>gi|26553746|ref|NP_757680.1| hypothetical protein MYPE2920 [Mycoplasma penetrans HF-2] >gi|26453753|dbj|BAC44084.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (683 aa)
Score = 2971, Expect = 0.0e+00, Identities = 683/683 (100%), Positives = 683/683 (100%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEWEINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKNKEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTVTVSPRIKENRRKEEIVLISNQIKKGIPYDEDIEPLKIKDLMYENYNDIESNTECPKYPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSLNEESFPTFAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNKYEDVINE 683
           MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEWEINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKNKEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTVTVSPRIKENRRKEEIVLISNQIKKGIPYDEDIEPLKIKDLMYENYNDIESNTECPKYPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSLNEESFPTFAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNKYEDVINE
  S:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEWEINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKNKEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTVTVSPRIKENRRKEEIVLISNQIKKGIPYDEDIEPLKIKDLMYENYNDIESNTECPKYPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSLNEESFPTFAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNKYEDVINE 683
>gi|185178853|ref|ZP_02554795.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024172|ref|ZP_02996896.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039672|ref|ZP_02529038.2| hypothetical protein Uures_03567 [Ureaplasma urealyticum serovar 8] >gi|195867717|ref|ZP_03079718.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209489|gb|EDU06532.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018807|gb|EDU56847.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195660572|gb|EDX53828.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (690 aa)
Score = 945, Expect = 8.7e-100, Identities = 275/676 (40%), Positives = 399/676 (59%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEW---EINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKN--KEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTV--TVSPRIKENRRKEEIVLISNQIKKG----------IPYDEDIEPLKI------KDLMYENYNDIESNTECPK--------------YPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSL----NEESFPT-FAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNK 676
           M+ S+Y++KY+YI YYTK K +WFF+  EI+ KL+    +++ Y  +  +   + + E    E+       I   E+ K   ++NP  AE         G I+D+AS+  + + Y +I  +++ E +  +K    +E AD T ELL+++  II+FQPVFI   +ITK D  +KEN +  VIETKGT+S K  H LD+++Q  VI    Y +  N    Y++C+++Y  L KN+VS   +P+ N  K+V  T+ P       K EI  +  + K+G            Y EDI+  +I       DL+   Y+ I+   E  K              +  T  +  KS E   K++++F + I++L +HK +L     E+  PT F PS NDK   K+ D++   + LY+ MGY++  YSGK+       +  + K  DI       +   + + NL+   +  +           +LK  KVYFDFE+I+S IR +DNS PF Q VTQ SII    +  I+NL C N+IIDP+ IN +WFK IID I+ G E                SYIVYNKSFE SRLKEMA+FINE+ Y  KV +I KN+YDLADFFI+S G       I   EL GFYSIKKVLP++ K   +IY    CL+Y  L +GNG VCQ +TTKRFF+ ++D EW++  ++ + YCENDVR+MIA+E FIK L+++
  S:     1 MRTSKYITKYDYIGYYTKQKAMWFFTNAEIKAKLDLMLKDVSSYDFEDLDDEEDHDIEIDAYEIYKEQTDFILQLEINKNIDKDNPKIAE---------GIILDQASQEDIKKTYPNITKIINFEADALYKNKSLEELADLTLELLDKNGEIILFQPVFINNQLITKPDCFIKENEEFIVIETKGTSSIKKHHLLDIFYQAQVISKHPYFV--NKCVSYKMCIVDYVKLKKNQVSFTISPFYNYQKSVVLTLPPTAANEFNKFEINELKRKRKRGEAIYLKKDENKKYYEDIDAYEICKGILLDDLIDGTYSSIDDYKEAKKIYDYKTEDLKDDVRFNKTMDEVVKSVE---KLHNDFDDVINELLAHKQTLLNLPIEQRIPTNFIPSYNDKGDYKDNDFWLELRNLYAYMGYDVIKYSGKILTIKKFGLNNVTK--DILGIDILKTYANQTFFNLYKNNRIKIYQAAV--DLFAKLKSKKVYFDFESINSAIRAVDNSFPFTQTVTQNSIIIDDGSCDIKNLKCTNMIIDPREINNEWFKAIIDKIHHGLE---------------YSYIVYNKSFEASRLKEMAEFINEEIYELKVSEIIKNMYDLADFFIVSMGKQ----LIVIPELKGFYSIKKVLPIIEKEFPQIYHDVNCLNYKELSVGNGLVCQTKTTKRFFNTITDLEWEQFVHDARIYCENDVRAMIAVEYFIKKLIDE 681
>gi|171920769|ref|ZP_02695318.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903522|gb|EDT49811.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (690 aa)
Score = 944, Expect = 1.1e-99, Identities = 279/676 (41%), Positives = 399/676 (59%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEW---EINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKN--KEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTV--TVSPRIKENRRKEEIVLISNQIKKG----------IPYDEDIEPLKI------KDLMYENYNDIESNTECPK--------------YPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSL----NEESFPT-FAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKI-NELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNK 676
           M+ S+Y++KY+YI YYTK K +WFF+  EI+ KL+    +++ Y  +  +   + + E    E+       I   E+ K   ++NP  AE         G I+D+AS+  + + Y +I  +++ E +  +K    +E AD T ELL+++  II+FQPVFI   +ITK D  +KEN +  VIETKGT+S K  H LD+++Q  VI    Y +  N    Y++C+++Y  L KN+VS   +P+ N  K+V  T+ P       K EI  +  + K+G            Y EDI+  +I       DL+   Y+ I+   E  K              +  T  +  KS E   K++++F + I++L +HK +L     E+  PT F PS NDK   K+ D++   + LY+ MGY++  YSGK     I  I+K    +  K+ L             FN  K   I      + +  +LK  KVYFDFE+I+S IR +DNS PF Q VTQ SII    +  I+NL C N+IIDP+ IN +WFK IID I+ G E                SYIVYNKSFE SRLKEMA+FINE+ Y  KV +I KN+YDLADFFI+S G       I   EL GFYSIKKVLP++ K   +IY    CL+Y  L +GNG VCQ +TTKRFF+ ++D EW++  ++ + YCENDVR+MIA+E FIK L+++
  S:     1 MRTSKYITKYDYIGYYTKQKAMWFFTNAEIKAKLDLMLKDVSSYDFEDLDDEEDHDIEIDAYEIYKEQTDFILQLEINKNIDKDNPKIAE---------GIILDQASQEDIKKAYPNITKIINFEADALYKNKSLEELADLTLELLDKNGEIILFQPVFINNQLITKPDCFIKENEEFIVIETKGTSSIKKHHLLDIFYQAQVISKHPYFV--NKCVSYKMCIVDYVKLKKNQVSFTISPFYNYQKSVVLTLPPTAANEFNKFEINELKRKRKRGEAIYLKKDENKKYYEDIDAYEICKGILLDDLIDGTYSSIDDYKEAKKIYDYKTEDLKDDVRFNKTMDEVVKSVE---KLHNDFDDVINELLAHKQTLLNLPIEQRIPTNFIPSYNDKGDYKDNDFWLELRNLYAYMGYDVIKYSGK-----ILTIKKFGLNNVTKDILGIDILKTYANQTFFNLYKNNQIKIYQAAVDLFAKLKSKKVYFDFESINSAIRAVDNSFPFTQTVTQNSIIIDDGSCDIKNLKCTNMIIDPREINNEWFKAIIDKIHHGLE---------------YSYIVYNKSFEASRLKEMAEFINEEIYELKVSEIIKNMYDLADFFIVSMGKQ----LIVIPELKGFYSIKKVLPIIEKEFPQIYHDVNCLNYKELSVGNGLVCQTKTTKRFFNTITDLEWEQFVHDARIYCENDVRAMIAVEYFIKKLIDE 681
>gi|188524089|ref|ZP_02557333.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530846|ref|ZP_03005144.1| hypothetical protein Uurese_01000003_0200001705 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568709|ref|ZP_02828739.2| hypothetical protein Uurealyserovar_01085 [Ureaplasma urealyticum serovar 2] >gi|195660075|gb|EDX53455.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (690 aa)
Score = 944, Expect = 1.2e-99, Identities = 273/676 (40%), Positives = 401/676 (59%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEW---EINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKN--KEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTVT---------------VSPRIKENRRKEEIVLISNQIKKGIPYDEDIEPLKI------KDLMYENYNDIESNTECPK--------------YPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSL----NEESFPT-FAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNK 676
