>gi|26553455|ref|NP_757389.1| DNA gyrase subunit B [Mycoplasma penetrans HF-2] >gi|26453461|dbj|BAC43793.1| DNA gyrase subunit B [Mycoplasma penetrans HF-2] (649 aa)
Score = 3180, Expect = 0.0e+00, Identities = 649/649 (100%), Positives = 649/649 (100%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI
  S:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
>gi|171920695|ref|ZP_02931917.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178763|ref|ZP_02554678.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024457|ref|ZP_02570760.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039331|ref|ZP_02528143.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 8] >gi|188518714|ref|ZP_02557214.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524147|ref|ZP_02557455.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530707|ref|ZP_02546279.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568760|ref|ZP_02828860.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 2] >gi|188592573|ref|ZP_02694194.2| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 10] >gi|195867481|ref|ZP_03079485.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903433|gb|EDT49722.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209375|gb|EDU06418.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018752|gb|EDU56792.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997713|gb|EDU66810.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660124|gb|EDX53504.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660957|gb|EDX54210.1| DNA gyrase, B subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (650 aa)
Score = 2262, Expect = 0.0e+00, Identities = 448/648 (69%), Positives = 533/648 (82%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDK-YNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           MN   K+N Y+A +IK+LEGLEAVRKRPGMYIGST  +GLHHM+WEIVDNSIDEAM G A+ + + + K+G  +V+DDGRGIPV  H KT  S VETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALS   KVWV K Y +HY+EF +GG  +  LK+ N+K   + GT +EF PDFEIME  E+D   I +RLKQLAYLNKG+ I F  E T+ KE + + GG+K+++ +LN EKEP+   IVY E E+ VK   + D+ YNI+ EVAFQYN +YNNST +FCNNINTTEGG+HEEGFK A+ +++NK+A++KK LK+TD+KI+KED  EGLTAI+SIKHPNPQYEGQTK+KLGNSEVRP+V+ + S IFEK+L ENPE++  I+ K + A EAR++S EAREATRRKSPFESNSLPGKLADCS +D  ++E+YIVEGDSAGGSAK GR+R FQAILPL+GKIINVEKAK DKIF+NEEI N+ITA GAG+GPEF I+KLRY+KII+MTDADVDGSHIRILLLTF +RYM PL++NGNVYIA PPL+K S GK+ KYAY ++ LE+ K      KY IQRYKGLGEMNPDQLWETTMDPKNRLLLKV IEDA  ADK FSLLMGD+V PR+EFIEKNAKYVKN+D
  S:     1 MNDSNKENKYTAESIKVLEGLEAVRKRPGMYIGSTQSEGLHHMIWEIVDNSIDEAMGGFATVVKVIIKKDGVIRVEDDGRGIPVGIHEKTGLSGVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSKNFKVWVNKNYVQHYVEFINGGHAIEPLKIINDKDIKEKGTTIEFIPDFEIMEENEWDELKIMARLKQLAYLNKGVNIEFESEMTNRKEKWHYEGGLKEYIADLNAEKEPLFDAIVYGEEEKEVKVPGHNDQTYNIKCEVAFQYNNSYNNSTHSFCNNINTTEGGTHEEGFKLAITRLLNKYAIDKKYLKDTDDKITKEDVSEGLTAIISIKHPNPQYEGQTKKKLGNSEVRPYVNEITSIIFEKFLNENPEESKKIVAKVMQAAEARRRSHEAREATRRKSPFESNSLPGKLADCSNRDSSVTEIYIVEGDSAGGSAKTGREREFQAILPLRGKIINVEKAKIDKIFANEEIQNMITAFGAGIGPEFNIEKLRYSKIIIMTDADVDGSHIRILLLTFFYRYMLPLIQNGNVYIAQPPLYKVSYGKTIKYAYSDQELEKIKSTLLNTKYNIQRYKGLGEMNPDQLWETTMDPKNRLLLKVNIEDAAIADKTFSLLMGDDVTPRKEFIEKNAKYVKNID 649
>gi|13357637|ref|NP_077911.1| DNA gyrase subunit B [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762124|ref|YP_001752160.1| DNA gyrase, B subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920490|ref|ZP_02931785.1| DNA gyrase, B subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508595|ref|ZP_02689822.2| DNA gyrase, B subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701878|ref|ZP_02553290.2| DNA gyrase, B subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11270885|pir||E82937 DNA topoisomerase, DNA gyrase subunit B UU081 [imported] - Ureaplasma urealyticum >gi|6899032|gb|AAF30486.1|AE002107_10 DNA topoisomerase - DNA gyrase subunit B [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827701|gb|ACA32963.1| DNA gyrase, B subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902958|gb|EDT49247.1| DNA gyrase, B subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676050|gb|EDT87955.1| DNA gyrase, B subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701184|gb|EDU19466.1| DNA gyrase, B subunit [Ureaplasma parvum serovar 6 str. ATCC 27818] (650 aa)
Score = 2256, Expect = 0.0e+00, Identities = 447/648 (68%), Positives = 533/648 (82%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKA-ANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           MN   K+  Y+A +IK+LEGLEAVRKRPGMYIGST  +GLHHM+WEIVDNSIDEAM G A+ + + L K+GS +V+DDGRGIP+E H KT  S VETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALS   KVWV K + ++Y+EF +GG  +  LK  N K   + GT +EF PDFEIME  E+D   I +RLKQLAYLNKG+ I F  E T+ KE + + GG+K+++ +LN EKEP+   IVY E E+ V+   +N+  YNI+ EVAFQYN +YNNST +FCNNINTTEGG+HEEGFK A+ +++NK+AV+KK LK+TD+KI+KED  EGLTAI+S+KHPNPQYEGQTK+KLGNSEVRP+V+ + S IFEK+L ENPE++  I+ K + A EAR++S EAREATRRKSPFESNSLPGKLADCS +D  ++E+YIVEGDSAGGSAK GR+R FQAILPL+GKIINVEKAK DKIF+NEEI N+ITA GAG+GPEF I+KLRY+KII+MTDADVDGSHIRILLLTF +RYM PL++NGNVYIA PPL+K S  K+ KYAY ++ LE  K   S +KY IQRYKGLGEMNPDQLWETTMDPKNRLLLKV IEDA  ADK FSLLMGD+VAPR+EFIEKNAKYVKN+D
  S:     1 MNDSNKEKKYTAESIKVLEGLEAVRKRPGMYIGSTQSEGLHHMIWEIVDNSIDEAMGGFATIVRVILKKDGSVRVEDDGRGIPIEIHEKTGLSGVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSKNFKVWVNKNHVQYYVEFINGGHAIEPLKPINNKDVKEKGTTIEFIPDFEIMEENEWDELKIMARLKQLAYLNKGVNIEFESELTNRKEKWHYEGGLKEYITDLNAEKEPLFDLIVYGEEEKEVRVPGHNEQTYNIKCEVAFQYNNSYNNSTHSFCNNINTTEGGTHEEGFKLAITRLLNKYAVDKKYLKDTDDKITKEDVSEGLTAIISVKHPNPQYEGQTKKKLGNSEVRPYVNEITSIIFEKFLNENPEESKKIVAKVMQAAEARRRSHEAREATRRKSPFESNSLPGKLADCSNRDSSVTEIYIVEGDSAGGSAKTGREREFQAILPLRGKIINVEKAKIDKIFANEEIQNMITAFGAGIGPEFNIEKLRYSKIIIMTDADVDGSHIRILLLTFFYRYMLPLIQNGNVYIAQPPLYKVSYAKTIKYAYSDQELERIKSTISNIKYNIQRYKGLGEMNPDQLWETTMDPKNRLLLKVNIEDAAIADKTFSLLMGDDVAPRKEFIEKNAKYVKNID 649
>gi|12044853|ref|NP_072663.1| DNA gyrase subunit B [Mycoplasma genitalium G37] >gi|1346242|sp|P47249|GYRB_MYCGE DNA gyrase subunit B >gi|497647|gb|AAA57071.1| DNA gyrase subunit B >gi|1045671|gb|AAC71219.1| DNA gyrase, B subunit [Mycoplasma genitalium G37] >gi|166078727|gb|ABY79345.1| DNA gyrase, B subunit [synthetic Mycoplasma genitalium JCVI-1.0] (650 aa)
Score = 2224, Expect = 0.0e+00, Identities = 424/649 (65%), Positives = 531/649 (81%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFL--FAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M +  K N Y +S+IK+LEGLEAVRKRPGMYIGST  +GLHHM+WEIVDNSIDEAM G AS + +TL      +V+DDGRGIPV+ H KT +STVETV TVLHAGGKFDNDSYKVSGGLHGVGASVVNALSS  KVWV+++ K++++ F DGGK + DL V    +  ++GTIVEF PDF +ME++++    I SRL+QLA+LNKGI+I+F+D R  + ++F   + GG+ +++  LNNEKEP+   ++ DE+ E+VKA N  + Y ++VEVAFQYNKTYN S F+FCNNINTTEGG+H EGF+ AL KIIN+FAVE K LK++DEKI+++D  EGLTAI+SIKHPNPQYEGQTK+KLGN+EVRP V++VVSEIFE+++LENP++AN II+K LLA EAR++S EARE TRRKSPF+S SLPGKLADC+T+D  ISELYIVEGDSAGG+AK GRDR FQAILPL+GKI+NVEK+  ++IF+N EI  L+ AIG G+ P+F+++KLRY+KI++MTDADVDG+HIR LLLTF FR+MYPL+E GN++IA PPL+K S      Y + +  LE++K +N  VK+ +QRYKGLGEM+  QLWETTMDPK R LLKVT+EDA  ADK FSLLMGDEV PRREFIEKNA+ VKN+DI
  S:     1 MEENNKANIYDSSSIKVLEGLEAVRKRPGMYIGSTGEEGLHHMIWEIVDNSIDEAMGGFASFVKLTLEDNFVTRVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVFRQNKKYFLSFSDGGKVIGDL-VQEGNSEKEHGTIVEFVPDFSVMEKSDYKQTVIVSRLQQLAFLNKGIRIDFVDNRKQNPQSFSWKYDGGLVEYIHHLNNEKEPLFNEVIADEKTETVKAVNRDENYTVKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKDSDEKINRDDVCEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSVVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSNFEQIFNNAEISALVMAIGCGIKPDFELEKLRYSKIVIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIFIAQPPLYKVSYSHKDLYMHTDVQLEQWKSQNPNVKFGLQRYKGLGEMDALQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEKNARSVKNIDI 650
>gi|13507742|ref|NP_109691.1| DNA gyrase subunit B [Mycoplasma pneumoniae M129] >gi|121890|sp|P22447|GYRB_MYCPN DNA gyrase subunit B >gi|44484|emb|CAA37622.1| gyrase B subunit [Mycoplasma pneumoniae] >gi|1673811|gb|AAB95799.1| DNA gyrase subunit B [Mycoplasma pneumoniae M129] (650 aa)
Score = 2219, Expect = 0.0e+00, Identities = 423/649 (65%), Positives = 528/649 (81%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFL--FAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M    K   Y +S+IKILEGLEAVRKRPGMYIGST  +GLHHM+WEI+DNSIDEAM G AS + +TL       V+DDGRGIPV+ H KT +STVETV TVLHAGGKFDNDSYKVSGGLHGVGASVVNALSS  KVWV +E++++++ F +GG+ + DL V   K   ++GT VEF PDF +ME++++    I SRL+QLA+LNKGI+I+F+DER  + ++F   + GG+ Q++  LNNEKEP+   I++ E+ ++VK+ +  + Y I+VEVAFQYNKTYN S F+FCNNINTTEGG+H EGF+ AL KIIN+FAVE K LKETDEKI+++D  EGLTAI+SIKHPNPQYEGQTK+KLGN+EVRP V+++VSEIFE+++LENP++AN II+K LLA EAR++S EARE TRRKSPF+S SLPGKLADC+T+D  ISELYIVEGDSAGG+AK GRDR FQAILPL+GKI+NVEK+  ++IF+N EI  L+ A+G G+ P+F+++KLRYNKII+MTDADVDG+HIR LLLTF FR+MYPL+E GN+YIA PPL+K S      Y   +  LEE+K+++  +KY +QRYKGLGEM+  QLWETTMDPK R LLKVT+EDA  ADK FSLLMGDEV PRREFIE+NA+ VKN+DI
  S:     1 MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYFLAFHNGGEVIGDL-VNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQNPQSFSWKYDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKETDEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDLYMQTDVQLEEWKQQHPNLKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEQNARNVKNIDI 650
>gi|1209515|gb|AAC43643.1| gyrase B (637 aa)
Score = 2175, Expect = 0.0e+00, Identities = 414/636 (65%), Positives = 516/636 (81%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFL--FAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREF 636
           M    K   Y +S+IKILEGLEAVRKRPGMYIGST  +GLHHM+WEI+DNSIDEAM G AS + +TL       V+DDGRGIPV+ H KT +STVETV TVLHAGGKFDNDSYKVSGGLHGVGASVVNALSS  KVWV +E++++++ F +GG+ + DL V   K   ++GT VEF PDF +ME++++    I SRL+QLA+LNKGI+I+F+DER  + ++F   + GG+ Q++  LNNEKEP+   I++ E+ ++VK+ +  + Y I+VEVAFQYNKTYN S F+FCNNINTTEGG+H EGF+ AL KIIN+FAVE K LKETDEKI+++D  EGLTAI+SIKHPNPQYEGQTK+KLGN+EVRP V+++VSEIFE+++LENP++AN II+K LLA EAR++S EARE TRRKSPF+S SLPGKLADC+T+D  ISELYIVEGDSAGG+AK GRDR FQAILPL+GKI+NVEK+  ++IF+N EI  L+ A+G G+ P+F+++KLRYNKII+MTDADVDG+HIR LLLTF FR+MYPL+E GN+YIA PPL+K S      Y   +  LEE+K+++  +KY +QRYKGLGEM+  QLWETTMDPK R LLKVT+EDA  ADK FSLLMGDEV PRREF
  S:     1 MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYFLAFHNGGEVIGDL-VNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQNPQSFSWKYDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKETDEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDLYMQTDVQLEEWKQQHPNLKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREF 637
>gi|31544928|ref|NP_853506.1| DNA gyrase subunit B [Mycoplasma gallisepticum R] >gi|33860162|sp|P47720|GYRB_MYCGA DNA gyrase subunit B >gi|31541775|gb|AAP57074.1| GyrB [Mycoplasma gallisepticum R] (648 aa)
Score = 2127, Expect = 0.0e+00, Identities = 423/644 (65%), Positives = 515/644 (79%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           TKK+ YS+ +IK+LEGL AVRKRPGMYIGSTD KGLHHM+WEI+DNS+DE M G  + + +TL      +V+DDGRGIPV+ H KT KSTVETVLT+LHAGGKFD+D+Y +SGGLHGVGASVVNALSS  KVWV ++YK HYIEFKDGG P+  L++     S K GT ++F PDF IME+ E+D   I  R++QLA+LNKGIK  F DERTD K  + +L+ GGIKQ+VE LN  KEPI+P I+Y E++  V       +  + +EVAFQY   Y NST++FCNNI+T +GG+HEEGFK AL KIIN++A+EKK +KETD KISKED  EGLTAI+SIKH  PQY+GQTK +LGN+EVR F ++VVSE+ E++ LENPE+A  I  K + AM +RK+S  A E+ R KSPFES SLPGKLADC+TKD EISELYIVEGDSAGGSAK GRDR +QAILPL+GK++NVEKA  +KIF NEEI  LITAIGAGV PEF +DK+RYNKII+MTDADVDG+HIRILLLTF FR+M+PL+E G+VYIA PPL++ S  K +KY Y +  LEE+K +N  V+Y++QRYKGLGEM+  QLWETTMDP+ R LLKV+I DA NADK FSLLMGDEV+PRR+FIEKNAK VKN+D
  S:     4 TKKDQYSSQSIKVLEGLSAVRKRPGMYIGSTDQKGLHHMIWEIIDNSVDEMMAGYGTTVKLTLKDNYLVEVEDDGRGIPVDIHEKTNKSTVETVLTILHAGGKFDSDTYSMSGGLHGVGASVVNALSSSFKVWVNRDYKIHYIEFKDGGVPLKPLEIIGTD-SKKQGTRIQFVPDFSIMEQFEYDETIIADRIEQLAFLNKGIKFIFNDERTDKKTKQEWLYEGGIKQYVENLNASKEPIIPQIIYGEKKTKVTLPKRNLEVTMLLEVAFQYTNGYYNSTYSFCNNIHTNQGGTHEEGFKNALYKIINRYALEKKFIKETDGKISKEDLSEGLTAIISIKHSEPQYQGQTKDRLGNTEVREFTNSVVSELLERFFLENPEEAAKITAKAVSAMFSRKRSEAALESAR-KSPFESASLPGKLADCTTKDMEISELYIVEGDSAGGSAKSGRDRFYQAILPLRGKVLNVEKANHEKIFKNEEIRTLITAIGAGVNPEFSLDKIRYNKIIIMTDADVDGAHIRILLLTFFFRHMFPLIEKGHVYIAQPPLYRVSYNKQNKYIYSDAQLEEWKNQNPNVRYELQRYKGLGEMDDVQLWETTMDPEKRTLLKVSINDAANADKTFSLLMGDEVSPRRDFIEKNAKSVKNID 647
>gi|603237|gb|AAA57341.1| DNA gyrase B subunit >gi|1583652|prf||2121321A DNA gyrase:SUBUNIT=B (646 aa)
Score = 2061, Expect = 0.0e+00, Identities = 412/644 (63%), Positives = 507/644 (78%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           TKK+ YS+ +IK+LEGL AVRKRPGMYIGSTD KGLHHM+WEI+DNS+DE M G  + + +TL      +V+DDGRGIPV+ H KT KSTVETVLT+LHAGGKFD+D+Y +SGGLHGVGASVVNALSS  KVWV ++YK HYIEFKDGG  +  L++       K GT ++F PDF IME+ E+D   I  R++QLA+LNKGIK  F DERTD K  + +L+ GGIKQ+VE LN  KEPI+P I+Y E++  V       +  + +EVAFQY   Y NST++FCNNI+T +GG+HEEG +    +   ++A+EKK +KETD KISKED  EGLTAI+SIKH  PQY+GQTK +LGN+EVR F ++VVSE+ E++ LENPE+A  I  K + AM +RK+S  A E+ R KSPFES SLPGKLADC+TKD  ISELYIVEGDSAGGSAK GRDR +QAILPL+GK++NVEKA  +KIF NEEI  LITAIGAGV PEF +DK+RYNKII+MTDADVDG+HIRILLLTF FR+M+PL+E G+VYIA PPL++ S  K +KY Y +  LEE+K +N  V+Y++QRYKGLGEM+  QLWETTMDP+ R+LLKV+I DA NADK FSLLMGDEV+PRR+FIEKNAK VKN+D
  S:     4 TKKDQYSSQSIKVLEGLSAVRKRPGMYIGSTDQKGLHHMIWEIIDNSVDEMMAGYGTTVKLTLKDNYLVEVEDDGRGIPVDIHEKTNKSTVETVLTILHAGGKFDSDTYSMSGGLHGVGASVVNALSSSFKVWVNRDYKIHYIEFKDGGVSLKPLEIIGTDNK-KQGTRIQFVPDFSIMEQFEYDETIISDRIEQLAFLNKGIKFIFNDERTDKKTKQEWLYEGGIKQYVENLNASKEPIIPQIIYGEKKTKVTLPKRNLEVTMLLEVAFQYTNGYYNSTYSFCNNIHTNQGGTHEEGLRMLFIRSY-RYALEKKFIKETDGKISKEDLSEGLTAIISIKHSEPQYQGQTKDRLGNTEVREFTNSVVSELLERFFLENPEEAAKITAKAVSAMFSRKRSEAALESAR-KSPFESASLPGKLADCTTKDG-ISELYIVEGDSAGGSAKSGRDRFYQAILPLRGKVLNVEKANHEKIFKNEEIRTLITAIGAGVNPEFSLDKIRYNKIIIMTDADVDGAHIRILLLTFFFRHMFPLIEKGHVYIAQPPLYRVSYNKQNKYIYSDAQLEEWKNQNPNVRYELQRYKGLGEMDDVQLWETTMDPEKRILLKVSINDAANADKTFSLLMGDEVSPRRDFIEKNAKSVKNID 645
>gi|15829210|ref|NP_326570.1| DNA gyrase subunit B [Mycoplasma pulmonis UAB CTIP] >gi|14090154|emb|CAC13912.1| DNA GYRASE SUBUNIT B [Mycoplasma pulmonis] (644 aa)
Score = 1843, Expect = 0.0e+00, Identities = 373/644 (57%), Positives = 477/644 (74%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +K N Y+ASNI++L+GLE VRKRPGMYIG+T  KGLHH++WEIVDNS+DE M G AS+ITITL  +    ++DDGRGIPV++H +T  STVETVLTVLHAGGKFD++SYKVSGGLHGVGASVVNALS+ LK W+ +  K HY+EF DGGK +  L+V +E  S + GT + F PDF IME+ +FD + +K R KQLAYLNK + IN +D R    + F F GGI  +++ELN  K+ +    +Y E    ++     D   + VEVA QY  +Y ++  ++ NNI T EGG+HE+GF   L +I+NKFA    L+K  +EK+ ++D  EG++AI+SIKH +P +EGQTK KLGN + R  V+ + S+ FE++L ENP +A  II K + A +AR     AREA RRKS F+ +SLPGKLADCS+K+ EISELYIVEG+SAGGSAK+GRDR FQAILPL+GK+IN EK   +K+F+NEEI +LI A+G G+  EF I+KLRY+KII+MTDADVDG+HIR LLLTF +RY  PL+E G VYIA PPL+K S+   S+YAY+++  EE       V K  IQRYKGLGEM+PDQLW+TTMDP  R +L+V IEDA  AD  F+ LMG EVAPRREFIE+NAKYVKN+D
  S:     4 SKNNQYNASNIQVLKGLEPVRKRPGMYIGTTGKKGLHHLIWEIVDNSVDETMAGFASQITITLDNDNLITIEDDGRGIPVDRHPETGISTVETVLTVLHAGGKFDSESYKVSGGLHGVGASVVNALSTNLKAWIKRHNKLHYVEFHDGGKILKPLEVISELESDQTGTKISFQPDFSIMEKNDFDLEVVKDRAKQLAYLNKQLVINVVDNRVGYTKQFYFEGGIVDYIKELNKSKKVLHDQTIYSEGANVLE-----DNPEVIVEVAIQYTDSYQSNIVSYANNILTIEGGTHEQGFFDGLVRILNKFATNLGLVKLEEEKLIRDDVKEGISAIISIKHVDPIFEGQTKGKLGNKDARIAVNKIFSKNFERFLNENPVEAKNIILKVINARKARMAGLLAREAVRRKSAFDISSLPGKLADCSSKNAEISELYIVEGNSAGGSAKMGRDREFQAILPLRGKVINAEKNNIEKVFNNEEIQSLIIALGTGIAEEFNINKLRYHKIIIMTDADVDGAHIRTLLLTFFYRYFKPLIEYGFVYIAQPPLYKISISGKSRYAYNDEQKEEILANIKDVSKVAIQRYKGLGEMDPDQLWDTTMDPGIRTMLQVQIEDAAKADWTFTTLMGGEVAPRREFIEQNAKYVKNID 643
>gi|47458936|ref|YP_015798.1| DNA gyrase subunit b [Mycoplasma mobile 163K] >gi|47458264|gb|AAT27587.1| DNA gyrase subunit b [Mycoplasma mobile 163K] (647 aa)
Score = 1840, Expect = 0.0e+00, Identities = 376/648 (58%), Positives = 484/648 (74%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +  +   N YS  NI++LEGLEAVRKRPGMYIG+T  KGLHH++WEIVDNSIDEAM G+A+++ ITL K G A ++D+GRGIP + H KT KS VETVLTVLHAGGKFD D+YKVSGGLHGVGASVVNALS+ L+VWV +E K HY EF+  GKPV  L + ++      GT + F+PD+ IM++ EF+ D I  R KQ+AYLN+G+K+   DER ++ E   F + GGI ++VE LN  K+ +   ++Y E +E        D+ +I VEVA QY  +Y  +  ++ NNI+T EGG+HE+GF  AL +I N +A E KL+K   EK++++D  EGLTAI+SIKH +P +EGQTK KLGN + R   + V+S +  K+LLENP+ A VII+K L + + R  +  AREAT +K+ F  +SLPGKLADCSTK+ EISELYIVEG+SAGGSAK+GRDR  QAILPL+GK+IN EKA   K+F N EI++LITA+G GVGPEF I+KLRY+K+++MTDADVDG+HIR LLLTFL+ +  PL+E G +YIA PPL+K S GKS +YA+ +   EE  K+     K  IQRYKGLGEM+P+QLWETTM+P++R +L+V IEDA  AD VFS LMG +VAPRREFIEKNAKYVK +D
  S:     3 LGDDMSNNNYSGKNIQVLEGLEAVRKRPGMYIGTTGKKGLHHLIWEIVDNSIDEAMAGHANQVKITLNKNGYAIIEDNGRGIPTDIHEKTGKSAVETVLTVLHAGGKFDKDTYKVSGGLHGVGASVVNALSNHLEVWVKREGKLHYQEFR-FGKPVKALNIISDVEESDTGTKISFFPDYSIMDKNEFEYDVIVDRAKQIAYLNRGLKLILRDERQEEPEDIEFYYEGGIIEYVEALNISKKALHENVIYAEGKEV------GDEGDITVEVALQYTDSYQPNIVSYANNISTIEGGTHEQGFVDALIRIFNNYAGENKLMKNDKEKLTRDDIREGLTAIISIKHVDPVFEGQTKAKLGNKDARTATNKVLSSVLYKFLLENPDQAKVIIEKVLFSQKIRFSASAAREATIKKNSFGISSLPGKLADCSTKNAEISELYIVEGNSAGGSAKMGRDRETQAILPLRGKVINAEKANIVKVFENTEILSLITALGTGVGPEFNINKLRYHKVVIMTDADVDGAHIRTLLLTFLYHHFRPLIEYGFIYIAQPPLYKISYGKSFQYAFSDAEKEEVLKQLLPNQKATIQRYKGLGEMDPEQLWETTMNPESRKMLQVQIEDAAIADLVFSTLMGGDVAPRREFIEKNAKYVKQID 646
>gi|194016365|ref|ZP_03054979.1| DNA gyrase, B subunit [Bacillus pumilus ATCC 7061] >gi|194011838|gb|EDW21406.1| DNA gyrase, B subunit [Bacillus pumilus ATCC 7061] (640 aa)
Score = 1800, Expect = 0.0e+00, Identities = 374/649 (57%), Positives = 473/649 (72%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M  E + N+Y  + I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  ++IT+ + K+ S  V+D+GRGIPV  H K  +  VE ++TVLHAGGKFD   YKVSGGLHGVGASVVNALS+ L V VY++ K HY +FK G  PV DL++  E  +   GT   F PD EI  E  EFD DT+ +R+++LA+L KG+ I   D R   + +  + + GGIK +VE LN  KE +    VY E E          K  I VEVA QYN +Y ++ ++F NNINT EGG+HE GFK  L ++IN +A +  + K+ D  +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R    ++ SE  EK+LLENP+ A  I++K ++A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+ ++ITA+G G+G +F ++K RY+K+++MTDADVDG+HIR LLLTF +RYM  ++ENG VYIA PPLFK   GK  +Y Y++K L+E  K   +  K  +QRYKGLGEMN  QLWETTMDP  R LL+VT+EDA++AD+ F +LMGD+V PRR FIE+NA+YVKNLDI
