+PK+K
  S:     1 MPTINQLVRKGRKTAEYKSNSPAL-------------KQCPQKRGVCTVVKTSTPKKPNSALRKVARVRLTNGYEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDAAGVANRMQARSKYGAKKPKQK 125
>gi|83648857|ref|YP_437292.1| 30S ribosomal protein S12 [Hahella chejuensis KCTC 2396] >gi|115305657|sp|Q2S907|RS12_HAHCH 30S ribosomal protein S12 >gi|83636900|gb|ABC32867.1| ribosomal protein S12 [Hahella chejuensis KCTC 2396] (124 aa)
Score = 374, Expect = 1.0e-34, Identities = 91/136 (66%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLDT+GV  RRQ RS YGAKR K
  S:     1 MATINQLVRKPRSRKVAKSDVPAL-------------QGCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTAGVNDRRQGRSKYGAKRGK 123
>gi|11467797|ref|NP_050848.1| ribosomal protein S12 [Nephroselmis olivacea] >gi|14423928|sp|Q9TKZ7|RR12_NEPOL Chloroplast 30S ribosomal protein S12 >gi|5880726|gb|AAD54819.1|AF137379_42 ribosomal protein S12 [Nephroselmis olivacea] (125 aa)
Score = 374, Expect = 1.0e-34, Identities = 90/138 (65%), Positives = 103/138 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  RK   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+L++G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLDT+GV++R+Q RS YG KR  +K
  S:     1 MPTIQQLVRAQRKRIVKKTKSPALC-------------ACPQRRGVCTRVYTTTPKKPNSALRKVARVRLSSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTAGVKERKQSRSKYGVKRVTKK 125
>gi|153004769|ref|YP_001379094.1| 30S ribosomal protein S12 [Anaeromyxobacter sp. Fw109-5] >gi|166231844|sp|A7HBL4|RS12_ANADF 30S ribosomal protein S12 >gi|152028342|gb|ABS26110.1| ribosomal protein S12 [Anaeromyxobacter sp. Fw109-5] (123 aa)
Score = 374, Expect = 1.0e-34, Identities = 90/135 (66%), Positives = 100/135 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRP 135
           M TI+QL+R  R+    K K+PAL               SP KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD  GV+ R+Q RS YGAKRP
  S:     1 MPTISQLVRKGREKLLTKKKAPAL-------------KESPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDAVGVQGRKQGRSKYGAKRP 122
>gi|26006391|gb|AAN77280.1|AF448459_1 ribosomal protein S12 [Brucella melitensis] (123 aa)
Score = 374, Expect = 1.0e-34, Identities = 89/136 (65%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R    K++K PAL               +P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDL GVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRTAPVKRNKVPAL-------------QANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLLGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|15640386|ref|NP_230013.1| 30S ribosomal protein S12 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121730315|ref|ZP_01682682.1| ribosomal protein S12 [Vibrio cholerae V52] >gi|14423920|sp|Q9KUZ9|RS12_VIBCH 30S ribosomal protein S12 >gi|9654776|gb|AAF93532.1| ribosomal protein S12 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121627933|gb|EAX60504.1| ribosomal protein S12 [Vibrio cholerae V52] >gi|150421950|gb|EDN13925.1| ribosomal protein S12 [Vibrio cholerae AM-19226] (124 aa)
Score = 374, Expect = 1.1e-34, Identities = 87/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  +  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV  R+Q RS YG KRPK
  S:     1 MATINQLVRKPRAKQVVKSNVPALA-------------ACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQARSKYGVKRPK 123
>gi|146308928|ref|YP_001189393.1| 30S ribosomal protein S12 [Pseudomonas mendocina ymp] >gi|166231878|sp|A4XZ95|RS12_PSEMY 30S ribosomal protein S12 >gi|145577129|gb|ABP86661.1| SSU ribosomal protein S12P [Pseudomonas mendocina ymp] (123 aa)
Score = 374, Expect = 1.1e-34, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK   +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R+Q RS YG KRPK
  S:     1 MATINQLVRQPRKRIVEKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYGTKRPK 123
>gi|86608398|ref|YP_477160.1| 30S ribosomal protein S12 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|110825786|sp|Q2JMY0|RS12_SYNJB 30S ribosomal protein S12 >gi|86556940|gb|ABD01897.1| ribosomal protein S12 [Synechococcus sp. JA-2-3B'a(2-13)] (135 aa)
Score = 374, Expect = 1.1e-34, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R    +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLD +GV+ R+Q RS YGAKRPK
  S:     1 MPTIQQLIREERSVAARKTKSPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDAAGVKDRKQGRSKYGAKRPK 123
>gi|114704479|ref|ZP_01437387.1| Ribosomal protein S12, bacterial and chloroplast forms:Ribosomal protein S12/S23 [Fulvimarina pelagi HTCC2506] >gi|114539264|gb|EAU42384.1| Ribosomal protein S12, bacterial and chloroplast forms:Ribosomal protein S12/S23 [Fulvimarina pelagi HTCC2506] (123 aa)
Score = 374, Expect = 1.2e-34, Identities = 89/136 (65%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R    +++  PAL               +P KRGVCTRV T TPKKPNSALRK AKV+L NGYEV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIRKPRIRPAERNTVPAL-------------EANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLVNGYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|94266160|ref|ZP_01289872.1| Ribosomal protein S12 [delta proteobacterium MLMS-1] >gi|93453275|gb|EAT03724.1| Ribosomal protein S12 [delta proteobacterium MLMS-1] (123 aa)
Score = 374, Expect = 1.2e-34, Identities = 89/136 (65%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  RK + KK+ +PA+                P KRGVC RV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYH+VRGTLDT GV  R+Q RS YGAKRPK
  S:     1 MPTINQLVRQGRKTRVKKTNTPAI-------------KGCPQKRGVCVRVYTTTPKKPNSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGTLDTLGVANRKQGRSKYGAKRPK 123
>gi|108796740|ref|YP_636468.1| ribosomal protein S12 [Zygnema circumcarinatum] >gi|122233023|sp|Q32RQ9|RR12_ZYGCR Chloroplast 30S ribosomal protein S12 >gi|61393724|gb|AAX45866.1| ribosomal protein S12 [Zygnema circumcarinatum] (123 aa)
Score = 374, Expect = 1.2e-34, Identities = 88/136 (64%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+    ++KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD  GV+ R Q RS YG KRPK
  S:     1 MPTIQQLIRNTRQPTQNRTKSPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAVGVKDRHQGRSKYGVKRPK 123
>gi|9107858|gb|AAF85428.1|AE004069_9 30S ribosomal protein S12 [Xylella fastidiosa 9a5c] (132 aa)
Score = 374, Expect = 1.2e-34, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+    KS SPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:     9 MATINQLVRKPRQASTYKSASPAL-------------DKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGAKRPK 131
>gi|114567846|ref|YP_755000.1| 30S ribosomal protein S12 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|119366816|sp|Q0AUH5|RS12_SYNWW 30S ribosomal protein S12 >gi|114338781|gb|ABI69629.1| SSU ribosomal protein S12P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (125 aa)
Score = 374, Expect = 1.2e-34, Identities = 92/138 (66%), Positives = 101/138 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R+   +KS +PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD SGV+KR Q RS YG KRPK+K
  S:     1 MPTINQLVRKGREKGEQKSTAPAL-------------KSCPQKRGVCTRVYTTTPKKPNSALRKIARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDASGVQKRNQGRSKYGTKRPKKK 125
>gi|114773732|ref|ZP_01450757.1| 30S ribosomal protein S12 [alpha proteobacterium HTCC2255] (124 aa)
Score = 374, Expect = 1.2e-34, Identities = 89/136 (65%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  RK   +KS   AL                P +RGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLD +GV  RRQ RS YGAKRPK
  S:     1 MATVNQLVRKPRKKPVEKSNVAAL-------------EACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDCAGVNDRRQARSKYGAKRPK 123
>gi|114764150|ref|ZP_01443388.1| 30S ribosomal protein S12 [Roseovarius sp. HTCC2601] >gi|163745531|ref|ZP_02152891.1| 30S ribosomal protein S12 [Oceanibulbus indolifex HEL-45] >gi|114543302|gb|EAU46318.1| 30S ribosomal protein S12 [Roseovarius sp. HTCC2601] >gi|161382349|gb|EDQ06758.1| 30S ribosomal protein S12 [Oceanibulbus indolifex HEL-45] (123 aa)
Score = 374, Expect = 1.2e-34, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVKRSKSMHL-------------QECPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|78211875|ref|YP_380654.1| 30S ribosomal protein S12 [Synechococcus sp. CC9605] >gi|118597402|sp|Q3AMT3|RS12_SYNSC 30S ribosomal protein S12 >gi|78196334|gb|ABB34099.1| ribosomal protein S12 [Synechococcus sp. CC9605] (124 aa)
Score = 374, Expect = 1.2e-34, Identities = 91/137 (66%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R     K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERSRLKAKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKAPKE 124
>gi|27380516|ref|NP_772045.1| 30S ribosomal protein S12 [Bradyrhizobium japonicum USDA 110] >gi|52783407|sp|Q89J79|RS12_BRAJA 30S ribosomal protein S12 >gi|27353680|dbj|BAC50670.1| 30S ribosomal protein S12 [Bradyrhizobium japonicum USDA 110] (123 aa)
Score = 374, Expect = 1.2e-34, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R+ +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIAQPREVQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|157414773|ref|YP_001482029.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 81116] >gi|172047076|sp|A8FKR5|RS12_CAMJ8 30S ribosomal protein S12 >gi|157385737|gb|ABV52052.1| 30S ribosomal protein S12 [Campylobacter jejuni subsp. jejuni 81116] (128 aa)
Score = 373, Expect = 1.2e-34, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R +RK   +KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK
  S:     1 MPTINQLVRKERKKVLEKSKSPAL-------------KNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPK 123
>gi|177676396|ref|ZP_02946810.1| ribosomal protein S12 [Methylocella silvestris BL2] >gi|172068963|gb|EDT55073.1| ribosomal protein S12 [Methylocella silvestris BL2] (123 aa)
Score = 373, Expect = 1.3e-34, Identities = 90/136 (66%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QLIR  R++K  + K+             R    SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTISQLIRKPRQEKTYREKA-------------RHLGASPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|11467352|ref|NP_043209.1| ribosomal protein S12 [Cyanophora paradoxa] >gi|133736|sp|P17294|RR12_CYAPA Cyanelle 30S ribosomal protein S12 >gi|11414|emb|CAA36738.1| unnamed protein product [Cyanophora paradoxa] >gi|1016153|gb|AAA81240.1| ribosomal protein S12 (124 aa)
Score = 373, Expect = 1.3e-34, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LD +GV+ RRQ RS YGAKRPK
  S:     1 MPTIQQLIRSKRTKIEKKTKSPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAAGVKDRRQSRSKYGAKRPK 123
>gi|33866667|ref|NP_898226.1| 30S ribosomal protein S12 [Synechococcus sp. WH 8102] >gi|52783389|sp|Q7U4D4|RS12_SYNPX 30S ribosomal protein S12 >gi|33633445|emb|CAE08650.1| 30S ribosomal protein S12 [Synechococcus sp. WH 8102] (124 aa)
Score = 373, Expect = 1.3e-34, Identities = 91/137 (66%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R     K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERSRLKAKTKSPAL-------------KSCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVKDRRQSRSKYGAKTPKE 124
>gi|150015038|ref|YP_001307292.1| 30S ribosomal protein S12 [Clostridium beijerinckii NCIMB 8052] >gi|189040451|sp|A6LPQ6|RS12_CLOB8 30S ribosomal protein S12 >gi|149901503|gb|ABR32336.1| ribosomal protein S12 [Clostridium beijerinckii NCIMB 8052] (125 aa)
Score = 373, Expect = 1.3e-34, Identities = 90/138 (65%), Positives = 98/138 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI+QL+R  RK    KS +PAL                P KRGVCT V T TPKKPNSALRK A+V+LTNG+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD +GV  R Q RS YGAKRPK+K
  S:     1 MPTISQLVRKGRKTAVVKSTAPAL-------------KECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDCAGVANRLQGRSKYGAKRPKKK 125
>gi|91216914|ref|ZP_01253878.1| 30S ribosomal protein S12 [Psychroflexus torquis ATCC 700755] >gi|91185075|gb|EAS71454.1| 30S ribosomal protein S12 [Psychroflexus torquis ATCC 700755] (124 aa)
Score = 373, Expect = 1.3e-34, Identities = 91/137 (66%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R+   KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDT+GVE R Q+RS YGAKRPK+
  S:     1 MPTISQLVRKGRRKMTKKSKSAAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVEGRLQRRSKYGAKRPKK 124
>gi|39936318|ref|NP_948594.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris CGA009] >gi|91977657|ref|YP_570316.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris BisB5] >gi|162134980|ref|YP_782501.2| 30S ribosomal protein S12 [Rhodopseudomonas palustris BisA53] >gi|167365716|ref|ZP_02299860.1| ribosomal protein S12 [Rhodopseudomonas palustris TIE-1] >gi|192292042|ref|YP_001992647.1| ribosomal protein S12 [Rhodopseudomonas palustris TIE-1] >gi|158564058|sp|Q07KL3|RS12_RHOP5 30S ribosomal protein S12 >gi|52783364|sp|Q6N4T2|RS12_RHOPA 30S ribosomal protein S12 (RRP-S12) >gi|119366799|sp|Q134S4|RS12_RHOPS 30S ribosomal protein S12 >gi|39650173|emb|CAE28696.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris CGA009] >gi|91684113|gb|ABE40415.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris BisB5] >gi|192285791|gb|ACF02172.1| ribosomal protein S12 [Rhodopseudomonas palustris TIE-1] (123 aa)
Score = 373, Expect = 1.3e-34, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI + R  +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIANPRVVQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|26987190|ref|NP_742615.1| 30S ribosomal protein S12 [Pseudomonas putida KT2440] >gi|104779750|ref|YP_606248.1| 30S ribosomal protein S12 [Pseudomonas entomophila L48] >gi|148545734|ref|YP_001265836.1| 30S ribosomal protein S12 [Pseudomonas putida F1] >gi|170723911|ref|YP_001751599.1| ribosomal protein S12 [Pseudomonas putida W619] >gi|122985974|sp|Q1IFX1|RS12_PSEE4 30S ribosomal protein S12 >gi|166231879|sp|A5VXP2|RS12_PSEP1 30S ribosomal protein S12 >gi|38258504|sp|Q88QP0|RS12_PSEPK 30S ribosomal protein S12 >gi|24981827|gb|AAN66079.1|AE016237_3 ribosomal protein S12 [Pseudomonas putida KT2440] >gi|95108737|emb|CAK13431.1| 30S ribosomal protein S12 [Pseudomonas entomophila L48] >gi|148509792|gb|ABQ76652.1| SSU ribosomal protein S12P [Pseudomonas putida F1] >gi|169761914|gb|ACA75230.1| ribosomal protein S12 [Pseudomonas putida W619] (123 aa)
Score = 373, Expect = 1.3e-34, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK   +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R Q RS YG KRPK
  S:     1 MATINQLVRQPRKRSVEKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGTKRPK 123
>gi|99080080|ref|YP_612234.1| 30S ribosomal protein S12 [Silicibacter sp. TM1040] >gi|163739430|ref|ZP_02146840.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis BS107] >gi|163740224|ref|ZP_02147618.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis 2.10] >gi|119366809|sp|Q1GK44|RS12_SILST 30S ribosomal protein S12 >gi|99036360|gb|ABF62972.1| SSU ribosomal protein S12P [Silicibacter sp. TM1040] >gi|161386082|gb|EDQ10457.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis 2.10] >gi|161387183|gb|EDQ11542.1| 30S ribosomal protein S12 [Phaeobacter gallaeciensis BS107] (123 aa)
Score = 373, Expect = 1.3e-34, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVKRSKSMHL-------------EQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|189424405|ref|YP_001951582.1| ribosomal protein S12 [Geobacter lovleyi SZ] >gi|189420664|gb|ACD95062.1| ribosomal protein S12 [Geobacter lovleyi SZ] (123 aa)
Score = 373, Expect = 1.4e-34, Identities = 92/136 (67%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K  KS +PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD+ GV+ R Q RS YGAKRPK