           M+ S+Y++KY+YI YYTK K +WFF+  EI+ KL+    +++ Y  +  +   + + E    E+       I   E+ K   ++NP  AE         G I+D+AS+  + + Y +I  +++ E +  +K    +E AD T ELL+++  II+FQPVFI   +ITK D  +KEN +  VIETKGT+S K  H LD+++Q  VI    Y +  N    Y++C+++Y  L KN+VS   +P+ N  K+V                ++   ++ +R E I L  ++ KK   Y EDI+  +I       DL+   Y+ I+   E  K              +  T  +  KS E   K++++F + I++L +HK +L     E+  PT F PS NDK   K+ D++   + LY+ MGY++  YSGK+       +  + K  DI       +   + + NL+   +  +           +LK  KVYFDFE+I+S IR +DNS PF Q VTQ SII    +  I+NL C N+IIDP+ IN +WFK IID I+ G E                SYIVYNKSFE SRLKEMA+FINE+ Y  KV +I KN+YDLADFF++S G       I   EL GFYSIKKVLP++ K   +IY    CL+Y  L +GNG VCQ +TTKRFF+ ++D EW++  ++ + YCENDVR+MIA+E FIK L+++
  S:     1 MRTSKYITKYDYIGYYTKQKAMWFFTNAEIKAKLDLMLKDVSSYDFEDLDDEEDHDIEIDAYEIYKEQTDFILQLEINKNIDKDNPKIAE---------GIILDQASQEDIKKTYPNITKIINFEADALYKNKSLEELADLTLELLDKNGEIILFQPVFINNQLITKPDCFIKENEEFIVIETKGTSSIKKHHLLDIFYQAQVISKHPYFV--NKCVSYKMCIVDYVKLKKNQVSFTISPFYNYQKSVVLALPPTAANEFNKFEINELKRKRKRGEAIYLKKDENKK---YYEDIDAYEICKGILLDDLIDGTYSSIDDYKEAKKIYDYKTEDLKDDVRFNKTMDEVVKSVE---KLHNDFDDVINELLAHKQTLLNLPIEQRIPTNFIPSYNDKGDYKDNDFWLELRNLYAYMGYDVIKYSGKILTIKKFGLNNVTK--DILGIDILKTYANQTFFNLYKNNQIKIYQAAVG--LFAKLKSKKVYFDFESINSAIRAVDNSFPFTQTVTQNSIIIDDGSCDIKNLKCTNMIIDPREINNEWFKTIIDKIHHGLE---------------YSYIVYNKSFEASRLKEMAEFINEEIYELKVSEIIKNMYDLADFFMVSMGKQ----LIVIPELKGFYSIKKVLPIIEKEFPQIYHDVNCLNYKELSVGNGLVCQTKTTKRFFNTITDLEWEQFVHDARIYCENDVRAMIAVEYFIKKLIDE 681
>gi|188518539|ref|ZP_03004005.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188997955|gb|EDU67052.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (690 aa)
Score = 937, Expect = 6.2e-99, Identities = 274/676 (40%), Positives = 399/676 (59%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEW---EINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKN--KEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTV--TVSPRIKENRRKEEIVLISNQIKKG----------IPYDEDIEPLKI------KDLMYENYNDIESNTECPK--------------YPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSL----NEESFPT-FAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNK 676
           M+ S+Y++KY+YI YYTK K +WFF+  EI+ KL+    +++ Y  +  +   + + E    E+       I   E+ K   ++NP  AE         G I+D+AS+  + + Y +I  +++ E +  +K    +E AD T ELL+++  II+FQPVFI   +ITK D  +KEN +  VIETKGT+S K  H LD+++Q  VI    Y +  N    Y++C+++Y  L KN+VS   +P+ N  K+V  T+ P       K EI  +  + K+G            Y EDI+  +I       DL+   Y+ I+   E  K              +  T  +  KS E   K++++F + I++L ++K +L     E+  PT F PS NDK   K+ D++   + LY+ MGY++  YSGK+       +  + K  DI       +   + + NL+   +  +           +LK  KVYFDFE+I+S IR +DNS PF Q VTQ SII    +  I+NL C N+IIDP+ IN +WFK IID I+ G E                SYIVYNKSFE SRLKEMA+FINE+ Y  KV +I KN+YDLADFFI+S G       I   EL GFYSIKKVLP++ K   +IY    CL+Y  L +GNG VCQ +TTKRFF+ ++D EW++  ++ + YCENDVR+MIA+E FIK L+++
  S:     1 MRTSKYITKYDYIGYYTKQKAMWFFTNAEIKAKLDLMLKDVSSYDFEDLDDEEDHDIEIDAYEIYKEQTDFILQLEINKNIDKDNPKIAE---------GIILDQASQEDIKKTYPNITKIINFEADALYKNKSLEELADLTLELLDKNGEIILFQPVFINNQLITKPDCFIKENEEFIVIETKGTSSIKKHHLLDIFYQAQVISKHPYFV--NKCVSYKMCIVDYVKLKKNQVSFTISPFYNYQKSVVLTLPPTAANEFNKFEINELKRKRKRGEAIYLKKDENKKYYEDIDAYEICKGILLDDLIDGTYSSIDDYKEAKKIYDYKTEDLKDDVRFNKTMDEVVKSVE---KLHNDFDDVINELLANKQTLLNLPIEQRIPTNFIPSYNDKGDYKDNDFWLELRNLYAYMGYDVIKYSGKILTIKKFGLNNVTK--DILGIDILKTYANQTFFNLYKNNRIKIYQAAV--DLFAKLKSKKVYFDFESINSAIRAVDNSFPFTQTVTQNSIIIDDGSCDIKNLKCTNMIIDPREINNEWFKAIIDKIHHGLE---------------YSYIVYNKSFEASRLKEMAEFINEEIYELKVSEIIKNMYDLADFFIVSMGKQ----LIVIPELKGFYSIKKVLPIIEKEFPQIYHDVNCLNYKELSVGNGLVCQTKTTKRFFNTITDLEWEQFVHDARIYCENDVRAMIAVEYFIKKLIDE 681
>gi|188592520|ref|ZP_03005851.1| hypothetical protein Uureaserovar_01115 [Ureaplasma urealyticum serovar 10] (690 aa)
Score = 937, Expect = 7.5e-99, Identities = 278/676 (41%), Positives = 398/676 (58%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEW---EINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKN--KEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTV--TVSPRIKENRRKEEIVLISNQIKKG----------IPYDEDIEPLKI------KDLMYENYNDIESNTECPK--------------YPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSL----NEESFPT-FAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKI-NELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNK 676
           M+ S+Y++KY+YI YYTK K +WFF+  EI+ KL+    +++ Y  +  +   + + E    E+       I   E+ K   ++NP  AE         G I+D+AS+  + + Y +I  +++ E +  +K    +E AD T ELL+++  II+FQPVFI   +ITK D  +KEN +  VIETKGT+S K  H LD+++Q  VI    Y +  N    Y++C+++Y  L KN+VS   +P+ N  K+V  T+ P       K EI  +  + K+G            Y EDI+  +I       DL+   Y+ I+   E  K              +  T  +  KS E   K++++F + I++L +HK +L     E+  PT F PS NDK   K+ D++   + LY+ MGY++  YSGK     I  I+K    +  K+ L             FN  K   I      + +  +LK  KVYFDFE+I+S IR +DNS PF Q VTQ SII    +  I+NL C N+IIDP+ IN +WFK IID I+ G E                SYIVYNKSFE SRLKEMA+FINE+ Y  KV +I KN+YDLADFFI+S         I   EL GFYSIKKVLP++ K   +IY    CL+Y  L +GNG VCQ +TTKRFF+ ++D EW++  ++ + YCENDVR+MIA+E FIK L+++
  S:     1 MRTSKYITKYDYIGYYTKQKAMWFFTNAEIKAKLDLMLKDVSSYDFEDLDDEEDHDIEIDAYEIYKEQTDFILQLEINKNIDKDNPKIAE---------GIILDQASQEDIKKTYPNITKIINFEADALYKNKSLEELADLTLELLDKNGEIILFQPVFINNQLITKPDCFIKENEEFIVIETKGTSSIKKHHLLDIFYQAQVISKHPYFV--NKCVSYKMCIVDYVKLKKNQVSFTISPFYNYQKSVVLTLPPTAANEFNKFEINELKRKRKRGEAIYLKKDENKKYYEDIDAYEICKGILLDDLIDGTYSSIDDYKEAKKIYDYKTEDLKDDVRFNKTMDEVVKSVE---KLHNDFDDVINELLAHKQTLLNLPIEQRIPTNFIPSYNDKGDYKDNDFWLELRNLYAYMGYDVIKYSGK-----ILTIKKFGLNNVTKDILGIDILKTYANQTFFNLYKNNQIKIYQAAVDLFAKLKSKKVYFDFESINSAIRAVDNSFPFTQTVTQNSIIIDDGSCDIKNLKCTNMIIDPREINNEWFKAIIDKIHHGLE---------------YSYIVYNKSFEASRLKEMAEFINEEIYELKVSEIIKNMYDLADFFIVSMRKQ----LIVIPELKGFYSIKKVLPIIEKEFPQIYHDVNCLNYKELSVGNGLVCQTKTTKRFFNTITDLEWEQFVHDARIYCENDVRAMIAVEYFIKKLIDE 681
>gi|13357731|ref|NP_078005.1| hypothetical protein UU173 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762390|ref|YP_001752255.1| hypothetical protein UPA3_0180 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508757|ref|ZP_02689939.2| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701904|ref|ZP_02554387.2| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|14195361|sp|Q9PQX0|Y173_UREPA Uncharacterized protein UU173 >gi|11278691|pir||H82923 conserved hypothetical UU173 [imported] - Ureaplasma urealyticum >gi|6899136|gb|AAF30580.1|AE002117_4 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827967|gb|ACA33229.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675691|gb|EDT87596.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700638|gb|EDU18920.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (690 aa)
Score = 921, Expect = 4.6e-97, Identities = 271/676 (40%), Positives = 395/676 (58%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEW---EINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKN--KEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTVTVS--PRIKENRRKEEIVLISNQIKKG----------IPYDEDIEP------LKIKDLMYENYNDIESNTECPKYPATRKKYAKSY--------ELIK---KINSEFVEAISKLQSHKDSL----NEESFPT-FAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNK 676