  S:     1 MAMEQQHNSYDENQIQVLEGLEAVRKRPGMYIGSTSAKGLHHLVWEIVDNSIDEALAGYCTDITVQIEKDNSITVKDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFDGSGYKVSGGLHGVGASVVNALSTTLDVTVYRDGKIHYQQFKRG-VPVGDLEIIGE--TDVTGTTTHFVPDTEIFTETIEFDYDTLANRVRELAFLTKGVNIVIEDLREGKERRNEYCYEGGIKSYVEHLNRSKEVVHEEPVYIEGE----------KDGITVEVALQYNDSYTSNIYSFANNINTYEGGTHEAGFKTGLTRVINDYARKNGVFKDGDSNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARTITDSLFSEALEKFLLENPDAAKKIVEKGVMAARARMAAKKARELTRRKSALEVSSLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMREIIENGYVYIAQPPLFKVQQGKRVEYVYNDKQLDELLKTLPQTPKPGLQRYKGLGEMNATQLWETTMDPDARTLLQVTLEDAIDADETFEMLMGDKVEPRRNFIEENAQYVKNLDI 640
>gi|157690804|ref|YP_001485266.1| DNA gyrase subunit B [Bacillus pumilus SAFR-032] >gi|157679562|gb|ABV60706.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Bacillus pumilus SAFR-032] (642 aa)
Score = 1799, Expect = 0.0e+00, Identities = 372/646 (57%), Positives = 472/646 (73%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E + N+Y  + I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  ++IT+ + K+ S  V+D+GRGIPV  H K  +  VE ++TVLHAGGKFD   YKVSGGLHGVGASVVNALS+ L V VY++ K HY +FK G  PV DL++  E  +   GT   F PD EI  E  EFD DT+ +R+++LA+L KG+ I   D R   + +  + + GGIK +VE LN  KE +    VY E E             I VEVA QYN +Y ++ ++F NNINT EGG+HE GFK  L ++IN +A +  + K+ D  +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R    ++ SE  EK+LLENP+ A  I++K ++A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+ ++ITA+G G+G +F ++K RY+K+++MTDADVDG+HIR LLLTF +RYM  ++ENG VYIA PPL+K   GK  +Y Y++K L+E  K  S+  K  +QRYKGLGEMN  QLWETTMDP  R LL+VT+EDA++AD+ F +LMGD+V PRR FIE+NA+YVKNLDI
  S:     6 EQQHNSYDENQIQVLEGLEAVRKRPGMYIGSTSAKGLHHLVWEIVDNSIDEALAGYCTDITVQIEKDNSITVKDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFDGSGYKVSGGLHGVGASVVNALSTTLDVTVYRDGKIHYQQFKRG-VPVGDLEIIGE--TDVTGTTTHFVPDPEIFTETIEFDYDTLANRVRELAFLTKGVNIIIEDLREGKERRNEYCYEGGIKSYVEHLNRSKEVVHEEPVYIEGERD----------GITVEVALQYNDSYTSNIYSFANNINTYEGGTHEAGFKTGLTRVINDYARKNGVFKDGDSNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARTITDSLFSEALEKFLLENPDAAKKIVEKGVMAARARMAAKKARELTRRKSALEVSSLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMREIIENGYVYIAQPPLYKVQQGKRVEYVYNDKQLDELLKSLSQTPKPGLQRYKGLGEMNAAQLWETTMDPDARTLLQVTLEDAIDADETFEMLMGDKVEPRRNFIEENAQYVKNLDI 642
>gi|116754690|ref|YP_843808.1| DNA gyrase, B subunit [Methanosaeta thermophila PT] >gi|116666141|gb|ABK15168.1| DNA gyrase subunit B [Methanosaeta thermophila PT] (628 aa)
Score = 1799, Expect = 0.0e+00, Identities = 358/643 (55%), Positives = 468/643 (72%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +  Y AS+IK++EGLEAVR RP MYIGSTD+ GLHH+V+E+VDNS+DEAM G   EI++ +  +GS  V+DDGRGIPV+ H +  +  VE V+TVLHAGGKFD+D+Y VSGGLHGVG SVVNALS WL+V V +E   Y++ Y    + G+PV+DL+ T    S   GT V F PD EI E  +F  D + SRL++LA+LN+G+KI+  DER+   +TF + GGI  +V+ LN  KE + P  +Y  R             ++ VEVA QYN +YN S FTF NNINT EGG+H  GF+ AL K +N F  EKKLLK  D K++ +D  EGL A+VS++ P+PQ+EGQTK +LGNS VR  V ++VSE   +Y   NP+ A  I++K   AM AR+ + +A+E TRRK+   S+ LPGKLADC  +D   SELYIVEG+SAGGSAK GR+R FQA+LPL+GKI+NVE+A+ DK+  NEEI NLITA+G G+G +F I K RY+KII+MTDADVDGSHIR LLLTF +RYM PL+E G VYIA PPL++   GKS KYAY ++ L +  ++   V   +QRYKGLGEMNP+QLWETTM+P+ R LL+VT++DA+ AD++FS+LMG++V PRR FIE +A+ V+NLD+
  S:     3 ETMYDASHIKVMEGLEAVRHRPSMYIGSTDVHGLHHLVYEVVDNSVDEAMAGYCKEISVVIHGDGSVSVKDDGRGIPVDIHPQYNRPAVEIVMTVLHAGGKFDHDTYHVSGGLHGVGVSVVNALSEWLEVEVSREGRVYRQRY----ERGRPVSDLQETG--VSENTGTTVRFKPDPEIFEVTDFSFDVLSSRLRELAFLNRGLKISITDERSGRSKTFHYDGGIISFVQYLNKSKEVLHPNPIYFSRVRD----------DVSVEVAMQYNTSYNESVFTFANNINTREGGTHLSGFRAALTKTVNDFVREKKLLK-GDAKLTGDDLREGLVAVVSVRLPDPQFEGQTKTRLGNSAVRGLVESLVSEGLMEYFELNPQVAEAIVEKATEAMRAREAARKAKEITRRKTALTSSGLPGKLADCVERDPAKSELYIVEGESAGGSAKQGRNRHFQAVLPLRGKILNVERARLDKMLKNEEIRNLITALGTGIGDDFDITKARYHKIIIMTDADVDGSHIRTLLLTFFYRYMQPLIEAGYVYIAQPPLYQVRKGKSVKYAYSDEELAKLLEDGKAV---VQRYKGLGEMNPEQLWETTMNPEKRTLLRVTLKDAVEADEIFSVLMGEQVEPRRVFIETHAREVRNLDV 628
>gi|52078497|ref|YP_077288.1| DNA gyrase subunit B [Bacillus licheniformis ATCC 14580] >gi|52001708|gb|AAU21650.1| DNA gyrase (subunit B) [Bacillus licheniformis ATCC 14580] (639 aa)
Score = 1781, Expect = 0.0e+00, Identities = 372/644 (57%), Positives = 472/644 (73%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++N Y  + I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  +EI + + K+ S  V+D+GRGIPV  H K  +  VE ++TVLHAGGKFD   YKVSGGLHGVGASVVNALS+ L V VY++ K HY EF + G P ADLKV  +      GT   F PD EI  E  E+D DT+ +R+++LA+L KG+KI   D+R   + K  + + GGIK +VE LN  +E I         EE V    +KD   I VEVA QYN +Y ++ ++F NNI+T EGG+HE GFK  L ++IN +A    + KE+D  +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + SE  EK+LLENP+ A  I++K ++A  AR  + +ARE TRRKS  E ++LPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+ ++ITA+G G+G +F ++K RY+K+++MTDADVDG+HIR LLLTF +RYM  ++E G VYIA PPL+K   GK  +YAY+++ LEE  KE     K  +QRYKGLGEMN  QLWETTMDP+ R LL+VT++DA++AD+ F +LMGD+V PRR FIE+NA+YVKNLDI
  S:     5 QQNNYDENQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCTEINVAIEKDNSITVKDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFDGSGYKVSGGLHGVGASVVNALSTELDVTVYRDGKIHYQEF-ERGVPKADLKVIGDTEV--TGTTTHFKPDPEIFTETTEYDYDTLATRVRELAFLTKGVKITIEDKREGKERKNEYCYEGGIKSYVEHLNRSREVI--------HEEPVYIEGSKD--GITVEVALQYNDSYTSNIYSFANNIHTYEGGTHEAGFKTGLTRVINDYARRNGVFKESDPNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARTITDALFSEALEKFLLENPDSAKKIVEKGVMAARARMAAKKARELTRRKSALEVSNLPGKLADCSSKDPTISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMRQIIEQGYVYIAQPPLYKVQQGKRVEYAYNDQQLEEILKELPQNPKPGLQRYKGLGEMNATQLWETTMDPETRTLLQVTLKDAIDADETFEMLMGDKVEPRRNFIEENARYVKNLDI 639
>gi|52783861|ref|YP_089690.1| DNA gyrase subunit B [Bacillus licheniformis ATCC 14580] >gi|52346363|gb|AAU38997.1| GyrB [Bacillus licheniformis DSM 13] (637 aa)
Score = 1780, Expect = 0.0e+00, Identities = 372/644 (57%), Positives = 472/644 (73%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++N Y  + I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  +EI + + K+ S  V+D+GRGIPV  H K  +  VE ++TVLHAGGKFD   YKVSGGLHGVGASVVNALS+ L V VY++ K HY EF + G P ADLKV  +      GT   F PD EI  E  E+D DT+ +R+++LA+L KG+KI   D+R   + K  + + GGIK +VE LN  +E I         EE V    +KD   I VEVA QYN +Y ++ ++F NNI+T EGG+HE GFK  L ++IN +A    + KE+D  +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + SE  EK+LLENP+ A  I++K ++A  AR  + +ARE TRRKS  E ++LPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+ ++ITA+G G+G +F ++K RY+K+++MTDADVDG+HIR LLLTF +RYM  ++E G VYIA PPL+K   GK  +YAY+++ LEE  KE     K  +QRYKGLGEMN  QLWETTMDP+ R LL+VT++DA++AD+ F +LMGD+V PRR FIE+NA+YVKNLDI
  S:     3 QQNNYDENQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCTEINVAIEKDNSITVKDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFDGSGYKVSGGLHGVGASVVNALSTELDVTVYRDGKIHYQEF-ERGVPKADLKVIGDTEV--TGTTTHFKPDPEIFTETTEYDYDTLATRVRELAFLTKGVKITIEDKREGKERKNEYCYEGGIKSYVEHLNRSREVI--------HEEPVYIEGSKD--GITVEVALQYNDSYTSNIYSFANNIHTYEGGTHEAGFKTGLTRVINDYARRNGVFKESDPNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARTITDALFSEALEKFLLENPDSAKKIVEKGVMAARARMAAKKARELTRRKSALEVSNLPGKLADCSSKDPTISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMRQIIEQGYVYIAQPPLYKVQQGKRVEYAYNDQQLEEILKELPQNPKPGLQRYKGLGEMNATQLWETTMDPETRTLLQVTLKDAIDADETFEMLMGDKVEPRRNFIEENARYVKNLDI 637
>gi|169351628|ref|ZP_02868566.1| hypothetical protein CLOSPI_02409 [Clostridium spiroforme DSM 1552] >gi|169291850|gb|EDS73983.1| hypothetical protein CLOSPI_02409 [Clostridium spiroforme DSM 1552] (641 aa)
Score = 1778, Expect = 0.0e+00, Identities = 367/649 (56%), Positives = 484/649 (74%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E  K++Y  S+I++LEGLEAVRKRPGMYIG+T I+GLHH+VWEIVDNSIDEA+ G AS I + L  +   +V DDGRG+P   HAKT  STVET+ TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V V+++   +Y  F++GG+PV  LKV  +  S   GTIV F  D  I  E   +D DT+  R+++LA+LNKG++++  D+R   + K+ + + GGIK++V  +N  K PI   I+Y E  +           +I +EVA QYN  Y ++ ++FCNNINT EGG+HEEGF+ AL ++IN +A  K LLK+ DE +S +D  EGLTAI+S+KHP+PQYEGQTK KLGN+EVR   SN+++   +K+LLENP+ A +I+ K ++A  AR  + +ARE TRRK+P E ++LPGKLADCS+KD    E++IVEGDSAGGSAK+GRDR  QAILPL+GKI+NVEK++ +KI  N EI ++ITA G G+G EF +DKLRY+KI++MTDADVDG HIRIL+LTFL+RY+ PL+ENG VY A PPL+    GK   Y Y ++ LE+ K K  S  KY IQRYKGLGEMN DQLWETTMDP+ R+L ++ +++A+ AD +F +LMG++V PRREFI++NAKYV +LDI
  S:     1 MSEEKVKHSYDESDIQVLEGLEAVRKRPGMYIGTTSIRGLHHLVWEIVDNSIDEALAGYASHIRVILKDDDVVQVIDDGRGMPTGTHAKTGISTVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVNVHRDGHVYYQRFENGGQPVDKLKVVGD--SDITGTIVTFKADKLIFKEGTVYDYDTLNQRIRELAFLNKGLRLSLEDQRNGINRKQVYHYEGGIKEYVSFINKNKTPIHEEIIYVEDIQQ----------DITIEVAMQYNDGYQSNIYSFCNNINTHEGGTHEEGFRMALTRVINNYAKNKGLLKKDDETLSGDDVREGLTAIISVKHPDPQYEGQTKTKLGNAEVRKIASNIIATSLDKFLLENPDTAKIIVDKAIIASRARMAAKKAREMTRRKNPLEVSNLPGKLADCSSKDPSECEIFIVEGDSAGGSAKMGRDRRIQAILPLRGKILNVEKSRLEKILGNAEIRSMITAFGTGIGEEFNLDKLRYHKIVIMTDADVDGGHIRILMLTFLYRYLKPLIENGFVYAAQPPLYLLKHGKEEHYCYSDEELEDLKTKIGSGAKYSIQRYKGLGEMNADQLWETTMDPQKRILNQIDLDEAMEADMIFDMLMGEKVEPRREFIQENAKYVTDLDI 641
>gi|56418540|ref|YP_145858.1| DNA gyrase subunit B [Geobacillus kaustophilus HTA426] >gi|56378382|dbj|BAD74290.1| DNA gyrase subunit B [Geobacillus kaustophilus HTA426] (638 aa)
Score = 1774, Expect = 0.0e+00, Identities = 370/643 (57%), Positives = 478/643 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD-KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + TY AS I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  + I +T+ K+ S  V D+GRGIPV+ H  T +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V+VY++ K HY  ++ G +P  DL+V  E  + + GT   F PD EI  E  EFD +T+ +RL++LA+LN+G+KI   DER D  K  +++ GGI+ +V  LN  +E +         EE +  A  +D   I VE+A QYN  Y ++ ++F NNI+T EGG+HE GFK AL +IIN +A ++++ KE D  ++ ED  EGLTAIVSIKHP+PQ+EGQTK KLGNS+ R     V SE FE +LLENP  A  I++K ++A  AR  + +ARE TRRKS  E ++LPGKLADCS++D  ISELY+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+  +ITA+G G+G EF I K RY+K+I+MTDADVDG+HIR LLLTF +RYM  L+E+G +YIA PPL+K   GK  +YAY+++ LE+   E   + K  IQRYKGLGEMNP+QLWETTM+P+ R LL+V+++DA++AD+ F +LMGD+V PRR+FIE+NA+YVKNLDI
  S:     6 EQTYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVWEIVDNSIDEALAGYCTNIDVTIGKDNSITVADNGRGIPVDIHEATGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVYRDGKIHYQRYERG-EPCTDLQVIGE--TDRTGTTTRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLTDERVDSRKNEYVYEGGIRSYVRHLNRTREVL--------HEEPIYIAGERD--GIAVEIALQYNDGYTSNIYSFVNNIHTHEGGTHESGFKMALTRIINDYARKQQIFKENDTNLTGEDVREGLTAIVSIKHPSPQFEGQTKTKLGNSDARTVTDAVFSEQFETFLLENPTIARKIVEKGMMAARARLAAKKARELTRRKSALEISNLPGKLADCSSRDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRAIITALGTGIGEEFDISKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRELIEHGYIYIAQPPLYKIEQGKQVRYAYNDRQLEKILAELPDQPKPTIQRYKGLGEMNPEQLWETTMNPETRTLLQVSLQDAIDADETFEILMGDKVEPRRQFIEENARYVKNLDI 638
>gi|154684524|ref|YP_001419685.1| DNA gyrase subunit B [Bacillus amyloliquefaciens FZB42] >gi|154350375|gb|ABS72454.1| GyrB [Bacillus amyloliquefaciens FZB42] (638 aa)
Score = 1764, Expect = 0.0e+00, Identities = 368/646 (56%), Positives = 470/646 (72%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E ++N+Y  + I++LEGLEAVRKRPGMYIGST+ KGLHH+VWEIVDNSIDEA+ G  ++I I + K+ S  V+D+GRGIPV    K  +  VE ++TVLHAGGKFD   YKVSGGLHGVGASVVNALS+ L V V+++ K HY  + + G PVADL+V  +  + K GTI  F PD EI  E   +D D + +R+++LA+L KG+ I   D+R   + K  + + GGIK +VE LN  KE +    +Y E E          K  I VEVA QYN +Y ++ ++F NNINT EGG+HE GFK  L ++IN +A  K + KE D  +S +D  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + S   E +LLENP+ A  I++K L+A  AR  + +ARE TRRKS  E ++LPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+ ++ITA+G G+G +F ++K RY+K+++MTDADVDG+HIR LLLTF +RYM  ++ENG VYIA PPL+K   GK  +YAY++K L+E  KE  +  K  +QRYKGLGEMN  QLWETTMDP  R LL+V +EDA++AD+ F +LMGD+V PRR FIE NA+YVKNLDI
  S:     2 EQQQNSYDENQIQVLEGLEAVRKRPGMYIGSTNSKGLHHLVWEIVDNSIDEALAGYCTDINIEIEKDNSITVKDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFDGSGYKVSGGLHGVGASVVNALSTTLDVTVHRDGKIHYQAY-ERGVPVADLEVIGD--TDKTGTITHFVPDPEIFKETIVYDYDLLSNRVRELAFLTKGVNITIEDKREGQERKNEYHYEGGIKSYVEYLNRSKEVVHEEPIYIEGE----------KDGITVEVALQYNDSYTSNIYSFTNNINTYEGGTHEAGFKTGLTRVINDYARRKGIFKENDPNLSGDDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARTITDTLFSSALETFLLENPDSARKIVEKGLMAARARMAAKKARELTRRKSALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMREIIENGYVYIAQPPLYKVQQGKRVEYAYNDKQLDELLKELPQSPKPGLQRYKGLGEMNATQLWETTMDPATRTLLQVNLEDAMDADETFEMLMGDKVEPRRNFIEANARYVKNLDI 638
>gi|16077074|ref|NP_387887.1| DNA gyrase subunit B [Bacillus subtilis subsp. subtilis str. 168] >gi|121887|sp|P05652|GYRB_BACSU DNA gyrase subunit B >gi|40018|emb|CAA26221.1| unnamed protein product [Bacillus subtilis] >gi|467396|dbj|BAA05242.1| B subunit of DNA gyrase [Bacillus subtilis] >gi|2632273|emb|CAB11782.1| DNA gyrase (subunit B) [Bacillus subtilis subsp. subtilis str. 168] (638 aa)
Score = 1764, Expect = 0.0e+00, Identities = 368/646 (56%), Positives = 469/646 (72%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E ++N+Y  + I++LEGLEAVRKRPGMYIGST+ KGLHH+VWEIVDNSIDEA+ G  ++I I + K+ S  V D+GRGIPV  H K  +  VE ++TVLHAGGKFD   YKVSGGLHGVGASVVNALS+ L V V+++ K H   +K G  PV DL++  E  +   GT   F PD EI  E  E+D D + +R+++LA+L KG+ I   D+R   + K  + + GGIK +VE LN  KE +    +Y E E          K  I VEVA QYN +Y ++ ++F NNINT EGG+HE GFK  L ++IN +A +K L+KE D  +S +D  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + S   E ++LENP+ A  I+ K L+A  AR  + +ARE TRRKS  E ++LPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+ ++ITA+G G+G +F ++K RY+K+++MTDADVDG+HIR LLLTF +RYM  ++ENG VYIA PPL+K   GK  +YAY++K LEE  K   +  K  +QRYKGLGEMN  QLWETTMDP +R LL+VT+EDA++AD+ F +LMGD+V PRR FIE NA+YVKNLDI
  S:     2 EQQQNSYDENQIQVLEGLEAVRKRPGMYIGSTNSKGLHHLVWEIVDNSIDEALAGYCTDINIQIEKDNSITVVDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFDGSGYKVSGGLHGVGASVVNALSTELDVTVHRDGKIHRQTYKRG-VPVTDLEIIGE--TDHTGTTTHFVPDPEIFSETTEYDYDLLANRVRELAFLTKGVNITIEDKREGQERKNEYHYEGGIKSYVEYLNRSKEVVHEEPIYIEGE----------KDGITVEVALQYNDSYTSNIYSFTNNINTYEGGTHEAGFKTGLTRVINDYARKKGLIKENDPNLSGDDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARTITDTLFSTAMETFMLENPDAAKKIVDKGLMAARARMAAKKARELTRRKSALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMRQIIENGYVYIAQPPLYKVQQGKRVEYAYNDKELEELLKTLPQTPKPGLQRYKGLGEMNATQLWETTMDPSSRTLLQVTLEDAMDADETFEMLMGDKVEPRRNFIEANARYVKNLDI 638
>gi|196249898|ref|ZP_03148594.1| DNA gyrase, B subunit [Geobacillus sp. G11MC16] >gi|196210774|gb|EDY05537.1| DNA gyrase, B subunit [Geobacillus sp. G11MC16] (640 aa)
Score = 1762, Expect = 0.0e+00, Identities = 366/643 (56%), Positives = 479/643 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD-KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  Y AS I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  +EI +T+ ++ S  + D+GRGIPV+ H  T +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V+VY++ K HY ++ + G+P  DL+V +E  + + GT   F PD EI  E  EFD +T+ +RL++LA+LN+G+KI   DER D+ K  + + GGI+ +V  LN  +E +         EE +  A  +D   I VE+A QYN  Y ++ ++F NNI+T EGG+HE GFK AL +IIN +A ++++ K+ D  ++ ED  EGLTAIVSIKHP PQ+EGQTK KLGNS+ R     V SE FE +LLE+P  A  I++K ++A  AR  + +ARE TRRKS  E ++LPGKLADCS++D  ISELY+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+  +ITA+G G+G +F I K RY+K+I+MTDADVDG+HIR LLLTF +RYM  L+E G +YIA PPL+K   GK  +YAY+++ LE+   E  ++ K  IQRYKGLGEMNP+QLWETTM+P+ R LL+V+++DA++AD+ F +LMGD+V PRR+FIE+NA+YVKNLDI
  S:     8 KQAYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVWEIVDNSIDEALAGYCTEIHVTIGEDNSITIADNGRGIPVDVHEATGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVYRDGKIHYQKY-ERGEPRTDLQVIDE--TDRTGTTTRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLTDERVDNRKNEYFYEGGIRSYVRHLNRTREVL--------HEEPIYIAGERD--GIAVEIALQYNDGYTSNIYSFVNNIHTHEGGTHESGFKMALTRIINDYARKQQIFKDNDANLTGEDVREGLTAIVSIKHPAPQFEGQTKTKLGNSDARTVTDAVFSEQFETFLLEHPAVARKIVEKGMMAARARVAAKKARELTRRKSALEISNLPGKLADCSSRDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRAIITALGTGIGEDFDISKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRELIERGYIYIAQPPLYKIEQGKQVRYAYNDRQLEKILAELPAQPKPMIQRYKGLGEMNPEQLWETTMNPETRTLLQVSLQDAIDADETFEILMGDKVEPRRQFIEENARYVKNLDI 640
>gi|160914817|ref|ZP_02077031.1| hypothetical protein EUBDOL_00824 [Eubacterium dolichum DSM 3991] >gi|158433357|gb|EDP11646.1| hypothetical protein EUBDOL_00824 [Eubacterium dolichum DSM 3991] (648 aa)
Score = 1760, Expect = 0.0e+00, Identities = 354/642 (55%), Positives = 471/642 (73%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAE-FDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++Y+A +I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I I + K+   +V+D+GRG+PV    KT  S VET+ TVLHAGGKF   +YKVSGGLHGVGASVVNALS WL+V V++  K+H++ F++GGKP   LKV  +  + K+G++V F  D  I    + +  DT+ +R++QLA+LNKGI++  IDER ++ +   + + GGI+Q+VE LN  K  +   ++Y E  E            I  EVA QYN  Y  + ++FCNNINT EGG+HE+GF+ AL ++IN +A E  L+K+ DE ++ +D  EGLTAI+S+KHP+PQYEGQTK KLGNSEVR  VS ++ +  E++L+ENP  A +I++K +LA +AR  + +ARE TRRKS  E  SLPGKLADCS+KD    E+YIVEGDSAGGSAK GR+  FQAILPL+GKI+NVEKA+  +IF N EI +++TA G G+G E  I KLRY+KI++MTDADVDG+HI  L+LTF +R++ P++E G VYIA PPLFK + G   +Y Y E+ +E  + E  +    +QRYKGLGEMNP+QLWETTMDP  R L +V IEDA+ AD +F +LMG+EV PRREFI++NAKY   LDI