  S:     1 MPTINQLIRQGREKKRDKSTAPAL-------------KSCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKGRMQGRSKYGAKRPK 123
>gi|83949802|ref|ZP_00958535.1| 30S ribosomal protein S12 [Roseovarius nubinhibens ISM] >gi|89070563|ref|ZP_01157852.1| 30S ribosomal protein S12 [Oceanicola granulosus HTCC2516] >gi|83837701|gb|EAP76997.1| 30S ribosomal protein S12 [Roseovarius nubinhibens ISM] >gi|89043870|gb|EAR50068.1| 30S ribosomal protein S12 [Oceanicola granulosus HTCC2516] (123 aa)
Score = 373, Expect = 1.4e-34, Identities = 92/136 (67%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNGYEV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVKRSKSMHL-------------EQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|154148589|ref|YP_001407179.1| 30S ribosomal protein S12 [Campylobacter hominis ATCC BAA-381] >gi|166231854|sp|A7I3T8|RS12_CAMHC 30S ribosomal protein S12 >gi|153804598|gb|ABS51605.1| ribosomal protein S12 [Campylobacter hominis ATCC BAA-381] (124 aa)
Score = 373, Expect = 1.4e-34, Identities = 89/137 (64%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R +RK   +KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK+
  S:     1 MPTINQLVRKERKKIIEKSKSPAL-------------KNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPKK 124
>gi|124112112|ref|YP_001019137.1| ribosomal protein S12 [Chlorokybus atmophyticus] >gi|158564119|sp|Q19V72|RR12_CHLAT Chloroplast 30S ribosomal protein S12 >gi|124012221|gb|ABD62244.2| ribosomal protein S12 [Chlorokybus atmophyticus] (123 aa)
Score = 373, Expect = 1.4e-34, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  RK   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LDT+GV+ R Q RS YG KRPK
  S:     1 MPTIQQLIRSQRKKVEKKTKSPAL-------------RGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGILDTAGVKDRSQGRSKYGVKRPK 123
>gi|16120539|ref|NP_403852.1| 30S ribosomal protein S12 [Yersinia pestis CO92] >gi|22127853|ref|NP_671276.1| 30S ribosomal protein S12 [Yersinia pestis KIM] >gi|45440059|ref|NP_991598.1| 30S ribosomal protein S12 [Yersinia pestis biovar Microtus str. 91001] >gi|51597995|ref|YP_072186.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis IP 32953] >gi|77957338|ref|ZP_00821397.1| COG0048: Ribosomal protein S12 [Yersinia bercovieri ATCC 43970] >gi|77962733|ref|ZP_00826550.1| COG0048: Ribosomal protein S12 [Yersinia mollaretii ATCC 43969] >gi|77974995|ref|ZP_00830532.1| COG0048: Ribosomal protein S12 [Yersinia frederiksenii ATCC 33641] >gi|77978220|ref|ZP_00833652.1| COG0048: Ribosomal protein S12 [Yersinia intermedia ATCC 29909] >gi|108809263|ref|YP_653179.1| 30S ribosomal protein S12 [Yersinia pestis Antiqua] >gi|108814027|ref|YP_649794.1| 30S ribosomal protein S12 [Yersinia pestis Nepal516] >gi|123444105|ref|YP_001008075.1| 30S ribosomal protein S12 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|150260751|ref|ZP_01917479.1| 30S ribosomal protein S12 [Yersinia pestis CA88-4125] >gi|153950162|ref|YP_001402869.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis IP 31758] >gi|162421204|ref|YP_001607997.1| 30S ribosomal protein S12 [Yersinia pestis Angola] >gi|165927847|ref|ZP_02223679.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165940004|ref|ZP_02228540.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str. IP275] >gi|166010450|ref|ZP_02231348.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213290|ref|ZP_02239325.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str. B42003004] >gi|167418992|ref|ZP_02310745.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425635|ref|ZP_02317388.1| ribosomal protein S12 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170022536|ref|YP_001719041.1| ribosomal protein S12 [Yersinia pseudotuberculosis YPIII] >gi|186897191|ref|YP_001874303.1| ribosomal protein S12 [Yersinia pseudotuberculosis PB1/+] >gi|158512899|sp|A1JS57|RS12_YERE8 30S ribosomal protein S12 >gi|166991595|sp|A7FNP1|RS12_YERP3 30S ribosomal protein S12 >gi|20140073|sp|Q8ZJB5|RS12_YERPE 30S ribosomal protein S12 >gi|60390796|sp|Q664R4|RS12_YERPS 30S ribosomal protein S12 >gi|119366818|sp|Q1C2T8|RS12_YERPA 30S ribosomal protein S12 >gi|119366819|sp|Q1CCT6|RS12_YERPN 30S ribosomal protein S12 >gi|21960987|gb|AAM87527.1|AE014001_16 30S ribosomal subunit protein S12 [Yersinia pestis KIM] >gi|45434914|gb|AAS60475.1| 30S ribosomal protein S12 [Yersinia pestis biovar Microtus str. 91001] >gi|51591277|emb|CAH22943.1| 30S ribosomal protein S12 [Yersinia pseudotuberculosis IP 32953] >gi|108777675|gb|ABG20194.1| SSU ribosomal protein S12P [Yersinia pestis Nepal516] >gi|108781176|gb|ABG15234.1| SSU ribosomal protein S12P [Yersinia pestis Antiqua] >gi|115346018|emb|CAL18884.1| 30S ribosomal protein S12 [Yersinia pestis CO92] >gi|122091066|emb|CAL13949.1| 30S ribosomal protein S12 [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|149290159|gb|EDM40236.1| 30S ribosomal protein S12 [Yersinia pestis CA88-4125] >gi|152961657|gb|ABS49118.1| ribosomal protein S12 [Yersinia pseudotuberculosis IP 31758] >gi|162354019|gb|ABX87967.1| ribosomal protein S12 [Yersinia pestis Angola] >gi|165912044|gb|EDR30685.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str. IP275] >gi|165920123|gb|EDR37424.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990540|gb|EDR42841.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205588|gb|EDR50068.1| ribosomal protein S12 [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962986|gb|EDR59007.1| ribosomal protein S12 [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167055325|gb|EDR65119.1| ribosomal protein S12 [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749070|gb|ACA66588.1| ribosomal protein S12 [Yersinia pseudotuberculosis YPIII] >gi|186700217|gb|ACC90846.1| ribosomal protein S12 [Yersinia pseudotuberculosis PB1/+] (124 aa)
Score = 373, Expect = 1.4e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATINQLVRKPRSMKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGVKKPK 123
>gi|84685442|ref|ZP_01013340.1| 30S ribosomal protein S12 [Rhodobacterales bacterium HTCC2654] >gi|84666599|gb|EAQ13071.1| 30S ribosomal protein S12 [Rhodobacterales bacterium HTCC2654] (123 aa)
Score = 373, Expect = 1.5e-34, Identities = 92/136 (67%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNGYEV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVKRSKSQHL-------------ESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|194684111|emb|CAR45510.1| 30S ribosomal protein S12 [Proteus mirabilis HI4320] (124 aa)
Score = 373, Expect = 1.5e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATINQLVRKSRSSKVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGVKKPK 123
>gi|22299290|ref|NP_682537.1| 30S ribosomal protein S12 [Thermosynechococcus elongatus BP-1] >gi|27151675|sp|P59168|RS12_SYNEL 30S ribosomal protein S12 >gi|22295473|dbj|BAC09299.1| 30S ribosomal protein S12 [Thermosynechococcus elongatus BP-1] (134 aa)
Score = 373, Expect = 1.5e-34, Identities = 90/136 (66%), Positives = 104/136 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ R+Q RS YGAKRPK
  S:     1 MPTIQQLIRQERELLKRKTKSPAL-------------KGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGAKRPK 123
>gi|126724856|ref|ZP_01740699.1| 30S ribosomal protein S12 [Rhodobacterales bacterium HTCC2150] >gi|159042827|ref|YP_001531621.1| 30S ribosomal protein S12 [Dinoroseobacter shibae DFL 12] >gi|189040457|sp|A8LM43|RS12_DINSH 30S ribosomal protein S12 >gi|126706020|gb|EBA05110.1| 30S ribosomal protein S12 [Rhodobacterales bacterium HTCC2150] >gi|157910587|gb|ABV92020.1| ribosomal protein S12 [Dinoroseobacter shibae DFL 12] (123 aa)
Score = 373, Expect = 1.5e-34, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVKRSKSQHL-------------ESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|120437178|ref|YP_862864.1| 30S ribosomal protein S12 [Gramella forsetii KT0803] >gi|158512452|sp|A0M5A2|RS12_GRAFK 30S ribosomal protein S12 >gi|117579328|emb|CAL67797.1| 30S ribosomal protein S12 [Gramella forsetii KT0803] (124 aa)
Score = 373, Expect = 1.5e-34, Identities = 91/137 (66%), Positives = 103/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDT+GVE R Q+RS YGAKRPK+
  S:     1 MPTISQLVRKGRAKITKKSKSAAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVEGRTQRRSKYGAKRPKK 124
>gi|77165792|ref|YP_344317.1| 30S ribosomal protein S12 [Nitrosococcus oceani ATCC 19707] >gi|90111787|sp|Q3J8Q9|RS12_NITOC 30S ribosomal protein S12 >gi|76884106|gb|ABA58787.1| SSU ribosomal protein S12P [Nitrosococcus oceani ATCC 19707] (124 aa)
Score = 373, Expect = 1.5e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  + +KS  PAL                P KRGVCTRV T TPKKPNSA+RK A+++LTNG EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LDT+GV  RRQ RS YGAKRPK
  S:     1 MATINQLVRKPRVRQKQKSNVPAL-------------QACPQKRGVCTRVYTTTPKKPNSAMRKVARIRLTNGMEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTAGVGDRRQGRSKYGAKRPK 123
>gi|182678332|ref|YP_001832478.1| ribosomal protein S12 [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634215|gb|ACB94989.1| ribosomal protein S12 [Beijerinckia indica subsp. indica ATCC 9039] (123 aa)
Score = 372, Expect = 1.6e-34, Identities = 89/136 (65%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QLIR  R +K  + K+             R     P KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTISQLIRKPRHEKAYREKA-------------RHLEACPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|161541288|ref|YP_826363.2| 30S ribosomal protein S12 [Solibacter usitatus Ellin6076] >gi|158563892|sp|Q01W87|RS12_SOLUE 30S ribosomal protein S12 (124 aa)
Score = 372, Expect = 1.6e-34, Identities = 87/136 (63%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T  QL+R+ RK    K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV  YIPG GHNLQEHS+VLI GGRVKDLPGVRYH++RG LDT+GV  R+Q RS YGAKRPK
  S:     1 MPTFNQLVRNGRKPPRWKTSSPAL-------------ESCPQKRGVCTRVYTSTPKKPNSALRKVARVRLTNGIEVTTYIPGVGHNLQEHSIVLIRGGRVKDLPGVRYHVIRGALDTAGVANRKQSRSKYGAKRPK 123
>gi|147674738|ref|YP_001218629.1| 30S ribosomal protein S12 [Vibrio cholerae O395] >gi|172047711|sp|A5F3L3|RS12_VIBC3 30S ribosomal protein S12 >gi|146316621|gb|ABQ21160.1| ribosomal protein S12 [Vibrio cholerae O395] (124 aa)
Score = 372, Expect = 1.6e-34, Identities = 86/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  +  KS  PAL                P KRGVCTRV T TP+KPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV  R+Q RS YG KRPK
  S:     1 MATINQLVRKPRAKQVVKSNVPALA-------------ACPQKRGVCTRVYTTTPRKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQARSKYGVKRPK 123
>gi|57242431|ref|ZP_00370369.1| ribosomal protein S12 [Campylobacter upsaliensis RM3195] >gi|57016716|gb|EAL53499.1| ribosomal protein S12 [Campylobacter upsaliensis RM3195] (129 aa)
Score = 372, Expect = 1.6e-34, Identities = 88/134 (65%), Positives = 101/134 (75%)
  Q:     3 TIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           TI QL+R +RK   +KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK
  S:     5 TINQLVRKERKKILEKSKSPAL-------------KNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPK 125
>gi|15803855|ref|NP_289889.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 EDL933] >gi|15833447|ref|NP_312220.1| 30S ribosomal protein S12 [Escherichia coli O157:H7 str. Sakai] >gi|16131221|ref|NP_417801.1| 30S ribosomal subunit protein S12 [Escherichia coli str. K-12 substr. MG1655] >gi|16762835|ref|NP_458452.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16766737|ref|NP_462352.1| 30S ribosomal protein S12 [Salmonella typhimurium LT2] >gi|29144322|ref|NP_807664.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|30065372|ref|NP_839543.1| 30S ribosomal protein S12 [Shigella flexneri 2a str. 2457T] >gi|56415367|ref|YP_152442.1| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56480314|ref|NP_709116.2| 30S ribosomal protein S12 [Shigella flexneri 2a str. 301] >gi|74313848|ref|YP_312267.1| 30S ribosomal protein S12 [Shigella sonnei Ss046] >gi|82545692|ref|YP_409639.1| 30S ribosomal protein S12 [Shigella boydii Sb227] >gi|82778623|ref|YP_404972.1| 30S ribosomal protein S12 [Shigella dysenteriae Sd197] >gi|89110668|ref|AP_004448.1| 30S ribosomal subunit protein S12 [Escherichia coli W3110] >gi|110807175|ref|YP_690695.1| 30S ribosomal protein S12 [Shigella flexneri 5 str. 8401] >gi|117625620|ref|YP_858943.1| 30S ribosomal protein S12 [Escherichia coli APEC O1] >gi|146313392|ref|YP_001178466.1| 30S ribosomal protein S12 [Enterobacter sp. 638] >gi|157159216|ref|YP_001464796.1| 30S ribosomal protein S12 [Escherichia coli E24377A] >gi|157162818|ref|YP_001460136.1| 30S ribosomal protein S12 [Escherichia coli HS] >gi|161486095|ref|NP_755980.2| 30S ribosomal protein S12 [Escherichia coli CFT073] >gi|162138355|ref|YP_542804.2| 30S ribosomal protein S12 [Escherichia coli UTI89] >gi|162139535|ref|YP_218369.2| 30S ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|168232575|ref|ZP_02657633.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168717119|ref|ZP_02749396.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4206] >gi|170018422|ref|YP_001723376.1| ribosomal protein S12 [Escherichia coli ATCC 8739] >gi|170683246|ref|YP_001745590.1| ribosomal protein S12 [Escherichia coli SMS-3-5] >gi|170769555|ref|ZP_02904008.1| ribosomal protein S12 [Escherichia albertii TW07627] >gi|187733627|ref|YP_001882015.1| ribosomal protein S12 [Shigella boydii CDC 3083-94] >gi|188492124|ref|ZP_02999394.1| ribosomal protein S12 [Escherichia coli 53638] >gi|189010787|ref|ZP_02809334.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4076] >gi|189401831|ref|ZP_02778106.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4401] >gi|189403222|ref|ZP_02794205.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4486] >gi|189404708|ref|ZP_02810157.2| ribosomal protein S12 [Escherichia coli O157:H7 str. EC869] >gi|191171605|ref|ZP_03033153.1| ribosomal protein S12 [Escherichia coli F11] >gi|194445616|ref|YP_002042698.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194450308|ref|YP_002047471.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194734350|ref|YP_002116390.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|62288954|sp|P0A7S3|RS12_ECOLI 30S ribosomal protein S12 >gi|123146630|sp|Q0SZX5|RS12_SHIF8 30S ribosomal protein S12 >gi|158512618|sp|A1AGM9|RS12_ECOK1 30S ribosomal protein S12 >gi|166991588|sp|A7ZSL7|RS12_ECO24 30S ribosomal protein S12 >gi|166991589|sp|A8A5E9|RS12_ECOHS 30S ribosomal protein S12 >gi|166991590|sp|A4WFD5|RS12_ENT38 30S ribosomal protein S12 >gi|189040458|sp|B1IPV7|RS12_ECOLC 30S ribosomal protein S12 >gi|62287384|sp|Q5PIW1|RS12_SALPA 30S ribosomal protein S12 >gi|62288955|sp|P0A7S4|RS12_ECOL6 30S ribosomal protein S12 >gi|62288956|sp|P0A7S5|RS12_ECO57 30S ribosomal protein S12 >gi|62288957|sp|P0A7S6|RS12_SALTY 30S ribosomal protein S12 >gi|62288958|sp|P0A7S7|RS12_SALTI 30S ribosomal protein S12 >gi|62288959|sp|P0A7S8|RS12_SHIFL 30S ribosomal protein S12 >gi|90111800|sp|Q57J24|RS12_SALCH 30S ribosomal protein S12 >gi|90111801|sp|Q31VU7|RS12_SHIBS 30S ribosomal protein S12 >gi|90111802|sp|Q32B24|RS12_SHIDS 30S ribosomal protein S12 >gi|90111803|sp|Q3YWT0|RS12_SHISS 30S ribosomal protein S12 >gi|119366769|sp|Q1R5U1|RS12_ECOUT 30S ribosomal protein S12 >gi|25294699|pir||AI1004 30S ribosomal chain protein S12 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|116666559|pdb|1VS5|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|116666611|pdb|1VS7|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|12517963|gb|AAG58449.1|AE005558_2 30S ribosomal subunit protein S12 [Escherichia coli O157:H7 EDL933] >gi|43010|emb|CAA23648.1| unnamed protein product [Escherichia coli] >gi|147892|gb|AAA50988.1| ribosomal protein S12 [Escherichia coli] >gi|154357|gb|AAA27216.1| ribosomal protein S12 [Salmonella typhimurium] >gi|208392|gb|AAA72526.1| ribosomal protein S12 [Cloning vector pHSG664] >gi|606276|gb|AAA58139.1| 30S ribosomal subunit protein S12 [Escherichia coli] >gi|1789740|gb|AAC76367.1| 30S ribosomal subunit protein S12 [Escherichia coli str. K-12 substr. MG1655] >gi|2501803|gb|AAC53716.1| small ribosomal protein [Cloning vector pAL-F] >gi|11120597|gb|AAG30937.1| ribosomal protein S12 [Escherichia coli K12] >gi|13363666|dbj|BAB37616.1| 30S ribosomal subunit protein S12 [Escherichia coli O157:H7 str. Sakai] >gi|16422005|gb|AAL22311.1| 30S ribosomal subunit protein S12 [Salmonella typhimurium LT2] >gi|16505141|emb|CAD08165.