           M+  +Y++KY+YI YYTK K +WFF+  EI+ K++     ++ Y  +  +     + E    E+       +   E+ K    +NP  AE         G ++DKAS+  + + Y +I+ +++ E +  FK    +E A+ T EL+++++ II FQPVFI   +ITK D  +K+N++  VIETKGT+S K  H LD+++Q  VI    Y +  N    Y++C+++Y  L KN+V+   +PY N  K+V +S  P       K EI  +  + K+G            Y EDI+       + I DL+   Y+ I    E  K    + +  K          ELIK   K++++F E IS+L  HK +L     E+  P  F PS NDK   K+ D++   + LY+  GY++  YSGK+       ++ + K  DI       +   + + NL+   +  +           +LK  KVYFDFE+I+S IR +DNS PF Q VTQ SII    +  I+NL C N+IIDP+ IN +WFK IID I+ G E                SYIVYNKSFE SRLKEMA+FINE+ Y  KV +I KN+YDLADFFI+S G       I   EL GFYSIKKVLP++ K   +IY    CL+Y  L +GNG VCQ +TTKRFF+ ++D EW++  ++ + YCENDVR+MIA+E FIK L+++
  S:     1 MRTGKYITKYDYIGYYTKQKAMWFFTNAEIKAKIDLLLKNVSSYDFEDLDDEEEHDYEIDAYEIYKEQTDFLSQLEINKNIDVDNPKIAE---------GILLDKASQEDIKKTYHYIKKIINFETDPLFKNKSLEELANLTLELIDKNDKIIFFQPVFINDKLITKPDCFIKKNDEFIVIETKGTSSIKKHHILDVFYQAQVISKHPYFI--NKCISYQMCIVDYVKLKKNQVNFTISPYYNYQKSVVLSLPPSAANQFNKFEINELKRKRKRGEAIYLKKDENKKYYEDIDAYDHCKGILIDDLIDGTYSSINDYKEAKKIYDYKTEDLKDDVRFNKTMDELIKGIEKLHNDFDEVISELLVHKQNLLALPIEQRIPNYFIPSYNDKGDYKDNDFWLELRNLYAYSGYDVIKYSGKILTIKKFGLDNVTK--DILGIDILKTYANQTFFNLYKNNQIKIYQAAV--DLFAKLKSKKVYFDFESINSAIRAVDNSFPFTQTVTQNSIIIDDGSCDIKNLKCTNMIIDPREINNEWFKAIIDKIHQGLE---------------YSYIVYNKSFEASRLKEMAEFINEEIYELKVSEIIKNMYDLADFFIVSMGKQ----LIVIPELKGFYSIKKVLPIIEKEFPQIYHDVNCLNYKELSVGNGLVCQTKTTKRFFNTITDLEWEQFVHDARIYCENDVRAMIAVEYFIKKLIDE 681
>gi|13508283|ref|NP_110233.1| hypothetical protein MPN544 [Mycoplasma pneumoniae M129] >gi|2496407|sp|P75234|Y544_MYCPN Uncharacterized protein MG366 homolog >gi|1673969|gb|AAB95946.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (664 aa)
Score = 562, Expect = 2.2e-55, Identities = 217/633 (34%), Positives = 329/633 (51%)
  Q:    42 LSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQ-----FKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKHIQTVVDIEQELKFKKNKEQADKTQELLE----QHESIIIFQPVFIYKNMITKSDAVVKENNKLT-VIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTVTVSPRIKENRRKEEIVLISNQIKKGIPYDEDIEPLKIKDLMYENYNDIE----------------SNTECPKYPATRKKYAKSYELIKKINSE-------FVEAISKLQSHKDSLNEESFPTFAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVA--DQTIEAIEKIKKKDDIKNFLKQ-------PSKNP--------EFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCS-IIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLL 674
           L KK +K  +   +   D +ED    EID  EL  +     F   NP   E           II+KA ++     Y H+  ++D +         E+   T++ +E      ++ IIF+PVF     + + DAVV   N L   +  K TT+ K    L++ +   + E     L +  L +Y  C++ Y+  NK+ VS      I  +K  + S      + KEE VL  +     +P+++   P KI  +  +    +                 +N E       R+  A S   +K+I SE       F   I  ++ H++  + +    ++ + N  S   N       K +++     ++  SGK+A  D+ +EA ++  K   I  FL +        +KNP         F+L  +N KK   + N+F ++   +LKE KVYFDFETISS +RVID SLPF QIVTQCS I+   T S    L C NLI DP  I I+ FK ++D++Y                    S++VYNKSFE +RL EMA FINE  Y  +V+ I +N++DLAD F L +        + FK+L GF SIKKVLP++   +Q+  + ++ + Y +LK+  G V QE T  RF + + + +W +   E+K YCENDVR+MIAIELFIKD +
  S:    32 LLKKHHKQVDTEIDVQEDLIEDP-VFEIDILELLNEAPELLFDSKNPRVKEAQI--------IIEKAKKD--IASYFHLDNILDTDNLGLKATVTEKIQFTEKQIEAAVQNKKAAIIFKPVFTVNQCLIQPDAVVVHANGLCEFVVIKATTNTKRKFILEIIYDFLLFEK----LGKYKLVNYYFCIVNYELKNKHNVSFFLNTEIKTAKNSSTS------KTKEEQVLYGH-----LPFND---PKKIAYIHSKKSGGVNGFLLVKLVDNIIRSGVTNLEQIISFVFRELNAPSIRSLKQIISEVAKVQLDFWNIIDDVKQHQELQDNQITFNYSDAFN--SFWNNYLLRNLIKLVFAYKYSEIFRLSGKLAKWDEVVEAYKE-NKSVKIDGFLYELNQGKMKKTKNPATSQFNKIHFFLRAWNDKKGIAVGNKFKSV-WQKLKEKKVYFDFETISSAVRVIDKSLPFTQIVTQCSLIVDDNTESDKSKLVCQNLIFDPLTIGIEDFKTVVDALY-------------QKQCDQYSFVVYNKSFEKNRLLEMATFINEAPYQQRVQAIIENLFDLADIFGLENDC------LAFKQLDGFSSIKKVLPMI---DQRFLDASRTVSYQSLKVQKGDVAQELTLARFLNCLDEQQWAQTALELKQYCENDVRAMIAIELFIKDFI 660
>gi|12045227|ref|NP_073038.1| hypothetical protein MG_366 [Mycoplasma genitalium G37] >gi|1351558|sp|P47606|Y366_MYCGE Uncharacterized protein MG366 >gi|3844953|gb|AAC71593.1| conserved hypothetical protein [Mycoplasma genitalium G37] >gi|166079032|gb|ABY79650.1| conserved hypothetical protein [synthetic Mycoplasma genitalium JCVI-1.0] (667 aa)
Score = 496, Expect = 1.0e-47, Identities = 186/550 (33%), Positives = 303/550 (55%)
  Q:   127 FKKNKEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAV-VKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSK-TVTVSPRIKENRRK------EEIVLISNQIKKGIPYDEDIEPLKIKDLMYENYNDIESNTECPKYPATRKKYAKSYELIK---KINSEFVEAISKLQSHKD-SLNE------ESFPTFAPSVNDKSPIKNC------DYFPTEKKL--YSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSII--KSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNK 676
           ++K +    K QE++   +S IIF+P+F  ++ + + DA+ V E      +  K TT+ K  ++L++ +   + +     + +  L +Y  C ++Y+  NKN VS      I  SK + ++S + K+  +       E+I  I  +   G+  +  +    I +L+  N  D+   ++        K       LIK   KI   F + I  ++ +++  +N+      E+F +F  +   ++ IK        + F    KL  +S + Y          +Q +  + + K K +  N   + S    F+L  +N++K   I N+F N   N+LK+ KVYFDFETISS IR+I+NSLPF QIVTQCS+I  K+  + K   L C+NLI DP  I+++ FK++IDS+Y              ++    S++V+NKSFE +RL EMA  INE+ Y  KV+ I  N++DLAD F + +        + FK+L GF SIKKVL ++   ++   + +K + Y  LKI  G V QE    RF + ++ +EW ++  E+K YCENDVR+MI+I LFI+DL+ K
  S:   114 YQKAELTEKKIQEIITSKKSAIIFKPIFEIEDCLIQPDAIIVHEKGLCEFVVIKATTNTKRKYFLEIIYDFVLFKK----IGKYKLLNYYFCTVKYELQNKNNVSFFLNTEIKTSKNSFSLSSKEKDYFKNKPFNHPEKIAYIHKKKSNGV--NGFLIVKLIDNLIKNNIVDLNKISDFVTKEIDSKSVRNIQPLIKNAAKIQINFWDQIQDIKKYQELKINQIVFNYSENFDSFWSNYLLRNLIKLVFAHKYNEIFKLSGKLANWSQLTYAYKENKSITINQLLHELNQKKSKANFNNSTNKIS----FFLEAWNSEKGFAIGNKFKN-TWNKLKKKKVYFDFETISSSIRIINNSLPFSQIVTQCSLIVDKNEIDDK-RKLNCENLIFDPLFISVNDFKKVIDSLY-------------QNNCSDYSFVVFNKSFEKNRLLEMATLINEQIYKEKVKAIVDNLFDLADIFTIENNC------LAFKQLNGFSSIKKVLTII---DESFLKASKSIGYQNLKIQKGDVAQEVALSRFLNCLNKNEWNQVAFELKKYCENDVRAMISIVLFIQDLIKK 657
>gi|31544334|ref|NP_852912.1| hypothetical protein MGA_0847 [Mycoplasma gallisepticum R] >gi|31541178|gb|AAP56480.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (719 aa)
Score = 399, Expect = 1.6e-36, Identities = 207/674 (30%), Positives = 332/674 (49%)
  Q:     1 MKKSEYLSKYNYIDYYTKPKGLWFFSINEIEEKLEWEINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEK--YKHIQTVVDIEQELKFKK---NKEQADKTQ--ELLEQHESIIIFQPVFIYKN-MITKSD--AVVKENN---------------------------------------KLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSKTVTVSP-RIKENRRKEEIVLISNQIKKGIPYDE---DIEPLKIKDLMYENYNDIESNTECPKYPATRKKYAKSYELIKKINSEFVEAISKLQSHKDS------LNEESFPTFAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKN-----PEFYLNLFN----TKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMA------------KFINEK----EYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLL 674