  S:    19 HSYTADDIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGFATDIEIAIEKDNVIRVEDNGRGMPVGIVEKTGISGVETIFTVLHAGGKFGGGAYKVSGGLHGVGASVVNALSEWLEVTVHQNGKKHFLRFENGGKPSGALKVIGD--TDKHGSVVRFKADASIFTETQVYSFDTLNTRIRQLAFLNKGIRLVIIDEREEEAKRIEYKYDGGIRQYVEYLNKNKNVLHEDVIYVEGLEE----------GILAEVALQYNDGYMPNIYSFCNNINTMEGGTHEDGFRLALTRVINAYARENNLIKK-DETLAGDDVREGLTAIISVKHPDPQYEGQTKTKLGNSEVRKIVSGILGDQLERFLIENPTTAKIIVEKGVLASKARMAAKKARELTRRKSALEITSLPGKLADCSSKDASECEIYIVEGDSAGGSAKQGRNSKFQAILPLRGKILNVEKARLHRIFENNEIRSMVTAFGCGIGDEIDISKLRYHKIVIMTDADVDGAHICTLMLTFFYRFLRPVIEGGYVYIAMPPLFKVAKGNRVEYVYKEEEMERVRAEMGE-NVNVQRYKGLGEMNPEQLWETTMDPAFRTLKQVNIEDAVEADAIFEMLMGEEVEPRREFIQENAKYA-TLDI 648
>gi|138893684|ref|YP_001124137.1| DNA gyrase subunit B [Geobacillus thermodenitrificans NG80-2] >gi|134265197|gb|ABO65392.1| DNA gyrase subunit B [Geobacillus thermodenitrificans NG80-2] (640 aa)
Score = 1758, Expect = 0.0e+00, Identities = 365/643 (56%), Positives = 479/643 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD-KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +  Y AS I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  +EI +T+ ++ S  + D+GRGIPV+ H  T +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V+VY++ K HY ++ + G+P  DL+V +E  + + GT   F PD EI  E  EFD +T+ +RL++LA+LN+G+KI   DER D+ K  + + GGI+ +V  LN  +E +         EE +  A  +D   I VE+A QYN  Y ++ ++F NNI+T EGG+HE GFK AL +IIN +A ++++ K+ D  ++ ED  EGLTAIVSIKHP PQ+EGQTK KLGNS+ R     V SE FE +LLE+P  A  I++K ++A  AR  + +ARE TRRKS  E ++LPGKLADCS++D  ISELY+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+  +ITA+G G+G +F I K RY+K+I+MTDADVDG+HIR LLLTF +RYM  L+E G +YIA PPL+K   GK  +YAY+++ LE+   E  ++ K  IQRYKGLGEMNP+QLWETTM+P+ R LL+V+++DA++AD+ F +LMGD+V PRR+FIE+NA+YVKNLDI
  S:     8 EQAYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVWEIVDNSIDEALAGYCTEIHVTIGEDNSITIADNGRGIPVDVHEATGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVYVYRDGKIHYQKY-ERGEPRTDLQVIDE--TDRTGTTTRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLTDERVDNRKNEYFYEGGIRSYVRHLNRTREVL--------HEEPIYIAGERD--GIAVEIALQYNDGYTSNIYSFVNNIHTHEGGTHESGFKMALTRIINDYARKQQIFKDNDANLTGEDVREGLTAIVSIKHPAPQFEGQTKTKLGNSDARTVTDAVFSEQFETFLLEHPAVARKIVEKGMMAARARVAAKKARELTRRKSALEISNLPGKLADCSSRDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRAIITALGTGIGEDFDISKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRELIERGYIYIAQPPLYKIEQGKQVRYAYNDRQLEKILAELPAQPKPMIQRYKGLGEMNPEQLWETTMNPETRTLLQVSLQDAIDADETFEILMGDKVEPRRQFIEENARYVKNLDI 640
>gi|1170146|sp|P43053|GYRB_MYCHO DNA gyrase subunit B >gi|453419|emb|CAA54665.1| gyrB [Mycoplasma hominis] (648 aa)
Score = 1748, Expect = 0.0e+00, Identities = 354/649 (54%), Positives = 468/649 (72%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+K  + + Y+A NI+ILEGLEAVRKRPGMYIGS   KGLHH++WEIVDNS+DEAM G A+EI I L      +V+D+GRG+P   H+ TKKS VET+LTVLHAGGKFD  +YKVSGGLHGVGASVVNALSS  +VWV ++ K HY +F++GG PV  L+V    + ++ GT ++F+PD+ IME+  F  DTI    KQ+AYLNKG+KI   +   +  + F F GG+  +V+ELN  K+ IVP ++Y E   + K  N  +  ++ VEVA QYN+ Y NS  ++ NNI T +GG+HE+GF  AL +I N +A   KL K + EKI++ED  EGL AI+SIKH +P +EGQTK KL N + R   + ++S+  E+YL ENPE A  II+KCLL+   R    +AREA+R+ +  +  +LPGKLADCS+K+ EI EL+IVEG+SAGGSAK+GRDR  QAILPL+GK+IN EK     + SN+EI  +I A+G G+  EF I+KL+Y+KII+MTDADVDG+HI  LLLTF +RYM PL+E G VY+A PPL+K + GK+ +YAY++   E+   K   K    IQRYKGLGEM+P+QLWETTMDP+ R +L+V I+DA   D VF+ LMG+E+ PR +FI++NAKY  N+DI
  S:     1 MDKIEEIHKYNADNIQILEGLEAVRKRPGMYIGSIGFKGLHHLLWEIVDNSVDEAMAGFATEIKIKLYPNNVIEVEDNGRGMPTGIHSGTKKSAVETILTVLHAGGKFDGSNYKVSGGLHGVGASVVNALSSEFEVWVKRDGKLHYQQFRNGGIPVKPLEVIGNFSEVETGTTIKFHPDYTIMEKENFFFDTIIDHSKQIAYLNKGLKITVENVEKNIIKVFCFEGGLIDYVKELNKGKKLIVPEVIYAEGVFNDK--NFTNGQDVIVEVAMQYNEAYTNSIVSYANNIQTIDGGTHEQGFYDALVRIYNNYAETNKLFKTSSEKITREDVKEGLVAIISIKHTDPIFEGQTKGKLENKDARIATNKILSDSLERYLNENPEIARAIIEKCLLSQHTRLLEIKAREASRKGNGLDLGNLPGKLADCSSKNAEIRELFIVEGNSAGGSAKMGRDRSIQAILPLRGKVINAEKNSFASVLSNKEIATMIHALGTGINTEFDINKLKYHKIIIMTDADVDGAHITTLLLTFFYRYMKPLIEYGFVYLAQPPLYKITSGKNVEYAYNDLQKEQIMAKLEDKRNVAIQRYKGLGEMDPEQLWETTMDPETRKMLQVQIDDAAICDTVFATLMGEEIEPRHDFIQENAKYANNIDI 648
>gi|78707357|gb|ABB46484.1| DNA gyrase subunit B [Acholeplasma laidlawii] (631 aa)
Score = 1741, Expect = 0.0e+00, Identities = 356/639 (55%), Positives = 474/639 (74%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           Y+A NI+ILEGLEAV+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A EITI + K    +V D+GRGIPV+ H KTK+  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+   Y++ Y    + G P  DLKV  + ++ K+GTI+ F  D  I  E   ++ +T+++R++QLA+LNKG+K+N ID+R ++   E+F + GGI ++V+ LN  K  I   I+Y ++E+            I VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A + K+ K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++L+ENP  A  I++K LLA  AR  + +A++ TRRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I K RY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K S G++ +YAY+E+ L E  K   + K  IQRYKGLGEM+ +QLW+TTMDP  R LL++ +EDA+ AD+VFS+LMG+EV PR++FI+KNA+Y  ++D
  S:     5 YTADNIQILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALGGYADEITIEILKGEVIRVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEWFVVEIHKDGTIYEQKY----ERGIPAYDLKV--KGSTDKSGTIISFQADPLIFTETVIYNYETLRTRIQQLAFLNKGLKLNLIDDRFEENKSESFHYEGGITEYVKFLNQSKSKIHNDIIYIDKEQD----------GITVELAMQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKMKK--DDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEAIERFLMENPAQAKAIVEKVLLATRARVAARKAKDLTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKISWGRNFQYAYNEQELNELLK-TIETKPSIQRYKGLGEMDAEQLWDTTMDPAKRTLLQIKLEDAIEADQVFSMLMGEEVEPRKDFIQKNAQYATDID 630
>gi|78707359|gb|ABB46485.1| DNA gyrase subunit B [Acholeplasma laidlawii] >gi|78707361|gb|ABB46486.1| DNA gyrase subunit B [Acholeplasma laidlawii] >gi|78707363|gb|ABB46487.1| DNA gyrase subunit B [Acholeplasma laidlawii] (631 aa)
Score = 1739, Expect = 0.0e+00, Identities = 356/639 (55%), Positives = 473/639 (74%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           Y+A NI+ILEGLEAV+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A EITI + K    +V D+GRGIPV+ H KTK+  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+   Y++ Y    + G P  DLKV  + ++ K+GTI+ F  D  I  E   ++ +T+++R++QLA+LNKG+K+N ID+R ++   E+F + GGI ++V+ LN  K  I   I+Y ++E+            I VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A + K+ K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++L+ENP  A  I++K LLA  AR  + +A++ TRRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I K RY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K S G++ +YAY+E+ L E  K   + K  IQRYKGLGEM+ +QLW+TTMDP  R LL++ +EDA+ AD+VFS+LMG+EV PR+EFI+ NA+Y  ++D
  S:     5 YTADNIQILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALGGYADEITIEILKGEVIRVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEWFVVEIHKDGTIYEQKY----ERGIPAYDLKV--KGSTDKSGTIISFQADPLIFTETVIYNYETLRTRIQQLAFLNKGLKLNLIDDRFEENKSESFHYEGGITEYVKFLNQSKSKIHNDIIYIDKEQD----------GITVELAMQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKMKK--DDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEAIERFLMENPAQAKAIVEKVLLATRARVAARKAKDLTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKISWGRNFQYAYNEQELNELLK-TIETKPSIQRYKGLGEMDAEQLWDTTMDPAKRTLLQIKLEDAIEADQVFSMLMGEEVEPRKEFIQNNAQYATDID 630
>gi|162446893|ref|YP_001620025.1| DNA gyrase, subunit B [Acholeplasma laidlawii PG-8A] >gi|161985000|gb|ABX80649.1| DNA gyrase, subunit B [Acholeplasma laidlawii PG-8A] (635 aa)
Score = 1738, Expect = 0.0e+00, Identities = 356/639 (55%), Positives = 473/639 (74%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           Y+A NI+ILEGLEAV+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A EITI + K    +V D+GRGIPV+ H KTK+  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+   Y++ Y    + G P  DLKV  + ++ K+GTI+ F  D  I  E   ++ +T+++R++QLA+LNKG+K+N ID+R ++   E+F + GGI ++V+ LN  K  I   I+Y ++E+            I VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A + K+ K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++L+ENP  A  I++K LLA  AR  + +A++ TRRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I K RY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K S G++ +YAY+E+ L E  K   + K  IQRYKGLGEM+ +QLW+TTMDP  R LL++ +EDA+ AD+VFS+LMG+EV PR+EFI+ NA+Y  ++D
  S:     9 YTADNIQILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALGGYADEITIEILKGEVIRVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEWFVVEIHKDGTIYEQKY----ERGIPAYDLKV--KGSTDKSGTIISFQADPLIFTETVIYNYETLRTRIQQLAFLNKGLKLNLIDDRFEENKSESFHYEGGITEYVKFLNQSKSKIHNDIIYIDKEQD----------GITVELAMQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKMKK--DDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEAIERFLMENPAQAKAIVEKVLLATRARVAARKAKDLTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKISWGRNFQYAYNEQELNELLK-TIETKPSIQRYKGLGEMDAEQLWDTTMDPAKRTLLQIKLEDAIEADQVFSMLMGEEVEPRKEFIQNNAQYATDID 634
>gi|193216997|ref|YP_002000239.1| DNA gyrase subunit B [Mycoplasma arthritidis 158L3-1] >gi|193002320|gb|ACF07535.1| DNA gyrase subunit B [Mycoplasma arthritidis 158L3-1] (647 aa)
Score = 1738, Expect = 0.0e+00, Identities = 350/648 (54%), Positives = 464/648 (71%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF--KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M+K+ + + Y A NI++LEGLEAVRKRPGMYIGS   +GLHH++WEIVDNS+DEAM G A+ I + L      +V D+GRG+PV+ H  TKKS VET+LTVLHAGGKFD+ +YKVSGGLHGVGASVVNALS   +VWV +  K +Y ++ +GG PV  L+V  E    + GT ++F+PD++IM++  FD  TI    KQ+AYLNKG+ I+  D   +    F F GGI  +V ELN  K+ I+P I+Y E     K  N +D   + V VA QYN+TY ++  ++ NNI T EGG+HE+GF  AL +I NK+A + KL K  +EKIS+ED  +GL AI+SIKH +P +EGQTK KL N + R   + ++SE  E+Y+ ENP  A  II+KCLL   +R  +  AREA+R+K   E  +LPGKLADCS+K+ E+ EL+IVEG+SAGGSAK+GRDR  QAILPL+GKIIN EK     + SN+E+ ++I A+G G+  EF I+KL+Y+KI++MTDADVDG+HI  LLLTF +RYM PL+E G VYIA PPL+K S  K ++YAY++   EE   K E+SK    IQRYKGLGEM+P+QLWETTM+P  R +L+V I+D  + D +FS LMG+E+ PR +FI++NAKY  N+D
  S:     1 MSKQEEISKYGAKNIQVLEGLEAVRKRPGMYIGSIGFRGLHHLIWEIVDNSVDEAMAGFATNIEVKLHPNNEIEVIDNGRGMPVDIHPTTKKSAVETILTVLHAGGKFDSTNYKVSGGLHGVGASVVNALSDSFEVWVKRGGKLYYQKYINGGHPVKPLEVIGEVNKDETGTRIKFHPDYQIMDKVAFDFGTIIDHAKQIAYLNKGLSISCEDITKNTIRNFCFEGGIIDYVSELNRGKKVIIPDIIYAEGTFRDKTPNAQD---VIVNVAIQYNETYTSNIVSYANNIQTGEGGTHEQGFYDALTRIYNKYAEDNKLFKNNNEKISREDTKDGLVAIISIKHTDPIFEGQTKGKLENKDARIATNKIISEQLERYMAENPSHAKAIIEKCLLTQRSRLAANAAREASRKKEGSEFGNLPGKLADCSSKNAEVRELFIVEGNSAGGSAKMGRDRATQAILPLRGKIINAEKQDFTSVMSNKEVSSMIHALGTGITDEFNINKLKYHKIVIMTDADVDGAHIATLLLTFFYRYMRPLIEYGFVYIAQPPLYKISTAKVTEYAYNDAQKEEILSKLEDSK-NISIQRYKGLGEMDPEQLWETTMNPATRKMLQVQIDDIASCDTIFSTLMGEEIEPRHDFIQENAKYATNID 646
>gi|147921290|ref|YP_684896.1| type II DNA topoisomerase II (gyrase), subunit B [uncultured methanogenic archaeon RC-I] >gi|110620292|emb|CAJ35570.1| type II DNA topoisomerase II (gyrase), subunit B [uncultured methanogenic archaeon RC-I] (635 aa)
Score = 1737, Expect = 0.0e+00, Identities = 355/649 (54%), Positives = 454/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+ E    TY AS+I++LEGLEAVRKRP MYIGSTD +GLHH+V+E+VDNSIDEA+ G  + I +T+   GS  V D+GRGIPVE H K KK  +E V+T+LHAGGKFDN +YKVSGGLHGVG SVVNALS +L+V V +  K  +  ++ G KPV ++K+  E  + + GT   F PD  I E  EF  D + +RL++LAYLNKGI+I   D        + + GGI Q++E LN +K  + P  +Y ERE          K   +VE++ QYN  Y+     F NNINT EGG+H  GF+ AL + +N +A +  +LK  D  +S ED  EGLTAI+S+K  NPQ+EGQTK KLGNS+V+  V ++V +    YL ENP DA  II+K + A +AR+ + +ARE TRRKS  E ++LPGKLADCS KD    ELYIVEGDSAGGSAK GR+R+FQAILPL+GKI+NVEKA+ +KI  + EI  LITA+G GVG +F +DK RY+KIILMTDADVDG+HIR LLLTF +RYM  ++E G VYIA PPL++   GK  KY Y ++ L E  +   +    IQRYKGLGEMNP+QLW TTMDP  R + +V +ED + AD+ F+LLMGD+V PRREFI KNAK+VKNLD+
  S:     1 MSNEVPAQTYDASSIQVLEGLEAVRKRPSMYIGSTDYRGLHHLVYEVVDNSIDEALAGYCNAIDVTINPNGSVTVTDNGRGIPVEMHEKYKKPALEIVMTILHAGGKFDNRTYKVSGGLHGVGVSVVNALSEYLEVEVKRNGKVFFQRYEKG-KPVCEVKIIGE--TDQTGTKTTFKPDKSIFETVEFQFDILANRLRELAYLNKGIRITLSDLGAQKSAEYHYEGGINQFIEYLNQDKTVLHPKPIYFERE----------KDTTKVEISMQYNDGYSEVILAFANNINTHEGGTHLSGFRAALTRTVNDYARKNNMLK-GDMVLSGEDIREGLTAIISVKLTNPQFEGQTKTKLGNSDVKGIVESLVGDGLNDYLEENPADARKIIEKTVQAFQAREAARKARELTRRKSALEGSTLPGKLADCSEKDASKCELYIVEGDSAGGSAKQGRNRLFQAILPLRGKILNVEKARLNKILESAEIRALITALGTGVGEDFVLDKARYHKIILMTDADVDGAHIRTLLLTFFYRYMQQIVEAGFVYIAQPPLYRIKKGKEEKYVYSDRELNEALEAMGRTNVSIQRYKGLGEMNPEQLWSTTMDPATRTMYQVKLEDVIEADRTFTLLMGDKVEPRREFIVKNAKFVKNLDV 635
>gi|15612569|ref|NP_240872.1| DNA gyrase subunit B [Bacillus halodurans C-125] >gi|4033396|sp|O50627|GYRB_BACHD DNA gyrase subunit B >gi|2760177|dbj|BAA24187.1| B subunit of DNA gyrase [Bacillus sp.] >gi|5672652|dbj|BAA82690.1| 78%-identity [Bacillus halodurans] >gi|10172618|dbj|BAB03725.1| DNA gyrase subunit B [Bacillus halodurans C-125] (637 aa)
Score = 1737, Expect = 0.0e+00, Identities = 360/644 (55%), Positives = 469/644 (72%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK-ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++  Y  S I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEAM G   EI + + ++ S  V D+GRGIPV  H K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V V++E K HY +F  G  P ADL+V     + + GT + F PD +I  E   F+ DT+ SRL++LA+LNKG++I   D R ++K + F + GGI  +VE LN  +E +  T ++ E E          K  + VE+A QYN  + ++ ++F NNINT EGG+HE GFK  L ++IN +A +  L KE+D  ++ ED  EGLTAI+S+K P+PQ+EGQTK KLGNSE R    ++ +E F ++L+E+P+ A  ++ K L+A  AR+ + +ARE TRRKS  E +SLPGKLADCS++D  ISE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI +N EI  +ITA+G G+G +F I+K RY+KII+MTDADVDG+HIR L+LTF +RYM PL+E+G VYIA PPL+K   GK  +YAY +  L+E   +   K K  IQRYKGLGEMNP QLWETTMDP  R +L+VT+EDA+ AD++F +LMGD V PRR+FI++NA+YVKNLDI
  S:     4 EQQAYDESQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVWEIVDNSIDEAMAGFCDEIGVVIEEDNSITVTDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTMLEVEVHREGKVHYQKFHRG-VPAADLEVIG--TTDRTGTKIHFKPDGDIFTETTVFEYDTLASRLRELAFLNKGLRIKITDMREEEKSDEFHYEGGIASFVEHLNRTRETLHETPIHIEGE----------KQGVYVEIAVQYNDGFTSNIYSFANNINTHEGGTHESGFKTGLTRVINDYARKHNLFKESDPNLTGEDVREGLTAIISVKIPDPQFEGQTKTKLGNSEARTITDSLFTEHFSRFLIEHPQVARKLVDKGLMASRAREAAKKARELTRRKSALEVSSLPGKLADCSSRDASISEIYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILANNEIRAIITALGTGIGDDFDIEKARYHKIIIMTDADVDGAHIRTLILTFFYRYMRPLIEHGYVYIAQPPLYKVQQGKDIQYAYGDAELQEILSQLPDKAKPGIQRYKGLGEMNPSQLWETTMDPGQRTVLQVTLEDAMKADEIFEILMGDRVEPRRDFIQENARYVKNLDI 637
>gi|118475783|ref|YP_892934.1| DNA gyrase subunit B [Bacillus thuringiensis str. Al Hakam] >gi|118415008|gb|ABK83427.1| DNA gyrase subunit B [Bacillus thuringiensis str. Al Hakam] (645 aa)
Score = 1737, Expect = 0.0e+00, Identities = 378/647 (58%), Positives = 482/647 (74%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     9 KQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 645
>gi|152973859|ref|YP_001373376.1| DNA gyrase subunit B [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152022611|gb|ABS20381.1| DNA gyrase, B subunit [Bacillus cereus subsp. cytotoxis NVH 391-98] (640 aa)
Score = 1736, Expect = 0.0e+00, Identities = 380/647 (58%), Positives = 477/647 (73%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD-DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KE + N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI + + ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  E  + + GT+  F PD EI  E   +D D + +R+++LA+LN+ IK+   D+R +  K+ F + GGIK +VE LN  K+PI         EE V     KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G VYIA PPLFK   GK  +YAY+EK LE    E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     4 KEMQANSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVVIEEDDSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGE--TDRTGTVTRFKPDPEIFKETTVYDFDILATRMRELAFLNRNIKLTIEDKRENKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGAKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPSISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDISKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYVYIAQPPLFKVQQGKKIQYAYNEKELERILAELPAQPKPSIQRYKGLGEMNPAQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
>gi|52145204|ref|YP_081624.1| DNA gyrase subunit B [Bacillus cereus E33L] >gi|51978673|gb|AAU20223.1| DNA topoisomerase II, ATP-hydrolyzing (DNA gyrase, subunit B) [Bacillus cereus E33L] (640 aa)
Score = 1736, Expect = 0.0e+00, Identities = 381/647 (58%), Positives = 479/647 (74%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     4 KQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
>gi|42779086|ref|NP_976333.1| DNA gyrase subunit B [Bacillus cereus ATCC 10987] >gi|42735001|gb|AAS38941.1| DNA gyrase, B subunit [Bacillus cereus ATCC 10987] (640 aa)
Score = 1735, Expect = 0.0e+00, Identities = 378/647 (58%), Positives = 482/647 (74%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     4 KQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKIQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