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139960|gb|AAO71524.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|30043634|gb|AAP19354.1| 30S ribosomal subunit protein S12 [Shigella flexneri 2a str. 2457T] >gi|56129624|gb|AAV79130.1| 30S ribosomal subunit protein S12 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56383865|gb|AAN44823.2| 30S ribosomal subunit protein S12 [Shigella flexneri 2a str. 301] >gi|73857325|gb|AAZ90032.1| 30S ribosomal subunit protein S12 [Shigella sonnei Ss046] >gi|81242771|gb|ABB63481.1| 30S ribosomal subunit protein S12 [Shigella dysenteriae Sd197] >gi|81247103|gb|ABB67811.1| 30S ribosomal subunit protein S12 [Shigella boydii Sb227] >gi|85676699|dbj|BAE77949.1| 30S ribosomal subunit protein S12 [Escherichia coli W3110] >gi|110616723|gb|ABF05390.1| 30S ribosomal subunit protein S12 [Shigella flexneri 5 str. 8401] >gi|115514744|gb|ABJ02819.1| 30S ribosomal protein S12 [Escherichia coli APEC O1] >gi|145320268|gb|ABP62415.1| SSU ribosomal protein S12P [Enterobacter sp. 638] >gi|157068498|gb|ABV07753.1| ribosomal protein S12 [Escherichia coli HS] >gi|157081246|gb|ABV20954.1| ribosomal protein S12 [Escherichia coli E24377A] >gi|161936401|emb|CAP53906.1| rpsL protein [Cloning vector pBAC-RT] >gi|169753350|gb|ACA76049.1| ribosomal protein S12 [Escherichia coli ATCC 8739] >gi|170121612|gb|EDS90543.1| ribosomal protein S12 [Escherichia albertii TW07627] >gi|170520964|gb|ACB19142.1| ribosomal protein S12 [Escherichia coli SMS-3-5] >gi|171194008|gb|ACB45196.1| ribosomal protein L [Cloning vector pMQ118] >gi|171194036|gb|ACB45219.1| ribosomal protein L [Cloning vector pMQ150] >gi|187430619|gb|ACD09893.1| ribosomal protein S12 [Shigella boydii CDC 3083-94] >gi|188487323|gb|EDU62426.1| ribosomal protein S12 [Escherichia coli 53638] >gi|188998489|gb|EDU67481.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4076] >gi|189359017|gb|EDU77436.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4401] >gi|189361745|gb|EDU80164.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC4486] >gi|189374566|gb|EDU92982.1| ribosomal protein S12 [Escherichia coli O157:H7 str. EC869] >gi|190908232|gb|EDV67823.1| ribosomal protein S12 [Escherichia coli F11] >gi|194404279|gb|ACF64501.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194408612|gb|ACF68831.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194709852|gb|ACF89073.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (124 aa)
Score = 372, Expect = 1.6e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:     1 MATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 123
>gi|70732887|ref|YP_262655.1| 30S ribosomal protein S12 [Pseudomonas fluorescens Pf-5] >gi|77461305|ref|YP_350812.1| 30S ribosomal protein S12 [Pseudomonas fluorescens PfO-1] >gi|90111793|sp|Q4K528|RS12_PSEF5 30S ribosomal protein S12 >gi|90111795|sp|Q3K5Y3|RS12_PSEPF 30S ribosomal protein S12 >gi|68347186|gb|AAY94792.1| ribosomal protein S12 [Pseudomonas fluorescens Pf-5] >gi|77385308|gb|ABA76821.1| SSU ribosomal protein S12P [Pseudomonas fluorescens PfO-1] (123 aa)
Score = 372, Expect = 1.6e-34, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK   +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R Q RS YG KRPK
  S:     1 MATINQLVRQPRKRIVEKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGTKRPK 123
>gi|28899547|ref|NP_799152.1| 30S ribosomal protein S12 [Vibrio parahaemolyticus RIMD 2210633] >gi|89075242|ref|ZP_01161673.1| 30S ribosomal protein S12 [Photobacterium sp. SKA34] >gi|90580823|ref|ZP_01236625.1| 30S ribosomal protein S12 [Vibrio angustum S14] >gi|156972437|ref|YP_001443344.1| 30S ribosomal protein S12 [Vibrio harveyi ATCC BAA-1116] >gi|163802784|ref|ZP_02196674.1| 30S ribosomal protein S12 [Vibrio campbellii AND4] >gi|166231895|sp|A7MZ64|RS12_VIBHB 30S ribosomal protein S12 >gi|31340395|sp|Q87L43|RS12_VIBPA 30S ribosomal protein S12 >gi|28807783|dbj|BAC61036.1| ribosomal protein S12 [Vibrio parahaemolyticus RIMD 2210633] >gi|89049064|gb|EAR54631.1| 30S ribosomal protein S12 [Photobacterium sp. SKA34] >gi|90437894|gb|EAS63083.1| 30S ribosomal protein S12 [Vibrio angustum S14] >gi|156524031|gb|ABU69117.1| hypothetical protein VIBHAR_00057 [Vibrio harveyi ATCC BAA-1116] >gi|159173491|gb|EDP58313.1| 30S ribosomal protein S12 [Vibrio campbellii AND4] (124 aa)
Score = 372, Expect = 1.7e-34, Identities = 87/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  +  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV  R+Q RS YG KRPK
  S:     1 MATINQLVRKPRAKQVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKQGRSKYGVKRPK 123
>gi|152998276|ref|YP_001343111.1| 30S ribosomal protein S12 [Marinomonas sp. MWYL1] >gi|189040465|sp|A6W397|RS12_MARMS 30S ribosomal protein S12 >gi|150839200|gb|ABR73176.1| ribosomal protein S12 [Marinomonas sp. MWYL1] (124 aa)
Score = 372, Expect = 1.7e-34, Identities = 89/137 (64%), Positives = 100/137 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           MAT+ QL+R  RK K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R+Q RS YG KRPK+
  S:     1 MATVNQLVRKPRKRKVAKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVQNRKQGRSKYGTKRPKK 124
>gi|15676064|ref|NP_273194.1| 30S ribosomal protein S12 [Neisseria meningitidis MC58] >gi|15793165|ref|NP_282987.1| 30S ribosomal protein S12 [Neisseria meningitidis Z2491] >gi|121634011|ref|YP_974256.1| 30S ribosomal protein S12 [Neisseria meningitidis FAM18] >gi|161870921|ref|YP_001600101.1| 30S ribosomal protein S12 [Neisseria meningitidis 053442] >gi|158513129|sp|A1KRG8|RS12_NEIMF 30S ribosomal protein S12 >gi|189040468|sp|A9M3X2|RS12_NEIM0 30S ribosomal protein S12 >gi|54039344|sp|P66375|RS12_NEIMB 30S ribosomal protein S12 >gi|54042117|sp|P66374|RS12_NEIMA 30S ribosomal protein S12 >gi|7225354|gb|AAF40595.1| 30S ribosomal protein S12 [Neisseria meningitidis MC58] >gi|120865717|emb|CAM09444.1| 30S ribosomal protein S12 [Neisseria meningitidis FAM18] >gi|121051184|emb|CAM07455.1| 30S ribosomal protein S12 [Neisseria meningitidis Z2491] >gi|161596474|gb|ABX74134.1| 30S ribosomal protein S12 [Neisseria meningitidis 053442] (123 aa)
Score = 372, Expect = 1.7e-34, Identities = 88/136 (64%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+     +K PAL                P KRGVCTRV T TPKKPNSALRK  KV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDT+GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKGRQKPVYVNKVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGAKRPK 123
>gi|56698323|ref|YP_168696.1| 30S ribosomal protein S12 [Silicibacter pomeroyi DSS-3] >gi|84499866|ref|ZP_00998132.1| ribosomal protein S12 [Oceanicola batsensis HTCC2597] >gi|126732281|ref|ZP_01748081.1| 30S ribosomal protein S12 [Sagittula stellata E-37] >gi|62287365|sp|Q5LMR2|RS12_SILPO 30S ribosomal protein S12 >gi|56680060|gb|AAV96726.1| ribosomal protein S12 [Silicibacter pomeroyi DSS-3] >gi|84391800|gb|EAQ04068.1| ribosomal protein S12 [Oceanicola batsensis HTCC2597] >gi|126707150|gb|EBA06216.1| 30S ribosomal protein S12 [Sagittula stellata E-37] (123 aa)
Score = 372, Expect = 1.8e-34, Identities = 92/136 (67%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNGYEV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVKRSKSQHL-------------EQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGYEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|85715136|ref|ZP_01046120.1| 30S ribosomal protein S12 [Nitrobacter sp. Nb-311A] >gi|92117093|ref|YP_576822.1| 30S ribosomal protein S12 [Nitrobacter hamburgensis X14] >gi|119366789|sp|Q1QN35|RS12_NITHX 30S ribosomal protein S12 >gi|85698051|gb|EAQ35924.1| 30S ribosomal protein S12 [Nitrobacter sp. Nb-311A] >gi|91799987|gb|ABE62362.1| SSU ribosomal protein S12P [Nitrobacter hamburgensis X14] (123 aa)
Score = 372, Expect = 1.8e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R  +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIASPRVIQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|27364735|ref|NP_760263.1| 30S ribosomal protein S12 [Vibrio vulnificus CMCP6] >gi|37681216|ref|NP_935825.1| 30S ribosomal protein S12 [Vibrio vulnificus YJ016] >gi|29611851|sp|Q8DCR0|RS12_VIBVU 30S ribosomal protein S12 >gi|52783381|sp|Q7MH40|RS12_VIBVY 30S ribosomal protein S12 >gi|27360880|gb|AAO09790.1|AE016801_109 Ribosomal protein S12 [Vibrio vulnificus CMCP6] >gi|37199967|dbj|BAC95796.1| ribosomal protein S12 [Vibrio vulnificus YJ016] (124 aa)
Score = 372, Expect = 1.9e-34, Identities = 87/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  +  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV  R+Q RS YG KRPK
  S:     1 MATINQLVRKPRAKQVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNNRKQGRSKYGVKRPK 123
>gi|69938872|ref|ZP_00633233.1| Ribosomal protein S12, bacterial and chloroplast form [Paracoccus denitrificans PD1222] >gi|119383505|ref|YP_914561.1| 30S ribosomal protein S12 [Paracoccus denitrificans PD1222] >gi|158512587|sp|A1B021|RS12_PARDP 30S ribosomal protein S12 >gi|119373272|gb|ABL68865.1| SSU ribosomal protein S12P [Paracoccus denitrificans PD1222] (123 aa)
Score = 372, Expect = 1.9e-34, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K ++SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVQRSKSQHL-------------QSCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGEKHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGAKRPK 123
>gi|119358196|ref|YP_912840.1| 30S ribosomal protein S12 [Chlorobium phaeobacteroides DSM 266] >gi|158512607|sp|A1BJ39|RS12_CHLPD 30S ribosomal protein S12 >gi|119355545|gb|ABL66416.1| SSU ribosomal protein S12P [Chlorobium phaeobacteroides DSM 266] (135 aa)
Score = 372, Expect = 1.9e-34, Identities = 91/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  R+Q RS YGAK+PK
  S:     1 MPTIQQLIRSGRSIKASKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPK 123
>gi|78189812|ref|YP_380150.1| 30S ribosomal protein S12 [Chlorobium chlorochromatii CaD3] >gi|90111773|sp|Q3APG8|RS12_CHLCH 30S ribosomal protein S12 >gi|78172011|gb|ABB29107.1| SSU ribosomal protein S12P [Chlorobium chlorochromatii CaD3] (137 aa)
Score = 372, Expect = 2.0e-34, Identities = 91/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  R+Q RS YGAK+PK
  S:     1 MPTIQQLIRLGRSVKVSKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKVEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPK 123
>gi|148263136|ref|YP_001229842.1| 30S ribosomal protein S12 [Geobacter uraniireducens Rf4] >gi|189040461|sp|A5GAY3|RS12_GEOUR 30S ribosomal protein S12 >gi|146396636|gb|ABQ25269.1| SSU ribosomal protein S12P [Geobacter uraniireducens Rf4] (123 aa)
Score = 372, Expect = 2.0e-34, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K  KS +PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD+ GV+ R++ RS YGAKRPK
  S:     1 MPTINQLIRIGRESKKDKSTAPAL-------------KCCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGVEVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDSVGVKDRKKSRSKYGAKRPK 123
>gi|72382915|ref|YP_292270.1| 30S ribosomal protein S12 [Prochlorococcus marinus str. NATL2A] >gi|90111791|sp|Q46IW1|RS12_PROMT 30S ribosomal protein S12 >gi|72002765|gb|AAZ58567.1| SSU ribosomal protein S12P [Prochlorococcus marinus str. NATL2A] (124 aa)
Score = 372, Expect = 2.0e-34, Identities = 91/137 (66%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +RK    K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYI G GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LDT+GV+ RRQ RS YGAK PKE
  S:     1 MPTIQQLIRTERKTLKTKTKSPAL-------------RGCPERRGVCTRVYTSTPKKPNSALRKVARVRLTSGFEVTAYIGGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGSLDTAGVKDRRQSRSKYGAKSPKE 124
>gi|167764376|ref|ZP_02436501.1| hypothetical protein BACSTE_02760 [Bacteroides stercoris ATCC 43183] >gi|167697781|gb|EDS14360.1| hypothetical protein BACSTE_02760 [Bacteroides stercoris ATCC 43183] (133 aa)
Score = 372, Expect = 2.0e-34, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+   +KSKSPAL             +  P +RGVC RV T TPKKPNSA+RK A+V+LTNG EV +YIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLDT+GV  R Q+RS YGAKRPK
  S:     1 MPTIQQLVRKGREVLVEKSKSPAL-------------DSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNGKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVANRTQRRSKYGAKRPK 123
>gi|118411216|ref|YP_874610.1| 30S ribosomal protein S12 [Thalassiosira pseudonana] >gi|125987677|sp|A0T0Z8|RR12_THAPS Chloroplast 30S ribosomal protein S12 >gi|116739963|gb|ABK20833.1| 30S ribosomal protein S12 [Thalassiosira pseudonana] (124 aa)
Score = 372, Expect = 2.0e-34, Identities = 88/136 (64%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R    KK+KSPAL+               P +RGVCTRV T TPKKPNSA+RK A+V+LT+G+EV AYIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD+ GV+ R Q+RS YG K+PK
  S:     1 MPTIQQLVRLRRIQITKKTKSPALV-------------NCPQRRGVCTRVYTTTPKKPNSAIRKVARVRLTSGFEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSGGVKDRTQRRSKYGVKKPK 123
>gi|34541545|ref|NP_906024.1| 30S ribosomal protein S12 [Porphyromonas gingivalis W83] >gi|52783382|sp|Q7MTK9|RS12_PORGI 30S ribosomal protein S12 >gi|34397862|gb|AAQ66923.1| ribosomal protein S12 [Porphyromonas gingivalis W83] (134 aa)
Score = 372, Expect = 2.0e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+    KSKSPAL             N  P +RGVC RV T TPKKPNSA+RK A+V+LTN  EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLDT+GV  R Q+RS YGAKRPK
  S:     1 MPTIQQLVRKGRESFADKSKSPAL-------------NSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNSKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGAKRPK 123
>gi|85712783|ref|ZP_01043827.1| 30S ribosomal protein S12 [Idiomarina baltica OS145] >gi|85693423|gb|EAQ31377.1| 30S ribosomal protein S12 [Idiomarina baltica OS145] (124 aa)
Score = 372, Expect = 2.0e-34, Identities = 88/136 (64%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R+    KS  PAL                P KRGVCTRV T TPKKPNSA+RK  +V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD SGV  R+Q RS YGAKRPK
  S:     1 MATVNQLVRKGRQKPVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSAMRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCSGVNDRKQGRSKYGAKRPK 123
>gi|83854985|ref|ZP_00948515.1| 30S ribosomal protein S12 [Sulfitobacter sp. NAS-14.1] >gi|83941507|ref|ZP_00953969.1| 30S ribosomal protein S12 [Sulfitobacter sp. EE-36] >gi|83842828|gb|EAP81995.1| 30S ribosomal protein S12 [Sulfitobacter sp. NAS-14.1] >gi|83847327|gb|EAP85202.1| 30S ribosomal protein S12 [Sulfitobacter sp. EE-36] (123 aa)