           M+K +   K ++++ + +PK LW FS  E+   ++ E+ L  SK    +     EN    + D DE++  + EL          + E++KNIY+ + + I   ++ Y+  +  ++ I      E  LKF     N+ Q   T   +L E  +++ I    +  K  +IT  D   ++K+++                                       K TV   K +T+ K    +  Y+   V+    Y +      ++ + LI+Y    KN V   TT  +  SK     P ++KE     + ++ +    K   Y++   D   LK  +  + +  DI       K    +K Y    E +  + + F     ++   K++      L+   F  FA +V+             E  L S   Y +  +  +        + +  +   I NF+   S N     P  Y N  N    TK       +      N+LK  KVYFDFE+I      +D+ LP MQIVTQ S I    +SK   L C N +IDP  ++++WF +II+ ++ G +                SY+VYNKSFE SRL EMA            +F+++K    ++  KV++I  N++DLADFF LS         +  + L GFYSIKK L L    ++K   +AK +DY TL +  G + Q  T KRF  L+SD EW+++  ++  YCENDVRSMIA+E +I+DLL
  S:     4 MEKKQIFKKTDFLNTFNRPKSLWKFSNTELLAIIQNELGL--SKDDYVDLIDQLENENTSVIDFDEIDFITDEL----------NQEESKNIYLNEVSKIKVKAKEYIKRRVLFQEIDYANLEEDNLKFVDGVFNESQIKYTDVFDLQEDKKALRIIDLAYYQKTPLITAIDLHEIIKKHDYNETKLLILDGIYFNEKSQYFLQANIDCCLFERHKNGKIKATVYSLKNSTTTKRKDIVAFYYDYRVLAELGYEV-----VEWNVVLIKYTLSKKNGVEFTTTNTVCHSKNSAAFPEKLKEPNLFSKSLIENKASFKRSGYEKLALDYPELKPNNTSFGDLLDIFLFN--VKESDNKKTYNFVAEHMSIVKNAFDNVFDEMMQIKETNIGKIVLSNAYFNQFADNVHGTIIKYTLGKKVFEPFLLSGNVYKVAKFFNENDQLDFPLVNQNNEPFSITNFMNYVSNNADTLKPVNYFNTLNKVYGTKPIDYFVFDEAKTAFNKLKPKKVYFDFESICHLFAPMDDLLPNMQIVTQNSYIIDNNDSK--ELECFNDVIDPCKLDVNWFAKIINDLHQGED---------------YSYVVYNKSFEKSRLYEMAYYLERYKQYHPQQFLDQKNLDVDFLKKVKEIENNLFDLADFFNLSKK------LLVIRSLNGFYSIKKTLLLTSSEHRK---KAKAVDYATLNVKRGDMAQNLTAKRFLGLLSDQEWEQIAIDLAIYCENDVRSMIAVEYYIRDLL 716
>gi|66880095|ref|ZP_00405081.1| hypothetical protein MgenG_01000559 [Mycoplasma genitalium G-37] (212 aa)
Score = 334, Expect = 5.9e-29, Identities = 91/206 (44%), Positives = 128/206 (62%)
  Q:   440 VYFDFETISSPIRVIDNSLPFMQIVTQCSII--KSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEW 645
           VYFDFETISS IR+I+NSLPF QIVTQCS+I  K+  + K   L C+NLI DP  I+++ FK++IDS+Y              ++    S++V+NKSFE +RL EMA  INE+ Y  KV+ I  N++DLAD F + +        + FK+L GF SIKKVL ++   ++   + +K + Y  LKI  G V QE    RF + ++ +EW
  S:    28 VYFDFETISSSIRIINNSLPFSQIVTQCSLIVDKNEIDDK-RKLNCENLIFDPLFISVNDFKKVIDSLY-------------QNNCSDYSFVVFNKSFEKNRLLEMATLINEQIYKEKVKAIVDNLFDLADIFTIENNC------LAFKQLNGFSSIKKVLTII---DESFLKASKSIGYQNLKIQKGDVAQEVALSRFLNCLNKNEW 212
>gi|54020495|ref|YP_115933.1| hypothetical protein mhp423 [Mycoplasma hyopneumoniae 232] >gi|53987668|gb|AAV27869.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (630 aa)
Score = 278, Expect = 2.1e-22, Identities = 140/524 (26%), Positives = 235/524 (44%)
  Q:   148 IIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIE-YKFLNKNEVSLETTPYINLSKTVTVSPRIKENRRKEEIVLISNQIKK--GIPYDEDIEPLKI-KDLMYENYNDIESNTECPKYPATRKKYAKSYELIKKINSEFVEAISKLQSHKDSLNEESFPTFAPSVNDKSPI-KNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINN--EFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKI-ENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINE---------------KEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIK 671
           IIF P F YK+ +  S      N K+++++   +T  K     +  F +     + +    N + +    LI+  +   KN+     T +++ +K V    ++    R+      + +I K  G+   E   P  + ++ + +N      +   PK P   +K  K            +  I  L   K++ N ++F    P ++D     KN D+     K Y      L N SG +  +  +A+  I+ ++ +    K       F+ N F    + +IN   E     +N   +  V++DFE  S P   ID   PF QIV+Q SI+ +     + +N +  NL+ DPKN   + F  IID IY                 H+  Y+V+NKS+E +RLKEM + I +               +EY  KV +I K   DL D F          Y++   +L G YSIKK+   + KY   +  +   + Y  L I NG     E+  R+F+ + D++W+     ++ YC+NDV +MI +  F+K
  S:   110 IIFNPCFEYKDAVAHSSVFFVFNKKISILKLSTSTKIKDYLAANWNFWITTYALRGFGNDLNPIEEVSYFLIDTVENPRKNQTEFCETLWVSTNKGVKSVSKVD---REGPYYFFAKKIAKQNGLTLLEFNNPYFLEQNRLVKNLLRNTVSRNSPKQPKKTRKIIK-----------MIPIIDALSEIKEAKNIKTFS--PPQISDNGNFEKNPDFNMLMTKFYP----QLANISGTLL-KAKDALSLIEDEEKLLTLEKN-----SFWFNFFQENNSIIINQIEELKKFLLNLYAKKIVWYDFEAFSLPFPPIDYVQPFQQIVSQVSIVLTNRGQILNQNFSDRNLVFDPKNYTWENFFLIIDKIY---------------HKHADFYVVFNKSYELTRLKEMLEIIFKNYLERLPYHKAKQKLEEYELKVAEIIKKTIDLKDPF--------AKYWLVISDLKGCYSIKKIENFITKYKYNL--KRLIIPYKQLAIKNGLEAMIESIDRYFNFIGDNQWEITRKNLQIYCQNDVIAMIMVWDFLK 605
>gi|71893771|ref|YP_279217.1| hypothetical protein MHJ_0420 [Mycoplasma hyopneumoniae J] (607 aa)
Score = 272, Expect = 8.8e-22, Identities = 88/262 (33%), Positives = 134/262 (51%)
  Q:   410 FYLNLFNTKKAGLINN--EFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKI-ENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINE---------------KEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIK 671
           F+ N F    + +IN   E     +N   +  V++DFE  S P   ID   PF QIV+Q SI+ +     + +N +  NL+ DPKN   + F  IID IY                 H+  Y+V+NKS+E +RLKEM + I +               +EY  KV +I K   DL D F          Y++   +L G YSIKK+   + KY   +  +   + Y  L I NG     E+  R+F+ + D++W+  +  ++ YC+NDV +MI +  F+K
  S:   328 FWFNFFQENNSIIINQIEELKKFLLNLYAKKIVWYDFEAFSLPFPPIDYVQPFQQIVSQVSIVLTNRGQILNQNFSDRNLVFDPKNYTWENFFLIIDKIY---------------HKHADFYVVFNKSYELTRLKEMLEIIFKNYLERLPYHKAKQKLEEYELKVAEIIKKTIDLKDPF--------AKYWLVISDLKGCYSIKKIENFITKYKYNL--KRLIIPYKQLAIKNGLEAMIESIDRYFNFIGDNQWEITKKNLQIYCQNDVIAMIMVWDFLK 582
>gi|144575420|gb|AAZ53776.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (630 aa)
Score = 272, Expect = 8.9e-22, Identities = 88/262 (33%), Positives = 134/262 (51%)
  Q:   410 FYLNLFNTKKAGLINN--EFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKI-ENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINE---------------KEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIK 671
           F+ N F    + +IN   E     +N   +  V++DFE  S P   ID   PF QIV+Q SI+ +     + +N +  NL+ DPKN   + F  IID IY                 H+  Y+V+NKS+E +RLKEM + I +               +EY  KV +I K   DL D F          Y++   +L G YSIKK+   + KY   +  +   + Y  L I NG     E+  R+F+ + D++W+  +  ++ YC+NDV +MI +  F+K
  S:   351 FWFNFFQENNSIIINQIEELKKFLLNLYAKKIVWYDFEAFSLPFPPIDYVQPFQQIVSQVSIVLTNRGQILNQNFSDRNLVFDPKNYTWENFFLIIDKIY---------------HKHADFYVVFNKSYELTRLKEMLEIIFKNYLERLPYHKAKQKLEEYELKVAEIIKKTIDLKDPF--------AKYWLVISDLKGCYSIKKIENFITKYKYNL--KRLIIPYKQLAIKNGLEAMIESIDRYFNFIGDNQWEITKKNLQIYCQNDVIAMIMVWDFLK 605
>gi|72080741|ref|YP_287799.1| hypothetical protein MHP7448_0407 [Mycoplasma hyopneumoniae 7448] (607 aa)
Score = 272, Expect = 9.0e-22, Identities = 88/262 (33%), Positives = 134/262 (51%)
  Q:   410 FYLNLFNTKKAGLINN--EFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKI-ENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINE---------------KEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIK 671
           F+ N F    + +IN   E     +N   +  V++DFE  S P   ID   PF QIV+Q SI+ +     + +N +  NL+ DPKN   + F  IID IY                 H+  Y+V+NKS+E +RLKEM + I +               +EY  KV +I K   DL D F          Y++   +L G YSIKK+   + KY   +  +   + Y  L I NG     E+  R+F+ + D++W+  +  ++ YC+NDV +MI +  F+K
  S:   328 FWFNFFQENNSIIINQIEELKKFLLNLYAKKIVWYDFEAFSLPFPPIDYVQPFQQIVSQVSIVLTNRGQILNQNFSDRNLVFDPKNYTWENFFLIIDKIY---------------HKHADFYVVFNKSYELTRLKEMLEIIFKNYLERLPYHKAKQKLEEYELKVAEIIKKTIDLKDPF--------AKYWLVISDLKGCYSIKKIENFITKYKYNL--KRLIIPYKQLAIKNGLEAMIESIDRYFNFIGDNQWEITKKNLQIYCQNDVIAMIMVWDFLK 582