>gi|30260200|ref|NP_842577.1| DNA gyrase subunit B [Bacillus anthracis str. Ames] >gi|47525259|ref|YP_016608.1| DNA gyrase subunit B [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183044|ref|YP_026296.1| DNA gyrase subunit B [Bacillus anthracis str. Sterne] >gi|49476686|ref|YP_034365.1| DNA gyrase subunit B [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65317473|ref|ZP_00390432.1| COG0187: Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [Bacillus anthracis str. A2012] >gi|165873014|ref|ZP_02217635.1| DNA gyrase, B subunit [Bacillus anthracis str. A0488] >gi|166982553|ref|ZP_02253985.1| DNA gyrase subunit B [Bacillus cereus AH187] >gi|166997066|ref|ZP_02263525.1| DNA gyrase subunit B [Bacillus cereus AH820] >gi|167635023|ref|ZP_02393340.1| DNA gyrase, B subunit [Bacillus anthracis str. A0442] >gi|167641730|ref|ZP_02399973.1| DNA gyrase, B subunit [Bacillus anthracis str. A0193] >gi|168160930|ref|ZP_02596163.1| DNA gyrase subunit B [Bacillus cereus H3081.97] >gi|170689461|ref|ZP_02880651.1| DNA gyrase, B subunit [Bacillus anthracis str. A0465] >gi|170707498|ref|ZP_02897951.1| DNA gyrase, B subunit [Bacillus anthracis str. A0389] >gi|177655278|ref|ZP_02936832.1| DNA gyrase, B subunit [Bacillus anthracis str. A0174] >gi|190569295|ref|ZP_03022189.1| DNA gyrase, B subunit [Bacillus anthracis Tsiankovskii-I] >gi|196036134|ref|ZP_03103534.1| DNA gyrase, B subunit [Bacillus cereus W] >gi|196041949|ref|ZP_03109236.1| DNA gyrase, B subunit [Bacillus cereus NVH0597-99] >gi|196045551|ref|ZP_03112782.1| DNA gyrase, B subunit [Bacillus cereus 03BB108] >gi|49066055|sp|Q9X3Y6|GYRB_BACAN DNA gyrase subunit B >gi|30253521|gb|AAP24063.1| DNA gyrase, B subunit [Bacillus anthracis str. Ames] >gi|47500407|gb|AAT29083.1| DNA gyrase, B subunit [Bacillus anthracis str. 'Ames Ancestor'] >gi|49176971|gb|AAT52347.1| DNA gyrase, B subunit [Bacillus anthracis str. Sterne] >gi|49328242|gb|AAT58888.1| DNA topoisomerase II, ATP-hydrolyzing (DNA gyrase, subunit B) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51988026|dbj|BAD44714.1| gyraseB [Bacillus anthracis] >gi|164711226|gb|EDR16782.1| DNA gyrase, B subunit [Bacillus anthracis str. A0488] >gi|167510284|gb|EDR85687.1| DNA gyrase, B subunit [Bacillus anthracis str. A0193] >gi|167529497|gb|EDR92247.1| DNA gyrase, B subunit [Bacillus anthracis str. A0442] >gi|170127494|gb|EDS96368.1| DNA gyrase, B subunit [Bacillus anthracis str. A0389] >gi|170666563|gb|EDT17336.1| DNA gyrase, B subunit [Bacillus anthracis str. A0465] >gi|172080205|gb|EDT65297.1| DNA gyrase, B subunit [Bacillus anthracis str. A0174] >gi|190559602|gb|EDV13593.1| DNA gyrase, B subunit [Bacillus anthracis Tsiankovskii-I] >gi|195991301|gb|EDX55269.1| DNA gyrase, B subunit [Bacillus cereus W] >gi|196023758|gb|EDX62434.1| DNA gyrase, B subunit [Bacillus cereus 03BB108] >gi|196027204|gb|EDX65824.1| DNA gyrase, B subunit [Bacillus cereus NVH0597-99] (640 aa)
Score = 1734, Expect = 0.0e+00, Identities = 378/647 (58%), Positives = 482/647 (74%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     4 KQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
>gi|163938018|ref|YP_001642902.1| DNA gyrase subunit B [Bacillus weihenstephanensis KBAB4] >gi|163860215|gb|ABY41274.1| DNA gyrase, B subunit [Bacillus weihenstephanensis KBAB4] (640 aa)
Score = 1734, Expect = 0.0e+00, Identities = 380/647 (58%), Positives = 476/647 (73%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V DDGRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G P ADLKV  E  + + GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY+ K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     4 KQMQENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIVVTDDGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGVPAADLKVIGE--TDRTGTITRFKPDSEIFTETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFAIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNNKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
>gi|30018283|ref|NP_829914.1| DNA gyrase subunit B [Bacillus cereus ATCC 14579] >gi|29893823|gb|AAP07115.1| DNA gyrase subunit B [Bacillus cereus ATCC 14579] (642 aa)
Score = 1734, Expect = 0.0e+00, Identities = 378/647 (58%), Positives = 480/647 (74%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     6 KQMQENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 642
>gi|167937953|ref|ZP_02525028.1| DNA gyrase subunit B [Bacillus cereus AH1134] >gi|168137568|ref|ZP_02580797.1| DNA gyrase subunit B [Bacillus cereus B4264] >gi|51988024|dbj|BAD44713.1| gyraseB [Bacillus cereus ATCC 14579] (640 aa)
Score = 1734, Expect = 0.0e+00, Identities = 378/647 (58%), Positives = 480/647 (74%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     4 KQMQENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
>gi|78707355|gb|ABB46483.1| DNA gyrase subunit B [Acholeplasma laidlawii] (631 aa)
Score = 1733, Expect = 0.0e+00, Identities = 355/639 (55%), Positives = 470/639 (73%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           Y+A NI+ILEGLEAV+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A EITI + K    +V D+GRGIPV+ H KTK+  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+   Y++ Y    + G P  DLK+     + K GTI+ F  D  I  E   ++ +T+++R++QLA+LNKG+K+N ID+R ++   E+F + GGI ++V+ LN  K  I   I+Y ++E+            I VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A + K+ K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++L+ENP  A  I++K LLA  AR  + +A++ TRRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I K RY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K S G++ +YAY+E+ L E  K   + K  IQRYKGLGEM+ +QLW+TTMDP  R LL++ +EDA+ AD+VFS+LMG+EV PR+EFI+ NA+Y  ++D
  S:     5 YTADNIQILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALGGYADEITIEILKGEVIRVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEWFVVEIHKDGTIYEQKY----ERGIPAYDLKIKGN--TDKTGTIISFQADPLIFTETVIYNYETLRTRIQQLAFLNKGLKLNLIDDRFEESKIESFHYEGGITEYVKFLNQSKSKIHNDIIYIDKEQD----------GITVELAMQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKMKK--DDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEAIERFLMENPTQAKAIVEKVLLATRARVAARKAKDLTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKISWGRNFQYAYNEQELNEILK-TIETKPSIQRYKGLGEMDAEQLWDTTMDPAKRTLLQIKLEDAIEADQVFSMLMGEEVEPRKEFIQNNAQYATDID 630
>gi|75761791|ref|ZP_00741726.1| DNA gyrase subunit B [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74490724|gb|EAO54005.1| DNA gyrase subunit B [Bacillus thuringiensis serovar israelensis ATCC 35646] (645 aa)
Score = 1732, Expect = 0.0e+00, Identities = 379/647 (58%), Positives = 478/647 (73%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     9 KQMQENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 645
>gi|168143804|ref|ZP_02587033.1| DNA gyrase subunit B [Bacillus cereus G9842] (640 aa)
Score = 1731, Expect = 0.0e+00, Identities = 379/647 (58%), Positives = 478/647 (73%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ ++N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLDI
  S:     4 KQMQENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
>gi|23097461|ref|NP_690927.1| DNA gyrase subunit B [Oceanobacillus iheyensis HTE831] >gi|22775684|dbj|BAC11962.1| DNA gyrase subunit B [Oceanobacillus iheyensis HTE831] (641 aa)
Score = 1728, Expect = 0.0e+00, Identities = 366/648 (56%), Positives = 474/648 (73%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE-TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +K T+   Y A  I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G    I + + ++ S  V+D+GRGIPV+   KT +  +E ++TVLHAGGKF    YKVSGGLHGVGASVVNALSS L+V+V+++ K H++ FK G  P  ++KV  +  +   GT+  F PD EI  E  E++ DT++ RL++LA+LNKG+KI+  D+RTD ++ T+ + GGI  +VE +N  KE ++    + E E+            I VEVA QYN  + ++ ++F NNI+T EGGSHE GF+  L +IIN +A +  L+K+ D  +S +D  EG+T IVSIKHP+PQ+EGQTK KLGNSEVR     V SE F K+L ENP  A +I++K L+A  AR  + +ARE TRRKS  E ++LPGKLADCS++D  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ D+I SN E+  +ITA+G+GVG EF I K RY+KI++MTDADVDG+HIR LLLTF +RYM PL+E G +YIA PPL++   GK+  YAY++K L+    E  K  K  IQRYKGLGEMN DQLW+TTMDP  R LL+V + DA++AD+VF +LMGD+V PRR FIE+NA+YVKNLDI
  S:     5 DKITENQEYGADQIQVLEGLEAVRKRPGMYIGSTSEKGLHHLVWEIVDNSIDEALAGYCDHIQVVVEEDNSITVKDNGRGIPVDIQQKTGRPALEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSELEVYVHRDGKVHFLSFKKG-VPDGEIKVIGD--TDITGTVTHFRPDTEIFTETTEYNFDTLEQRLRELAFLNKGLKISIEDKRTDREQVTYHYEGGISSYVEFINKNKE-VLHEPFFAEGEDQ----------GISVEVAIQYNDGFASNLYSFANNIHTYEGGSHEVGFRSGLTRIINDYAKKNGLIKDGDSNLSGDDVREGMTTIVSIKHPDPQFEGQTKTKLGNSEVRAITDGVFSEAFSKFLYENPSTAKIIVEKGLMASRARLAAKKARELTRRKSNLEISNLPGKLADCSSRDAAISELYIVEGDSAGGSAKSGRDRHFQAILPLRGKILNVEKARLDRILSNNEVRAMITALGSGVGEEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRYMRPLIEQGYIYIAQPPLYQVKQGKTVNYAYNDKELDRILNEIPKAPKPNIQRYKGLGEMNADQLWDTTMDPDTRTLLQVELSDAIDADQVFDMLMGDKVEPRRIFIEENAQYVKNLDI 641
>gi|145578005|gb|ABP82721.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar bolivia] (632 aa)
Score = 1726, Expect = 0.0e+00, Identities = 378/642 (58%), Positives = 476/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPIY--------EEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKIQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577997|gb|ABP82717.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar pulsiensis] (632 aa)
Score = 1726, Expect = 0.0e+00, Identities = 376/642 (58%), Positives = 479/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E +++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELSAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|167036441|ref|YP_001664019.1| DNA gyrase subunit B [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855275|gb|ABY93683.1| DNA topoisomerase IV, B subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] (633 aa)
Score = 1726, Expect = 0.0e+00, Identities = 365/644 (56%), Positives = 463/644 (71%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  TY+AS I+ILEGLEAVRKRPGMYIGST  +GLHH+V+E+VDNSIDEA+ G    I +T+ K+ S  V+DDGRGIP + H K +K  VE  LT+LHAGGKF+ND+YKVSGGLHGVG SVVNALS  L+V + K++ + Y +  + G P  DL+V  E       T + F PD EI E   FD D +  RL++LA+LNKGI I  IDER   +E F + GGI  +V+ LN  KE +    +Y E + S          +  VEV  QYN +Y  + F+F NNI+T EGG+H  GFK AL K+IN +A +  ++K+ ++ +  ED  EGLTAIVS+K  NPQ+EGQTK KLGNSE+R  V NVV+E    +L ENP  A VI++K   A  AR+ + +ARE TRRKS  E+ +LPGKLADCS KD    EL++VEGDSAGGSAK GR+  FQAILPL+GKI+NVEKA+ DKI SNEEI  +ITA+G G+G EF I KLRY+K+++MTDADVDGSHIR LLLTF +R+M PL+ENGNVYIA PPL+K + GK   YAY ++ L+    E  +  Y +QRYKGLGEMN DQLW+TTMDP+ R +LKVT+EDA+ AD++F++LMGD+V PRREFIEK+AK V+NLDI
  S:     3 KDETYTASQIQILEGLEAVRKRPGMYIGSTGSRGLHHLVYEVVDNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDIHPKVRKPAVEVALTMLHAGGKFNNDAYKVSGGLHGVGVSVVNALSEKLEV-IVKQHGKIYRQRYERGVPKTDLEVIGETEETG--TTITFKPDKEIFEETVFDYDVLAQRLRELAFLNKGINIKLIDERDGKEEVFNYEGGIISFVKYLNRNKEVLHEEPIYMEAKNS----------DYEVEVCMQYNDSYTENIFSFANNIDTREGGTHLVGFKAALTKVINDYARKYGIIKDNEKNLQGEDVREGLTAIVSVKLKNPQFEGQTKTKLGNSEMRSIVENVVTEKLSAFLEENPSVAKVIVEKATQAARAREAARKARELTRRKSALENTTLPGKLADCSEKDPSKCELFLVEGDSAGGSAKSGRNSRFQAILPLRGKILNVEKARLDKILSNEEIRAMITALGTGIGDEFDISKLRYHKVVIMTDADVDGSHIRTLLLTFFYRFMRPLIENGNVYIAQPPLYKITKGKKVYYAYSDRELDRILNEIGRENYTVQRYKGLGEMNADQLWDTTMDPEKRTMLKVTLEDAIAADEIFTILMGDKVEPRREFIEKHAKTVRNLDI 633
>gi|145577961|gb|ABP82699.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar finitimus] >gi|145578027|gb|ABP82732.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar poloniensis] (632 aa)
Score = 1725, Expect = 0.0e+00, Identities = 376/642 (58%), Positives = 478/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKIQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577999|gb|ABP82718.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar roskildiensis] (632 aa)
Score = 1725, Expect = 0.0e+00, Identities = 378/642 (58%), Positives = 475/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIP+    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPIGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNERYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577989|gb|ABP82713.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus weihenstephanensis] >gi|145578003|gb|ABP82720.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar vazensis] >gi|145578011|gb|ABP82724.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus weihenstephanensis] (632 aa)
Score = 1725, Expect = 0.0e+00, Identities = 378/642 (58%), Positives = 472/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V DDGRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G P ADLKV  E  + + GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY+ K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIVVTDDGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGVPAADLKVIGE--TDRTGTITRFKPDSEIFTETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFAIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNNKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145578025|gb|ABP82731.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus weihenstephanensis] (632 aa)
Score = 1725, Expect = 0.0e+00, Identities = 378/642 (58%), Positives = 472/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V DDGRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G P ADLKV  E  + + GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY+ K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIVVTDDGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPAADLKVIGE--TDRTGTITRFKPDAEIFTETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNNKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|20090442|ref|NP_616517.1| DNA topoisomerase (ATP-hydrolyzing), subunit B [Methanosarcina acetivorans C2A] >gi|19915457|gb|AAM04997.1| DNA topoisomerase (ATP-hydrolyzing), subunit B [Methanosarcina acetivorans C2A] (634 aa)
Score = 1725, Expect = 0.0e+00, Identities = 350/645 (54%), Positives = 468/645 (72%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K  Y AS I++LEGLEAVRKRP MYIGSTD +GLHH+V+E+VDNSIDEA+ G  + + +T+  +GS  V D+GRGIP++ H   KKS +E V+TVLHAGGKFD ++YKVSGGLHGVG SVVNALS WL V V ++ K+++  +  G KP A+++ T    S   GT   F PD  I E  +F  D + +RL++LA+LN+G+ IN  D R+ +   ETF+++GGI ++VE LN +K+P+    +Y ER+            ++ VE+A QY  +Y  + ++F NNINT EGG+H  GFK AL ++ N +    KL KE D K++ +D  EGLTAI+S+K   PQ+EGQTK +LGNSEV+  V ++V++   +Y  ENP+ ANVI++K LLA +AR+ + +ARE TRRKS  E ++LPGKLADCS KD  + E+YIVEG+SAGGSAK GRDR FQAILPL+GKI+NVEK++  KI  N E+++LITA+G GV  +F ++  RY+K+ILMTDADVDG+HIR LLLT  FRYM PL++ G VYIA PPL++   GKS  Y + ++ LE  KKE  +    IQRYKGLGEMNP+QLWETTM+P++R LL+VT+EDAL AD++F +LMGDEV PRR FIE +AK V +LDI
  S:     2 SDKQVYDASRIQVLEGLEAVRKRPSMYIGSTDSRGLHHLVYEVVDNSIDEALAGFCTRVDVTINPDGSVTVLDNGRGIPIDPHPVHKKSALEVVMTVLHAGGKFDKNTYKVSGGLHGVGVSVVNALSEWLNVEVERDGKKYFQRYIRG-KPEAEVQETG--TSEITGTKTTFKPDARIFETTDFQYDILSNRLRELAFLNRGLTINLKDLRSPEGQAETFIYSGGIVEFVEYLNKKKQPLHEKPIYFERQRD----------DMVVEIAMQYTNSYTENVYSFANNINTHEGGTHIIGFKTALTRVANDYIKANKLSKE-DAKLTGDDVREGLTAIISVKLMEPQFEGQTKTRLGNSEVKGIVDSLVTDGLAEYFEENPKVANVILEKALLAQKAREAAKKARELTRRKSALEVSTLPGKLADCSEKDPSVCEIYIVEGNSAGGSAKQGRDRGFQAILPLRGKILNVEKSRLAKILKNNEVVSLITALGTGVSEDFALESARYHKVILMTDADVDGAHIRTLLLTLFFRYMRPLIDAGYVYIAQPPLYRIKKGKSEYYIHSDRELEVKKKELGEKGLAIQRYKGLGEMNPEQLWETTMNPESRTLLQVTLEDALRADEIFRVLMGDEVEPRRNFIETHAKEVVDLDI 634
>gi|145577977|gb|ABP82707.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar higo] >gi|145577979|gb|ABP82708.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar kenyae] >gi|145578009|gb|ABP82723.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar azorensis] >gi|145578021|gb|ABP82729.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar zhaodongensis] (632 aa)
Score = 1724, Expect = 0.0e+00, Identities = 376/642 (58%), Positives = 476/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577967|gb|ABP82702.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus cereus] (632 aa)
Score = 1724, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 476/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DK+ SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGTQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKVLSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|20806552|ref|NP_621723.1| DNA gyrase subunit B [Thermoanaerobacter tengcongensis MB4] >gi|20514990|gb|AAM23327.1| DNA gyrase (topoisomerase II) B subunit [Thermoanaerobacter tengcongensis MB4] (654 aa)
Score = 1723, Expect = 0.0e+00, Identities = 365/644 (56%), Positives = 464/644 (72%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  TY+AS I+ILEGLEAVRKRPGMYIGST  +GLHH+V+E+VDNSIDEA+ G    I +T+ K+ S  V+DDGRGIP + H K  K  VE  LT+LHAGGKF+ND+YKVSGGLHGVG SVVNALS  L+V + K+  + + +  + G P   L+V  E    + GTI+ F PD EI E   FD D +  RL++LA+LNKGI I  IDER   +E F + GG+  +V+ LN  KE +    +Y E       A N D     VEV  QYN +YN + ++F NNI+T EGG+H  GFK AL K+IN +A +  ++K+ ++ +  ED  EGLTAIVS+K  NPQ+EGQTK +LGN E+R  V  VV+E    YL ENP  A +I++K L A  AR+ + +ARE TRRKS  E+ +LPGKLADCS KD    EL+IVEGDSAGGSAK GR+  FQAILPL+GKI+NVEKA+ DKIFSNEEI ++ITA+G G+G +F I KLRY+K+I+MTDADVDGSHIR LLLTF FR+M PL+ENG++YIA PPL+K + GK   YAY ++ L++   E  +    +QRYKGLGEMN DQLWETTMDP+ R +LKVT+EDA+ AD++F++LMGD+V PRREFIEK AK V+NLDI
  S:    24 KDETYTASQIQILEGLEAVRKRPGMYIGSTGSRGLHHLVYEVVDNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDIHPKVGKPAVEVALTMLHAGGKFNNDAYKVSGGLHGVGVSVVNALSERLEV-IVKQRGKVFRQVYERGVPKTPLEVIGETE--ETGTIITFKPDKEIFEEIVFDYDILAQRLRELAFLNKGINIKLIDERDGKEEVFNYEGGLIAFVKYLNRNKEVLHEEPIYME-------AKNTD---YEVEVCMQYNDSYNENIYSFANNIDTKEGGTHLIGFKSALTKVINDYAKKYGMIKDGEKNLQGEDVREGLTAIVSVKLKNPQFEGQTKTRLGNPEMRSIVEGVVTEKLSAYLEENPSVARIIVEKALQAARAREAARKARELTRRKSALENTALPGKLADCSEKDPSKCELFIVEGDSAGGSAKAGRNSRFQAILPLRGKILNVEKARLDKIFSNEEIRSIITALGTGIGEDFDISKLRYHKVIIMTDADVDGSHIRTLLLTFFFRFMKPLIENGHIYIAQPPLYKITKGKKVYYAYSDRELDKILSEIGRENIVVQRYKGLGEMNADQLWETTMDPEKRTMLKVTLEDAIAADEIFTILMGDKVEPRREFIEKYAKTVRNLDI 654
>gi|145577965|gb|ABP82701.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus mycoides] (632 aa)
Score = 1722, Expect = 0.0e+00, Identities = 376/642 (58%), Positives = 477/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  E  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGE--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|167755161|ref|ZP_02427288.1| hypothetical protein CLORAM_00666 [Clostridium ramosum DSM 1402] >gi|167705211|gb|EDS19790.1| hypothetical protein CLORAM_00666 [Clostridium ramosum DSM 1402] (641 aa)
Score = 1720, Expect = 0.0e+00, Identities = 361/649 (55%), Positives = 480/649 (73%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E  +++Y  S+I++LEGLEAVRKRPGMYIG+T I+GLHH+VWEIVDNSIDEA+ G AS I + L  +   +V DDGRG+P   HAKT  STVET+ TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V V+++  E+Y  F++GGKP  +LK+  +  S   GTIV F  D  I  E   +D DT++ R+++LA+LNKG++++  D+R   D K  + + GGIK++V  +N  K PI   I+Y E  +            I +EV  QYN  Y ++ ++FCNNINT EGG+HEEGF+ AL ++IN +A  K LLK+ +E +S +D  EGLTAI+S+KHP+PQYEGQTK KLGN+EVR   SN++S   +K+LLENP+ A +I+ K ++A  AR  + +ARE TRRK+  E ++LPGKLADCS+KD    E++IVEGDSAGGSAK+GRDR  QAILPL+GKI+NVEK++ +KI  N EI ++ITA G G+G EF +DKLRY+KI++MTDADVDG HIRIL+LTFL+RY+ PL+E G VY A PPL+    GK   Y Y ++ L++ K K     KY IQRYKGLGEMN +QLWETTMDP+ R+L ++ +++A+ AD +F +LMG++V PRREFI++NAKYV +LDI