Score = 372, Expect = 2.1e-34, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAK+PK
  S:     1 MPTIQQLIRKPRQPKIKRSKSMHL-------------QECPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKKPK 123
>gi|28212179|ref|NP_783123.1| 30S ribosomal protein S12 [Clostridium tetani E88] >gi|52783406|sp|Q890N6|RS12_CLOTE 30S ribosomal protein S12 >gi|28204623|gb|AAO37060.1| SSU ribosomal protein S12P [Clostridium tetani E88] (125 aa)
Score = 371, Expect = 2.1e-34, Identities = 90/138 (65%), Positives = 99/138 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  RK    +S SPAL                P +RGVCT V T TPKKPNSALRK A+V+LTNGYEV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD++GV  R Q RS YGAK+PK+K
  S:     1 MPTINQLVRKSRKTVKAQSDSPAL-------------KNCPQRRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVSAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSAGVATRMQSRSKYGAKKPKQK 125
>gi|187935415|ref|YP_001884468.1| ribosomal protein S12 [Clostridium botulinum B str. Eklund 17B] >gi|188589278|ref|YP_001919667.1| ribosomal protein S12 [Clostridium botulinum E3 str. Alaska E43] >gi|187723568|gb|ACD24789.1| ribosomal protein S12 [Clostridium botulinum B str. Eklund 17B] >gi|188499559|gb|ACD52695.1| ribosomal protein S12 [Clostridium botulinum E3 str. Alaska E43] (125 aa)
Score = 371, Expect = 2.1e-34, Identities = 89/138 (64%), Positives = 98/138 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI+QL+R  RK    KS +PAL                P KRGVCT V T TPKKPNSALRK A+V+LTNG+EV AYI G GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD +GV  R Q RS YGAK+PK+K
  S:     1 MPTISQLVRKGRKSTAVKSTAPAL-------------KECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGFEVTAYIGGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDCAGVANRMQGRSKYGAKKPKQK 125
>gi|124302966|ref|YP_001023725.1| ribosomal protein S12 [Angiopteris evecta] >gi|158512826|sp|A2T357|RR12_ANGEV Chloroplast 30S ribosomal protein S12 >gi|113367278|gb|ABG79660.1| ribosomal protein S12 [Angiopteris evecta] (123 aa)
Score = 371, Expect = 2.1e-34, Identities = 86/136 (63%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M+TI QLIR+ R+    ++KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD  GV+ R+Q RS YG K+PK
  S:     1 MSTIQQLIRNTRQPIEDRTKSPAL-------------RGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRKQGRSQYGVKKPK 123
>gi|75675551|ref|YP_317972.1| 30S ribosomal protein S12 [Nitrobacter winogradskyi Nb-255] >gi|90111788|sp|Q3SSX1|RS12_NITWN 30S ribosomal protein S12 >gi|74420421|gb|ABA04620.1| SSU ribosomal protein S12P [Nitrobacter winogradskyi Nb-255] (123 aa)
Score = 371, Expect = 2.1e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R  +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIASPRVLQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|84515201|ref|ZP_01002564.1| 30S ribosomal protein S12 [Loktanella vestfoldensis SKA53] >gi|84511360|gb|EAQ07814.1| 30S ribosomal protein S12 [Loktanella vestfoldensis SKA53] (123 aa)
Score = 371, Expect = 2.2e-34, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K  KSKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYH++RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKIVKSKSQHL-------------ESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHVLRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|167031495|ref|YP_001666726.1| 30S ribosomal protein S12 [Pseudomonas putida GB-1] >gi|189040473|sp|B0KK62|RS12_PSEPG 30S ribosomal protein S12 >gi|166857983|gb|ABY96390.1| ribosomal protein S12 [Pseudomonas putida GB-1] (123 aa)
Score = 371, Expect = 2.2e-34, Identities = 88/136 (64%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK   +KS  PAL                P +RGVCTRV T TP+KPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R Q RS YG KRPK
  S:     1 MATINQLVRQPRKRSVEKSDVPAL-------------QNCPQRRGVCTRVYTTTPRKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGTKRPK 123
>gi|57240979|ref|ZP_00368927.1| ribosomal protein S12 [Campylobacter lari RM2100] >gi|57018598|gb|EAL55372.1| ribosomal protein S12 [Campylobacter lari RM2100] (132 aa)
Score = 371, Expect = 2.2e-34, Identities = 88/134 (65%), Positives = 101/134 (75%)
  Q:     3 TIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           TI QL+R +RK   +KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK
  S:     8 TINQLVRKERKKVLEKSKSPAL-------------KNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPK 128
>gi|113461783|ref|YP_719852.1| 30S ribosomal protein S12 [Haemophilus somnus 129PT] >gi|170718095|ref|YP_001785129.1| ribosomal protein S12 [Haemophilus somnus 2336] >gi|189040463|sp|B0UWC6|RS12_HAES2 30S ribosomal protein S12 >gi|119366774|sp|Q0I535|RS12_HAES1 30S ribosomal protein S12 >gi|112823826|gb|ABI25915.1| SSU ribosomal protein S12P [Haemophilus somnus 129PT] >gi|168826224|gb|ACA31595.1| ribosomal protein S12 [Haemophilus somnus 2336] (124 aa)
Score = 371, Expect = 2.2e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +++LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRVKKVVKSNVPAL-------------ESCPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQSRSKYGVKRPK 123
>gi|114771274|ref|ZP_01448694.1| 30S ribosomal protein S12 [alpha proteobacterium HTCC2255] >gi|114548199|gb|EAU51086.1| 30S ribosomal protein S12 [alpha proteobacterium HTCC2255] (123 aa)
Score = 371, Expect = 2.3e-34, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K+SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAK+PK
  S:     1 MPTIQQLIRKPRQPKIKRSKSQHL-------------ESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKKPK 123
>gi|15606128|ref|NP_213505.1| 30S ribosomal protein S12 [Aquifex aeolicus VF5] >gi|15606877|ref|NP_214257.1| 30S ribosomal protein S12 [Aquifex aeolicus VF5] >gi|6226057|sp|O70089|RS12_AQUAE 30S ribosomal protein S12 >gi|2983320|gb|AAC06910.1| ribosomal protein S12 [Aquifex aeolicus VF5] >gi|2984118|gb|AAC07655.1| ribosomal protein S12 [Aquifex aeolicus VF5] (128 aa)
Score = 371, Expect = 2.3e-34, Identities = 88/139 (63%), Positives = 103/139 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T  QL+++ R+ + KKSK+PAL                P KRGVC RV T+TPKKPNSALRK A+V+L+NG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRY I+RG LD +GVE RRQ RS YG KRPKE+K
  S:     1 MPTFNQLVKYGREKRKKKSKAPAL-------------QGCPQKRGVCVRVYTVTPKKPNSALRKVARVRLSNGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDAAGVEGRRQSRSKYGTKRPKEEK 126
>gi|50122958|ref|YP_052125.1| 30S ribosomal protein S12 [Pectobacterium atrosepticum SCRI1043] >gi|52783349|sp|Q6CZW3|RS12_ERWCT 30S ribosomal protein S12 >gi|49613484|emb|CAG76935.1| 30S ribosomal subunit protein S12 [Erwinia carotovora subsp. atroseptica SCRI1043] (124 aa)
Score = 371, Expect = 2.3e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATINQLVRKPRSLKAAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQSRSKYGVKKPK 123
>gi|90424942|ref|YP_533312.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris BisB18] >gi|119366798|sp|Q211E3|RS12_RHOPB 30S ribosomal protein S12 >gi|90106956|gb|ABD88993.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris BisB18] (123 aa)
Score = 371, Expect = 2.3e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R  +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIASPRVVQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|157372783|ref|YP_001480772.1| 30S ribosomal protein S12 [Serratia proteamaculans 568] >gi|166991593|sp|A8GKK4|RS12_SERP5 30S ribosomal protein S12 >gi|157324547|gb|ABV43644.1| ribosomal protein S12 [Serratia proteamaculans 568] (124 aa)
Score = 371, Expect = 2.3e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATINQLVRKPRSVKAAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKKPK 123
>gi|11467742|ref|NP_050794.1| ribosomal protein S12 [Guillardia theta] >gi|133735|sp|P19461|RR12_GUITH Chloroplast 30S ribosomal protein S12 >gi|3603067|gb|AAC35728.1| ribosomal protein S12 [Guillardia theta] (123 aa)
Score = 371, Expect = 2.3e-34, Identities = 88/137 (64%), Positives = 104/137 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R+   +K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHN+QEHSVVL+ GGRVKDLPGVRYHI+RGTLD +GV+ R+Q RS YGAK+PKE
  S:     1 MPTIQQLIRSERQ-TIQKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNIQEHSVVLLRGGRVKDLPGVRYHIIRGTLDAAGVKNRKQSRSKYGAKKPKE 123
>gi|53803526|ref|YP_114793.1| 30S ribosomal protein S12 [Methylococcus capsulatus str. Bath] >gi|61215835|sp|Q605A7|RS12_METCA 30S ribosomal protein S12 >gi|53757287|gb|AAU91578.1| ribosomal protein S12 [Methylococcus capsulatus str. Bath] (124 aa)
Score = 371, Expect = 2.3e-34, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R  K +KS  PAL                P +RGVCTRV T TPKKPNSALRK A+V+LTNG EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH+VRG+LDT+GV+KRRQ RS YGAKRPK
  S:     1 MTTINQLVRKPRVSKKEKSNVPAL-------------EGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTNGAEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHVVRGSLDTAGVQKRRQGRSKYGAKRPK 123
>gi|7524807|ref|NP_045809.1| ribosomal protein S12 [Chlorella vulgaris] >gi|3024564|sp|P56354|RR12_CHLVU Chloroplast 30S ribosomal protein S12 >gi|2224400|dbj|BAA57884.1| 30S ribosomal protein S12 [Chlorella vulgaris] (123 aa)
Score = 371, Expect = 2.4e-34, Identities = 89/136 (65%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD++GV+ R Q RS YG KRPK
  S:     1 MPTIQQLVRSARTRLSKKTKSPAL-------------KSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSAGVKDRSQSRSKYGVKRPK 123
>gi|110643583|ref|YP_671313.1| 30S ribosomal protein S12 [Escherichia coli 536] >gi|119366768|sp|Q0TCB7|RS12_ECOL5 30S ribosomal protein S12 >gi|22121665|gb|AAM88610.1| mutant 30S ribosomal subunit protein S12 [Escherichia coli] >gi|110345175|gb|ABG71412.1| 30S ribosomal protein S12 [Escherichia coli 536] (124 aa)
Score = 371, Expect = 2.4e-34, Identities = 86/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRV+DLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:     1 MATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVRDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 123
>gi|11120595|gb|AAG30936.1| ribosomal protein S12 [Escherichia coli] (124 aa)
Score = 371, Expect = 2.4e-34, Identities = 86/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TP+KPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:     1 MATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPRKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 123
>gi|172048406|sp|A8Z6I5|RS12_CAMC1 30S ribosomal protein S12 >gi|158604948|gb|ABW74765.1| ribosomal protein S12 [Campylobacter concisus 13826] (131 aa)
Score = 371, Expect = 2.4e-34, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R++RK    KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YGAKRPK
  S:     1 MPTINQLVRNERKKVTVKSKSPAL-------------KECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGAKRPK 123
>gi|37524438|ref|NP_927782.1| 30S ribosomal protein S12 [Photorhabdus luminescens subsp. laumondii TTO1] >gi|52783383|sp|Q7N9B4|RS12_PHOLL 30S ribosomal protein S12 >gi|36783862|emb|CAE12724.1| ribosomal protein S12 [Photorhabdus luminescens subsp. laumondii TTO1] (124 aa)
Score = 371, Expect = 2.4e-34, Identities = 88/136 (64%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNGYEV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATINQLVRKPRSMKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQGRSKYGVKKPK 123
>gi|74316418|ref|YP_314158.1| 30S ribosomal protein S12 [Thiobacillus denitrificans ATCC 25259] >gi|90111827|sp|Q3SLQ4|RS12_THIDA 30S ribosomal protein S12 >gi|74055913|gb|AAZ96353.1| Ribosomal protein S12m [Thiobacillus denitrificans ATCC 25259] (125 aa)
Score = 371, Expect = 2.5e-34, Identities = 89/137 (64%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR  R+   +KSK PAL                P +RGVCTRV T TPKKPNSALRK  KVKLT+G+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYH VRG+LDT+GV+ R+Q RS YGAKRPK+
  S:     1 MPTINQLIRKPRQAPVEKSKVPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVCKVKLTSGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQSRSKYGAKRPKK 124
>gi|110639539|ref|YP_679748.1| 30S ribosomal protein S12 [Cytophaga hutchinsonii ATCC 33406] >gi|119366765|sp|Q11QA8|RS12_CYTH3 30S ribosomal protein S12 >gi|110282220|gb|ABG60406.1| SSU ribosomal protein S12P [Cytophaga hutchinsonii ATCC 33406] (137 aa)
Score = 371, Expect = 2.5e-34, Identities = 88/134 (65%), Positives = 98/134 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R+    KSKSPAL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTN  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG LDT+GV  R+Q RS YGAKR
  S:     1 MPTIQQLVRKGREQLVFKSKSPAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNSKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGALDTAGVNGRKQSRSKYGAKR 121
>gi|194335440|ref|YP_002017234.1| ribosomal protein S12 [Pelodictyon phaeoclathratiforme BU-1] >gi|194307917|gb|ACF42617.1| ribosomal protein S12 [Pelodictyon phaeoclathratiforme BU-1] (136 aa)
Score = 371, Expect = 2.5e-34, Identities = 91/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  R+Q RS YGAK+PK
  S:     1 MPTIQQLIRLGRSVKASKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQPK 123
>gi|186902678|ref|ZP_02975620.1| ribosomal protein S12 [Cyanothece sp. PCC 7424] >gi|186690296|gb|EDU14930.1| ribosomal protein S12 [Cyanothece sp. PCC 7424] (123 aa)
Score = 371, Expect = 2.5e-34, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD +GV+ R+Q RS YG KRPK
  S:     1 MPTIQQLIRTERSKVQKKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDATGVKDRKQGRSKYGTKRPK 123
>gi|90417768|ref|ZP_01225680.1| ribosomal protein S12 [Aurantimonas sp. SI85-9A1] >gi|90337440|gb|EAS51091.1| ribosomal protein S12 [Aurantimonas sp. SI85-9A1] (123 aa)
Score = 371, Expect = 2.6e-34, Identities = 88/136 (64%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R    +++  PAL               +P KRGVCTRV T TPKKPNSALRK AKV+L NGYEV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLVRKPRVRPTERNTVPAL-------------EANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLVNGYEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|88710952|ref|ZP_01105040.1| 30S ribosomal protein S12 [Flavobacteriales bacterium HTCC2170] >gi|88805147|ref|ZP_01120667.1| 30S ribosomal protein S12 [Robiginitalea biformata HTCC2501] >gi|88709893|gb|EAR02125.1| 30S ribosomal protein S12 [Flavobacteriales bacterium HTCC2170] >gi|88786026|gb|EAR17195.1| 30S ribosomal protein S12 [Robiginitalea biformata HTCC2501] (124 aa)
Score = 371, Expect = 2.7e-34, Identities = 90/137 (65%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDT+GV  R Q+RS YGAKRPK+
  S:     1 MPTISQLVRKGRATITKKSKSAAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVAGRTQRRSKYGAKRPKK 124
>gi|116748986|ref|YP_845673.1| 30S ribosomal protein S12 [Syntrophobacter fumaroxidans MPOB] >gi|158512348|sp|A0LII6|RS12_SYNFM 30S ribosomal protein S12 >gi|116698050|gb|ABK17238.1| SSU ribosomal protein S12P [Syntrophobacter fumaroxidans MPOB] (123 aa)
Score = 371, Expect = 2.7e-34, Identities = 88/136 (64%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R++  KKS +PAL                P KRGVC RV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD  GV  R+Q RS YG KRPK
  S:     1 MPTINQLVRKGREEIRKKSSTPALQCC-------------PQKRGVCVRVYTTTPKKPNSALRKIARVRLTNGIEVTSYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDALGVADRKQGRSKYGTKRPK 123