>gi|144227621|gb|AAZ44506.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (630 aa)
Score = 272, Expect = 9.1e-22, Identities = 88/262 (33%), Positives = 134/262 (51%)
  Q:   410 FYLNLFNTKKAGLINN--EFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKI-ENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINE---------------KEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIK 671
           F+ N F    + +IN   E     +N   +  V++DFE  S P   ID   PF QIV+Q SI+ +     + +N +  NL+ DPKN   + F  IID IY                 H+  Y+V+NKS+E +RLKEM + I +               +EY  KV +I K   DL D F          Y++   +L G YSIKK+   + KY   +  +   + Y  L I NG     E+  R+F+ + D++W+  +  ++ YC+NDV +MI +  F+K
  S:   351 FWFNFFQENNSIIINQIEELKKFLLNLYAKKIVWYDFEAFSLPFPPIDYVQPFQQIVSQVSIVLTNRGQILNQNFSDRNLVFDPKNYTWENFFLIIDKIY---------------HKHADFYVVFNKSYELTRLKEMLEIIFKNYLERLPYHKAKQKLEEYELKVAEIIKKTIDLKDPF--------AKYWLVISDLKGCYSIKKIENFITKYKYNL--KRLIIPYKQLAIKNGLEAMIESIDRYFNFIGDNQWEITKKNLQIYCQNDVIAMIMVWDFLK 605
>gi|47459142|ref|YP_016004.1| hypothetical protein MMOB3070 [Mycoplasma mobile 163K] >gi|47458471|gb|AAT27793.1| expressed protein [Mycoplasma mobile 163K] (582 aa)
Score = 251, Expect = 2.5e-19, Identities = 88/238 (36%), Positives = 132/238 (55%)
  Q:   432 INELKENK---VYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTF------------KVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELF 669
           I  LKE     +++DFE+ S P   IDN LP+ QI  Q SII+ T N KI  ++ +NL+ DP N   + F +II++IY               S  + SY+VYNKS+E +RLKEM + +   +               ++E I     DLA+ FI           IF  EL GFYSIKK+   + K   K+  +   + Y+TL++ +G +  +   KR  +++ + EWKK +  +K YCENDVR+M+ +  F
  S:   337 IKSLKEKNARIIWYDFESYSLPYSAIDNYLPYKQIPFQLSIIE-TLNDKI--ISKNNLVYDPLNYTNENFIEIINTIY---------------SKKADSYVVYNKSYENTRLKEMCENLKTTKNKLFGNVEKLNDLNKRIEYIISKTVDLAELFIPKVDQTP----IFLSELKGFYSIKKIEKYITKNQIKL--KNNIVPYSTLEVKDGLMAMKLGIKRSLNIIGNEEWKKEKENLKKYCENDVRAMLMVYDF 565
>gi|193216660|ref|YP_001999902.1| conserved hypothetical protein [Mycoplasma arthritidis 158L3-1] >gi|193001983|gb|ACF07198.1| conserved hypothetical protein [Mycoplasma arthritidis 158L3-1] (670 aa)
Score = 191, Expect = 2.1e-12, Identities = 71/232 (30%), Positives = 119/232 (51%)
  Q:   433 NELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMA---------KFINEKEY---TFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMI 664
           +E K+N V+FDFE  + P  +++   P+ Q+V+Q SIIK+  N   ++   D+ + DP+  +     +I++ IY                  +  Y+V+NK +E +RL E+          K I E+ Y   + KV+ I   I DL  FF + S       +I   +L   YSIK V   + + N ++  + K + Y+ L++ NG +       R  + + D+EW +   E+K YC NDV +MI
  S:   421 DESKQNFVWFDFEGFTMPEPIMNYHSPWTQLVSQLSIIKTKDNKIYQS---DDFVYDPQKYSYQSLIKIVNDIY---------------DQDADGYVVFNKGYEKTRLLEIKEMLFYYAKDKIITEELYFDISHKVDAIIDKIIDLLCFFAVRSLNSVKETFILISKLMCRYSIKMVERFITENNIEL--EHKIIPYHELEVKNGSIALAIANARANNAIKDNEWAQKVVELKKYCHNDVIAMI 644
>gi|71894430|ref|YP_278538.1| hypothetical protein MS53_0415 [Mycoplasma synoviae 53] >gi|71851218|gb|AAZ43827.1| conserved hypothetical protein [Mycoplasma synoviae 53] (824 aa)
Score = 174, Expect = 2.3e-10, Identities = 81/244 (33%), Positives = 131/244 (53%)
  Q:   435 LKENKV-YFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMA-----------------------KFINEKEYTFKVEQINKNIYDLADFFILSS------------------------GTDKVGYY-------------IFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNKYE 678
           LK+ K+ ++D+E  SS + V+  + P  Q+V Q SII++   ++       NL+ D          +II++IY               S  S  YIVYNK++E +R KE+                        K+ +  E+  K+E IN N  DL DFF  S                           +++ +Y             +F  +L  FYSIK++   + KY  KI  + K  +Y  L+I NG +   E   R +   +++ WK++   +K YCENDVR+M+ +  F+  L  K +
  S:   502 LKDKKIIWYDYEGFSSILPVLTFTNPHQQLVNQVSIIQTINGNETYT---KNLVFDTFEFKYQDLVEIIENIY---------------SDKSDYYIVYNKAYENTRNKEIGNLVTKVLASNSEEFDEFKLWFNQKYSDVSEFLKKIEHINSNTIDLTDFFTHSRIKFNNEFLENHLSVDKNLFKFFKVSENEITFYDSVLKEEFLKIEKVFLTDLKYFYSIKRIEKFITKY--KIELKNKIKEYKNLEIQNGYMAMNEAINRHWKTTNNATWKRISLYLKEYCENDVRAMMMLYDFLMLLFYKID 786
>gi|168281484|ref|ZP_02689151.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182675943|gb|EDT87848.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (61 aa)
Score = 138, Expect = 3.2e-06, Identities = 34/63 (53%), Positives = 39/63 (61%)
  Q:   486 LIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFIN 548
           +IIDP  IN +WFK +ID I+ G E                SYIVYNKSFE SRLKEMA+FIN
  S:     1 MIIDPLEINNEWFKAVIDKIHHGLE---------------YSYIVYNKSFEASRLKEMAEFIN 48
>gi|183508471|ref|ZP_02689150.2| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182675888|gb|EDT87793.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (153 aa)
Score = 135, Expect = 7.2e-06, Identities = 50/147 (34%), Positives = 78/147 (53%)
  Q:   314 IKKINSEFVEAISKLQSHKDSL----NEESFPT-FAPSVNDKSPIKNCDYFPTEKKLYSLMGYNLYNYSGKVADQTIEAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPF 460
           I+K++++F E I++L  HK +L     E+  P  F PS NDK   K+ D++   + LY+  GY++  Y+G   D   + I  I   D +K +  Q       + NL+   +  +           +LK  KVYF FE+I+S IR +DNS PF
  S:    14 IEKLHNDFDEVITELLVHKQNLLALPIEQRIPNYFIPSYNDKGEYKDNDFWLELRNLYAYSGYDVIKYTG--LDNVTKDILGI---DILKTYANQT------FFNLYKNNQIKIYQTAV--DLFAKLKSKKVYFYFESINSAIRAVDNSFPF 152
>gi|189423093|ref|YP_001950270.1| conserved hypothetical protein [Geobacter lovleyi SZ] >gi|189419352|gb|ACD93750.1| conserved hypothetical protein [Geobacter lovleyi SZ] (493 aa)
Score = 128, Expect = 4.2e-05, Identities = 60/249 (24%), Positives = 101/249 (40%)
  Q:   418 KKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSI-IKSTTNSKI-ENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           KK  ++N E     ++ L     Y DFET    +   D   P+ Q+  Q S+ I+     K+  +       IDP+   +D   +++                    P     +VY K FE SRLKE+A+    K+   +++Q+  N+ DL D F           +++  +  G +SIK VLP             K L Y+ L+I NG    +        + S  +   L  ++  YC+ D  +M+ +
  S:   274 KKQTIVNKEGLQEFMDSLWYPLCYLDFETFMEAVPSYDGQRPYQQMPFQFSLHIQKKPGGKVYHHEYLAPPAIDPRKEFLDELLKVL--------------------PDDGCIMVYYKPFEQSRLKELAELYPRKKK--QIQQLIDNMVDLLDPF--------KARHLYSWKQQGSHSIKAVLPAF----------VKDLSYDELEISNGSAAMQAYHSMCASVESPRKLATLRKQLLAYCKQDTLAMVRL 484
Score = 92, Expect = 6.7e-01, Identities = 24/70 (34%), Positives = 37/70 (52%)
  Q:   132 EQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIEN 201
           EQ  +TQ +L+Q  S +I++  F Y  +  K+D + K      + E K ++  K  +Y DL  Q HVI N
  S:    74 EQLQQTQNVLKQ--SKVIYEASFEYNGVFVKADILRKGRGGWELYEVKSSSKLKDTYYDDLAVQYHVITN 141
>gi|148377976|ref|YP_001256852.1| hypothetical protein MAG7140 [Mycoplasma agalactiae PG2] >gi|148292022|emb|CAL59414.1| Conserved hypothetical protein [Mycoplasma agalactiae PG2] (805 aa)
Score = 122, Expect = 2.2e-04, Identities = 39/113 (34%), Positives = 58/113 (51%)
  Q:   440 VYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEY 552