  S:     1 MSEEKVEHSYDESDIQVLEGLEAVRKRPGMYIGTTSIRGLHHLVWEIVDNSIDEALAGYASHIRVILKDDDVVQVIDDGRGMPTGTHAKTGISTVETIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVNVHRDGHEYYQRFENGGKPAGELKIIGD--SDITGTIVTFKADKIIFKEGTVYDYDTLRQRIRELAFLNKGLRLSLEDQRNGVDRKHEYYYEGGIKEYVAYINKNKTPIHEEIIYVEDMQQ----------EITIEVGMQYNDGYQSNIYSFCNNINTHEGGTHEEGFRLALTRVINNYAKSKGLLKKDEEALSGDDVREGLTAIISVKHPDPQYEGQTKTKLGNAEVRKIASNIISASLDKFLLENPDTAKIIVDKAIVAARARMAAKKAREMTRRKNVLEVSNLPGKLADCSSKDASECEIFIVEGDSAGGSAKMGRDRRIQAILPLRGKILNVEKSRLEKILGNAEIRSMITAFGTGIGEEFNLDKLRYHKIVIMTDADVDGGHIRILMLTFLYRYLRPLVEGGFVYAAQPPLYLLKHGKDEYYCYSDEELDDLKTKIGEGAKYSIQRYKGLGEMNAEQLWETTMDPEKRILNQIDLDEAMEADMIFDMLMGEKVEPRREFIQENAKYVTDLDI 641
>gi|145577975|gb|ABP82706.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar entomocidus] (632 aa)
Score = 1720, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 476/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K+RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++ A+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKVRYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQGAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577983|gb|ABP82710.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar sotto] (632 aa)
Score = 1720, Expect = 0.0e+00, Identities = 377/642 (58%), Positives = 474/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIARPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145578007|gb|ABP82722.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar finitimus] (632 aa)
Score = 1720, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 476/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  +++K  +A  AR  + +ARE TRRK   E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKMVEKGTMAARARVAAKKARELTRRKRALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKIQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577973|gb|ABP82705.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus weihenstephanensis] (632 aa)
Score = 1719, Expect = 0.0e+00, Identities = 378/642 (58%), Positives = 471/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V DDGRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G P ADLKV  E  + + GTI  F PD EI  E  E++ DT  +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY+ K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIVVTDDGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGVPAADLKVIGE--TDRTGTITRFKPDSEIFTETTEYEFDTSATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFAIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNNKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145578019|gb|ABP82728.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar tolworthi] (632 aa)
Score = 1719, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 475/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   E  +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDETNVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577985|gb|ABP82711.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar thompsoni] (632 aa)
Score = 1718, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 475/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+  YN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLSYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577971|gb|ABP82704.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus mycoides] (632 aa)
Score = 1718, Expect = 0.0e+00, Identities = 376/642 (58%), Positives = 473/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V DDGRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G P ADLKV  E  + + GTI  F PD EI  E  E++ DT  +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY+ K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIVVTDDGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDRKIHYQKY-ERGIPAADLKVIGE--TDRTGTITRFKPDSEIFTETTEYEFDTSATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFAIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNNKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|146295090|ref|YP_001178861.1| DNA gyrase, B subunit [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145408666|gb|ABP65670.1| DNA gyrase subunit B [Caldicellulosiruptor saccharolyticus DSM 8903] (637 aa)
Score = 1717, Expect = 0.0e+00, Identities = 356/640 (55%), Positives = 471/640 (73%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEARE-ATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y+AS I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDN+IDEAM G    I + + ++ S  V DDGRGIPV+ H K +KS VE V TVLHAGGKF+   YKVSGGLHGVGASVVNALS +L+V VY++ K +Y ++ + GKPV DLKV  +  + + GT V F PD EI E  EFDAD +  RL++LA+LNKGI+I F DER  + +T    + GGI ++V+ LN  KE + P  +Y E E          K  I VEVA QY   +  + ++F NNI T +GG+H  GFK A+ K +N++A +   +K  D ++  ED  +G+TA+VS+K   PQ+EGQTK KLGNSE R  V N+VSE    +L ENP+ +  II K LLA +AR+++ +ARE   +RKS  +S++LPGKLADCS KD E  E++IVEGDSAGGSAK GRDR +QAILPL GK++NVEKA  DKI+SN++++ LI A+G G+G +  + KLRY+K+I+M DADVDGSHIR LLLTF +RYM PL+ENG++YIA PPL+K + GK  +YAY++K L++  +E      Q+QR+KGLGEMN ++LWETTMDP  R+LL+V +EDA+ A+++F++LMG++V PRREFIEKNAKYV+NLDI
  S:    11 YTASEIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVYEIVDNAIDEAMAGFCKNIDVIIHRDNSVTVLDDGRGIPVDIHPKLQKSGVEVVFTVLHAGGKFNESVYKVSGGLHGVGASVVNALSRYLEVEVYRDGKVYYQKY-ERGKPVCDLKVIGQ--TQRTGTKVTFLPDDEIFETIEFDADVLLQRLRELAFLNKGIRITFTDEREKNPKTIELKYDGGIAEFVKFLNRNKEVLHPEPIYIEGE----------KNQILVEVAIQYTDQFGENIYSFANNIATIDGGTHLVGFKAAVTKAVNEYAKKYNFVK-GDNQLLGEDIRDGMTAVVSVKIHEPQFEGQTKTKLGNSEARWAVENLVSEKLAAFLEENPDVSKKIIDKALLAAKAREEARKARELVIKRKSALDSSNLPGKLADCSEKDPEKCEIFIVEGDSAGGSAKQGRDRRYQAILPLWGKMLNVEKASPDKIYSNDKLLPLIQALGCGIGNDLDLKKLRYHKVIVMADADVDGSHIRTLLLTFFYRYMRPLIENGHIYIAQPPLYKITKGKQVRYAYNDKELQKILQEMKDA--QVQRFKGLGEMNAEELWETTMDPARRILLRVELEDAVMAEEIFTILMGEKVEPRREFIEKNAKYVRNLDI 637
>gi|145577963|gb|ABP82700.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar finitimus] (632 aa)
Score = 1717, Expect = 0.0e+00, Identities = 374/642 (58%), Positives = 477/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGM IGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NA+YVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMCIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKIQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENARYVKNLD 632
>gi|145577981|gb|ABP82709.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar seoulensis] (632 aa)
Score = 1716, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 473/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  ++ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGG AK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKVVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGCAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145578013|gb|ABP82725.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar graciosensis] (632 aa)
Score = 1716, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 476/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VW IVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  E  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWGIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGE--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|171325328|ref|ZP_02913834.1| DNA gyrase, B subunit [Geobacillus sp. WCH70] >gi|171088752|gb|EDT35097.1| DNA gyrase, B subunit [Geobacillus sp. WCH70] (640 aa)
Score = 1716, Expect = 0.0e+00, Identities = 370/649 (57%), Positives = 479/649 (73%)
  Q:     1 MNKETK-KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD-KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M  E K ++TY AS I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  +EI +T+ K+    + D+GRGIPV+   K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS  L+V+V+++ K HY +++ G  P  DL+V  E  + + GT V F PD EI  E  EFD +T+ +RL++LA+LN+G+KI   D+R ++ K  + + GGIK +V+ LN  +E +         EE +     +D   I VE+A QYN +Y+++ ++F NNI+T EGG+HE GFK AL +IIN +A + ++LK+ D  ++ ED  EGLTAIVSIKHP+PQ+EGQTK KLGNS+ R     + SE FE +LLENP  A  I++K ++A  AR  + +ARE TRRKS  E ++LPGKLADCS+KD  ISELY+VEGDSAGGSAK GRDR FQAILPL+GKIINVEKA+ DKI SN E+  +ITA+G G+G +F I K RY+KII+MTDADVDG+HIR LLLTF +RYM   +E G VYIA PPL+K   GK  KYAY+++ LE+   E     K  IQRYKGLGEMNP+QLWETTM+P+ R LL+V+++DA+ AD+ F +LMGD+V PRR+FIE+NA+YVKNLDI
  S:     1 MTMEQKIEHTYDASQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVWEIVDNSIDEALAGYCTEINVTIEKDNIIAITDNGRGIPVDIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEELEVYVHRDGKIHYQKYQRG-VPCTDLEVIGE--TDRTGTTVRFKPDPEIFTETTEFDYETLATRLRELAFLNRGLKITLEDKRVENRKNEYHYEGGIKSYVKHLNRTREVL--------HEEPIYIIGERD--GIYVEIALQYNDSYSSNIYSFVNNIHTHEGGTHESGFKTALTRIINDYARKHQILKDNDPNLTGEDVREGLTAIVSIKHPSPQFEGQTKTKLGNSDARAVTDAIFSEQFETFLLENPTIARKIVEKGMMAARARLAAKKARELTRRKSALEISNLPGKLADCSSKDPSISELYVVEGDSAGGSAKQGRDRHFQAILPLRGKIINVEKARLDKILSNNEVRAIITALGTGIGEDFDITKARYHKIIIMTDADVDGAHIRTLLLTFFYRYMREFIERGYVYIAQPPLYKIEQGKQVKYAYNDRQLEKILAELPENPKPTIQRYKGLGEMNPEQLWETTMNPETRTLLQVSLQDAIEADETFEILMGDKVEPRRQFIEENARYVKNLDI 640
>gi|145577969|gb|ABP82703.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus mycoides] (632 aa)
Score = 1715, Expect = 0.0e+00, Identities = 376/642 (58%), Positives = 475/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD-DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G P ADLKV  E  +   GTI  F PD EI  E  E+D DT+ +R+++LA+LN+ IK+   D+R +  K+ F + GGIK +VE LN  K PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I++TDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY++K LE+   E  +  K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPAADLKVIGE--TDHTGTITRFKPDPEIFKETTEYDFDTLATRMRELAFLNRNIKLIIEDKRENKQKKEFHYEGGIKSYVEHLNRSKAPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPSISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIITDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAHPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577987|gb|ABP82712.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar wratislaviensis] (632 aa)
Score = 1714, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 473/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  ++ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWET MDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEAIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKVVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETAMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145578015|gb|ABP82726.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar ostriniae] (632 aa)
Score = 1714, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 474/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGL+H+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  ++ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLYHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKVVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKLGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145578017|gb|ABP82727.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar tohokuensis] (632 aa)
Score = 1714, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 473/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  ++ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQA LPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLSTRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKVVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQATLPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|118587497|ref|ZP_01544922.1| DNA gyrase, B subunit [Oenococcus oeni ATCC BAA-1163] >gi|71466856|emb|CAH41002.1| DNA gyrase subunit B [Oenococcus oeni] >gi|118432147|gb|EAV38888.1| DNA gyrase, B subunit [Oenococcus oeni ATCC BAA-1163] (652 aa)
Score = 1714, Expect = 0.0e+00, Identities = 345/645 (53%), Positives = 464/645 (71%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD--DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAY---DEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +  N+Y  S+I+ILEGLEAVRKRPGMYIGST   GLHH+VWEI+DN IDEA+ G A  +T+T+ K+ S  + DDGRG+PVE   KT +  +E V T+LHAGGKFD+ SYKVSGGLHGVGASVVNALS  + V VY++ K +Y++F + G    ++K+ +E   +K GTIV F PD +I  E   FD  T+ SR+++LA+LNKG++++  D+R D    E+F++ GGI ++V+ LN  K+P+ P  VY E EE+           I+VEVA QY      +  +F NNI+T EGG+HE GFK AL +IIN +  +K +LK++D+ +S ED  EG+TAIVSIKHP+PQ+EGQTK KLGN++ +  V++  S IF ++++ENPE A  I  K L+A +AR  + +AR+ TR+KS  E ++L GKLAD +++D EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  DK+ +NEEI +L TA+G G G EF I K  Y+K+I+MTDADVDG+HIR LLLT  FRYM PL++ G +YIA PPL+  ++G S +  Y   DE+  +      +  K +IQRYKGLGEM+  QLW+TTMDPK+R LL+V  E     D  F +LMGD V PRREFIE NA++V++LD+
  S:    13 SDNNSYGGSSIQILEGLEAVRKRPGMYIGSTASSGLHHLVWEIIDNGIDEALAGFAHHVTLTIEKDNSITITDDGRGVPVEIQPKTGRPAMEAVFTILHAGGKFDSKSYKVSGGLHGVGASVVNALSKEMDVRVYRDNKIYYMDF-ERGHIKTEMKLLDEPMRLKRGTIVHFAPDPDIFRETIVFDYRTLASRIRELAFLNKGLRLSITDKRVDPVKNESFMYEGGIAEYVKFLNKNKQPLFPEPVYVEGEEN----------GIQVEVALQYTDAVAETLMSFTNNIHTHEGGTHETGFKMALTRIINDYVKKKGILKDSDDPLSGEDVREGITAIVSIKHPDPQFEGQTKTKLGNTDAQQAVNHQFSTIFNRFMMENPETARAIANKGLIASKARVAAKKARDLTRKKSGLEISALAGKLADNTSRDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDKVLANEEIRSLFTAMGTGFGEEFDISKAHYHKVIIMTDADVDGAHIRTLLLTLFFRYMRPLIDAGYIYIAQPPLYGVAIGNSDQRVYLDSDEELDQYTATLPASPKPRIQRYKGLGEMDAVQLWDTTMDPKHRRLLRVDPEYQPEVDTTFDMLMGDRVEPRREFIEDNAQFVEDLDV 652
>gi|73670270|ref|YP_306285.1| DNA gyrase subunit B [Methanosarcina barkeri str. Fusaro] >gi|72397432|gb|AAZ71705.1| DNA gyrase subunit B [Methanosarcina barkeri str. Fusaro] (633 aa)
Score = 1711, Expect = 0.0e+00, Identities = 351/645 (54%), Positives = 469/645 (72%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K  Y AS+I++LEGLEAVRKRP MYIGSTD +GLHH+V+E+VDNSIDEA+ G  + I +T+  +GS  V D+GRGIPV+ H   KKS +E V+TVLHAGGKFD ++YKVSGGLHGVG SVVN LS WL+V V +E K+++  + D GKP AD  V     S   GT   F PD +I E  +FD + + +RL++LA+LN+G+ I+ +D RT D   ETF + GGI ++V+ LNN+K+P+   I ++ + +           ++ VE+A QY  +Y  + ++F NNINT EGG+H  GFK AL ++ N +    KL KE D K++ +D  EGLTAI+S+K   PQ+EGQTK +LGNS+V+  V ++V++   +Y  ENP+ ANVI++K LLA +AR+ + +ARE TRRK+  E ++LPGKLADCS K+    E+YIVEG+SAGGSAK GRDR FQAILPL+GKI+NVEK++  KI  NEEII+LITAIG G+  +F ++  RY+K+I+MTDADVDG HIR LLLT  FRYM PL++ G VYIA PPL++   GK+  Y + ++ LE  KKE  +    IQRYKGLGEMNP QLWETTM+P++R+LL+VT+EDA+ AD++F +LMGDEV PRR FIE +AK V NLDI
  S:     2 SDKQVYDASHIQVLEGLEAVRKRPSMYIGSTDSRGLHHLVYEVVDNSIDEALAGFCTIINVTINPDGSVTVLDNGRGIPVDPHPFHKKSALEVVMTVLHAGGKFDKNTYKVSGGLHGVGVSVVNGLSEWLEVEVAREGKKYFQRY-DRGKPKAD--VLEIGTSETTGTKTTFKPDEKIFETLDFDYEILSNRLRELAFLNRGLTISLMDLRTPDGQAETFTYEGGIVEFVKYLNNKKQPLHAPIYFERQRD-----------DMVVEIAMQYTSSYAENVYSFANNINTHEGGTHIIGFKTALTRVANDYIKANKLSKE-DIKLTGDDVREGLTAIISVKLMEPQFEGQTKTRLGNSDVKGIVDSLVTDGLAEYFEENPKVANVILEKALLAQKAREAAKKARELTRRKNALEVSTLPGKLADCSEKNPAACEIYIVEGNSAGGSAKQGRDRSFQAILPLRGKILNVEKSRLAKILKNEEIISLITAIGTGISEDFTLESARYHKVIIMTDADVDGEHIRTLLLTLFFRYMRPLIDEGYVYIAQPPLYRIKKGKAEYYIHSDRELEAKKKELGEKGLGIQRYKGLGEMNPGQLWETTMNPESRILLQVTLEDAIRADEIFRVLMGDEVEPRRNFIEAHAKEVVNLDI 633
>gi|167038684|ref|YP_001661669.1| DNA gyrase subunit B [Thermoanaerobacter sp. X514] >gi|166852924|gb|ABY91333.1| DNA topoisomerase IV, B subunit [Thermoanaerobacter sp. X514] (633 aa)
Score = 1710, Expect = 0.0e+00, Identities = 366/644 (56%), Positives = 460/644 (71%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  TY+AS I+ILEGLEAVRKRPGMYIGST  +GLHH+V+E+VDNSIDEA+ G    I +T+ K+ S  V+DDGRGIP + H K  K  VE  LT+LHAGGKF+ND+YKVSGGLHGVG SVVNALS  L+V V K+  + + +  + G P  DL++  E       T + F PD EI E   F+ D +  RL++LA+LNKGI I  IDER   +E F + GGI  +V+ LN  KE +    +Y E       A N D     VEV  QYN TY  + F+F NNI+T EGG+H  GFK AL K+IN +A +  ++K+ ++ +  ED  EGLTAIVS+K  NPQ+EGQTK KLGNSE+R  V NVV E    +L ENP  A VI++K   A  AR+ + +ARE TRRKS  E+ +LPGKLADCS KD    EL++VEGDSAGGSAK GR+  FQAILPL+GKI+NVEKA+ DKI SNEEI  +ITA+G G+G EF I KLRY+K+++MTDADVDGSHIR LLLTF +R+M PL+ENGNVYIA PPL+K + GK   YAY ++ L+    E  +  Y +QRYKGLGEMN DQLW+TTMDP+ R +LKVT+EDA+ AD++F++LMGD+V PRREFIEK+AK V+NLDI
  S:     3 KDETYTASQIQILEGLEAVRKRPGMYIGSTGSRGLHHLVYEVVDNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDIHPKVGKPAVEVALTMLHAGGKFNNDAYKVSGGLHGVGVSVVNALSEKLEV-VVKQRGKIFRQTYERGVPKTDLEIIGETEETG--TTITFKPDKEIFEETVFNYDVLAQRLRELAFLNKGINIRLIDERDGKEEVFNYEGGIISFVKYLNRNKEVLHEEPIYME-------AKNTD---YEVEVCMQYNDTYTENIFSFANNIDTREGGTHLVGFKSALTKVINDYARKYGIIKDNEKNLQGEDVREGLTAIVSVKLKNPQFEGQTKTKLGNSEMRSIVENVVIEKLSAFLEENPSVAKVIVEKATQAARAREAARKARELTRRKSALENTTLPGKLADCSEKDPSKCELFLVEGDSAGGSAKTGRNSRFQAILPLRGKILNVEKARLDKILSNEEIRAMITALGTGIGDEFDISKLRYHKVVIMTDADVDGSHIRTLLLTFFYRFMRPLIENGNVYIAQPPLYKITKGKKVYYAYSDRELDRILNEIGRENYTVQRYKGLGEMNADQLWDTTMDPEKRTMLKVTLEDAIAADEIFTILMGDKVEPRREFIEKHAKTVRNLDI 633
>gi|27262246|gb|AAN87404.1| DNA gyrase subunit B [Heliobacillus mobilis] (641 aa)
Score = 1710, Expect = 0.0e+00, Identities = 350/643 (54%), Positives = 450/643 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++TY AS I++LEGLEAVR+RPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + ++ S +V D+GRGIPV+ H K  K  VE  LTVLHAGGKF  + YKVSGGLHGVG SVVNALS  LKV V +  K H  ++ + G  + DLKV     S   GT + F PD  I E  E+  +T+  RL++L++LN+G+KI   D RT  +  F   GGI  +V+ LN  K+ I P ++Y + E          K  + VE+A QYN  Y+ + F++ NNINT EGG+HE GFK AL ++IN +      +KE D  +S ED  EG+TA++S+K   PQ+EGQTK KLGNSEVR    + V+E    YL ENP     +I+K L AM AR+ + +ARE TRRKS  ES SLPGKLADCS KD  + ELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK++ DKI SNEEI  LITA+G G+G +F + K RY+++ LMTDADVDGSHIR LLLTF FR+M PL+ENG VYIA PPL++   G+  +Y Y +  L ++  +N +    IQRYKGLGEMNP+QLW+TTMDP++R +L+V++EDA  A+ +F+ LMGD V PRREFI+ +AK V+NLDI