>gi|189485079|ref|YP_001956020.1| 30S ribosomal protein S12 [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287038|dbj|BAG13559.1| 30S ribosomal protein S12 [uncultured Termite group 1 bacterium phylotype Rs-D17] (131 aa)
Score = 371, Expect = 2.7e-34, Identities = 83/131 (63%), Positives = 100/131 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYG 131
           M TI QLI + RK   KK+KSPAL                P +RGVCTRV T+TP+KPNSALRK A+V+LT+GYE+ +YIPGEGHNLQEHS+VLI GGR++DLPGVRYHI+RGTLDT+GV+ R+Q RS YG
  S:     1 MPTINQLITNGRKGIIKKTKSPAL-------------KNCPQRRGVCTRVYTVTPRKPNSALRKVARVRLTSGYEISSYIPGEGHNLQEHSLVLIRGGRIRDLPGVRYHIIRGTLDTAGVDGRKQGRSKYG 118
>gi|117617539|ref|YP_858449.1| 30S ribosomal protein S12 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|162209425|ref|YP_001140226.2| 30S ribosomal protein S12 [Aeromonas salmonicida subsp. salmonicida A449] >gi|158512306|sp|A0KQ98|RS12_AERHH 30S ribosomal protein S12 >gi|158514190|sp|A4SHV6|RS12_AERS4 30S ribosomal protein S12 >gi|117558946|gb|ABK35894.1| ribosomal protein S12 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (124 aa)
Score = 371, Expect = 2.7e-34, Identities = 87/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R     KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRIKLVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQARSKYGVKRPK 123
>gi|121997654|ref|YP_001002441.1| 30S ribosomal protein S12 [Halorhodospira halophila SL1] >gi|158514011|sp|A1WVC7|RS12_HALHL 30S ribosomal protein S12 >gi|121589059|gb|ABM61639.1| SSU ribosomal protein S12P [Halorhodospira halophila SL1] (125 aa)
Score = 371, Expect = 2.7e-34, Identities = 91/138 (65%), Positives = 101/138 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           MAT+ QL+R  R  +  KS  PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTN YEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH+VRG  DT+GV+KRRQ RS YGAKRPK+K
  S:     1 MATVNQLVRKGRTKRTAKSSVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNSYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGAADTAGVDKRRQGRSKYGAKRPKKK 125
>gi|190572939|ref|YP_001970784.1| putative 30S ribosomal protein S12 [Stenotrophomonas maltophilia K279a] >gi|194364529|ref|YP_002027139.1| ribosomal protein S12 [Stenotrophomonas maltophilia R551-3] >gi|190010861|emb|CAQ44470.1| putative 30S ribosomal protein S12 [Stenotrophomonas maltophilia K279a] >gi|194347333|gb|ACF50456.1| ribosomal protein S12 [Stenotrophomonas maltophilia R551-3] (124 aa)
Score = 370, Expect = 2.7e-34, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+    KS SPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:     1 MATINQLVRKPRQATTYKSASPAL-------------DKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQARSKYGAKRPK 123
>gi|160888403|ref|ZP_02069406.1| hypothetical protein BACUNI_00816 [Bacteroides uniformis ATCC 8492] >gi|156862080|gb|EDO55511.1| hypothetical protein BACUNI_00816 [Bacteroides uniformis ATCC 8492] (133 aa)
Score = 370, Expect = 2.8e-34, Identities = 89/136 (65%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+   +KSKSPAL             +  P +RGVC RV T TPKKPNSA+RK A+V+LTNG EV +YIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLDT+GV  R Q+RS YGAKRPK
  S:     1 MPTIQQLVRKGREVLVEKSKSPAL-------------DSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNGKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVAGRTQRRSKYGAKRPK 123
>gi|52424217|ref|YP_087354.1| 30S ribosomal protein S12 [Mannheimia succiniciproducens MBEL55E] >gi|60390793|sp|Q65W91|RS12_MANSM 30S ribosomal protein S12 >gi|52306269|gb|AAU36769.1| RpsL protein [Mannheimia succiniciproducens MBEL55E] (124 aa)
Score = 370, Expect = 2.8e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +++LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRVKKVVKSNVPAL-------------QACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGVKRPK 123
>gi|118496848|ref|YP_897898.1| 30S ribosomal protein S12 [Francisella tularensis subsp. novicida U112] >gi|194324468|ref|ZP_03058240.1| ribosomal protein S12 [Francisella tularensis subsp. novicida FTE] >gi|158512416|sp|A0Q4H9|RS12_FRATN 30S ribosomal protein S12 >gi|118422754|gb|ABK89144.1| 30S ribosomal protein S12 [Francisella tularensis subsp. novicida U112] >gi|151569942|gb|EDN35596.1| 30S ribosomal protein S12 [Francisella tularensis subsp. novicida GA99-3549] >gi|151571417|gb|EDN37071.1| 30S ribosomal protein S12 [Francisella tularensis subsp. novicida GA99-3548] >gi|194321303|gb|EDX18789.1| ribosomal protein S12 [Francisella tularensis subsp. novicida FTE] (124 aa)
Score = 370, Expect = 2.9e-34, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+ + RK    KSK PAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDTSGV  R+  RS YG KRPK
  S:     1 MATINQLVNNPRKRSVVKSKVPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVNNRKHGRSKYGTKRPK 123
>gi|108758569|ref|YP_631494.1| 30S ribosomal protein S12 [Myxococcus xanthus DK 1622] >gi|27151677|sp|Q8KRD1|RS12_MYXXA 30S ribosomal protein S12 >gi|119366788|sp|Q1D779|RS12_MYXXD 30S ribosomal protein S12 >gi|21307596|gb|AAK59393.1| 30S ribosomal protein S12 [Myxococcus xanthus] >gi|108462449|gb|ABF87634.1| ribosomal protein S12 [Myxococcus xanthus DK 1622] (123 aa)
Score = 370, Expect = 2.9e-34, Identities = 90/135 (66%), Positives = 99/135 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRP 135
           M TI+QL+R  R+    K KSPAL               SP KRGVCTRV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVV+I GGRVKDLPGVRYHIVRGTLD+ GV  R+Q RS YGAKRP
  S:     1 MPTISQLVRKGREKLVVKGKSPAL-------------KESPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIEVTSYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIVRGTLDSVGVAGRKQSRSKYGAKRP 122
>gi|59802166|ref|YP_208878.1| 30S ribosomal protein S12 [Neisseria gonorrhoeae FA 1090] >gi|75355448|sp|Q5F5S1|RS12_NEIG1 30S ribosomal protein S12 >gi|59719061|gb|AAW90466.1| putative 30S ribosomal protein S12 [Neisseria gonorrhoeae FA 1090] (123 aa)
Score = 370, Expect = 2.9e-34, Identities = 87/136 (63%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+     +K PAL                P KRGVCTRV T TP+KPNSALRK  KV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDT+GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKGRQKPVYVNKVPAL-------------EACPQKRGVCTRVYTTTPRKPNSALRKVCKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGAKRPK 123
>gi|194470904|ref|ZP_03076888.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194457268|gb|EDX46107.1| ribosomal protein S12 [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (124 aa)
Score = 370, Expect = 3.0e-34, Identities = 86/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGV YH VRG LD SGV+ R+Q RS YG KRPK
  S:     1 MATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVCYHTVRGALDCSGVKDRKQARSKYGVKRPK 123
>gi|188995736|ref|YP_001929988.1| 30S ribosomal protein S12 [Porphyromonas gingivalis ATCC 33277] >gi|188595416|dbj|BAG34391.1| 30S ribosomal protein S12 [Porphyromonas gingivalis ATCC 33277] (134 aa)
Score = 370, Expect = 3.0e-34, Identities = 89/136 (65%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+    KSKSPAL             N  P +RGVC RV T TP+KPNSA+RK A+V+LTN  EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLDT+GV  R Q+RS YGAKRPK
  S:     1 MPTIQQLVRKGRESFADKSKSPAL-------------NSCPQRRGVCVRVYTTTPRKPNSAMRKVARVRLTNSKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGAKRPK 123
>gi|126734501|ref|ZP_01750247.1| 30S ribosomal protein S12 [Roseobacter sp. CCS2] >gi|126715056|gb|EBA11921.1| 30S ribosomal protein S12 [Roseobacter sp. CCS2] (123 aa)
Score = 370, Expect = 3.0e-34, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K  KSKS  +                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVTKSKSQHM-------------EGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|16272525|ref|NP_438739.1| 30S ribosomal protein S12 [Haemophilus influenzae Rd KW20] >gi|42630028|ref|ZP_00155573.1| COG0048: Ribosomal protein S12 [Haemophilus influenzae R2846] >gi|42630860|ref|ZP_00156399.1| COG0048: Ribosomal protein S12 [Haemophilus influenzae R2866] >gi|68249207|ref|YP_248319.1| 30S ribosomal protein S12 [Haemophilus influenzae 86-028NP] >gi|126208865|ref|YP_001054090.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae L20] >gi|145629759|ref|ZP_01785554.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.1-21] >gi|145631886|ref|ZP_01787643.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae 22.4-21] >gi|145633462|ref|ZP_01789191.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae 3655] >gi|145635869|ref|ZP_01791559.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittAA] >gi|145637944|ref|ZP_01793585.1| 30S ribosomal protein S7 [Haemophilus influenzae PittHH] >gi|145638509|ref|ZP_01794118.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittII] >gi|145640559|ref|ZP_01796143.1| 30S ribosomal protein S7 [Haemophilus influenzae R3021] >gi|148825139|ref|YP_001289892.1| 30S ribosomal protein S12 [Haemophilus influenzae PittEE] >gi|148827805|ref|YP_001292558.1| 30S ribosomal protein S12 [Haemophilus influenzae PittGG] >gi|165976831|ref|YP_001652424.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150807|ref|YP_001969332.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|158513511|sp|A3N249|RS12_ACTP2 30S ribosomal protein S12 >gi|166231862|sp|A5U9Q8|RS12_HAEIE 30S ribosomal protein S12 >gi|166231863|sp|A5UHB9|RS12_HAEIG 30S ribosomal protein S12 >gi|52783784|sp|P63195|RS12_PASHA 30S ribosomal protein S12 >gi|52783785|sp|P63196|RS12_HAEIN 30S ribosomal protein S12 (Streptomycin resistance protein) >gi|81336389|sp|Q4QMT8|RS12_HAEI8 30S ribosomal protein S12 >gi|6690556|gb|AAF24190.1|AF160257_1 ribosomal protein S12 [Mannheimia haemolytica] >gi|148985|gb|AAA25003.1| StrA >gi|1573569|gb|AAC22239.1| ribosomal protein S12 (rps12) [Haemophilus influenzae Rd KW20] >gi|68057406|gb|AAX87659.1| 30S ribosomal protein S12 [Haemophilus influenzae 86-028NP] >gi|126097657|gb|ABN74485.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae L20] >gi|144977998|gb|EDJ87782.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.1-21] >gi|144982489|gb|EDJ90052.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae R3021] >gi|144985831|gb|EDJ92439.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae 3655] >gi|145266881|gb|EDK06895.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittAA] >gi|145268858|gb|EDK08820.1| 30S ribosomal protein S7 [Haemophilus influenzae PittHH] >gi|145272104|gb|EDK12012.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Haemophilus influenzae PittII] >gi|145275145|gb|EDK15007.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.4-21] >gi|148715299|gb|ABQ97509.1| 30S ribosomal protein S12 [Haemophilus influenzae PittEE] >gi|148719047|gb|ABR00175.1| 30S ribosomal protein S12 [Haemophilus influenzae PittGG] >gi|165876932|gb|ABY69980.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915938|gb|ACE62190.1| 30S ribosomal protein S12 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (124 aa)
Score = 370, Expect = 3.0e-34, Identities = 87/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +++LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRVKKVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGVKRPK 123
>gi|15603219|ref|NP_246293.1| 30S ribosomal protein S12 [Pasteurella multocida subsp. multocida str. Pm70] >gi|14423912|sp|Q9CL86|RS12_PASMU 30S ribosomal protein S12 >gi|71153724|sp|Q5F1R7|RS12_HAEPR 30S ribosomal protein S12 >gi|12721724|gb|AAK03438.1| RpS12 [Pasteurella multocida subsp. multocida str. Pm70] >gi|37929046|gb|AAP70010.1| ribosomal protein S12 [Haemophilus parasuis] (124 aa)
Score = 370, Expect = 3.1e-34, Identities = 88/136 (64%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +++LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRVKKVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRIRLTNGYEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGVKRPK 123
>gi|196178554|gb|EDX73553.1| ribosomal protein S12 [Microcoleus chthonoplastes PCC 7420] (123 aa)
Score = 370, Expect = 3.1e-34, Identities = 89/136 (65%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +R     K+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLDT+GV+ R+Q RS YG KRPK
  S:     1 MPTIQQLIRSERAKIKAKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDTAGVKDRKQGRSKYGTKRPK 123
>gi|57504742|ref|ZP_00370796.1| ribosomal protein S12 [Campylobacter coli RM2228] >gi|57019398|gb|EAL56096.1| ribosomal protein S12 [Campylobacter coli RM2228] (128 aa)
Score = 370, Expect = 3.1e-34, Identities = 88/136 (64%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R +RK   +KSKSPAL                P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV KR   RS YG KRPK
  S:     1 MPTINQLVRKERKKVLEKSKSPAL-------------KNCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVAKRTVSRSKYGTKRPK 123
>gi|147676650|ref|YP_001210865.1| 30S ribosomal protein S12 [Pelotomaculum thermopropionicum SI] >gi|189040469|sp|A5D5I5|RS12_PELTS 30S ribosomal protein S12 >gi|146272747|dbj|BAF58496.1| ribosomal protein S12 [Pelotomaculum thermopropionicum SI] (124 aa)
Score = 370, Expect = 3.2e-34, Identities = 88/137 (64%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QLIR  R++  KKS +PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LD++GV+ R + RS YG KRPK+
  S:     1 MPTISQLIRKGREEAVKKSAAPAL-------------KECPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDSAGVQNRNRGRSKYGTKRPKK 124
>gi|42524379|ref|NP_969759.1| 30S ribosomal protein S12 [Bdellovibrio bacteriovorus HD100] >gi|52783363|sp|Q6MJ11|RS12_BDEBA 30S ribosomal protein S12 >gi|39576588|emb|CAE80752.1| 30S ribosomal protein S12 [Bdellovibrio bacteriovorus HD100] (124 aa)
Score = 370, Expect = 3.2e-34, Identities = 86/137 (62%), Positives = 100/137 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLI+ +R  +  ++KSPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+L+NG+EV++YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD  GV  R + RS YG KRPK+
  S:     1 MPTINQLIKSERTVQKNQTKSPAL-------------DSCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLSNGFEVISYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVLDLQGVNGRLRARSKYGTKRPKK 124
>gi|160872811|ref|ZP_02062943.1| ribosomal protein S12 [Rickettsiella grylli] >gi|159121610|gb|EDP46948.1| ribosomal protein S12 [Rickettsiella grylli] (125 aa)
Score = 370, Expect = 3.3e-34, Identities = 89/138 (64%), Positives = 100/138 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           MATI QL+R  R  +  KS  PAL             +  P KRGVCTRV T+TPKKPNSALRK A+V+LTNG EV  YI GEGHNLQEHSV+L+ GGRVKDLPGVRYH+VRG LD SGV  R+Q RS YGAKRPK+K
  S:     1 MATINQLVRKPRVQRRVKSMVPAL-------------SSCPQKRGVCTRVYTVTPKKPNSALRKVARVRLTNGMEVTTYIGGEGHNLQEHSVILMRGGRVKDLPGVRYHVVRGALDASGVSGRKQGRSKYGAKRPKDK 125
>gi|90417540|ref|ZP_01225461.1| ribosomal protein S12 [marine gamma proteobacterium HTCC2207] >gi|90330632|gb|EAS45922.1| ribosomal protein S12 [marine gamma proteobacterium HTCC2207] (124 aa)
Score = 370, Expect = 3.4e-34, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K  KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LT+G+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRGTLDT+GV  R Q+RS YG KRPK
  S:     1 MATINQLVRKPRKRKVSKSDVPAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTSGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGTLDTAGVNGRSQRRSKYGTKRPK 123