           V++D+E+  S + VID+  P+ QIV Q SII  T N KI   T ++++ DPKNI+I     I+ ++Y                     YIVYNK FE +R  E+A +     +
  S:   450 VWYDYESFMSLLPVIDDFSPYSQIVNQVSII-DTINGKIITNTQEDIVYDPKNISIFNLISILKNLY---------------DRQGDKYIVYNKGFENTRNMEIATWAQNHNF 546
Score = 102, Expect = 4.4e-02, Identities = 35/101 (34%), Positives = 55/101 (54%)
  Q:   583 IFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLK-IGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLNKYEDVINE 683
           +F K+L G  SIKKV  L+   ++KI  +     Y  LK + NG    E   KR+ +L+  + W++  + +K YC NDV +MI    FI+ +++     INE
  S:   674 VFLKDLKGMGSIKKVEHLIT--SKKIQLEHMITPYPDLKKVHNGSEAMEIAIKRYANLIDGNVWEENLSNLKKYCHNDVLAMIMAFNFIEKIVSDIFPEINE 773
>gi|110004541|emb|CAK98878.1| hypothetical transmembrane protein [Spiroplasma citri] (674 aa)
Score = 119, Expect = 4.5e-04, Identities = 47/147 (31%), Positives = 66/147 (44%)
  Q:   528 YIVYNKSFECSRLKEMAKFI--------------NEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKK-LENEMKTYCENDVRSMIAIELFIKDLL 674
           Y+ Y KSFEC  L E+  ++              N + +  K+  I     DL DFF          + I+ KE YG  SIKK  P     NQ          Y TLK+  G +  E   +R  + +  + W+K    EM  YC  D  +M+ I   I  L+
  S:   516 YVAYYKSFECKVLAELISYLTILINQNRNEERITNYQNWQKKLSIIRNKTIDLMDFF--------QDFMIYKKEFYGSASIKKTQPAFD--NQ--------FTYQTLKVQKGDMASEIFRRRVENNIPITIWQKSFRAEMLKYCNRDTLAMVVIYQHIVRLM 659
>gi|126664159|ref|ZP_01735152.1| hypothetical protein FBBAL38_11034 [Flavobacteria bacterium BAL38] >gi|126623873|gb|EAZ94568.1| hypothetical protein FBBAL38_11034 [Flavobacteria bacterium BAL38] (497 aa)
Score = 119, Expect = 5.5e-04, Identities = 60/226 (26%), Positives = 100/226 (44%)
  Q:   441 YFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNIN---IDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMA-KFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDS---EWKKLENEMKTYCENDVRSMIAI 666
           +FDFETI   + V++ + PF Q+  Q S+         +N T    + +PK+ N   ID  K++I+ +             ++      S + YN +FE SRLKE+A  F  ++++   +E I     DL   F           + +  E+ G  SIK VLP +          A   +Y  L+I NG     + +  F  ++++    +       +K YCE D   M+ I
  S:   296 FFDFETIFPALPVLNGTRPFQQVPFQYSL--HILEQCGDNYTHKEFLAEPKDFNEISIDPRKKLIEQM-------------KLDFGEIGSIVAYNATFEISRLKELAIAFPEDRDF---IENIINRFVDLLIPF--------RNAWFYHPEMGGSASIKAVLPAI----------APEFNYKDLEISNGG----DASNIFLSMINNKFIGDEIFTRESLKKYCERDTVGMVII 488
>gi|24216859|ref|NP_714340.1| hypothetical protein LA4160 [Leptospira interrogans serovar Lai str. 56601] >gi|45659138|ref|YP_003224.1| hypothetical protein LIC13319 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24198236|gb|AAN51358.1|AE011570_1 conserved hypothetical protein [Leptospira interrogans serovar Lai str. 56601] >gi|45602384|gb|AAS71861.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (407 aa)
Score = 118, Expect = 6.2e-04, Identities = 60/231 (25%), Positives = 98/231 (42%)
  Q:   441 YFDFETISSPIRVIDNSLPFMQI--VTQCSIIKSTTNSKIENL-TCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIK 671
           + DFE+I+ PI V   + PF  +  +    +I+     + EN    D+ I+DP+   ++  ++ I                    P  T  + +N  FE   L E A    E  Y   ++ I  N  DLA  F         GY  +  +  G  S+K +LP++   N           Y  LKI +GQ+   E  +   + +S++E K++E  +  YC+ D  +MI I   IK
  S:   208 FLDFESINPPIPVYPKTYPFQHVPFLFSLHVIRKDLFQEPENFHYIDDGIVDPRKGILEKLQEWI-------------------LPEGT-IVCFNDKFEKRCLDESAAIFTE--YKDWLKSIQDNFLDLATPFW--------GYEYYHPDQKGSTSLKTILPIITGKN-----------YKNLKIQSGQMANSEFLRAKTESMSENERKEVEKNLIEYCKLDTYAMILILRKIK 400
>gi|91203505|emb|CAJ71158.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (500 aa)
Score = 118, Expect = 7.3e-04, Identities = 83/310 (26%), Positives = 131/310 (42%)
  Q:   357 DYFPTEKKLYSLMGYNLYNYSGKVADQTI-EAIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIKINELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSI-IKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRL-KEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLP-LVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTK-RFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           DY P    L       LY + G+ A   I + +  I K DD        S   +  +    +K+   +N E     +N+L     Y DFETI + I + D+  P+ QI  Q S+ I+++  SK+E              +I +  +  D     P P +    ++       S + YN SFE  +L K    F   +E+  K++     I DL D F       K  YY  +K+  G  SIK VLP L GK             Y+ ++I +G     E  +  + + V++ E K +   ++ YCE D  +M+ I
  S:   224 DYLPRHNPL------TLYYFKGEKAFSLINDGVTDILKFDDSITL----SAKQKIQIQSLRSKRE-YVNKEGIQSFLNKLAYPLYYLDFETIGTAIPLFDHVKPYQQIPFQFSLHIQASPKSKLE--------------HIGYLAEGKDD----PRP-ELLKLLKKHLGMKGSIVTYNASFEKDKLNKACEAFPAYREWNRKIQ---ARIVDLLDPF-------KAFYYYNYKQ-EGSASIKSVLPVLTGK------------GYDGMEIADGGTASNEYLRVTYGEGVTEKERKTVRKYLEEYCELDTMAMVKI 485
>gi|118590081|ref|ZP_01547485.1| hypothetical protein SIAM614_15490 [Stappia aggregata IAM 12614] >gi|118437578|gb|EAV44215.1| hypothetical protein SIAM614_15490 [Stappia aggregata IAM 12614] (474 aa)
Score = 117, Expect = 7.5e-04, Identities = 88/340 (25%), Positives = 148/340 (43%)
  Q:   335 LNEESFPTFAPSVNDKSPIKNCD---YFPTEKKLYSLMGYNLYNYSGKVADQTIE----AIEKIKKKDDIKNFLKQPSKNPEFYLNLFNTKKAGLINNEFCNIK--INELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHST-SYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIG-NGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLL 674
           LNE +    + S  + S   +CD   YF      YS+  Y+L   SGK  +  +      +++I+   D    L+QP         +     AG    +  +I+  I+ L+    + D+ET +S I ++D + P  Q+  Q S+     + ++ +                 F+ ++D     PEP +  +     +  +T S + +NK+FE +R KEMA+   +K   F V  + + + DL D F       K GY        G  SIKKVLP+V    +  YE+ +  D      G N  + +E+  KR           +L   +  YCE D  +M+ I  F + L+
  S:   178 LNEAAIDESSCSCLNLSRSHHCDSFDYFNPGIPKYSI--YSLPRLSGKKLENFVSEGRFGLDQIEL--DEVTLLQQP---------IIQAHNAGAPYVDLADIENFISVLEYPLYFLDYETYASAIPIVDGTGPQEQLPFQFSLHVLHNDGRLNH-----------------FEYLVDQ----PEPPRRLVEALEGAIGATGSVVAWNKAFENTRNKEMAEAFPDKA-DFLVGLVERTV-DLMDVF-------KTGYVDI--RFNGSTSIKKVLPVV--VPELSYEEMEIADGTAAMDGWNKMINEEDPEKR----------AQLRKALLAYCELDTLAMVRIFQFAETLI 471
>gi|117925124|ref|YP_865741.1| hypothetical protein Mmc1_1827 [Magnetococcus sp. MC-1] >gi|117608880|gb|ABK44335.1| conserved hypothetical protein [Magnetococcus sp. MC-1] (488 aa)
Score = 117, Expect = 8.7e-04, Identities = 36/137 (26%), Positives = 64/137 (46%)
  Q:   530 VYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           VYN SFE  R++EMA+  ++     K  Q  K + DL           +  YY     + G +S+K VLP +GK           L Y  L I +G+  Q       FD + +++  +++ +++ YC+ D  +++ +
  S:   362 VYNASFEKGRMQEMAQRFSDLADALKAAQ--KRVVDLHPL-------ARDHYY--HPAMQGSWSLKAVLPTLGK----------GLSYTNLTIADGEQAQARYLSWMFDPLEEAQALQIQLDLECYCQLDTLALVMM 477
>gi|77917895|ref|YP_355710.1| hypothetical protein Pcar_0279 [Pelobacter carbinolicus DSM 2380] >gi|77543978|gb|ABA87540.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380] (491 aa)
Score = 116, Expect = 1.3e-03, Identities = 53/226 (23%), Positives = 91/226 (40%)