  S:    12 ESTYDASQIQVLEGLEAVRRRPGMYIGSTSARGLHHLVYEIVDNSIDEALAGYCDTIEVIIHEDNSIEVSDNGRGIPVDIHPKMGKPAVEVALTVLHAGGKFGGEGYKVSGGLHGVGLSVVNALSEKLKVTVRRNGKVHE-QYYERGVTMTDLKVVGNAES--TGTTIYFKPDGLIFEELEYSYETLSHRLRELSFLNRGVKITLKDLRTGQESIFAHEGGIIDFVKFLNRNKDLIHPHVIYFQNE----------KEGVHVEMALQYNDGYSETLFSYANNINTQEGGTHESGFKTALTRVINDYGRRINQIKENDSNLSGEDIREGITAVISVKVREPQFEGQTKTKLGNSEVRGITDSCVTEGLSTYLEENPSVGKKVIEKALSAMRAREAARKARELTRRKSALESTSLPGKLADCSFKDPSMCELYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDKILSNEEIRALITALGTGIGEDFDLSKARYHRVCLMTDADVDGSHIRTLLLTFFFRHMKPLIENGYVYIAQPPLYQVKKGRDVRYYYHDNELNQYLDKNGRDGVTIQRYKGLGEMNPEQLWDTTMDPEHRTILQVSMEDAAEAESIFTTLMGDRVEPRREFIQSHAKDVRNLDI 641
>gi|148377999|ref|YP_001256875.1| DNA gyrase subunit B [Mycoplasma agalactiae PG2] >gi|148292045|emb|CAL59437.1| DNA gyrase subunit B [Mycoplasma agalactiae PG2] (655 aa)
Score = 1710, Expect = 0.0e+00, Identities = 345/648 (53%), Positives = 461/648 (71%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFES-NSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + ++K N+Y+AS+I++LEGLEAVR RPGMYIG+   KGLHH+VWEIVDNS+DE M G A+ I IT+ K+G  +++D+GRGIPV KH +T  STVETVLTVLHAGGKFD+D+YKVSGGLHGVGASVVNALSS   VWV +E   +Y  F+ GG+ V  L V N     + GT ++F+PDF I+E+  F  + I    K++AYL KG ++  +DE  +  E F + GG+  +V ELN  ++ +  +I+Y E       + +K    I VEVA QY  T+     T+ NNI T EGG+HE+GF  AL ++IN +A++  L+K  +E+++KED  +GL AIVS+KHP+P +EGQTK KL N + R  V  +++ + E+Y  ENP DA  II KCL + ++R  +  A EA +      S  SLPGKLA+C++K+ EI ELYIVEG+SAGGSAK+GRDR  QAILPL+GK+IN EK   +++ SN EII+LITA+G G+   F I+KLRY+K+I+MTDADVDG+HIR LLLTF +RY   L+E G +YIA PPL+K    K   YAY++   +   +  N   K  IQRYKGLGEM+P+QLWETTM+P+NR + +V I+DA  AD VF+ LMGD+V PRREFIEKNAK+V+N+DI
  S:    10 DNQSKNNSYNASSIRVLEGLEAVRVRPGMYIGTITDKGLHHLVWEIVDNSVDECMAGYANFIKITICKDGYIEIEDNGRGIPVAKHPQTGLSTVETVLTVLHAGGKFDSDAYKVSGGLHGVGASVVNALSSNFHVWVKREGHTYYAHFQHGGQTVQPLTVINNIDPSETGTKIKFHPDFTILEKHPFSVEAITDHAKRIAYLTKGTRLVVVDEINNTSEEFYYEGGLIDYVNELNEGQKLVHDSIIYAEGLYDSDKSGSK----ITVEVALQYTSTFQPRITTYTNNIVTIEGGTHEQGFFDALSRLINSYALKNGLIKNENERLNKEDTSKGLVAIVSVKHPDPIFEGQTKGKLNNKDARTAVREILAPVLERYFDENPIDAREIINKCLQSRKSRLAAEAAAEAVQANMGNNSIASLPGKLANCTSKNAEICELYIVEGNSAGGSAKMGRDRNVQAILPLRGKVINAEKVSPERVLSNAEIISLITALGTGLNESFDINKLRYHKVIIMTDADVDGAHIRTLLLTFFYRYFRKLIEYGFIYIAQPPLYKIQQNKYIAYAYNDSQKDSILQSLNQDSKITIQRYKGLGEMDPEQLWETTMNPENRKMYQVQIDDAAKADWVFTTLMGDDVLPRREFIEKNAKFVQNIDI 655
>gi|145578023|gb|ABP82730.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar fukuokaensis] (632 aa)
Score = 1709, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 473/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVR+RPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E   + K  IQRYKGLGEM+P QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRERPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPALPKPGIQRYKGLGEMSPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|149182285|ref|ZP_01860764.1| DNA gyrase subunit B [Bacillus sp. SG-1] >gi|148849977|gb|EDL64148.1| DNA gyrase subunit B [Bacillus sp. SG-1] (638 aa)
Score = 1709, Expect = 0.0e+00, Identities = 370/647 (57%), Positives = 473/647 (73%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET-FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ ++ +Y  + I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  SEI +++ K+ S  VQD+GRGIPV  H K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY +F+ G  P  DLKVT E  S   GTI+ F PD EI  E  E++ D + +RL++LA+LN+GIKI   D R +DK+  + + GGIK +VE LN  KE +    +Y E E          K NI VE+A QYN  + ++ ++F NNI+T EGG+HE GFK AL ++IN +A +  L KE+D  +S ED  EG+TAI+SIKHP+PQ+EGQTK KLGNSE R     + SE FE +LLENP  A  ++ K L+A  AR  + +ARE TRRKS  E +SLPGKLADCS++D +ISE+YIVEGDSAGGSAK GRDR FQAILPL+GKIINVEKA+ DKI SN E+  +ITA+G G+G +F I K RY K+++MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPL++   GK  +Y Y +K LEE   +  ++ K  IQRYKGLGEMN  QLWETTMDP+ R LL+V++EDA+ AD+ F +LMGD+V PRR FIE NA YVKNLD+
  S:     2 EQEQRQSYDENQIQVLEGLEAVRKRPGMYIGSTSSKGLHHLVWEIVDNSIDEALAGYCSEIKVSIEKDNSITVQDNGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKFEKG-VPSGDLKVTGE--SDVTGTIIHFKPDPEIFTETTEYEYDILANRLRELAFLNRGIKIIIEDNRVEDKKNEYHYEGGIKSYVEHLNRSKEVVHEEPIYIEGE----------KDNISVEIALQYNDGFASNLYSFANNIHTYEGGTHESGFKTALTRVINDYARKNHLYKESDANLSGEDVREGITAIISIKHPDPQFEGQTKTKLGNSEARTITDALFSEHFESFLLENPVVARKVVDKGLMAARARLAAKKARELTRRKSALEVSSLPGKLADCSSRDPKISEIYIVEGDSAGGSAKQGRDRHFQAILPLRGKIINVEKARLDKILSNNEVRAMITALGTGIGEDFDISKARYQKVVIMTDADVDGAHIRTLLLTFFYRYMRQIIEAGYIYIAQPPLYQIKQGKKIEYVYSDKQLEEALAQMPAQPKPGIQRYKGLGEMNATQLWETTMDPEYRTLLQVSLEDAIEADETFEMLMGDKVEPRRNFIEDNAAYVKNLDV 638
>gi|89892751|ref|YP_516238.1| DNA gyrase subunit B [Desulfitobacterium hafniense Y51] >gi|109647876|ref|ZP_01371779.1| DNA gyrase, B subunit [Desulfitobacterium hafniense DCB-2] >gi|89332199|dbj|BAE81794.1| DNA gyrase subunit B [Desulfitobacterium hafniense Y51] >gi|109640966|gb|EAT50521.1| DNA gyrase, B subunit [Desulfitobacterium hafniense DCB-2] (644 aa)
Score = 1709, Expect = 0.0e+00, Identities = 352/647 (54%), Positives = 453/647 (70%)
  Q:     3 KET-KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KET   N Y+A  I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G    I +T+ K+ S  V D+GRGIPV+ H K  K  VE  LTVLHAGGKF   +YKVSGGLHGVG SVVNALS+WL V V K+   ++ EF  G K   +L V  +    + GT + F PD EI E   F  DT+  RL++L++LNK + I  ID R D KE +   GGI  +V+ +N  KE + P  +Y E E          K  ++VEV+ QYN  Y  + F++ NNI+T EGG+HE GFK AL ++ N +A +  +LK  +  +S ED  EGLTA++S+K P PQ+EGQTK KLGNSE+R  V ++  E    +  ENP     +I+K + A  AR+ + +ARE TRRKS  E ++LPGKLADCS K+ E+ E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ D+I  N EI  +ITA+G G+  +F I+K RY+K+++MTDADVDG+HIRILLLTF FRYM PLLEN  VYIA PPLFK   GK   Y Y  + L + + E  + + +IQRYKGLGEMN +QLWETTMDP  R +L+VT+EDA+ AD++F++LMGD V PRREFI+ NA+YV+NLD+
  S:     8 KETIPTNDYNAGQIEVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGYCDTIEVTIHKDNSISVVDNGRGIPVDIHPKLGKPAVEVALTVLHAGGKFSGSAYKVSGGLHGVGMSVVNALSTWLHVEVRKDGNIYHQEFMRG-KTKTELAVIGQVDPNQTGTTITFSPDPEIFEDTVFLFDTLAHRLRELSFLNKKVSITLIDAREDKKEVYYHTGGIYDFVKYINRSKESLHPEPIYFEAE----------KDGVQVEVSMQYNDGYVENLFSYANNIHTHEGGTHESGFKAALTRVANDYARKNNILKANEANLSGEDIREGLTAVISVKVPEPQFEGQTKTKLGNSEIRSIVDSITGEGLSAFFEENPAIGKKVIEKSIQASRAREAARKARELTRRKSALEVSALPGKLADCSWKEAELCEMYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDRILGNAEIRAMITAMGTGISEDFDIEKARYHKLVIMTDADVDGAHIRILLLTFFFRYMKPLLENNYVYIAQPPLFKVKKGKDIHYVYSNEELAKLQDEIGRDRVEIQRYKGLGEMNAEQLWETTMDPAKRTILQVTMEDAIKADELFTILMGDVVEPRREFIQDNAQYVRNLDV 644
>gi|89101114|ref|ZP_01173950.1| DNA topoisomerase IV subunit B [Bacillus sp. NRRL B-14911] >gi|89084169|gb|EAR63334.1| DNA topoisomerase IV subunit B [Bacillus sp. NRRL B-14911] (640 aa)
Score = 1708, Expect = 0.0e+00, Identities = 370/647 (57%), Positives = 475/647 (73%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET-FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  ++ +Y  + I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  SEI + + K+ S  V DDGRGIPV  H K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V ++ K HY +F + G P ADLKV  E    + GT + F PD EI  E  E++ + + +R+++LA+LN+G+KI   D+R ++K++ + + GGIK +VE LN  KE +    +Y E E          K  I VEVA QYN  +  + +++ NNI+T EGG+HE GFK AL ++IN +A +  + K++D  +S ED  EGLTAIVSIKHP+PQ+EGQTK KLGNSEVR       S+ FEK+L+ENP+ A  +++K L+A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN E+  +ITA G G+G +F+I K RY+KI++MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPL+K   GK  +YAY++K L++  +E  K  K  IQRYKGLGEMNP+QLWETTMDP  R LL+V++EDA+ AD+ F +LMGD+V PRR+FIE NA YVKNLDI
  S:     4 KAIQEQSYDENQIQVLEGLEAVRKRPGMYIGSTSSKGLHHLVWEIVDNSIDEALAGYCSEINVIIEKDNSITVVDDGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVRRDGKLHYQKF-ERGVPAADLKVIGEAE--ETGTTIHFKPDGEIFTETLEYEYEILANRIRELAFLNRGLKITIEDKRAENKKSEYFYEGGIKSYVEHLNRTKEVLHEEPIYIEGE----------KEGITVEVAIQYNDGFTGNIYSYANNIHTYEGGTHESGFKTALTRVINDYARKNGIFKDSDANLSGEDVREGLTAIVSIKHPDPQFEGQTKTKLGNSEVRTVTDTFFSDHFEKFLMENPQVARKVVEKGLMAARARLAAKKARELTRRKSALEVSSLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDKILSNNEVRAIITAAGTGIGDDFEISKARYHKIVIMTDADVDGAHIRTLLLTFFYRYMRQIIEAGYIYIAQPPLYKVQQGKRVEYAYNDKQLDQIFEELPKAPKPNIQRYKGLGEMNPEQLWETTMDPGTRTLLQVSLEDAIEADETFEILMGDKVEPRRQFIEDNAVYVKNLDI 640
>gi|145578001|gb|ABP82719.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar shandongiensis] (632 aa)
Score = 1707, Expect = 0.0e+00, Identities = 374/642 (58%), Positives = 472/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  ++ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  IS +YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+  KI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKVVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISGIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLGKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 632
>gi|145577995|gb|ABP82716.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar oswaldocruzi] (631 aa)
Score = 1706, Expect = 0.0e+00, Identities = 375/642 (58%), Positives = 477/642 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVE DSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVE-DSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 631
>gi|188584649|ref|YP_001916194.1| DNA gyrase subunit B [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349336|gb|ACB83606.1| DNA gyrase subunit B [Natranaerobius thermophilus JW/NM-WN-LF] (640 aa)
Score = 1705, Expect = 0.0e+00, Identities = 354/648 (54%), Positives = 455/648 (70%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           NK   +  Y  S I++LEGLEAVRKRPGMYIGSTD +GLHH+V E+VDNSIDEAM G   +I I L      +V D+GRGIPV+ H K KK T+E ++T LHAGGKF NDSYKVSGGLHGVG SVVN LS W++V VY++ K +  E++ G  P  ++K   E  S K GT + F PD EI E  EFD   +++RL+QLA+LN+G+ I   DER D+  +E F + GGIK +VE LN  K  +    VY E E+             ++EVA QYN  Y     ++ NNINT EGG+HE GFK +L + +N +A    LLK  D+ ++ ED  EG+TAI+S+K  +PQ+EGQTK KLGNSEVR  V  +VSE  E YL ENP     I+ K + A  AR+ + +A+E TRRK+  E  +LPGKLADC+TKD   SELY+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI +NEEI  +ITAIG G+G EF I K RY +II+MTDADVDG+HIR LLLTF +RYM PL+E+G VYIA PPL+         Y +++  L+   +E  K    +QRYKGLGEMNP QLWETTM+P++R +L V ++DA+ ADK+F++LMG++V+PRR+FIE+NA+ V+NLD+
  S:     4 NKFVNEQNYDESQIQVLEGLEAVRKRPGMYIGSTDERGLHHLVHEVVDNSIDEAMAGYCDDIRIKLEPGNKVRVTDNGRGIPVKDHPKIKKPTLEVIMTYLHAGGKFSNDSYKVSGGLHGVGISVVNGLSKWIRVKVYRDGKVYQQEYEKG-YPKTEIKEIGE--SDKRGTEIIFLPDEEIFETVEFDYQVLRNRLQQLAFLNRGVSITISDEREDEFKEEHFKYEGGIKSFVEYLNENKTTLFTPPVYIEGEQE----------GCKLEVAIQYNDGYQEMIHSYANNINTHEGGTHESGFKISLTRTVNDYARRHNLLKNGDKNLTGEDIREGITAIISVKVEDPQFEGQTKTKLGNSEVRRIVEGIVSEHLESYLEENPAVGKKIVNKAINASRAREAARKAKELTRRKNALEVTALPGKLADCTTKDASKSELYLVEGDSAGGSAKQGRDREFQAILPLRGKILNVEKARFDKILANEEIKTIITAIGTGIGEEFDISKARYQRIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEHGYVYIAQPPLYMVKKKGKHYYTFNDHELDNLLEEIGKEGISLQRYKGLGEMNPTQLWETTMNPESRTVLNVNLQDAIEADKIFTVLMGEKVSPRRKFIEENARDVRNLDV 640
>gi|145577991|gb|ABP82714.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus mycoides] (631 aa)
Score = 1704, Expect = 0.0e+00, Identities = 376/642 (58%), Positives = 470/642 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V DDGRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNAL + L+V+V+++ K HY ++ + G P ADLKV  E  + + GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +Y A PPLFK   GK  +YAY+ K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKYVKNLD
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIVVTDDGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALPTELEVFVHRDGKIHYQKY-ERGVPAADLKVIGE--TDRTGTITRFKPDSEIFTETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFAIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIY-AQPPLFKVQQGKKIQYAYNNKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLD 631
>gi|89210819|ref|ZP_01189203.1| DNA gyrase, B subunit [Halothermothrix orenii H 168] >gi|89159560|gb|EAR79224.1| DNA gyrase, B subunit [Halothermothrix orenii H 168] (642 aa)
Score = 1704, Expect = 0.0e+00, Identities = 355/643 (55%), Positives = 456/643 (70%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  Y A +I++LEGLEAVRKRPGMYIGST + GLHH+V+E+VDNSIDEAM G    I + +       V+D+GRGIPV+ H K KK  VE VLTVLHAGGKF  D YKVSGGLHGVG SVVNALS WL+V V     + Y +  + G PV DLKV  E +    GT + F PD EI E   F    +  RLK+LA+LNKG++I   DER ++  ++ + F GG+  +V+ LN  K P+     Y E ++           N  VE+A QYN  Y +S FTF NNINT EGG+H  GFK AL + +N +A  K +LKE DE ++ ED  EG+TAI+S++  +PQ+EGQTK KLGNSE+R FV + +S     +L ENP+   +I++K   A  ARK + +ARE TRRK    + +LPGKLADCS++D E +E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ +KI +NEEI  LITAIG G+G EF I+K RY KII+MTDADVDG+HIR LLLTF +RYM PL+ENG +YIA PPL+K   G+  +Y Y+++ L++   +  + K  +QRYKGLGEMNPDQLWETTM+P+NR++LKV IEDA+ AD+ F+ LMGD+V PRREFI+++A  V+NLD+
  S:    10 KGNYEAEHIQVLEGLEAVRKRPGMYIGSTGMDGLHHLVYEVVDNSIDEAMQGYCDLIEVIIKPGNIITVKDNGRGIPVDPHPKLKKPAVEVVLTVLHAGGKFGGDGYKVSGGLHGVGVSVVNALSKWLEVEVCWRDGKVYHQKYNRGIPVYDLKVIGECSG--TGTTISFKPDEEIFEDVNFKYKVLAQRLKELAFLNKGVRIILRDEREEEARQDEYCFEGGLVSFVKYLNKNKNPLFDEPFYLEEKDE----------NREVEIAIQYNDGYVDSIFTFANNINTREGGTHLSGFKSALTRTVNDYARSKGILKENDENLTGEDIREGITAIISVRLTDPQFEGQTKTKLGNSEIRGFVDSALSSNLRTFLEENPKIGKIIVEKARSAARARKAAKKARELTRRKGALSNTALPGKLADCSSRDTENTEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARLNKILNNEEIRALITAIGTGIGDEFDINKARYGKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIENGMIYIAQPPLYKVKKGRREEYVYNDRGLQKLLNDIGRDKITLQRYKGLGEMNPDQLWETTMNPENRIILKVKIEDAVVADETFTTLMGDKVQPRREFIQEHAHEVQNLDV 642
>gi|167730276|emb|CAO81188.1| DNA gyrase subunit B [Candidatus Cloacamonas acidaminovorans] (632 aa)
Score = 1703, Expect = 0.0e+00, Identities = 344/644 (53%), Positives = 458/644 (71%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + +TY+ASNIK+L+GLEAVRKRP MYIG T  +GLHH+V+E++DNSIDEA+ G   EI  T+T EG+ +V+D+GRGIPV+         V+ VLTVLHAGGKFD+ SYKV+GGLHGVG SVVNALS +L+V ++K+ KE+++ F + G PV +L+V  +  + K GT+V F PD  I E  EF  D + SRL++LA+LN G++I   DER+     F + GGIK +VE LN  K+P+ P  +Y     SVK         +  EVA QYN+ Y  + F+F NNINTTEGG+H  GFK  L + +N +     LLK      S ED  EGLTA++S+K  NPQ+EGQTK KL NSEV   V++ V E   +Y  E+P +A  I  K +LA  +R+ + +ARE TRRK+  ES SLPGKLADC+  D E +EL++VEGDSAGGSAK GRDR FQAILPL GK++N EKA+ DK+ +N++I  +I A+GAG+G EF I KLRY+KII+M DADVDGSHI  LL+TF +RYM P++E G +YIA PPLF+   GK   Y Y+E+  ++  +E  +    +QRYKGLGEMN +QLWETT+DPKNR ++ + ++DA+ AD++F++LMGDEV PRREFI++NA+YVKNLD+
  S:     2 QSSTYTASNIKVLKGLEAVRKRPAMYIGGTSERGLHHLVYEVIDNSIDEALAGYCDEIICTITTEGNIRVEDNGRGIPVDIQKDMGVPAVQVVLTVLHAGGKFDDKSYKVAGGLHGVGVSVVNALSEFLEVNIFKDGKEYFMRF-ERGLPVTELQVLGD--TNKTGTVVTFRPDPLIFETTEFSFDYLTSRLRELAFLNSGLRIILKDERSGRVHDFKYEGGIKSFVEYLNQNKKPLFPNPIYIS---SVKEG-------MEFEVALQYNEGYQENIFSFANNINTTEGGTHLSGFKSGLTRAVNTYIKNADLLKNEKVSPSGEDIREGLTAVISLKIANPQFEGQTKTKLQNSEVEGIVNSAVYEKLMEYFEEHPAEAKNITMKSILAARSREAARKARELTRRKTVLESGSLPGKLADCTLSDPEKTELFLVEGDSAGGSAKQGRDRSFQAILPLWGKMLNTEKARVDKVLNNDKIQPIILALGAGIGQEFDISKLRYHKIIIMADADVDGSHIATLLMTFFYRYMRPVIEEGKLYIAMPPLFQVRKGKQKVYVYNEEERDKAIREFGEKGVLVQRYKGLGEMNAEQLWETTLDPKNRKMIAIKMDDAIEADRMFTILMGDEVEPRREFIQENARYVKNLDV 632
>gi|167461556|ref|ZP_02326645.1| DNA gyrase subunit B [Paenibacillus larvae subsp. larvae BRL-230010] (636 aa)
Score = 1703, Expect = 0.0e+00, Identities = 357/643 (55%), Positives = 466/643 (72%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +NTY  S I++LEGLEAVRKRPGMYIGST  +GLHH+VWE+VDNSIDEA+ G  ++I +T+ ++ S  V D+GRGIPV +H K KK T+E VLTVLHAGGKF  + YKVSGGLHGVG SVVNALS  L   V ++   +  EFK G  P   +KV  +  + + GT++ F PD EI  E   +D + ++SR+++LA+LNK ++IN  DERT    ++ + GGI  +VE LN  +EP+    +Y E         NKD  NI+VE+A QYN  +N + ++F NNI+T EGG+HE GFK AL ++IN +A +  +LK+++  +S +D  EG+ AI+S+K P+PQ+EGQTK KLGNSEVR  V ++++E  +++L ENP  A  I++K + A  AR+ + +ARE TRRKS  E +SLPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ D+I SN EI  +ITA+G G+  +F + K RY+KII+MTDADVDG+HIR LLLTF FRYM  L+E G VYIA PPL+K    K+ +YAY++K   E  KE     K  +QRYKGLGEMN  QLWETTMDP++R LL+V IEDA+ AD +F +LMGD V PRR FI ++AKYV NLD+
  S:     5 QNTYDESQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVWEVVDNSIDEALAGFCTKIDVTIHEDNSITVIDNGRGIPVGEHPKLKKPTLEVVLTVLHAGGKFGGEGYKVSGGLHGVGVSVVNALSESLVATVKRDGHIYQQEFKRG-VPQYGVKVIGD--TDEYGTVITFKPDAEIFTETTVYDYEVLQSRIRELAFLNKELEINLKDERTGASHSYKYEGGIISFVEYLNQNREPLNQPPIYVE--------GNKD--NIQVEIAIQYNDNFNENIYSFANNIHTHEGGTHESGFKSALTRVINDYARKTNVLKDSNSNLSGDDVREGIAAIISVKIPDPQFEGQTKTKLGNSEVRGIVESLLAEKLQEFLEENPSTAKRIMEKSMQAARAREAARKARELTRRKSALEVSSLPGKLADCSSKDAAISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDRILSNMEIRAIITALGTGISEDFDLSKARYHKIIIMTDADVDGAHIRTLLLTFFFRYMRKLIEAGYVYIAQPPLYKLEKNKTVRYAYNDKQRAEIMKEFGEGSKVNVQRYKGLGEMNAGQLWETTMDPESRTLLQVNIEDAIKADAIFDMLMGDNVEPRRNFIHEHAKYVTNLDV 636
>gi|145577993|gb|ABP82715.1| DNA topoisomerase II ATP-hydrolyzing DNA gyrase subunit B [Bacillus thuringiensis serovar alesti] (632 aa)
Score = 1702, Expect = 0.0e+00, Identities = 373/639 (58%), Positives = 470/639 (73%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRD  FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LL TF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAK+VKNLD
  S:     4 YDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDCHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLFTFFYRYMGQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKFVKNLD 632
>gi|190710595|gb|ACE95128.1| gyrase subunit B [Bacillus thuringiensis serovar pondicheriensis] (627 aa)
Score = 1702, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 473/637 (74%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N+Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710559|gb|ACE95110.1| gyrase subunit B [Bacillus thuringiensis serovar nigeriensis] (627 aa)