>gi|22711991|ref|NP_683767.1| ribosomal protein S12 [Chaetosphaeridium globosum] >gi|25009148|sp|Q8MA18|RR12_CHAGL Chloroplast 30S ribosomal protein S12 >gi|22416995|gb|AAM96595.1| ribosomal protein S12 [Chaetosphaeridium globosum] (123 aa)
Score = 370, Expect = 3.4e-34, Identities = 88/136 (64%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+    ++KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD+ GV+ R Q RS YGAK+PK
  S:     1 MPTIQQLIRNRREPIENRTKSPAL-------------RSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDSVGVKDRHQGRSKYGAKKPK 123
>gi|71905956|ref|YP_283543.1| 30S ribosomal protein S12 [Dechloromonas aromatica RCB] >gi|90111777|sp|Q47JA8|RS12_DECAR 30S ribosomal protein S12 >gi|71845577|gb|AAZ45073.1| SSU ribosomal protein S12P [Dechloromonas aromatica RCB] (125 aa)
Score = 370, Expect = 3.4e-34, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R  +  KSK PAL                P KRGVCTRV T TPKKPNSALRK  KV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDT GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLVRKPRVAEKAKSKVPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVCKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTQGVKDRKQSRSKYGAKRPK 123
>gi|86749410|ref|YP_485906.1| 30S ribosomal protein S12 [Rhodopseudomonas palustris HaA2] >gi|119366797|sp|Q2IXR5|RS12_RHOP2 30S ribosomal protein S12 >gi|86572438|gb|ABD06995.1| SSU ribosomal protein S12P [Rhodopseudomonas palustris HaA2] (123 aa)
Score = 370, Expect = 3.4e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R  +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIARPRVVQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|1173192|sp|P42344|RR12_SPIMX Chloroplast 30S ribosomal protein S12 >gi|951437|gb|AAB01590.1| ribosomal protein S12 (123 aa)
Score = 370, Expect = 3.5e-34, Identities = 90/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+    K+KSPAL               SP +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD  GV+ RR+ RS YG KRPK
  S:     1 MPTIQQLIRNKRQAAENKTKSPALQR-------------SPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDVVGVKDRRKGRSKYGVKRPK 123
>gi|171462874|ref|YP_001796987.1| ribosomal protein S12 [Polynucleobacter necessarius STIR1] >gi|171192412|gb|ACB43373.1| ribosomal protein S12 [Polynucleobacter necessarius STIR1] (126 aa)
Score = 370, Expect = 3.5e-34, Identities = 91/137 (66%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR  R     KSKSPA+               SP +RGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKR K+
  S:     1 MPTINQLIRKPRARLTVKSKSPAM-------------QNSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKRAKK 124
>gi|195441804|ref|XP_002068664.1| GK12483 [Drosophila willistoni] >gi|194164749|gb|EDW79650.1| GK12483 [Drosophila willistoni] (126 aa)
Score = 370, Expect = 3.5e-34, Identities = 90/137 (65%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDT+GV  R Q+RS YGAKRPK+
  S:     3 MPTISQLVRKGRAKITKKSKSAAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVAGRTQRRSKYGAKRPKK 126
>gi|15617123|ref|NP_240336.1| 30S ribosomal protein S12 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11387088|sp|P57595|RS12_BUCAI 30S ribosomal protein S12 >gi|25294689|pir||F84991 30S ribosomal protein S12 [imported] - Buchnera sp. (strain APS) >gi|10039188|dbj|BAB13222.1| 30S ribosomal protein S12 [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (124 aa)
Score = 369, Expect = 3.6e-34, Identities = 88/137 (64%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           MAT+ QL+R  R  K  KS  PAL               SP KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV AYI GEGHNLQEHSV+LI GGRVKDLPGVRYHIVRG+LD +GV++R+Q RS YG K+PK+
  S:     1 MATVNQLVRKPRVRKVIKSNVPAL-------------GKSPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTAYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHIVRGSLDCAGVKERKQGRSKYGVKKPKK 124
>gi|187251830|ref|YP_001876312.1| ribosomal protein S12 [Elusimicrobium minutum Pei191] >gi|186971990|gb|ACC98975.1| ribosomal protein S12 [Elusimicrobium minutum Pei191] (126 aa)
Score = 369, Expect = 3.7e-34, Identities = 88/139 (63%), Positives = 98/139 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M T+ QL+R  R     K+KSPALM               P +RGVCTRV T TPKKPNSALRK A+VKLT+  EV AYIPG GHNLQEHS+VL+ GGRVKDLPGVRYHI+RG LD SGVE R+Q RS YG KRPK  K
  S:     1 MPTVNQLVRQGRTMNKTKTKSPALM-------------SCPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSKVEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYHIIRGALDASGVENRKQGRSLYGVKRPKAAK 126
>gi|109629811|gb|ABG35127.1| mutant RpsL [Serratia marcescens] (124 aa)
Score = 369, Expect = 3.7e-34, Identities = 86/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TP KPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATINQLVRKPRSVKAAKSNVPAL-------------EACPQKRGVCTRVYTTTPIKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKKPK 123
>gi|167752381|ref|ZP_02424508.1| hypothetical protein ALIPUT_00625 [Alistipes putredinis DSM 17216] >gi|167660622|gb|EDS04752.1| hypothetical protein ALIPUT_00625 [Alistipes putredinis DSM 17216] (134 aa)
Score = 369, Expect = 3.8e-34, Identities = 87/134 (64%), Positives = 100/134 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R+ R     KSKSPAL                P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYH+VRG LD++GV+ RRQ+RS YGAKR
  S:     1 MPTIQQLVRNGRVRLEDKSKSPALA-------------ACPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHLVRGALDSAGVDGRRQRRSKYGAKR 121
>gi|126662268|ref|ZP_01733267.1| 30S ribosomal protein S12 [Flavobacteria bacterium BAL38] >gi|126625647|gb|EAZ96336.1| 30S ribosomal protein S12 [Flavobacteria bacterium BAL38] (135 aa)
Score = 369, Expect = 3.9e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDT+GV  R Q+RS YGAKRPK
  S:     1 MPTIQQLVRTGRTQITKKSKSAAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGNEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVAGRTQRRSKYGAKRPK 123
>gi|28867849|ref|NP_790468.1| 30S ribosomal protein S12 [Pseudomonas syringae pv. tomato str. DC3000] >gi|66047780|ref|YP_237621.1| 30S ribosomal protein S12 [Pseudomonas syringae pv. syringae B728a] >gi|71734434|ref|YP_276711.1| 30S ribosomal protein S12 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|38258479|sp|Q889X6|RS12_PSESM 30S ribosomal protein S12 >gi|75500411|sp|Q4ZMN9|RS12_PSEU2 30S ribosomal protein S12 >gi|90111792|sp|Q48D31|RS12_PSE14 30S ribosomal protein S12 >gi|28851085|gb|AAO54163.1| ribosomal protein S12 [Pseudomonas syringae pv. tomato str. DC3000] >gi|63258487|gb|AAY39583.1| Ribosomal protein S12, bacterial and chloroplast form [Pseudomonas syringae pv. syringae B728a] >gi|71554987|gb|AAZ34198.1| ribosomal protein S12 [Pseudomonas syringae pv. phaseolicola 1448A] (123 aa)
Score = 369, Expect = 3.9e-34, Identities = 88/136 (64%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK   +KS  PAL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDTSGV+ R Q RS YG K+PK
  S:     1 MATINQLVRQPRKRIVEKSDVPAL-------------QNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGTKKPK 123
>gi|167729445|emb|CAO80356.1| 30S ribosomal subunit protein S12 [Candidatus Cloacamonas acidaminovorans] (128 aa)
Score = 369, Expect = 3.9e-34, Identities = 89/138 (64%), Positives = 101/138 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R +  KK K+ ALM               P +RGVCTRV T TPKKPNSALRK A+V+L NG+EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LD++GVEKR + RS YG KRPK K
  S:     1 MPTINQLVRKGRAEVEKKRKNRALM-------------ECPQRRGVCTRVYTTTPKKPNSALRKVARVRLVNGFEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDSAGVEKREKSRSKYGTKRPKAK 125
>gi|69216533|gb|AAZ03932.1| ribosomal protein S12 [Ginkgo biloba] (123 aa)
Score = 369, Expect = 3.9e-34, Identities = 86/136 (63%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+     +KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD  GV+ R+Q RS YG K+PK
  S:     1 MPTIQQLIRNARQPIENGTKSPAL-------------RGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGVKKPK 123
>gi|126658890|ref|ZP_01730033.1| 30S ribosomal protein S12 [Cyanothece sp. CCY0110] >gi|172039004|ref|YP_001805505.1| 30S ribosomal protein S12 [Cyanothece sp. ATCC 51142] >gi|126619840|gb|EAZ90566.1| 30S ribosomal protein S12 [Cyanothece sp. CCY0110] >gi|171700458|gb|ACB53439.1| 30S ribosomal protein S12 [Cyanothece sp. ATCC 51142] (124 aa)
Score = 369, Expect = 4.0e-34, Identities = 90/137 (65%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLIR +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHI+RGTLD  GV+ R+Q RS YG K+PKE
  S:     1 MPTIQQLIRSERSKAKKKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVKDRKQGRSKYGTKKPKE 124
>gi|160883069|ref|ZP_02064072.1| hypothetical protein BACOVA_01032 [Bacteroides ovatus ATCC 8483] >gi|156111541|gb|EDO13286.1| hypothetical protein BACOVA_01032 [Bacteroides ovatus ATCC 8483] (136 aa)
Score = 369, Expect = 4.1e-34, Identities = 88/136 (64%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+   +KSKSPAL             +  P +RGVC RV T TPKKPNSA+RK A+V+LTN  EV +YIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLDT+GV  R Q+RS YGAKRPK
  S:     1 MPTIQQLVRKGREVLVEKSKSPAL-------------DSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNQKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVAGRTQRRSKYGAKRPK 123
>gi|170788992|gb|EDT30036.1| ribosomal protein S12 [Oligotropha carboxidovorans OM5] (123 aa)
Score = 369, Expect = 4.2e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI   R  +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIAKPRVLQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 123
>gi|167626810|ref|YP_001677310.1| 30S ribosomal protein S12 [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189040460|sp|B0U0Z3|RS12_FRAP2 30S ribosomal protein S12 >gi|167596811|gb|ABZ86809.1| 30S ribosomal protein S12 [Francisella philomiragia subsp. philomiragia ATCC 25017] (124 aa)
Score = 369, Expect = 4.2e-34, Identities = 89/136 (65%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+   RK    KSK PAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDTSGV  R+  RS YG KRPK
  S:     1 MATINQLVNSPRKRSVVKSKVPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTSGVNNRKHGRSKYGTKRPK 123
>gi|134096326|ref|YP_001101401.1| 30S ribosomal protein S12 [Herminiimonas arsenicoxydans] >gi|152980527|ref|YP_001355106.1| 30S ribosomal protein S12 [Janthinobacterium sp. Marseille] >gi|158513608|sp|A4G9U3|RS12_HERAR 30S ribosomal protein S12 >gi|166231865|sp|A6T3K9|RS12_JANMA 30S ribosomal protein S12 >gi|133740229|emb|CAL63280.1| 30S ribosomal subunit protein S12 [Herminiimonas arsenicoxydans] >gi|151280604|gb|ABR89014.1| small subunit ribosomal protein S12 [Janthinobacterium sp. Marseille] (127 aa)
Score = 369, Expect = 4.3e-34, Identities = 92/140 (65%), Positives = 101/140 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QLIR  R     KSKSPAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYH+VRG LDT GV+ R+Q RS YG KR K  K+
  S:     1 MPTINQLIRQPRVSARVKSKSPAL-------------ENSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLLRGGRVKDLPGVRYHMVRGALDTQGVKDRKQARSKYGTKRAKAGKK 127
>gi|153805604|ref|YP_001382187.1| ribosomal protein S12 [Leptosira terrestris] >gi|134270135|gb|ABO69324.1| ribosomal protein S12 [Leptosira terrestris] (123 aa)
Score = 369, Expect = 4.5e-34, Identities = 86/136 (63%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL++H RK   K +KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+L+ G+EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD +GV+ R + RS YG K+PK
  S:     1 MPTIQQLVQHARKKILKNTKSPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVARVRLSTGFEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAAGVKNRIKTRSKYGVKKPK 123
>gi|6094150|sp|O50563|RS12_THICU 30S ribosomal protein S12 >gi|2654446|gb|AAB87731.1| ribosomal protein S12 [Thiomonas cuprina] (124 aa)
Score = 368, Expect = 4.8e-34, Identities = 88/137 (64%), Positives = 100/137 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R     +  KSKS A+               SP +RGVCTRV T TPKKPNSALRK AKV LTNG+EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAKRPK+
  S:     1 MPTINQLVRQGAXAETIKSKSAAM-------------ENSPQRRGVCTRVYTTTPKKPNSALRKVAKVPLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQSRSKYGAKRPKK 124
>gi|85703981|ref|ZP_01035084.1| ribosomal protein S12 [Roseovarius sp. 217] >gi|149203506|ref|ZP_01880476.1| 30S ribosomal protein S12 [Roseovarius sp. TM1035] >gi|85671301|gb|EAQ26159.1| ribosomal protein S12 [Roseovarius sp. 217] >gi|149143339|gb|EDM31378.1| 30S ribosomal protein S12 [Roseovarius sp. TM1035] (123 aa)
Score = 368, Expect = 4.8e-34, Identities = 89/136 (65%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K + +KS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVRTTKSQHL-------------QGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|30249995|ref|NP_842065.1| 30S ribosomal protein S12 [Nitrosomonas europaea ATCC 19718] >gi|52783401|sp|Q82T68|RS12_NITEU 30S ribosomal protein S12 >gi|30139102|emb|CAD85966.1| Ribosomal protein S12 [Nitrosomonas europaea ATCC 19718] (125 aa)
Score = 368, Expect = 4.8e-34, Identities = 92/136 (67%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QL+R  RK K  KSK PAL                P KRGVCTRV T TPKKPNSALRK A+V+LTNGYEV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDT+GV+ R+Q RS YG+KRPK
  S:     1 MPTISQLVRKPRKAKRTKSKVPAL-------------ESCPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQARSKYGSKRPK 123
>gi|21230359|ref|NP_636276.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769647|ref|YP_244409.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris str. 8004] >gi|23822079|sp|Q8PC54|RS12_XANCP 30S ribosomal protein S12 >gi|81304398|sp|Q4URD4|RS12_XANC8 30S ribosomal protein S12 >gi|21111914|gb|AAM40200.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66574979|gb|AAY50389.1| 30S ribosomal protein S12 [Xanthomonas campestris pv. campestris str. 8004] (124 aa)
Score = 368, Expect = 4.8e-34, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+    KS SPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:     1 MATINQLVRKPRQATTYKSASPAL-------------DKCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGAKRPK 123
>gi|121608238|ref|YP_996045.1| 30S ribosomal protein S12 [Verminephrobacter eiseniae EF01-2] >gi|158513936|sp|A1WHC0|RS12_VEREI 30S ribosomal protein S12 >gi|121552878|gb|ABM57027.1| SSU ribosomal protein S12P [Verminephrobacter eiseniae EF01-2] (125 aa)
Score = 368, Expect = 4.9e-34, Identities = 90/138 (65%), Positives = 103/138 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEK 138
           M TI QL+R  R+ +  KSKSPA+               SP +RGVCTRV T TPKKPNSALRK AKV+LTNG EV++YI GEGHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LD  GV+ R+Q RS YGAK+PK K
  S:     1 MPTINQLVRQGREVEKIKSKSPAM-------------ENSPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTNGSEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDLQGVKDRKQARSKYGAKKPKAK 125
>gi|146192858|emb|CAL76863.1| 30S ribosomal subunit protein S12 [Bradyrhizobium sp. ORS278] (130 aa)
Score = 368, Expect = 4.9e-34, Identities = 90/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLI + R+ +  + K PAL               SP KRGVCTRV T TPKKPNSALRK AKV+LTNG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     8 MPTINQLIANPREVQKSRKKVPAL-------------QQSPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHILRGVLDTQGVKNRKQRRSKYGAKRPK 130