  Q:   441 YFDFETISSPIRVIDNSLPFMQIVTQCSI-IKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           + DFET  +PI   D   P+ ++  Q S+ I++   ++ ++      +  P   NID  +++I+ +               + P     + YN++FE S L+E+A    +       E I K + ++ D  +          YI+   + G YSIK+VLP +             L Y  L I NG     +       L       +L   M  YC+ D  +M+ I
  S:   294 HLDFETFDTPIPPFDGVRPYQKVPFQYSLHIQTEAGAEPQHF---EYLAPP---NIDPRRELIEHLL-------------AAIPADACVLTYNQAFEKSVLRELAALFPD-----LAEAIEKRVANVRDLMLPFKKR-----YIYRWPMRGSYSIKEVLPAM----------VPELSYEGLDIANGMAAM-QAYHEMCALEDSVALAELRRAMLAYCQLDTLAMVRI 480
>gi|153852816|ref|ZP_01994253.1| hypothetical protein DORLON_00235 [Dorea longicatena DSM 13814] >gi|149754458|gb|EDM64389.1| hypothetical protein DORLON_00235 [Dorea longicatena DSM 13814] (491 aa)
Score = 115, Expect = 1.6e-03, Identities = 46/144 (31%), Positives = 73/144 (50%)
  Q:   523 PHSTSYIVYNKSFECSRLKEMA-KFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLK-IGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           P +     YNKSFECSR+KE+A  F +  E+   +++   NI DL D F       + G+Y + + + G +SIK VLP        I+     L+Y+ L+ + NG         R  D+ ++ E KK  + +  YCE D  +M+ +
  S:   350 PMNVCVTAYNKSFECSRIKELAGMFPDLSEHLLNIKE---NIKDLLDPF-------QAGHY-YNRAMGGSFSIKSVLP-------AIFPDDPELNYHNLEGVHNGSEAM-TIFPRIKDMPAE-EQKKARHNLLKYCELDTYAMVKV 475
>gi|87198374|ref|YP_495631.1| hypothetical protein Saro_0349 [Novosphingobium aromaticivorans DSM 12444] >gi|87134055|gb|ABD24797.1| conserved hypothetical protein [Novosphingobium aromaticivorans DSM 12444] (493 aa)
Score = 113, Expect = 2.3e-03, Identities = 54/228 (23%), Positives = 93/228 (40%)
  Q:   439 KVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKI---ENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISS-PHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           + + DFET++  I     + PF QI  Q S+       ++   E L+CD                       G +P +      +S+ P   + I YN +FE S L+E+A      + + ++E + +   DL     L    +    + + ++  G +SIK VLP +          A  LDY  L++ +G   Q    +           + LE  +K YC  D  +M+A+
  S:   299 RAWLDFETVAPAIPRWVGTRPFQQIPFQFSLHLERRGGRMTHHEFLSCD-----------------------GSDPRRACAEALVSNIPEGATIIAYNAAFERSVLRELAASF--PDLSSRLEAMAEATVDL-----LPVARN----HWYHRDQRGSWSIKAVLPTI----------AAELDYGVLEVKDGGDAQAAWFEAADPACDPLRREALEEALKAYCARDTWAMVAV 486
>gi|117926330|ref|YP_866947.1| hypothetical protein Mmc1_3050 [Magnetococcus sp. MC-1] >gi|117610086|gb|ABK45541.1| conserved hypothetical protein [Magnetococcus sp. MC-1] (500 aa)
Score = 113, Expect = 2.4e-03, Identities = 60/234 (25%), Positives = 105/234 (44%)
  Q:   441 YFDFETISSPIRVIDNSLPFMQIVTQCSI-IKSTTNSKIEN---LTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLE----NEMKTYCENDVRSMIAIELFIKDLL 674
           +FDFET  SP+ + D   P+ QI  Q S+ I+      +E+   L   N  +DP+    D  K +++ I                 P  +  + +N +FE +R+KEM++  +  E+   +  I+  + DL   F           Y +  + YG  SIK VLP               + Y  L+I NG +  +     +  + S+++  KLE    N +K YC+ D  +M+ I   + +++
  S:   295 HFDFETFMSPVPLHDGMRPYQQIPFQYSLHIQRQEGGAVEHYEFLAEPN--VDPRP---DLIKAMLEQI-----------------PKDSCVLTFNMAFEKTRIKEMSQ--DFPEHAEDLNHIHDRVMDLIVPF--------RKRYAYRWQQYGSNSIKNVLPAF----------VPDMSYKDLEISNGGMAMDA----YHLMCSETDPIKLELLRCNLLK-YCKRDTEAMVKIHQVLVEMV 489
>gi|171853976|emb|CAM11939.1| Conserved hypothetical protein [Candidatus Phytoplasma australiense] (599 aa)
Score = 113, Expect = 2.6e-03, Identities = 48/140 (34%), Positives = 69/140 (49%)
  Q:   527 SYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADF------FILSSGTDK---VGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           S IVY+K+FE SRLKE+A F    EY  ++  +   I+DL D       F  S G DK    G   + +++ G +SIKK+ PL              L Y+ L I NG   +   T   F  +  SE++     ++ YC  D   M+ I
  S:   444 SIIVYHKTFEISRLKELALFF--PEYKTQINNLISRIFDLKDLLKGSKEFYQSLGLDKNQAQGINFYHEKMQGSFSIKKIAPLFSN-----------LTYDNLMIQNG--VEAFITYLQFPFMKPSEFQLKYQALEKYCMQDTWVMVEI 577
>gi|57233784|ref|YP_182208.1| hypothetical protein DET1510 [Dehalococcoides ethenogenes 195] >gi|57224232|gb|AAW39289.1| conserved hypothetical protein [Dehalococcoides ethenogenes 195] (492 aa)
Score = 110, Expect = 5.5e-03, Identities = 57/244 (23%), Positives = 108/244 (44%)
  Q:   432 INELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSI-IKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLN 675
           +N+L+    Y DFET ++ + + D + P+  I  Q S+ I+ + +S +++ +   L  D  +    +  ++   I         GL          S +VY +SFE +RLKE++      EY+  +  I + I DL   F          YY    +  G  S+K V+P + +           + Y+ L+I  GQ    +  +  F  ++  E +K+  +++ YC  D   M+ I   +++ L+
  S:   288 LNKLEYPLHYLDFETFATAVPIYDGTRPYQNIPFQFSLHIQDSIDSGVKHYS--YLAEDKGDPRPGFLAELKKDI---------GLK--------GSILVYYESFEKTRLKELSAAF--PEYSEWINSILERIKDLIVPF------KDFSYY--HPKQKGSTSLKYVMPALAQ-----------ISYDNLEIAEGQTASLKFMESVFGNLTREEIQKIRTDLEVYCGQDTGGMVEIVKKLREFLS 492
>gi|50365228|ref|YP_053653.1| hypothetical protein Mfl410 [Mesoplasma florum L1] >gi|50363784|gb|AAT75769.1| unknown protein [Mesoplasma florum L1] (709 aa)
Score = 107, Expect = 1.3e-02, Identities = 43/150 (28%), Positives = 66/150 (44%)
  Q:   528 YIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSG-TDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWK-KLENEMKTYCENDVRSMIAIELFIKDLLNKY 677
           Y+ YNKSFE   L+++A      +Y   +  I +N  DL DFF   +  T +  + I+     G YSIKK  P +               YN L I  G    E   K     +  + W  K++  M  YC+ D  +M+ I   +K+L+  +
  S:   566 YVAYNKSFEQGVLRKLAMMF--PKYAKPLAYIIQNTVDLMDFFTSDTKVTGRPAFLIYHPYFKGSYSIKKTQPSLD----------PSFSYNDLVINKGDKASETFRKFVDGRIPKAAWDLKVKEGMLKYCDRDTLAMVVILKKVKELVEAH 705
Score = 96, Expect = 2.2e-01, Identities = 29/83 (34%), Positives = 51/83 (61%)
  Q:   124 ELKFKKNKEQADKTQELLEQHESIIIFQPVFIY--KNMITKSDAV-VKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLL 206
           ELKF    E   KT+ELLE+++   I++  F +  + + T+ D + +K+N  + +IE K TT  K  H+ DL +Q+ V+E   +++
  S:   146 ELKFF---EAEKKTKELLEENKCEYIYEAAFSFDDEKIRTRCDVLKIKDNKHVEIIEAKATTKVKAEHFFDLMYQVFVLEKCGFIV 228
>gi|73749227|ref|YP_308466.1| hypothetical protein cbdb_A1527 [Dehalococcoides sp. CBDB1] >gi|73660943|emb|CAI83550.1| conserved hypothetical protein [Dehalococcoides sp. CBDB1] (492 aa)
Score = 104, Expect = 2.4e-02, Identities = 59/244 (24%), Positives = 110/244 (45%)
  Q:   432 INELKENKVYFDFETISSPIRVIDNSLPFMQIVTQCSI-IKSTTNSKIENLT--CDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLN 675
           +N+L+    Y DFET ++ + + D + P+  I  Q S+ I+ + +S +++ +   +N   DP+   +   K+ I            GL          S +VY +SFE +RLKE++      EY+  +  I + I DL   F          YY    +  G  S+K V+P + +           + Y+ L+I  GQ    +  +  F  ++  E +K+  +++ YC  D   M+ I   +++ L+
  S:   288 LNKLEYPLHYLDFETFATAVPIYDGTRPYQNIPFQFSLHIQDSIDSGVKHYSYLAENKG-DPRPGFLAELKKDI------------GLK--------GSILVYYESFEKTRLKELSAAF--PEYSEWINSILERIKDLIVPF------KDFSYY--HPKQKGSTSLKYVMPALAQ-----------ISYDNLEIAEGQTASLKFMESVFGNLTREEIQKIRIDLEVYCGQDTGGMVEIVKKLREFLS 492