Score = 1702, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 471/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADEAFEILMGDKVEPRRNFIQENAKY 627
>gi|190710557|gb|ACE95109.1| gyrase subunit B [Bacillus thuringiensis serovar londrina] >gi|190710571|gb|ACE95116.1| gyrase subunit B [Bacillus thuringiensis serovar kurstaki] >gi|190710573|gb|ACE95117.1| gyrase subunit B [Bacillus thuringiensis serovar kurstaki] >gi|190710579|gb|ACE95120.1| gyrase subunit B [Bacillus thuringiensis serovar canadensis] >gi|190710583|gb|ACE95122.1| gyrase subunit B [Bacillus thuringiensis serovar jegathesan] >gi|190710585|gb|ACE95123.1| gyrase subunit B [Bacillus thuringiensis serovar yosoo] >gi|190710593|gb|ACE95127.1| gyrase subunit B [Bacillus thuringiensis serovar kurstaki] >gi|190710599|gb|ACE95130.1| gyrase subunit B [Bacillus thuringiensis serovar yunnanensis] >gi|190710603|gb|ACE95132.1| gyrase subunit B [Bacillus thuringiensis serovar galleriae] >gi|190710607|gb|ACE95134.1| gyrase subunit B [Bacillus thuringiensis serovar kumamotoensis] >gi|190710613|gb|ACE95137.1| gyrase subunit B [Bacillus thuringiensis serovar galleriae] (627 aa)
Score = 1701, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 471/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|124520299|ref|ZP_01695482.1| DNA gyrase, B subunit [Bacillus coagulans 36D1] >gi|124497789|gb|EAY45342.1| DNA gyrase, B subunit [Bacillus coagulans 36D1] (641 aa)
Score = 1699, Expect = 0.0e+00, Identities = 364/647 (56%), Positives = 471/647 (72%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ +K +Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G   EI + + K+ S  V+D+GRGIPV    K  +  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS+ L V+V+++   +Y +++ G KP  DLK+  E  + + GT   F PD EI  E  EFD D + +RL++LA+LNKGIKI   D+R  +  K+ + + GGIK +VE LN  KE +    +Y E E          K  I VEV+ QYN  + ++ ++F NNI+T EGG+HE GFK AL ++IN +A +  L+KE +  ++ ED  EGLTAIVSIKHP+PQ+EGQTK KLGN+E R     V SE FEK+++ENP+ A  I++K L+A  AR  + +ARE TRRKS  ES SLPGKLADC+++D   SELYIVEGDSAGGSAK GRDR+FQAILPL+GKI+NVEKA+ DKI SN EI  +ITA+G GVG +F I K RY+K+++MTDADVDG+HIR LLLTF +RYM PL++ G +YIA PPL+K   GK  +Y Y ++ LEE      ++ K  IQRYKGLGEMNP+QLWETTM+P NR +L+V+++DA+ AD  F +LMGD+V PRR FIE+NA YVKNLDI
  S:     4 EQLQKQSYGAEQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVWEIVDNSIDEALAGFCDEINVFIEKDNSITVKDNGRGIPVGIQEKVGRPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVYVHRDGHIYYQKYRRG-KPAFDLKIIGE--TDRTGTTTHFKPDPEIFTETTEFDFDILTTRLRELAFLNKGIKITIEDKREKNPRKQEYHYEGGIKSYVEHLNRSKEVLHKEPIYVEGE----------KDGITVEVSLQYNDGFASNIYSFANNIHTYEGGTHESGFKTALTRVINDYARKNNLIKENEANLTGEDVREGLTAIVSIKHPDPQFEGQTKTKLGNTEARTITDAVFSETFEKFMMENPQVARKIVEKGLMAARARMAAKKARELTRRKSALESTSLPGKLADCTSRDPAESELYIVEGDSAGGSAKQGRDRMFQAILPLRGKILNVEKARLDKILSNAEIRTIITALGTGVGEDFDISKARYHKVVIMTDADVDGAHIRTLLLTFFYRYMRPLIDAGYIYIAQPPLYKVQQGKRVEYVYSDRGLEELLNTLPAQPKPAIQRYKGLGEMNPEQLWETTMEPANRTMLQVSLDDAIEADGTFEMLMGDKVEPRRNFIEENAIYVKNLDI 641
>gi|190710601|gb|ACE95131.1| gyrase subunit B [Bacillus thuringiensis serovar neoleonensis] (627 aa)
Score = 1699, Expect = 0.0e+00, Identities = 372/637 (58%), Positives = 469/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  ++ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI+KNAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKVVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQKNAKY 627
>gi|190710547|gb|ACE95104.1| gyrase subunit B [Bacillus thuringiensis serovar alesti] (627 aa)
Score = 1698, Expect = 0.0e+00, Identities = 372/637 (58%), Positives = 469/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKRGHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710561|gb|ACE95111.1| gyrase subunit B [Bacillus thuringiensis serovar novosibirsk] (627 aa)
Score = 1698, Expect = 0.0e+00, Identities = 372/637 (58%), Positives = 466/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V DDGRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G P ADLKV  E  + + GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  II K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLL F +RYM  ++E G +YIA PPLFK   GK  +YAY+ K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIVVTDDGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGVPAADLKVIGE--TDRTGTITRFKPDSEIFTETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVDGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIIDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFAIEKARYHKVIIMTDADVDGAHIRTLLLMFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNNKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710577|gb|ACE95119.1| gyrase subunit B [Bacillus thuringiensis serovar kenyae] (627 aa)
Score = 1697, Expect = 0.0e+00, Identities = 370/637 (58%), Positives = 470/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y    I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDEGQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710605|gb|ACE95133.1| gyrase subunit B [Bacillus thuringiensis serovar galleriae] (627 aa)
Score = 1697, Expect = 0.0e+00, Identities = 370/637 (58%), Positives = 470/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+ +++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGHKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQASLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710567|gb|ACE95114.1| gyrase subunit B [Bacillus thuringiensis serovar toumanoffi] (627 aa)
Score = 1697, Expect = 0.0e+00, Identities = 372/637 (58%), Positives = 469/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSETFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|83588881|ref|YP_428890.1| DNA gyrase, B subunit [Moorella thermoacetica ATCC 39073] >gi|83571795|gb|ABC18347.1| DNA gyrase, B subunit [Moorella thermoacetica ATCC 39073] (634 aa)
Score = 1697, Expect = 0.0e+00, Identities = 347/643 (53%), Positives = 456/643 (70%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +N Y AS I+ILEGLEAVR+RPGMYIG+T ++GLH +V+E+VDNSIDEA+ G    I +T+ + GS  V D+GRGIPV+ H KT    VE  LT+LHAGGKF  + YKV+GGLHGVG SVVNALS WL++ V +  K ++ E++ G K V++LKV  +      GT V FYPD EI E   F  + I  RL++L++LN+G+KI F DER + + T+   GG+  +V  LN  K  +    +Y   E          K +++ E+A QYN  YN    ++ NNI+T EGGSHE GFK AL ++IN +A    LLK+ +  +S ED  EGLTA++S+K   PQ+EGQTK KLGN+EVR  V ++V+E    YL ENP     I+ K L A  AR+ + +ARE TRRK+  E  SLPGKLADC+ KD  ++EL++VEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI +NEEI  +ITA+G G+G +F I+K RY+K ILM DADVDGSHIR LLLTF +RYM PL+  G +YIA PPL+K   GK  +Y Y++  LE+F KE+   +++IQRYKGLGEMNP+QLWETTM+P++R LL+V +EDA+ AD +F++LMGD V PRREFI+++A  V+NLDI
  S:     5 RNEYDASQIQILEGLEAVRRRPGMYIGNTGVRGLHQLVFELVDNSIDEALAGFCDRIEVTIHENGSLTVADNGRGIPVDIHEKTGLPAVEVALTILHAGGKFGGNGYKVAGGLHGVGLSVVNALSEWLEIKVKRNGKIYHQEYRRGQK-VSELKVIGKTKG--TGTSVTFYPDGEIFEDLVFQDEIIGRRLQELSFLNRGVKIVFRDERNESETTYYHTGGLIDFVRHLNKNKTVLFNKPLYFSGE----------KDDVQAEIAIQYNDGYNELILSYANNIHTVEGGSHEIGFKTALTRVINDYARRFNLLKDAEANLSGEDIREGLTAVISVKVLEPQFEGQTKTKLGNTEVRGIVDSLVAENLSAYLEENPTIGRRIVDKALNAFRAREAARKARELTRRKNALEITSLPGKLADCTHKDPAMAELFLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKILNNEEIRTIITALGTGIGDDFNINKARYHKTILMADADVDGSHIRTLLLTFFYRYMRPLITEGYIYIAQPPLYKVYRGKVERYLYNDAELEKFLKEHEGERWEIQRYKGLGEMNPEQLWETTMNPESRTLLQVNLEDAMEADAIFNILMGDRVEPRREFIQQHAHEVRNLDI 634
>gi|190710551|gb|ACE95106.1| gyrase subunit B [Bacillus thuringiensis serovar sotto] >gi|190710565|gb|ACE95113.1| gyrase subunit B [Bacillus thuringiensis serovar sumiyoshiensis] >gi|190710591|gb|ACE95126.1| gyrase subunit B [Bacillus thuringiensis serovar sotto] (627 aa)
Score = 1697, Expect = 0.0e+00, Identities = 372/637 (58%), Positives = 469/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710589|gb|ACE95125.1| gyrase subunit B [Bacillus thuringiensis serovar darmstadiensis] (627 aa)
Score = 1696, Expect = 0.0e+00, Identities = 372/637 (58%), Positives = 469/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYANHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|163765005|ref|ZP_02172054.1| DNA topoisomerase (ATP-hydrolyzing) [Bacillus selenitireducens MLS10] >gi|160354543|gb|EDP81207.1| DNA topoisomerase (ATP-hydrolyzing) [Bacillus selenitireducens MLS10] (637 aa)
Score = 1696, Expect = 0.0e+00, Identities = 361/643 (56%), Positives = 464/643 (72%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET-FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + +Y  S I++LEGLEAVRKRPGMYIGST+ +GLHH+VWEIVDNSIDEAM G+ S I +T+ ++ +  V+DDGRGIPV  H K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALSS+L+V V+KE + HYI F+ G     +L V    ++ K GT++ F  D  I  E   +D D + +RL++L++LNKG+ I   D+R +DK   + + GGI  +VE LN  K  +    ++ E E          K  I+VEVA QYN ++ ++ ++F NNINT EGG+HE GFK AL ++IN +A +  L KE D  +  +D  EGLTAIVS+K  NPQ+EGQTK KLGNSE R    ++ +E   K++ ENP  A  I++K ++A  AR  + +ARE TRRKS  E +SLPGKLADCSTKD  ISE+Y+VEGDSAGGSAK GRDR FQAILPL+GKIINVEKA+ DKI +N EI  +ITA+G G+G EF I K RY+KII+MTDADVDG+HIR LLLTFL+RYM PL+E G +YIA PPL++   GK+  YA++EK +E    E ++  K  +QRYKGLGEMNP QLWETTMDP  R LL+V+++DA+ AD+VF  LMGD V PRR+FI++NA YVKNLDI
  S:     5 QQSYDESQIQVLEGLEAVRKRPGMYIGSTNERGLHHLVWEIVDNSIDEAMAGHCSHIWVTIEEDNTITVEDDGRGIPVGIHEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSSFLEVEVHKEGEVHYISFERGAVK-EELNVIG--STEKTGTLIRFKADNMIFTETTVYDFDVLANRLRELSFLNKGLTIEITDKREEDKSAKYFYEGGISSFVEHLNRTKTALHEPPIFIESE----------KEGIQVEVAMQYNDSFASNLYSFANNINTHEGGTHESGFKTALTRVINDYARKNGLFKENDPNLIGDDVREGLTAIVSVKIENPQFEGQTKTKLGNSEARTITDSLFTEHMAKFMAENPTVARQIVEKGIMASRARDAAKKARELTRRKSALEVSSLPGKLADCSTKDASISEIYVVEGDSAGGSAKQGRDRHFQAILPLRGKIINVEKARLDKILANNEIRAIITALGTGIGEEFDITKARYHKIIIMTDADVDGAHIRTLLLTFLYRYMRPLIEEGYIYIAQPPLYQIKQGKAVHYAFNEKEMERILGELSASPKPGLQRYKGLGEMNPTQLWETTMDPATRTLLQVSLKDAMLADEVFETLMGDRVEPRRDFIQENAHYVKNLDI 637
>gi|190710563|gb|ACE95112.1| gyrase subunit B [Bacillus thuringiensis serovar entomocidus] (627 aa)
Score = 1695, Expect = 0.0e+00, Identities = 369/637 (57%), Positives = 469/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDN IDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++ A+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNCIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPSVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQGAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710553|gb|ACE95107.1| gyrase subunit B [Bacillus thuringiensis serovar kyushuensis] (627 aa)
Score = 1695, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 469/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  ++ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKVVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|116490131|ref|YP_809655.1| DNA gyrase subunit B [Oenococcus oeni PSU-1] >gi|116090856|gb|ABJ56010.1| DNA gyrase subunit B [Oenococcus oeni PSU-1] (652 aa)
Score = 1695, Expect = 0.0e+00, Identities = 346/645 (53%), Positives = 465/645 (72%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD--DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAY---DEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +  N+Y  S+I+ILEGLEAVRKRPGMYIGST   GLHH+VWEI+DN IDEA+ G A  +T+T+ K+ S  + DDGRG+PVE   KT +  +E V T+LHAGGKFD+ SYKVSGGLHGVGASVVNALS  + V VY++ K +Y++F + G    ++K+ +E   +K GTIV F PD +I  E   FD  T+ SR+++LA+LNKG++++  D+R D    E+F++ GGI ++V+ LN  K+P+ P  VY E EE+           I+VEVA QY      +  +F NNI+T EGG+HE GFK AL +IIN +A +K +LK++D+ +S ED  EG+TAIVSIKHP+PQ+EGQTK KLGN++ +  V++  S IF ++++ENPE A  I  K L+A +AR  + +AR+ TR+KS  E ++L GKLAD +++D EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  DK+ +NEEI +L TA+G G G EF I K  Y+K+I+MTDADVDG+HIR LLLT  FRYM PL++ G +YIA PPL+  ++G S +  Y   DE+  +      +  K +IQRYKGLGEM+  QLW+TTMDPK+R LL+V  E     D  F +LMGD V PRREFIE NA++V++LD+
  S:    13 SDNNSYGGSSIQILEGLEAVRKRPGMYIGSTASSGLHHLVWEIIDNGIDEALAGFAHHVTLTIEKDNSITITDDGRGVPVEIQPKTGRPAMEAVFTILHAGGKFDSKSYKVSGGLHGVGASVVNALSKEMDVRVYRDNKIYYMDF-ERGHIKTEMKLLDEPMRLKRGTIVHFAPDPDIFRETIVFDYRTLASRIRELAFLNKGLRLSTTDKRVDPVKNESFMYEGGIAEYVKFLNKNKQPLFPEPVYVEGEEN----------GIQVEVALQYTDAVAETLMSFTNNIHTHEGGTHETGFKMALTRIINDYAKKKGILKDSDDPLSGEDVREGITAIVSIKHPDPQFEGQTKTKLGNTDAQQVVNHQFSTIFNRFMMENPETARAIANKGLIASKARAAAKKARDLTRKKSGLEISALAGKLADNTSRDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDKVLANEEIRSLFTAMGTGFGEEFDISKAHYHKVIIMTDADVDGAHIRTLLLTLFFRYMRPLIDAGYIYIAQPPLYGVAIGNSDQRVYLDSDEELDQYTATLPASPKPRIQRYKGLGEMDAVQLWDTTMDPKHRRLLRVDPEYQPEVDTTFDMLMGDRVEPRREFIEDNAQFVEDLDV 652
>gi|190710549|gb|ACE95105.1| gyrase subunit B [Bacillus thuringiensis serovar kenyae] (627 aa)
Score = 1694, Expect = 0.0e+00, Identities = 370/637 (58%), Positives = 470/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNA S+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNAPSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710611|gb|ACE95136.1| gyrase subunit B [Bacillus thuringiensis serovar morrisoni] (627 aa)
Score = 1693, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 468/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLK   +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKAIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710569|gb|ACE95115.1| gyrase subunit B [Bacillus thuringiensis serovar alesti] (627 aa)
Score = 1693, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 468/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++T LHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTALHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710575|gb|ACE95118.1| gyrase subunit B [Bacillus thuringiensis serovar kenyae] (627 aa)
Score = 1692, Expect = 0.0e+00, Identities = 369/637 (57%), Positives = 470/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP  +WETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTLIWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710609|gb|ACE95135.1| gyrase subunit B [Bacillus thuringiensis serovar morrisoni] (627 aa)
Score = 1692, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 468/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NN +T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNTHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710587|gb|ACE95124.1| gyrase subunit B [Bacillus thuringiensis serovar galleriae] (627 aa)
Score = 1691, Expect = 0.0e+00, Identities = 370/637 (58%), Positives = 470/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S +V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLH V ASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   +D DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E GN+YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQKKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHDVVASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGNIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|21228521|ref|NP_634443.1| DNA gyrase, subunit B [Methanosarcina mazei Go1] >gi|20907008|gb|AAM32115.1| DNA gyrase, subunit B [Methanosarcina mazei Go1] (634 aa)
Score = 1691, Expect = 0.0e+00, Identities = 351/645 (54%), Positives = 461/645 (71%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K  Y AS+I++LEGLEAVRKRP MYIGSTD +GLHH+V+E+VDNSIDEA+ G  SEI +T+   GS  V D+GRGIP++ H   KKS +E V+T+LHAGGKFD ++YKVSGGLHGVG SVVNALS W +V V ++ K+++  +  G KP +D++      +    T   F PD +I E  +F  D + +RL++LA+LN+G+ IN  D R+ +   ETF ++GGI ++VE LN +K+P+    +Y ER+            ++ VE+A QY   Y  + ++F NNINT EGG+H  GFK AL ++ N +    KL KE DEK++ +D  EGLTAI+S+K   PQ+EGQTK KLGNSEV+  V ++V++   +Y  ENP+ AN+I+ K LLA  AR+ + +ARE TRRKS  E ++LPGKLADCS K+    E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK++  KI  N E+I+LITAIG GV  +F ++  RY+KII+MTDADVDG+HIR LLLT  FRYM  L++ G VYIA PPL+K   GK   YAY +K L +  KE  +    IQRYKGLGEMNP QLWETTMDP++R LL+VT+EDA+ AD++F +LMGDEV PRR FIE +AK V +LDI
  S:     2 SDKQVYDASHIQVLEGLEAVRKRPSMYIGSTDGRGLHHLVYEVVDNSIDEALAGFCSEIDVTINPNGSVTVIDNGRGIPIDPHPVHKKSALEVVMTILHAGGKFDKNTYKVSGGLHGVGVSVVNALSEWTEVEVSRDGKKYFQRYIRG-KPESDVREIGTSDTTG--TKTTFKPDTKIFETTDFQYDILLNRLRELAFLNRGLIINLKDLRSPEGQAETFNYSGGIIEFVEYLNKKKQPLHEKPIYFERQRD----------DMVVEIAMQYTNGYTENVYSFANNINTHEGGTHIIGFKTALTRVANDYIKANKLSKE-DEKLTGDDVREGLTAIISVKLMEPQFEGQTKTKLGNSEVKGIVDSLVTDGLAEYFEENPKVANIILDKALLAQRAREAAKKARELTRRKSALEVSTLPGKLADCSNKNPAECEIYIVEGDSAGGSAKQGRDRSFQAILPLRGKILNVEKSRLAKILKNNEVISLITAIGTGVSEDFDLENARYHKIIIMTDADVDGAHIRTLLLTLFFRYMRHLIDAGYVYIAQPPLYKIKKGKMDYYAYSDKELADKLKELGEKGVAIQRYKGLGEMNPGQLWETTMDPESRTLLQVTLEDAIRADEIFRVLMGDEVEPRRNFIETHAKEVVDLDI 634
>gi|190710597|gb|ACE95129.1| gyrase subunit B [Bacillus thuringiensis serovar morrisoni] (627 aa)
Score = 1689, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 468/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K  Y ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIQYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|190710581|gb|ACE95121.1| gyrase subunit B [Bacillus thuringiensis serovar sotto] (627 aa)
Score = 1688, Expect = 0.0e+00, Identities = 371/637 (58%), Positives = 468/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N Y  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G   EI +++ ++ S  V D+GRGIPV    K  +  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V+++ K HY ++ + G PVADLKV  +  + K GTI  F PD EI  E  E++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEVA QYN+ Y N  ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I+ K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E G +YIA PPLFK   GK  +YAY++K LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR  I++NAKY
  S:     1 ENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSILVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHRDGKIHYQKY-ERGIPVADLKVIGD--TDKTGTITRFKPDPEIFKETTEYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVALQYNEGYTNHIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNNILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVDKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIECGYIYIAQPPLFKVQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNSIQENAKY 627