>gi|28199865|ref|NP_780179.1| 30S ribosomal protein S12 [Xylella fastidiosa Temecula1] >gi|71275245|ref|ZP_00651532.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella fastidiosa Dixon] >gi|71899987|ref|ZP_00682133.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella fastidiosa Ann-1] >gi|77747617|ref|NP_299908.2| 30S ribosomal protein S12 [Xylella fastidiosa 9a5c] >gi|170731244|ref|YP_001776677.1| 30S ribosomal protein S12 [Xylella fastidiosa M12] >gi|54039347|sp|P66380|RS12_XYLFT 30S ribosomal protein S12 >gi|54042119|sp|P66379|RS12_XYLFA 30S ribosomal protein S12 >gi|28057986|gb|AAO29828.1| 30S ribosomal protein S12 [Xylella fastidiosa Temecula1] >gi|71164054|gb|EAO13769.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella fastidiosa Dixon] >gi|71730274|gb|EAO32359.1| Ribosomal protein S12, bacterial and chloroplast form [Xylella fastidiosa Ann-1] >gi|167966037|gb|ACA13047.1| 30S ribosomal protein S12 [Xylella fastidiosa M12] (124 aa)
Score = 368, Expect = 5.0e-34, Identities = 91/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R+    KS SPAL             +  P +RGVCTRV T TPKKPNSALRK AKV+LTN  EV++YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LD +GV KRRQ RS YGAKRPK
  S:     1 MATINQLVRKPRQASTYKSASPAL-------------DKCPQRRGVCTRVYTSTPKKPNSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDAAGVAKRRQGRSKYGAKRPK 123
>gi|188535284|ref|YP_001909081.1| 30S ribosomal protein S12 [Erwinia tasmaniensis] >gi|188030326|emb|CAO98215.1| 30S ribosomal protein S12 [Erwinia tasmaniensis] (124 aa)
Score = 368, Expect = 5.1e-34, Identities = 86/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MAT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG K+PK
  S:     1 MATVNQLVRKPRVRKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKKPK 123
>gi|51894215|ref|YP_076906.1| 30S ribosomal protein S12 [Symbiobacterium thermophilum IAM 14863] >gi|60390800|sp|Q67JT8|RS12_SYMTH 30S ribosomal protein S12 >gi|51857904|dbj|BAD42062.1| 30S ribosomal protein S12 [Symbiobacterium thermophilum IAM 14863] (127 aa)
Score = 368, Expect = 5.1e-34, Identities = 89/140 (63%), Positives = 99/140 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  RK   +KS SPAL               +P+KRGVCT V T TPKKPNSALRK A+V+L+N  EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG LD +GV  R Q RS YGAKRPK  K+
  S:     1 MPTINQLVRQGRKKLTEKSASPAL-------------KGNPFKRGVCTVVKTTTPKKPNSALRKIARVRLSNNIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDAAGVANRMQGRSKYGAKRPKAGKK 127
>gi|88803755|ref|ZP_01119279.1| 30S ribosomal protein S12 [Polaribacter irgensii 23-P] >gi|88780488|gb|EAR11669.1| 30S ribosomal protein S12 [Polaribacter irgensii 23-P] (124 aa)
Score = 368, Expect = 5.2e-34, Identities = 88/137 (64%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  R    KKSKS AL+               P +RGVCTRV T TPKKPNSA+RK A+V+LTNG E+ AYIPGEGHNLQEHS+VL+ GGRVKDLPGV+YH+VRG LDT+GVE R Q+RS YGAKRPK+
  S:     1 MPTIQQLVRKGRTKITKKSKSAALL-------------SCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGNEINAYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHVVRGALDTAGVEGRTQRRSKYGAKRPKK 124
>gi|113170434|ref|YP_717226.1| Rps12 [Ostreococcus tauri] >gi|122235249|sp|Q0P3M9|RR12_OSTTA Chloroplast 30S ribosomal protein S12 >gi|112806841|emb|CAL36348.1| Rps12 [Ostreococcus tauri] (124 aa)
Score = 368, Expect = 5.3e-34, Identities = 88/136 (64%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R     K+KSPAL                P +RG+CTRV T TPKKPNSALRK A+V+LT G EV AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRG+LDT+GV+ R Q RS YG KRPK
  S:     1 MPTIQQLIRSQRIKCETKTKSPAL-------------KACPQRRGICTRVYTTTPKKPNSALRKVARVRLTTGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDTAGVKDRLQSRSKYGVKRPK 123
>gi|83856560|ref|ZP_00950089.1| putative 30S ribosomal protein S12 [Croceibacter atlanticus HTCC2559] >gi|89891152|ref|ZP_01202660.1| 30S ribosomal protein S12, RpsL [Flavobacteria bacterium BBFL7] >gi|83850360|gb|EAP88228.1| putative 30S ribosomal protein S12 [Croceibacter atlanticus HTCC2559] >gi|89516796|gb|EAS19455.1| 30S ribosomal protein S12, RpsL [Flavobacteria bacterium BBFL7] (124 aa)
Score = 368, Expect = 5.3e-34, Identities = 90/137 (65%), Positives = 102/137 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI+QL+R  R    KKSKS AL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LDT+GV  R Q+RS YGAKRPK+
  S:     1 MPTISQLVRKGRAKITKKSKSAAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDTAGVAGRTQRRSKYGAKRPKK 124
>gi|153799907|gb|ABS50672.1| RpsL [Bdellovibrio bacteriovorus] (124 aa)
Score = 368, Expect = 5.3e-34, Identities = 85/137 (62%), Positives = 100/137 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QLI+ +R  +  ++KSPAL             +  P +RGVCTRV T TP+KPNSALRK AKV+L+NG+EV++YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD  GV  R + RS YG KRPK+
  S:     1 MPTINQLIKSERTVQKNQTKSPAL-------------DSCPQRRGVCTRVYTTTPRKPNSALRKVAKVRLSNGFEVISYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVLDLQGVNGRLRARSKYGTKRPKK 124
>gi|149279672|ref|ZP_01885801.1| 30S ribosomal protein S12 [Pedobacter sp. BAL39] >gi|149229708|gb|EDM35098.1| 30S ribosomal protein S12 [Pedobacter sp. BAL39] (137 aa)
Score = 368, Expect = 5.3e-34, Identities = 90/136 (66%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R     KSKSPAL             +  P +RGVCTRV T TPKKPNSA+RK A+V+LTNG EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHI+RG LDTSGV  R Q+RS YG KRPK
  S:     1 MPTIQQLVRKGRVALEFKSKSPAL-------------DSCPQRRGVCTRVYTTTPKKPNSAMRKVARVRLTNGKEVNAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGALDTSGVAGRNQRRSKYGTKRPK 123
>gi|54778765|gb|AAV39599.1| ribosomal protein S12 [synthetic construct] (151 aa)
Score = 368, Expect = 5.3e-34, Identities = 86/135 (63%), Positives = 95/135 (70%)
  Q:     2 ATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           AT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:    26 ATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 147
>gi|51244971|ref|YP_064855.1| 30S ribosomal protein S12 [Desulfotalea psychrophila LSv54] >gi|60390807|sp|Q6AP76|RS12_DESPS 30S ribosomal protein S12 >gi|50876008|emb|CAG35848.1| probable 30S ribosomal protein S12 [Desulfotalea psychrophila LSv54] (124 aa)
Score = 368, Expect = 5.4e-34, Identities = 87/137 (63%), Positives = 98/137 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           M TI QL+R  RK   KK+ +PAL                P KRGVC RV T TPKKPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVV+I GGRVKDLPGVRYH++RGTLDT GV  RRQ RS YGAK+P +
  S:     1 MPTINQLVRQGRKKSVKKTNTPAL-------------KGCPQKRGVCVRVYTTTPKKPNSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVMIRGGRVKDLPGVRYHVIRGTLDTLGVSDRRQGRSKYGAKKPSK 124
>gi|167856459|ref|ZP_02479178.1| ribosomal protein S12 [Haemophilus parasuis 29755] >gi|167852419|gb|EDS23714.1| ribosomal protein S12 [Haemophilus parasuis 29755] (124 aa)
Score = 368, Expect = 5.5e-34, Identities = 86/136 (63%), Positives = 96/136 (70%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  K  KS  PAL                P KRGVCTRV T TP+KPNSALRK  +++LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV+ R+Q RS YG KRPK
  S:     1 MATINQLVRKPRVKKVVKSNVPAL-------------EACPQKRGVCTRVYTTTPRKPNSALRKVCRIRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVKDRKQGRSKYGVKRPK 123
>gi|110634035|ref|YP_674243.1| 30S ribosomal protein S12 [Mesorhizobium sp. BNC1] >gi|119366784|sp|Q11HP7|RS12_MESSB 30S ribosomal protein S12 >gi|110285019|gb|ABG63078.1| SSU ribosomal protein S12P [Mesorhizobium sp. BNC1] (123 aa)
Score = 368, Expect = 5.5e-34, Identities = 85/136 (62%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLI   RK   K++K PA+               +P KRGVCTRV T +PKKPNSA+RK AK++L NG+EV+ YIPGEGHNLQEHSVV+I GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIAKPRKAPVKRNKVPAM-------------EANPQKRGVCTRVYTTSPKKPNSAMRKVAKIRLANGFEVIGYIPGEGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKSRKQRRSKYGAKRPK 123
>gi|34501389|ref|NP_904164.1| ribosomal protein S12 [Physcomitrella patens subsp. patens] >gi|68053174|sp|Q6YXM6|RR12_PHYPA Chloroplast 30S ribosomal protein S12 >gi|34494759|dbj|BAC85026.1| ribosomal protein S12 [Physcomitrella patens subsp. patens] (123 aa)
Score = 368, Expect = 5.5e-34, Identities = 86/136 (63%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+    ++KSPAL                P +RGVCTRV T+TPKKPNSALRK A+V+LT+G+E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD  GV+ R+Q RS YG K+PK
  S:     1 MPTIQQLIRNRRQPIENRTKSPAL-------------RGCPQRRGVCTRVYTVTPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK 123
>gi|150008988|ref|YP_001303731.1| 30S ribosomal protein S12 [Parabacteroides distasonis ATCC 8503] >gi|166231876|sp|A6LEJ5|RS12_PARD8 30S ribosomal protein S12 >gi|149937412|gb|ABR44109.1| 30S ribosomal protein S12 [Parabacteroides distasonis ATCC 8503] (136 aa)
Score = 368, Expect = 5.6e-34, Identities = 86/134 (64%), Positives = 99/134 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R+   +K KSPAL             +  P +RGVC RV T TPKKPNSA+RK A+V+LTNG EV +YIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLDT+GV  R Q+RS YGAKR
  S:     1 MPTIQQLVRKGRETLVEKGKSPAL-------------DACPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNGKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGAKR 121
>gi|82701895|ref|YP_411461.1| 30S ribosomal protein S12 [Nitrosospira multiformis ATCC 25196] >gi|115305664|sp|Q2YB02|RS12_NITMU 30S ribosomal protein S12 >gi|82409960|gb|ABB74069.1| SSU ribosomal protein S12P [Nitrosospira multiformis ATCC 25196] (125 aa)
Score = 368, Expect = 5.6e-34, Identities = 91/136 (66%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI+QL+R  R  K  KSK PAL               SP KRGVCTRV T TPKKPNSALRK A+V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG+LDT+GV+ R+Q RS YGAK+PK
  S:     1 MPTISQLVRKPRAAKPLKSKVPAL-------------GNSPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTAGVKDRKQGRSKYGAKKPK 123
>gi|149915839|ref|ZP_01904363.1| 30S ribosomal protein S12 [Roseobacter sp. AzwK-3b] >gi|149810162|gb|EDM70008.1| 30S ribosomal protein S12 [Roseobacter sp. AzwK-3b] (123 aa)
Score = 368, Expect = 5.6e-34, Identities = 89/136 (65%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K +  KS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKVRSQKSMHL-------------QGCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|189347708|ref|YP_001944237.1| ribosomal protein S12 [Chlorobium limicola DSM 245] >gi|189341855|gb|ACD91258.1| ribosomal protein S12 [Chlorobium limicola DSM 245] (135 aa)
Score = 368, Expect = 6.0e-34, Identities = 89/134 (66%), Positives = 97/134 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QLIR  R  K  K+ SPAL                P KRGVCTRV T TPKKPNSALRK A+V+L+N  EV AYIPGEGHNLQEHS+VLI GGRVKDLPGVRYHIVRG+LDTSGV  R+Q RS YGAK+
  S:     1 MPTIQQLIRSGRSIKASKTASPAL-------------EKCPQKRGVCTRVYTTTPKKPNSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDTSGVADRKQSRSKYGAKQ 121
>gi|77918310|ref|YP_356125.1| 30S ribosomal protein S12 [Pelobacter carbinolicus DSM 2380] >gi|90111789|sp|Q3A6Q2|RS12_PELCD 30S ribosomal protein S12 >gi|77544393|gb|ABA87955.1| SSU ribosomal protein S12P [Pelobacter carbinolicus DSM 2380] (123 aa)
Score = 367, Expect = 6.4e-34, Identities = 90/136 (66%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K +KS +PAL               +P KRGVCTRV T TPKKPNSALRK A+V+LTNG  V +YIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRG LD +GV+ R+Q RS YGAKRPK
  S:     1 MPTINQLIRKGREKKVRKSTAPAL-------------KCNPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNGIVVTSYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDLAGVKDRKQGRSKYGAKRPK 123
>gi|16330916|ref|NP_441644.1| 30S ribosomal protein S12 [Synechocystis sp. PCC 6803] >gi|2500447|sp|P74230|RS12_SYNY3 30S ribosomal protein S12 >gi|1653410|dbj|BAA18324.1| 30S ribosomal protein S12 [Synechocystis sp. PCC 6803] (126 aa)
Score = 367, Expect = 6.6e-34, Identities = 92/139 (66%), Positives = 102/139 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLIR +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHNLQEHSVVLI GGRVKDLPGVRYHIVRGTLD +GV+ R+Q RS YG KR K KK
  S:     1 MPTIQQLIRSERSKVQKKTKSPAL-------------KQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDATGVKDRKQGRSKYGTKREKAKK 126
>gi|154494376|ref|ZP_02033696.1| hypothetical protein PARMER_03731 [Parabacteroides merdae ATCC 43184] >gi|154085820|gb|EDN84865.1| hypothetical protein PARMER_03731 [Parabacteroides merdae ATCC 43184] (136 aa)
Score = 367, Expect = 7.0e-34, Identities = 86/134 (64%), Positives = 99/134 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKR 134
           M TI QL+R  R+   +K KSPAL             +  P +RGVC RV T TPKKPNSA+RK A+V+LTNG EV +YIPGEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRGTLDT+GV  R Q+RS YGAKR
  S:     1 MPTIQQLVRKGRETLVEKGKSPAL-------------DSCPQRRGVCVRVYTTTPKKPNSAMRKVARVRLTNGKEVNSYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGTLDTAGVNGRTQRRSKYGAKR 121
>gi|90994479|ref|YP_536969.1| ribosomal protein S12 [Porphyra yezoensis] >gi|122238238|sp|Q1XDJ9|RR12_PORYE Chloroplast 30S ribosomal protein S12 >gi|90819043|dbj|BAE92412.1| 30S ribosomal protein S12 [Porphyra yezoensis] >gi|116266154|gb|ABJ91315.1| 30S ribosomal protein S12 [Porphyra yezoensis] (124 aa)
Score = 367, Expect = 7.0e-34, Identities = 86/136 (63%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R +R+   KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHN+QEHSVVLI GGR+KDLPGVRYH+VRGTLD +GV+ RR+ RS YG K+PK
  S:     1 MPTIQQLVRSERRKIHKKTKSPAL-------------QSCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGVGHNIQEHSVVLIRGGRIKDLPGVRYHVVRGTLDAAGVKDRRKSRSKYGTKKPK 123
>gi|28202218|ref|NP_777387.1| ribosomal protein S12 [Anthoceros formosae] >gi|41688682|sp|Q85BW6|RR12_ANTFO Chloroplast 30S ribosomal protein S12 >gi|27807920|dbj|BAC55395.1| ribosomal protein S12 [Anthoceros formosae] >gi|27808039|dbj|BAC55469.1| ribosomal protein S12 [Anthoceros formosae] (123 aa)
Score = 367, Expect = 7.3e-34, Identities = 88/136 (64%), Positives = 100/136 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+    ++KSPAL                P +RGVCTRV T TPKKPNSALRK A+VKLT+G+E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLDT GV+ R+Q RS YG K+PK
  S:     1 MPTIQQLIRSKRQLVKSRTKSPAL-------------QGCPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDTVGVKDRKQGRSKYGVKKPK 123
>gi|196478110|gb|ACG77638.1| 30S ribosomal protein S12 [Phenylobacterium zucineum HLK1] (123 aa)
Score = 367, Expect = 7.6e-34, Identities = 88/136 (64%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M T+ QLIR  R+ K  ++K PAL                P +RGVCTRV T TPKKPNSALRK AKV+LT G E + YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTVNQLIRKPRQTKPARNKVPAL-------------KGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTTGIEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSLYGAKRPK 123
>gi|59710837|ref|YP_203613.1| 30S ribosomal protein S12 [Vibrio fischeri ES114] >gi|163730903|ref|ZP_02138372.1| 30S ribosomal protein S12 [Vibrio fischeri MJ11] >gi|75354727|sp|Q5E8C1|RS12_VIBF1 30S ribosomal protein S12 >gi|59478938|gb|AAW84725.1| 30S ribosomal subunit protein S12 [Vibrio fischeri ES114] >gi|161395758|gb|EDQ20058.1| 30S ribosomal protein S12 [Vibrio fischeri MJ11] (124 aa)
Score = 367, Expect = 7.7e-34, Identities = 86/136 (63%), Positives = 95/136 (69%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  R  +  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD +GV  R++ RS YG KRPK
  S:     1 MATINQLVRKPRAKQVVKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCAGVNDRKKGRSKYGVKRPK 123