>gi|42560984|ref|NP_975435.1| hypothetical protein MSC_0449 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492481|emb|CAE77077.1| Conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (714 aa)
Score = 103, Expect = 3.9e-02, Identities = 57/190 (30%), Positives = 96/190 (50%)
  Q:    26 SINEIEEKLEWEINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKH------IQTVVDIEQELKFKKNKEQADK-----------------TQELLEQHES--IIIFQPVFIYKNMITKSDAVVKE---NNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYL--------LKQNLLFDYE 215
           +IN  ++ +EW      +K K   FNI+ +   ++   SD   I+ +E Y     N     EQ KN +  +      +   +  +++K       ++    + Q    K+ KE  DK                 T+ELL+ H+   I +++P F Y N   K    V +   NN + +IE K T+  K  H+ DL +Q +V+E   Y+        L +N L DY+
  S:    30 NINNFKKAVEW------NKNKEFFFNIDHDLESEDDFSSDATSINLFEEYT----NTELKTEQEKNEFKQKWENFFNSDDGFNLDEFKGDAIEDGLEFGQQVIQYFDLKQIKEYPDKLTKDFNDTANIIDAVNQTRELLKNHQDQYIYLYEPAFEYDNFNLKVKCDVLKLNGNNHVEIIEAKATSKVKKEHFWDLVYQAYVLERNGYIVDNIAIARLNKNYLRDYD 245
>gi|83319463|ref|YP_424493.1| hypothetical protein MCAP_0521 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283349|gb|ABC01281.1| conserved hypothetical protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (714 aa)
Score = 102, Expect = 4.9e-02, Identities = 57/190 (30%), Positives = 99/190 (52%)
  Q:    26 SINEIEEKLEWEINLYLSKKKNKNFNINDENSYDELEDSDELEIDSYELYKQFKENNPTSAEQNKNIYMVQGNIIDKASRNYLCEKYKH------IQTVVDIEQELKFKKNKEQADK-----------------TQELLEQH--ESIIIFQPVFIYKN--MITKSDAV-VKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYL--------LKQNLLFDYE 215
           +IN  ++ +EW      +K K   FNI+ +   ++   SD   I+ +E Y     N     EQ KN +  +      +   +  +++K       ++    + Q    K+ KE  DK                 T+ELL+ H  E I +++P F + N  +  K D + +  NN + +IE K T+  K  H+ DL +Q++V+E   Y+        L +N L DY+
  S:    30 NINNFKKAVEW------NKNKEYFFNIDHDLESEDDFSSDATSINLFEEYT----NTELKTEQEKNEFKQKWESFFNSDDGFNLDEFKGDAIEDGLEFGQQVIQYFDLKQIKEYPDKLTKDFNDTANIYDAVNQTKELLKNHQDEYIYLYEPAFEFDNYNLKVKCDVLKLNGNNHVEIIEAKATSKVKKEHFWDLAYQVYVLEKNGYIVDNIAIARLNKNYLRDYD 245
>gi|94496840|ref|ZP_01303415.1| hypothetical protein SKA58_16913 [Sphingomonas sp. SKA58] >gi|94423853|gb|EAT08879.1| hypothetical protein SKA58_16913 [Sphingomonas sp. SKA58] (463 aa)
Score = 97, Expect = 1.7e-01, Identities = 51/228 (22%), Positives = 94/228 (41%)
  Q:   439 KVYFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIEN---LTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           + + DFETI+  I     + P+ Q+  Q S      +  +++   L+ D    DP+    +    +I                    P S + + YN  FE +RL+E+++F  +       + +N  I  + D   ++    +  +Y   ++  G +SIK VLP V          A  LDY+ L++ +G   Q    +      +D     L+  ++ YC  D  +MI +
  S:   269 RTWLDFETIAFAIPRWVGTRPYQQVPFQFSAHVEAEDGSLQHHEFLSLDG--ADPRRACAEALVTMI--------------------PSSGAVVAYNAGFEKARLRELSEFFPDL-----ADDLNSIIDRVVDLLPVT----RANWY--HRDQRGSWSIKAVLPTV----------APDLDYSELEVKDGGNAQAAYLEAISPTTTDDRRAALDAALRAYCGRDTEAMIVL 456
>gi|66880094|ref|ZP_00405080.1| COG0419: ATPase involved in DNA repair [Mycoplasma genitalium G-37] (231 aa)
Score = 97, Expect = 1.9e-01, Identities = 31/115 (26%), Positives = 59/115 (51%)
  Q:   127 FKKNKEQADKTQELLEQHESIIIFQPVFIYKNMITKSDA-VVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVIENQDYLLKQNLLFDYELCLIEYKFLNKNEVSLETTPYINLSK 241
           ++K +    K QE++   +S IIF+P+F  ++ + + DA +V E      +  K TT+ K  ++L++ +   + +     + +  L +Y  C ++Y+  NKN VS      I  SK
  S:    31 YQKAELTEKKIQEIITSKKSAIIFKPIFEIEDCLIQPDAIIVHEKGLCEFVVIKATTNTKRKYFLEIIYDFVLFKK----IGKYKLLNYYFCTVKYELQNKNNVSFFLNTEIKTSK 142
>gi|121997225|ref|YP_001002012.1| hypothetical protein Hhal_0421 [Halorhodospira halophila SL1] >gi|121588630|gb|ABM61210.1| conserved hypothetical protein [Halorhodospira halophila SL1] (493 aa)
Score = 93, Expect = 4.7e-01, Identities = 20/76 (26%), Positives = 40/76 (52%)
  Q:   124 ELKFKKNKEQADKTQELLEQHESIIIFQPVFIYKNMITKSDAVVKENNKLTVIETKGTTSAKFVHYLDLYFQMHVI 199
           E  ++  ++  ++TQ L+       IF+    +  ++T+ DA+V+  +   ++E KG T AK V  LD+  Q  ++
  S:    61 EADYRHTRQALEQTQVLMADPGVPAIFEAALEHDQVLTRVDALVRNGDGWDLVEVKGATRAKEVFQLDVAIQYWIL 136
>gi|116327007|ref|YP_796727.1| hypothetical protein LBL_0177 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116119751|gb|ABJ77794.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] (522 aa)
Score = 92, Expect = 6.4e-01, Identities = 57/235 (24%), Positives = 103/235 (43%)
  Q:   441 YFDFETISSPIRVIDNSLPFMQI--VTQCSIIKSTTNSKIENLT-CDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLN 675
           + DFE+I+ PI V  NS PF  +  +    +I+     + E+    D+ I DP+       K+I++ +    E I  G ++          + YN  FE   L+E A   +E  +   ++ I +   DL+  F          Y  +  +  G  S+K VLP++              DY  L I +GQ+   E  +   + +++ E  ++E  +  YC+ D  +M+ I   IK+ ++
  S:   324 FLDFESINPPIPVYPNSRPFQHVPFLFSLHVIREDLFEEPESFYYIDDGIEDPR-------KKILEKL---QEWILPGGTI----------LCYNDKFERRCLEESAAVFSE--FKPWLQSIKEYFVDLSKPFW--------EYDYYHPDQKGSTSLKTVLPVITGR-----------DYKNLGIQSGQMANSEFLRIKTEFMTEFEKSEIEKNLIEYCKLDTYAMVLILRKIKEWID 520
>gi|116332327|ref|YP_802045.1| hypothetical protein LBJ_2886 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116126016|gb|ABJ77287.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (522 aa)
Score = 92, Expect = 6.5e-01, Identities = 57/235 (24%), Positives = 103/235 (43%)
  Q:   441 YFDFETISSPIRVIDNSLPFMQI--VTQCSIIKSTTNSKIENLT-CDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHSTSYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAIELFIKDLLN 675
           + DFE+I+ PI V  NS PF  +  +    +I+     + E+    D+ I DP+       K+I++ +    E I  G ++          + YN  FE   L+E A   +E  +   ++ I +   DL+  F          Y  +  +  G  S+K VLP++              DY  L I +GQ+   E  +   + +++ E  ++E  +  YC+ D  +M+ I   IK+ ++
  S:   324 FLDFESINPPIPVYPNSRPFQHVPFLFSLHVIREDLFEEPESFYYIDDGIEDPR-------KKILEKL---QEWILPGGTI----------LCYNDKFERRCLEESAAVFSE--FKPWLQSIKEYFVDLSKPFW--------EYDYYHPDQKGSTSLKTVLPVITGR-----------DYKNLGIQSGQMANSEFLRIKTEFMTEFEKSEIEKNLIEYCKLDTYAMVLILRKIKEWID 520
>gi|16331687|ref|NP_442415.1| hypothetical protein slr0569 [Synechocystis sp. PCC 6803] >gi|1001244|dbj|BAA10485.1| slr0569 [Synechocystis sp. PCC 6803] (497 aa)
Score = 91, Expect = 9.4e-01, Identities = 55/226 (24%), Positives = 85/226 (37%)
  Q:   441 YFDFETISSPIRVIDNSLPFMQIVTQCSIIKSTTNSKIENLTCDNLIIDPKNINIDWFKQIIDSIYFGPEPIKDGLSVRISSPHST----SYIVYNKSFECSRLKEMAKFINEKEYTFKVEQINKNIYDLADFFILSSGTDKVGYYIFFKELYGFYSIKKVLPLVGKYNQKIYEQAKCLDYNTLKIGNGQVCQEETTKRFFDLVSDSEWKKLENEMKTYCENDVRSMIAI 666
           +FD ET SS I       P+ + + Q S  +   +  +E+                         Y   E     L + IS  H      S +VYN+SFE   L+++A       Y  K+ QI   ++DL   F       K  Y  F     G YS+KKVLP++            C D   +K GN      E      +  +  +  ++  +++ YC  D   M+ I
  S:   303 FFDVETHSSAIPRFAGLHPYERCIFQYSCHRLNPDGSLEHFE-----------------------YLHTEDSDPRLPLLISLIHHIGDRGSVVVYNQSFEKGVLQQLAA--AYPNYGAKINQIIDRLWDLQVIF-------KRAY--FHPGFRGSYSLKKVLPVMAP--------QFCHDDLVIKSGNEAPLVWEA---LLECSAPDKRAEMAQQLREYCGLDTLGMVKI 487