>gi|33357889|pdb|1P6G|L Chain L, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome >gi|33357966|pdb|1P87|L Chain L, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Initiation-Like State Of E. Coli 70s Ribosome >gi|83754050|pdb|2AVY|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|83754106|pdb|2AW7|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138064|pdb|2I2P|L Chain L, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|118138135|pdb|2I2U|L Chain L, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|157836034|pdb|2QOU|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836082|pdb|2QOW|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836138|pdb|2QOY|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|157836186|pdb|2QP0|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Spectinomycin And Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Spectinomycin And Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes. >gi|158429709|pdb|2QAL|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429761|pdb|2QAN|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Neomycin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Neomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429819|pdb|2QB9|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429871|pdb|2QBB|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin. This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429923|pdb|2QBD|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158429975|pdb|2QBF|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430029|pdb|2QBH|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158430082|pdb|2QBJ|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Gentamicin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Gentamicin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431382|pdb|2Z4K|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The First 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|158431435|pdb|2Z4M|L Chain L, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With Paromomycin And Ribosome Recycling Factor (Rrf). This File Contains The 30s Subunit Of The Second 70s Ribosome, With Paromomycin Bound. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. >gi|168988799|pdb|2VHO|L Chain L, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 3 Of 4) >gi|168988820|pdb|2VHP|L Chain L, Structure Of Pdf Binding Helix In Complex With The Ribosome (Part 4 Of 4) (123 aa)
Score = 367, Expect = 7.8e-34, Identities = 86/135 (63%), Positives = 95/135 (70%)
  Q:     2 ATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           AT+ QL+R  R  K  KS  PAL                P KRGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSV+LI GGRVKDLPGVRYH VRG LD SGV+ R+Q RS YG KRPK
  S:     1 ATVNQLVRKPRARKVAKSNVPAL-------------EACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK 122
>gi|160902261|ref|YP_001567842.1| 30S ribosomal protein S12 [Petrotoga mobilis SJ95] >gi|189040470|sp|A9BHB0|RS12_PETMO 30S ribosomal protein S12 >gi|160359905|gb|ABX31519.1| ribosomal protein S12 [Petrotoga mobilis SJ95] (124 aa)
Score = 367, Expect = 7.8e-34, Identities = 89/136 (65%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R    KK+KSPAL               +P KRGVC RV TMTPKKPNSALRK A+VKL+NG EV  YIPGEGHNLQEHS VL+ GGRVKDLPGVRY I+RGTLD +GVE R+Q RS YG K+PK
  S:     1 MPTINQLIRYGRTSVKKKTKSPAL-------------RGNPQKRGVCVRVSTMTPKKPNSALRKIARVKLSNGIEVTCYIPGEGHNLQEHSNVLVRGGRVKDLPGVRYKIIRGTLDAAGVEGRKQGRSKYGTKKPK 123
>gi|126737170|ref|ZP_01752905.1| 30S ribosomal protein S12 [Roseobacter sp. SK209-2-6] >gi|126721755|gb|EBA18458.1| 30S ribosomal protein S12 [Roseobacter sp. SK209-2-6] (123 aa)
Score = 366, Expect = 7.9e-34, Identities = 91/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K K SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTIQQLIRKPRQPKRKVSKSQHL-------------EQCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGESHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSKYGAKRPK 123
>gi|163783786|ref|ZP_02178770.1| 30S ribosomal protein S12 [Hydrogenivirga sp. 128-5-R1-1] >gi|159880939|gb|EDP74459.1| 30S ribosomal protein S12 [Hydrogenivirga sp. 128-5-R1-1] (128 aa)
Score = 366, Expect = 8.0e-34, Identities = 91/139 (65%), Positives = 107/139 (76%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKK 139
           M TI QLI++ R+ + KKSKSPAL               +P KRGVC RV T+TPKKPNSALRK A+V+L+NG EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRY ++RGTLD +GV+ RRQ RS YGAKRPKE+K
  S:     1 MPTINQLIKYGREKRKKKSKSPAL-------------EGNPQKRGVCVRVYTVTPKKPNSALRKVARVRLSNGIEVSAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKVIRGTLDAAGVQGRRQSRSKYGAKRPKEEK 126
>gi|114800161|ref|YP_761534.1| 30S ribosomal protein S12 [Hyphomonas neptunium ATCC 15444] >gi|119366777|sp|Q0BYA9|RS12_HYPNA 30S ribosomal protein S12 >gi|114740335|gb|ABI78460.1| ribosomal protein S12 [Hyphomonas neptunium ATCC 15444] (123 aa)
Score = 366, Expect = 8.0e-34, Identities = 88/136 (64%), Positives = 102/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+ K  ++K+PAL                P +RGVCTRV T TPKKPNSALRK AKV++T+G+E L YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG LDT  V+ R+Q+RS YGAK+PK
  S:     1 MPTIQQLIRNPREPKRTRTKTPAL-------------KACPQRRGVCTRVYTTTPKKPNSALRKVAKVRMTSGFESLCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTQPVKNRKQRRSHYGAKKPK 123
>gi|89095343|ref|ZP_01168260.1| ribosomal protein S12 [Oceanospirillum sp. MED92] >gi|89080385|gb|EAR59640.1| ribosomal protein S12 [Oceanospirillum sp. MED92] (124 aa)
Score = 366, Expect = 8.1e-34, Identities = 88/136 (64%), Positives = 97/136 (71%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           MATI QL+R  RK K + S   AL                P +RGVCTRV T TPKKPNSALRK  +V+LTNG+EV +YI GEGHNLQEHSVVLI GGRVKDLPGVRYH VRG LD SGV +R+Q RS YGAKRPK
  S:     1 MATINQLVRKPRKRKVQPSDVRAL-------------QACPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDCSGVNERKQGRSKYGAKRPK 123
>gi|152991729|ref|YP_001357450.1| 30S ribosomal protein S12 [Sulfurovum sp. NBC37-1] >gi|166231891|sp|A6Q6I4|RS12_SULNB 30S ribosomal protein S12 >gi|151423590|dbj|BAF71093.1| 30S ribosomal protein S12 [Sulfurovum sp. NBC37-1] (123 aa)
Score = 366, Expect = 8.2e-34, Identities = 87/136 (63%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR +RK + KKSKSPAL+               P +RGVCTRV T TPKKPNSALRK AKV+LT+G+EV++YI GEGHNLQEHS+VL+ GGR+KDLPGV+YHIVRG LD SGV  R   RS YG K+PK
  S:     1 MPTINQLIRKERKKQVKKSKSPALV-------------KCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRIKDLPGVKYHIVRGALDASGVTGRTVARSKYGTKKPK 123
>gi|187734819|ref|YP_001876931.1| ribosomal protein S12 [Akkermansia muciniphila ATCC BAA-835] >gi|187424871|gb|ACD04150.1| ribosomal protein S12 [Akkermansia muciniphila ATCC BAA-835] (127 aa)
Score = 366, Expect = 8.4e-34, Identities = 89/136 (65%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R    +KSKS AL             +  P +RGVC +V T TPKKPNSALRK AKV+LTNG EV+AYI GEGHNLQEHS+VL+ GGRVKDLPGVRYHIVRG LD  GV+KRRQ RS YGAKRPK
  S:     1 MPTINQLVRKGRITPEEKSKSRAL-------------HSCPQRRGVCLQVMTRTPKKPNSALRKVAKVRLTNGEEVIAYIGGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDCLGVDKRRQGRSKYGAKRPK 123
>gi|77462254|ref|YP_351758.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides 2.4.1] >gi|126461116|ref|YP_001042230.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides ATCC 17029] >gi|126461130|ref|YP_001042244.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides ATCC 17029] >gi|146278573|ref|YP_001168732.1| 30S ribosomal protein S12 [Rhodobacter sphaeroides ATCC 17025] >gi|158513429|sp|A3PGJ2|RS12_RHOS1 30S ribosomal protein S12 >gi|166231880|sp|A4WVL3|RS12_RHOS5 30S ribosomal protein S12 >gi|90111798|sp|Q3J5S7|RS12_RHOS4 30S ribosomal protein S12 >gi|77386672|gb|ABA77857.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides 2.4.1] >gi|126102780|gb|ABN75458.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides ATCC 17029] >gi|126102794|gb|ABN75472.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides ATCC 17029] >gi|145556814|gb|ABP71427.1| SSU ribosomal protein S12P [Rhodobacter sphaeroides ATCC 17025] (123 aa)
Score = 366, Expect = 8.4e-34, Identities = 91/136 (66%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R+ K  +SKS  L                P KRGVCTRV T TPKKPNSA+RK AKV+LTNG+EV++YIPGE HNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ RRQ+RS YGAKRPK
  S:     1 MPTIQQLIRKPREPKRVRSKSQHL-------------ESCPQKRGVCTRVYTTTPKKPNSAMRKVAKVRLTNGFEVISYIPGEKHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRRQRRSKYGAKRPK 123
>gi|51209918|ref|YP_063582.1| ribosomal protein S12 [Gracilaria tenuistipitata var. liui] >gi|68053121|sp|Q6B8X8|RR12_GRATL Chloroplast 30S ribosomal protein S12 >gi|50657672|gb|AAT79657.1| 30S ribosomal protein S12 [Gracilaria tenuistipitata var. liui] (124 aa)
Score = 366, Expect = 8.5e-34, Identities = 88/136 (64%), Positives = 101/136 (74%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R +R    KK+KSPAL                P +RGVCTRV T TPKKPNSALRK A+V+LT+G+EV AYIPG GHN+QEHSVVLI GGRVKDLPGVRYHIVRG LD SGV+ R++ RS YGAK+PK
  S:     1 MPTIQQLVRSERHKSSKKTKSPAL-------------KGCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSGFEVTAYIPGIGHNIQEHSVVLIRGGRVKDLPGVRYHIVRGILDASGVKDRKKSRSKYGAKQPK 123
>gi|115376085|ref|ZP_01463330.1| ribosomal protein S12 [Stigmatella aurantiaca DW4/3-1] >gi|115366900|gb|EAU65890.1| ribosomal protein S12 [Stigmatella aurantiaca DW4/3-1] (123 aa)
Score = 366, Expect = 8.7e-34, Identities = 87/135 (64%), Positives = 98/135 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRP 135
           M TI+QL+R  R+    K KSPAL                P KRGVCTRV T TP+KPNSALRK A+V+LTNG EV +YIPG GHNLQEHSVV+I GGRVKDLPGVRYHI+RGTLD+ GV  R+Q RS YGAKRP
  S:     1 MPTISQLVRKGREKLNIKGKSPAL-------------KECPQKRGVCTRVYTTTPRKPNSALRKVARVRLTNGIEVTSYIPGVGHNLQEHSVVMIRGGRVKDLPGVRYHIIRGTLDSVGVANRKQGRSKYGAKRP 122
>gi|149195226|ref|ZP_01872316.1| 30S ribosomal protein S12 [Caminibacter mediatlanticus TB-2] >gi|149134659|gb|EDM23145.1| 30S ribosomal protein S12 [Caminibacter mediatlanticus TB-2] (127 aa)
Score = 366, Expect = 9.0e-34, Identities = 88/140 (62%), Positives = 103/140 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKEKKE 140
           M TI QL+R  RK   KKSKSPAL+               P +RGVCTRV T TPKKPNSALRK AKV+LT+GYEV++YIPGEGHNLQEHS+VL+ GGRVKDLPGV+YHIVRG LDT+GV+ R   RS YG K+ +  K+
  S:     1 MPTINQLVRKGRKKVIKKSKSPALV-------------SCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSGYEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVKGRVHSRSKYGTKKSEAGKK 127
>gi|21223040|ref|NP_628819.1| 30S ribosomal protein S12 [Streptomyces coelicolor A3(2)] >gi|29831460|ref|NP_826094.1| 30S ribosomal protein S12 [Streptomyces avermitilis MA-4680] >gi|182436639|ref|YP_001824358.1| putative 30S ribosomal protein S12 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|61236792|sp|P0A4A3|RS12_STRCO 30S ribosomal protein S12 >gi|61236798|sp|P0A4A4|RS12_STRAW 30S ribosomal protein S12 >gi|61236802|sp|P0A4A5|RS12_STRLI 30S ribosomal protein S12 >gi|61236805|sp|P0A4A6|RS12_STRFL 30S ribosomal protein S12 >gi|1685024|gb|AAC44743.1| ribosomal protein S12 >gi|1772348|dbj|BAA12096.1| ribosomal protein S12 [Streptomyces lividans] >gi|7288055|emb|CAB81850.1| 30S ribosomal protein S12 [Streptomyces coelicolor A3(2)] >gi|13989955|gb|AAK49775.1| ribosomal protein S12 [Streptomyces avermitilis] >gi|29608575|dbj|BAC72629.1| putative ribosomal protein S12 [Streptomyces avermitilis MA-4680] >gi|126506524|gb|ABO14701.1| streptomycin resistance protein [Cloning vector pLS205] >gi|178465155|dbj|BAG19675.1| putative 30S ribosomal protein S12 [Streptomyces griseus subsp. griseus NBRC 13350] (123 aa)
Score = 366, Expect = 9.1e-34, Identities = 87/136 (63%), Positives = 103/136 (75%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QL+R  R+DK +K+K+PAL               SP +RGVCTRV T TPKKPNSALRK A+V+LT+G EV AYIPGEGHNLQEHS+VL+ GGRVKDLPGVRY I+RG+LDT GV+ R+Q RS YGAK+ K
  S:     1 MPTIQQLVRKGRQDKVEKNKTPAL-------------EGSPQRRGVCTRVFTTTPKKPNSALRKVARVRLTSGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEK 123
>gi|16127432|ref|NP_421996.1| 30S ribosomal protein S12 [Caulobacter crescentus CB15] >gi|20140206|sp|Q9A3K2|RS12_CAUCR 30S ribosomal protein S12 >gi|13424880|gb|AAK25164.1| ribosomal protein S12 [Caulobacter crescentus CB15] (123 aa)
Score = 366, Expect = 9.2e-34, Identities = 89/136 (65%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  R  K  ++K PAL                P +RGVCTRV T TPKKPNSALRK AKV+LT G E + YIPGEGHNLQEHSVVLI GGRVKDLPGVRYHI+RG LDT GV+ R+Q+RS YGAKRPK
  S:     1 MPTINQLIRKPRSPKPVRNKVPAL-------------KGCPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTTGIEAVCYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHILRGVLDTQGVKDRKQRRSLYGAKRPK 123
>gi|156618847|ref|YP_001430088.1| ribosomal protein S12 [Cuscuta reflexa] >gi|156618875|ref|YP_001430157.1| ribosomal protein S12 [Cuscuta reflexa] >gi|156556032|emb|CAM98415.1| ribosomal protein S12 [Cuscuta reflexa] (123 aa)
Score = 366, Expect = 9.6e-34, Identities = 85/136 (62%), Positives = 99/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR+ R+     +KSPAL                P +RG CTRV T+TPKKPNSALRK A+V+LT+G+E+ AYIPG GHNLQEHSVVL+ GGRVKDLPGVRYHIVRGTLD  GV+ R+Q RS YG K+PK
  S:     1 MPTIKQLIRNTRQPIKNVTKSPAL-------------GGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSQYGVKKPK 123
>gi|15618463|ref|NP_224748.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae CWL029] >gi|15836083|ref|NP_300607.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae J138] >gi|16752489|ref|NP_444751.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae AR39] >gi|33241904|ref|NP_876845.1| 30S ribosomal protein S12 [Chlamydophila pneumoniae TW-183] >gi|7388119|sp|Q9Z800|RS12_CHLPN 30S ribosomal protein S12 >gi|4376843|gb|AAD18692.1| S12 Ribosomal Protein [Chlamydophila pneumoniae CWL029] >gi|8163384|gb|AAF73639.1| ribosomal protein S12 [Chlamydophila pneumoniae AR39] >gi|8978923|dbj|BAA98758.1| S12 ribosomal protein [Chlamydophila pneumoniae J138] >gi|33236414|gb|AAP98502.1| ribosomal protein S12 [Chlamydophila pneumoniae TW-183] (123 aa)
Score = 366, Expect = 9.7e-34, Identities = 88/136 (64%), Positives = 98/136 (72%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPK 136
           M TI QLIR  RK    + KSPAL                P KRGVC +V T TPKKPNSALRK A V+L+NG EV+AYI GEGHNLQEHS+VLI+GGRVKDLPGVRYHIVRGTLD + V+ R+Q RS YGAKRPK
  S:     1 MPTINQLIRKRRKSSLARKKSPAL-------------QKCPQKRGVCLQVKTKTPKKPNSALRKVAWVRLSNGQEVIAYIGGEGHNLQEHSIVLIQGGRVKDLPGVRYHIVRGTLDCAAVKNRKQSRSRYGAKRPK 123
>gi|161830075|ref|YP_001596180.1| 30S ribosomal protein S12 [Coxiella burnetii RSA 331] >gi|189040455|sp|A9NAL9|RS12_COXBR 30S ribosomal protein S12 >gi|161761942|gb|ABX77584.1| ribosomal protein S12 [Coxiella burnetii RSA 331] (124 aa)
Score = 366, Expect = 9.8e-34, Identities = 89/137 (64%), Positives = 101/137 (73%)
  Q:     1 MATIAQLIRHDRKDKFKKSKSPALMYTYNSLKKKRTYNPSPYKRGVCTRVGTMTPKKPNSALRKYAKVKLTNGYEVLAYIPGEGHNLQEHSVVLIEGGRVKDLPGVRYHIVRGTLDTSGVEKRRQQRSGYGAKRPKE 137
           MA I QL+R  R+ + KKS  PAL                P +RGVCTRV T+TPKKPNSALRK A+V++TNG EV AYI GEGHNLQEHSVVLI GGRVKDLPGVRYHIVRG+LDT+GV  RR+ RS YG K+PKE
  S:     1 MARINQLVRKPRRARAKKSDVPAL-------------EGCPQRRGVCTRVYTITPKKPNSALRKVARVRITNGAEVTAYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDTAGVSGRRRGRSKYGEKKPKE 124