>gi|172056050|ref|YP_001812510.1| DNA gyrase, B subunit [Exiguobacterium sibiricum 255-15] >gi|171988571|gb|ACB59493.1| DNA gyrase, B subunit [Exiguobacterium sibiricum 255-15] (643 aa)
Score = 1687, Expect = 0.0e+00, Identities = 358/640 (55%), Positives = 457/640 (71%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A  I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G    I +T+    S  V+D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V +  K +Y  +  G  P ADL++     S + GT++ F+PD EI  E  E+D D + +RL++LA+LNKG+ I   D+R D+    +F + GGIK +VE LN  KE +         EE V    N+D   I VEVA QYN  +  + ++F NNI T EGG+HE GFK AL ++IN +A +  L+KE D  +S ED  EG+TAIVSIKHPNPQ+EGQTK KLGNS+ R     + S  FE++++ENP  A  I++K ++A  AR  +  ARE TRRK   E +SLPGKLADCS++D  ISE+YIVEGDSAGGSAK GRDR FQAILP++GKI+NVEKA+ DKI  N EI  +ITA+G  +G EF I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM PL+E+G VYIA PPL+    GK+  Y ++E+ L E         +Y IQRYKGLGEM+P+QLWETTMDP  R +L+V ++DA+ AD+VF +LMGD+V PRR+FI+ +A YVKNLDI
  S:    13 YGADQIQVLEGLEAVRKRPGMYIGSTASKGLHHLVWEIVDNSIDEALAGYCDTIKVTIEPGNSILVEDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLEVFVKRNEKLYYQAYHRG-VPAADLEIIG--TSEETGTMIRFFPDDEIFQETLEYDYDLLATRLRELAFLNKGLTIEITDDRADEPITRSFHYEGGIKSYVEHLNRSKEVV--------HEEPVYVHGNRD--GIEVEVALQYNDGFAANIYSFTNNIPTHEGGTHETGFKTALTRVINDYAKKFGLMKEADGTLSGEDVREGMTAIVSIKHPNPQFEGQTKTKLGNSDARTATDTLFSSAFEQFMMENPTSARAIVEKGMMASRARMAAKRARELTRRKGVLEVSSLPGKLADCSSRDATISEIYIVEGDSAGGSAKSGRDRHFQAILPIRGKILNVEKARLDKILGNNEIRTIITALGTSIGSEFNIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRPLVEHGYVYIAQPPLYGIKQGKNITYVHNERELNEALAALPENARYDIQRYKGLGEMDPEQLWETTMDPSGRQMLRVELQDAIEADEVFDILMGDQVEPRRDFIQSHAHYVKNLDI 643
>gi|190710555|gb|ACE95108.1| gyrase subunit B [Bacillus thuringiensis serovar monterrey] (627 aa)
Score = 1686, Expect = 0.0e+00, Identities = 368/637 (57%), Positives = 471/637 (73%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT-DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           +N+Y  S I++LEGLEAVRKRPGMYI ST  KGLHH+VWEIVDNSIDEA+ G   +I +++ +  S +V D+GRGIPV    K  +  V+ ++TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E K HY ++ + G PVADLKV  +  + + GTI  F PD EI  E   ++ DT+ +R+++LA+LN+ IK+   D+R    K+ F + GGIK +VE LN  K+PI         EE V    +KD   I+VEV+ QYN+ Y N+ ++F NNI+T EGG+HE GFK AL ++IN +  +  +LK+ D  ++ ED  EGLTAIVSIKHPNPQ+EGQTK KLGNSE R    +V SE FEK+LLENP  A  I++K  +A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD  ISE+YIVEGDSAGGSAK GRDR FQAILPLKGKIINVEKA+ DKI SN+E+  +ITAIG  +G +F I+K RY+K+I+MTDADVDG+HIR LLLTF +RYM  ++E+G +YIA PPLFK   GK  +YAY+EK LE+   E  ++ K  IQRYKGLGEMNP QLWETTMDP+ R LL+V+++DA+ AD+ F +LMGD+V PRR FI++NAKY
  S:     1 ENSYDESQIQVLEGLEAVRKRPGMYIASTSGKGLHHLVWEIVDNSIDEALAGYCDQINVSIEEYNSIRVTDNGRGIPVGIQEKMGRPAVKVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKY-ERGIPVADLKVIGD--TDQTGTITRFKPDPEIFQETTVYEFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEFHYEGGIKSYVEHLNRSKQPI--------HEEPVYVEGSKD--GIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELPAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKY 627
>gi|15893304|ref|NP_346653.1| DNA gyrase subunit B [Clostridium acetobutylicum ATCC 824] >gi|18273027|sp|P94604|GYRB_CLOAB DNA gyrase subunit B >gi|15022823|gb|AAK77993.1|AE007513_6 DNA gyrase (topoisomerase II) B subunit [Clostridium acetobutylicum ATCC 824] (637 aa)
Score = 1685, Expect = 0.0e+00, Identities = 354/644 (54%), Positives = 456/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K   Y  S I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G  S I + + K+ S  V DDGRG+P+  H K KK TVE ++T+LHAGGKF   +Y+VSGGLHGVGASVVNALS   +V V  E   +K+ Y      GK  +  +   +  S ++GT + F PD EI E  E+D DT+  RL++LA+LNKGIKI   DER D  E F + GG+K +V  LN  KE +    +Y   E S+ +       N  VE+A QYN  YN + F+F NNI+T EGG+H  GFK AL ++IN +A +   LKE D+ +S ED  EGLTA+VS+K   PQ+EGQTK KLGN+EVR  V +++SE    YL ENP+   ++I K L+A  AR+ + +ARE TRRKS  ES SLPGKLADCS+KD E  E+YIVEGDSAGGSAK GR+R FQAILPL+GKI+NVEK + DKI ++EEI  + TA G G+G +F + KLRY+KII+MTDADVDG+HIR L+LTF +RYM  L+  G+V+IA PPL+K +  +   YAY +K LE+  ++         IQRYKGLGEMNP+QLWETTM+P+ R L+KV IEDA+ AD++F++LMGD+V PRR+FIE+NA  V NLD+
  S:     4 KNEIYDESQIQVLEGLEAVRKRPGMYIGSTGTRGLHHLVYEIVDNSIDEALAGYCSHIKVFIHKDNSVTVSDDGRGMPIGIHHKMKKPTVEVIMTILHAGGKFGGGAYRVSGGLHGVGASVVNALSETCEVEVKTEGHIWKQTYHR----GKVASPFEKIGD--SDEHGTKIYFKPDPEIFEDTEYDYDTLSQRLRELAFLNKGIKIELTDERHDKNEIFHYEGGLKSFVSYLNRNKEVVFKEPIY--VEGSIDS-------NYSVEIALQYNDGYNENIFSFANNIHTIEGGTHLAGFKTALTRVINDYAKKFGYLKENDKNLSGEDIREGLTAVVSVKLTEPQFEGQTKTKLGNTEVRGIVDSIISERVSTYLEENPQIGKLVIDKALVASRAREAAKKAREITRRKSVLESTSLPGKLADCSSKDAEECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQRIDKILNSEEIKAMATAFGGGIGKDFDVSKLRYHKIIIMTDADVDGAHIRTLILTFFYRYMTELISEGHVFIAQPPLYKVTKTRKEYYAYSDKELEDVLQDVGGKDKNTDIQRYKGLGEMNPEQLWETTMNPEQRTLIKVNIEDAMAADEIFTILMGDKVDPRRKFIEENATKVVNLDV 637
>gi|1790875|gb|AAB41130.1| DNA gyrase subunit B (637 aa)
Score = 1683, Expect = 0.0e+00, Identities = 353/644 (54%), Positives = 456/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K   Y  S I++LEGLEAVRKRPGMYIG+T  +GLHH+V+EIVDNSIDEA+ G  S I + + K+ S  V DDGRG+P+  H K KK TVE ++T+LHAGGKF   +Y+VSGGLHGVGASVVNALS   +V V  E   +K+ Y      GK  +  +   +  S ++GT + F PD EI E  E+D DT+  RL++LA+LNKGIKI   DER D  E F + GG+K +V  LN  KE +    +Y   E S+ +       N  VE+A QYN  YN + F+F NNI+T EGG+H  GFK AL ++IN +A +   LKE D+ +S ED  EGLTA+VS+K   PQ+EGQTK KLGN+EVR  V +++SE    YL ENP+   ++I K L+A  AR+ + +ARE TRRKS  ES SLPGKLADCS+KD E  E+YIVEGDSAGGSAK GR+R FQAILPL+GKI+NVEK + DKI ++EEI  + TA G G+G +F + KLRY+KII+MTDADVDG+HIR L+LTF +RYM  L+  G+V+IA PPL+K +  +   YAY +K LE+  ++         IQRYKGLGEMNP+QLWETTM+P+ R L+KV IEDA+ AD++F++LMGD+V PRR+FIE+NA  V NLD+
  S:     4 KNEIYDESQIQVLEGLEAVRKRPGMYIGTTGTRGLHHLVYEIVDNSIDEALAGYCSHIKVFIHKDNSVTVSDDGRGMPIGIHHKMKKPTVEVIMTILHAGGKFGGGAYRVSGGLHGVGASVVNALSETCEVEVKTEGHIWKQTYHR----GKVASPFEKIGD--SDEHGTKIYFKPDPEIFEDTEYDYDTLSQRLRELAFLNKGIKIELTDERHDKNEIFHYEGGLKSFVSYLNRNKEVVFKEPIY--VEGSIDS-------NYSVEIALQYNDGYNENIFSFANNIHTIEGGTHLAGFKTALTRVINDYAKKFGYLKENDKNLSGEDIREGLTAVVSVKLTEPQFEGQTKTKLGNTEVRGIVDSIISERVSTYLEENPQIGKLVIDKALVASRAREAAKKAREITRRKSVLESTSLPGKLADCSSKDAEECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQRIDKILNSEEIKAMATAFGGGIGKDFDVSKLRYHKIIIMTDADVDGAHIRTLILTFFYRYMTELISEGHVFIAQPPLYKVTKTRKEYYAYSDKELEDVLQDVGGKDKNTDIQRYKGLGEMNPEQLWETTMNPEQRTLIKVNIEDAMAADEIFTILMGDKVDPRRKFIEENATKVVNLDV 637
>gi|28896290|ref|NP_802640.1| DNA gyrase subunit B [Streptococcus pyogenes SSI-1] >gi|161485752|ref|NP_664280.2| DNA gyrase subunit B [Streptococcus pyogenes MGAS315] >gi|73919729|sp|Q8K840|GYRB_STRP3 DNA gyrase subunit B >gi|28811541|dbj|BAC64473.1| putative DNA gyrase B subunit [Streptococcus pyogenes SSI-1] (650 aa)
Score = 1682, Expect = 0.0e+00, Identities = 355/646 (54%), Positives = 458/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF   SYKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL+V          T V F PD EI  E  +FD   +  R+++LA+LN+G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQVKTGRPAVETVFTVLHAGGKFGGGSYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEVIGTTDVTG--TTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 650
>gi|196191597|gb|EDX86561.1| DNA gyrase, B subunit [Synechococcus sp. PCC 7335] (645 aa)
Score = 1681, Expect = 0.0e+00, Identities = 340/631 (53%), Positives = 446/631 (70%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDS-YKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD----DKET---FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIE 638
           N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDN++DEA+ G+ + IT  L  +GS  V DDGRGIP + H  T KS +ETVLTVLHAGGKF  DS YKVSGGLHGVG SVVNALS W++V V++E K H   F+ G  P+  LK +  K S K GT V F PD  I     EFD DTI  RL++LAYLN G+ I F D R D    DK     + + GGI+++VE +NNEKEP+ P ++Y           N DK  ++VE A Q+    ++++   F NNI T +GG+H EG K  L + +N  A ++K  K+T+  ++ E+  EGLTA+VS+K P+P++EGQTK KLGN+EVR  V ++V E   +YL  NP  A+ I++K + A  A + + +AR+  RRKS  ES++LPGKL+DCS++D   SE++IVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N E+ +LITA+G G+ G +F  D LRY++I LMTDADVDG+HIR LLLTF +RY   L++ G +YIACPPL+K   GK+  Y Y EK L++      +  KY IQR+KGLGEM P QLW+TTM+P+ R L +V IEDA  AD++F++LMGD VAPRR+FIE
  S:     3 NNYGAQQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNAVDEALAGHCTHITAALNADGSVTVTDDGRGIPTDIHPTTGKSALETVLTVLHAGGKFGGDSGYKVSGGLHGVGVSVVNALSEWVEVTVWREGKVHTQRFEQG-NPIGKLKTS--KGSTKTGTQVTFKPDATIFTHTVEFDYDTIARRLRELAYLNAGVDITFTDYRLDLIKADKPQVSHYFYEGGIREYVEYINNEKEPLHPDVIY----------VNSDKNGVQVEAALQWCGDAFSDNLMGFANNIRTVDGGTHLEGLKTVLTRTMNVIARKRKKRKDTESNMAGENIREGLTAVVSVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGEALTEYLDFNPSVADAILEKAIQAFNAAEAAKKARDLVRRKSVLESSTLPGKLSDCSSRDPGESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNNEVQSLITALGLGIKGEDFAPDTLRYHRICLMTDADVDGAHIRTLLLTFFYRYQRDLVDQGYIYIACPPLYKLERGKNHTYCYSEKELQDGIDAMPTNAKYNIQRFKGLGEMMPQQLWDTTMNPETRTLKRVEIEDAAEADRIFTVLMGDRVAPRRDFIE 632
>gi|91772465|ref|YP_565157.1| DNA gyrase subunit B [Methanococcoides burtonii DSM 6242] >gi|91711480|gb|ABE51407.1| DNA gyrase subunit B [Methanococcoides burtonii DSM 6242] (632 aa)
Score = 1679, Expect = 0.0e+00, Identities = 341/642 (53%), Positives = 455/642 (70%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + Y A++I++LEGLEAVRKRP MYIGS D +GLHH+V+E+VDNSIDEA+ G    I +++  +GS  V DDGRGIPV+ H K KKS +E VLTVLHAGGKFD  +YKVSGGLHGVG SVVNALS W++V V ++ K +Y  ++ G  P +D+ V  +      GT   F PD +I E  EF   T+ +RL++LA+LNKGI+I   D R ++  ++ F + GGI  +VE LN  +  +  T +Y ERE          K    VE+A QY  +Y    ++F NNINT EGG+H  GFK AL ++ N + ++K  + + DEK++ ED  EGL AI+S+K   PQ+EGQTK KLGNSE++  V ++VSE   +Y+ ENP+ A +I +K L A  AR+ + +ARE TRRKS  E  +LPGKLADCS KD  +SE+Y+VEGDSAGGSAK GR+R FQAILP +GKIINVEKA+  K+  N E+++LITA+G G+  ++ I+K RY+K+I+MTDADVDG+HIR L+LTF FRYM PL++ G VYIA PPL++   GK+  Y Y ++ L    +E  +    +QRYKGLGEMNP+QLWETTM+P  R LL+VT++DA  AD++FS+LMGDEVAPR+ FI+K AK V NLD+
  S:     3 DDYDATHIQVLEGLEAVRKRPSMYIGSVDTRGLHHLVYEVVDNSIDEALAGFCKNIDVSINADGSVTVVDDGRGIPVDNHPKYKKSALEVVLTVLHAGGKFDKSNYKVSGGLHGVGVSVVNALSEWMEVEVKRDGKLYYQRYERGA-PTSDVTVIGDAKG--TGTKSTFMPDSQIFETTEFSYGTLITRLRELAFLNKGIRITITDSREEELEQDVFEYEGGIISFVEHLNQSRTALHKTPIYFERE----------KEGTIVEIAMQYTDSYGEYVYSFANNINTYEGGTHLIGFKTALTRVANDY-IKKNNVVKGDEKLTGEDIREGLAAIISVKLTEPQFEGQTKTKLGNSELKGIVDSMVSEGLSEYMEENPKVAVIIFQKALDARRAREAAKKARELTRRKSALEIGTLPGKLADCSEKDPSVSEVYLVEGDSAGGSAKQGRNRRFQAILPFRGKIINVEKARLSKVLKNNEVLSLITAMGTGIAEDYNIEKARYHKVIIMTDADVDGAHIRTLILTFFFRYMAPLIDAGYVYIAQPPLYRIKKGKAEHYVYSDRELAAKLEEIGENNTYVQRYKGLGEMNPEQLWETTMNPDTRTLLQVTMDDAAAADEMFSVLMGDEVAPRKAFIQKYAKEVVNLDL 632
>gi|89209970|ref|ZP_01188363.1| DNA gyrase, B subunit [Halothermothrix orenii H 168] >gi|89160310|gb|EAR79965.1| DNA gyrase, B subunit [Halothermothrix orenii H 168] (637 aa)
Score = 1678, Expect = 0.0e+00, Identities = 346/640 (54%), Positives = 447/640 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A  I+IL+GLEAVRKRPGMYIGST I+GLHH+VWE+VDNSIDE + G   +I +T+ ++ S  V+D GRGIP E+H +T     + V+T LHAGGKF+N+SYKVSGGLHGVG SVVNALS WL++  Y    E+Y  ++ G       K      S +NGTI+ F PD EI +  EF  +T+  RL++ A+LNK + +  ID+R+D   KE F + GGIK +VE LN  ++ I   I+Y E+E       N D Y   +EVA QYN+ YN   F++ NNINT +GG H  GFK AL K IN FA +  LLK++D  ++  D  EGLTA+V++K PNPQ+EGQTK KLGNSE+R  V + + +    YL  NPE    I+ K + A+ AR+ S +ARE TRRK+   S+SLPGKLADC+++  E SEL++VEGDSAGGSAK GR+R FQAILPLKGKI+NVE+A+ DKI SN EI  +I+A+G G+G EF IDKLRY+KII+MTDADVDG+HI  LLLT  +RYM  L++ G +YIA PPL+K S  K+ +Y Y +K LE  K+E     Y IQRYKGLGEMNP QLWETTM+P+ R LL++ I+D + AD++F+ LMG   + RREFI  NA  V  LDI
  S:     9 YGAEQIEILKGLEAVRKRPGMYIGSTGIRGLHHLVWEVVDNSIDEYLAGYGDKIEVTINEDNSITVEDWGRGIPAEEHPETGLPAAQVVMTTLHAGGKFNNNSYKVSGGLHGVGISVVNALSEWLELTTYWNGNEYYQRYERG---YPKTKFQKLGTSNRNGTIISFKPDPEIFDVTEFKYETLAHRLQESAFLNKELSLILIDKRSDKTKKEVFQYDGGIKAFVEYLNKNRQVINEDIIYTEKE-------NGDYY---IEVALQYNEGYNERIFSYANNINTVDGGYHLTGFKTALTKAINNFAKQNNLLKQSDPTLTGNDVREGLTAVVNVKLPNPQFEGQTKSKLGNSEIRSIVESNIYDYLSLYLDSNPEVGKKIVDKAIQAIRARQASKKARELTRRKNALNSHSLPGKLADCASRKPEKSELFLVEGDSAGGSAKQGRNRHFQAILPLKGKIMNVERARLDKILSNNEIATIISALGTGIGQEFNIDKLRYHKIIIMTDADVDGAHIATLLLTLFYRYMPELIKEGYIYIAQPPLYKVSWKKNIRYLYTDKELESLKRELENKSYSIQRYKGLGEMNPRQLWETTMNPETRKLLRIEIDDEIEADEIFTRLMGSNASLRREFIISNADMVDELDI 637
>gi|169187367|ref|ZP_02847526.1| DNA gyrase, B subunit [Paenibacillus sp. JDR-2] >gi|169005376|gb|EDS52228.1| DNA gyrase, B subunit [Paenibacillus sp. JDR-2] (635 aa)
Score = 1673, Expect = 0.0e+00, Identities = 357/645 (55%), Positives = 463/645 (71%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +++NTY  S I++LEGLEAVRKRPGMYIGST  KGLHH+VWE+VDNSIDEA+ G  ++I + + ++ S  V D+GRGIPV ++AK KKST+E V+TVLHAGGKF  + YKVSGGLHGVG SVVNALS  + V V      +  E++ G  P  D+K+  E  S + GT V+F PD EI  +   ++ +T++SR+++LA+LNKG++I  IDERT    +F + GGI ++V+ LN  KE +         EE +    +KD  +I+VEV+ QYN  Y  +  +F NNINT EGG+HE GFK AL +IIN +A +  L+K+ D   S +D  EGLTAI+S+K P PQ+EGQTK KLGNSEVR  V +  +E  +++L ENP  +  I++K L A  AR+ + +ARE TRRKS  E +SLPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVE+A+ D+I  N EI  +ITA+G G+G +F + K RY+K+I+MTDADVDG+HIR L+LTF FRYM  ++E G +YIA PPLFK    K  +YA  EK  EE   E     K  +QRYKGLGEMN  QLWETTMDP++R +L+V+IEDA+ AD +F  LMGD V PRR+FI++ AK VKNLDI
  S:     2 SQQNTYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEVVDNSIDEALAGYCTKIQVRVHEDNSITVIDNGRGIPVGENAKLKKSTLEVVMTVLHAGGKFGGEGYKVSGGLHGVGVSVVNALSEHVTVTVKLHGNVYQQEYRRG-VPQYDVKIIGE--SDETGTTVKFKPDPEIFTDTTVYEYETLQSRIRELAFLNKGLEIELIDERTGTSNSFKYDGGIIEFVKHLNRNKEVM--------HEEPIYVEGSKD--HIQVEVSLQYNDGYTENIHSFANNINTHEGGTHESGFKSALTRIINDYARKTGLIKDNDSNFSGDDVREGLTAIISVKIPEPQFEGQTKTKLGNSEVRGIVESFFAEKLQEFLDENPSVSRKIVEKGLQAARAREAARKARELTRRKSALEVSSLPGKLADCSSKDASISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVERARLDRILGNAEIRAIITALGTGIGDDFDLAKARYHKVIIMTDADVDGAHIRTLMLTFFFRYMRKIIEAGYIYIAQPPLFKIERNKVIRYAQSEKEREEIIAEFGEGAKVNVQRYKGLGEMNATQLWETTMDPESRTMLQVSIEDAIEADVIFDTLMGDNVEPRRDFIQQFAKDVKNLDI 635
>gi|167629176|ref|YP_001679675.1| DNA gyrase, b subunit [Heliobacterium modesticaldum Ice1] >gi|167591916|gb|ABZ83664.1| DNA gyrase, b subunit [Heliobacterium modesticaldum Ice1] (641 aa)
Score = 1672, Expect = 0.0e+00, Identities = 339/642 (52%), Positives = 453/642 (70%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++Y AS I++LEGLEAVR+RPGMYIGST  +GLHH+V+EIVDNSIDEA+ G  + I + +  + S +V D+GRGIPV+ H K  K  VE  LTVLHAGGKF  + YKVSGGLHGVG SVVNALS  L+V V +  K H   + + G   ++L+V  +  S + GT + F PD +I +  E+  DT+  RL++L++LN+G++I   D+R+  +  F  +GGI  +V+ LN  K+ I   ++Y + E          K  + VEVA QYN  Y  + F++ NNINT EGG+HE GFK AL +++N++A     LK+ +  +S ED  EG+TA++S+K   PQ+EGQTK KLGNSEVR  + + V+E    YL E+P  A  II+K + AM AR+ + +ARE TRRK+  ES SLPGKLADCS KD  + ELY+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEK++ DK+ SNEEI  +ITA+G G+G +F + K RY++I LMTDADVDGSHIR LLLTF +R+M PL+ENG VYIA PPL++    +  +Y Y +  L  + ++  +    IQRYKGLGEMNP+QLWETTMDPKNR +L+V++EDA  A+ +F+ LMGD V PRR+FI+ +AK V+NLDI
  S:    13 SSYDASQIQVLEGLEAVRRRPGMYIGSTSARGLHHLVYEIVDNSIDEALAGYCNRIDVIIHDDNSIEVIDNGRGIPVDIHPKMGKPAVEVALTVLHAGGKFGGEGYKVSGGLHGVGLSVVNALSEKLRVTVRRNGKIHEQHY-ERGVATSELRVVGQ--SKETGTTIYFKPDPQIFDELEYSYDTLSHRLRELSFLNRGVRITLTDKRSGQESVFAHSGGIVDFVKFLNRNKDVIHNEVIYFQTE----------KDGVHVEVALQYNDGYVENLFSYANNINTQEGGTHEAGFKTALTRVVNEYARRLNQLKDNENNLSGEDIREGITAVISVKVREPQFEGQTKTKLGNSEVRGIIDSCVTEGVGTYLEEHPSIAKRIIEKAIGAMRAREAARKARELTRRKTALESTSLPGKLADCSFKDPSLCELYLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDKVLSNEEIRAIITAMGTGIGEDFDLSKARYHRICLMTDADVDGSHIRTLLLTFFYRHMKPLIENGYVYIAQPPLYQVKKNRDVRYFYHDNELNRYLEKTGRDGVTIQRYKGLGEMNPEQLWETTMDPKNRTILQVSLEDAAEAELIFTTLMGDRVEPRRDFIQSHAKDVRNLDI 641
>gi|5817861|gb|AAD52967.1|AF167102_1 DNA gyrase beta subunit [Acholeplasma laidlawii] (615 aa)
Score = 1669, Expect = 0.0e+00, Identities = 344/619 (55%), Positives = 455/619 (73%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGD 628
           Y+A NI+ILEGLEAV+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A EITI + K    +V D+GRGIPV+ H KTK+  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+   Y++ Y    + G P  DLKV  + ++ K+GTI+ F  D  I  E   ++ +T+++R++QLA+LNKG+K+N ID+R ++   E+F + GGI ++V+ LN  K  I   I+Y ++E+            I VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL  +I+K+A + K+ K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++L+ENP  A  I++K LLA  AR  + +A++ TRRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I K RY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K S G++ +Y Y+E+ L E  K   + K  IQRYKGLGEM+ +QLW+TTMDP  R LL++ +EDA+ AD+VFS+LMG+
  S:     9 YTADNIQILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALCGYADEITIEILKGEVIRVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEWFVVEIHKDGTIYEQKY----ERGIPAYDLKV--KGSTDKSGTIISFQADPLIFTETVIYNYETLRTRIQQLAFLNKGLKLNLIDDRFEENKSESFHYEGGITEYVKFLNQSKSKIHNDIIYIDKEQD----------GITVELAMQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALSAVISKYADDLKMKK--DDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEAIERFLMENPAQAKAIVEKVLLATRARVAARKAKDLTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKISWGRNFQYRYNEQELNELLK-TIETKPSIQRYKGLGEMDAEQLWDTTMDPAKRTLLQIKLEDAIEADQVFSMLMGE 614
>gi|51891144|ref|YP_073835.1| DNA gyrase B subunit [Symbiobacterium thermophilum IAM 14863] >gi|51854833|dbj|BAD38991.1| DNA gyrase B subunit [Symbiobacterium thermophilum IAM 14863] (638 aa)
Score = 1669, Expect = 0.0e+00, Identities = 337/639 (52%), Positives = 449/639 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           Y+   I++LEGLEAVR+RPGMYIG T  +GLHH++WEI+DN++DE + G   +I +TL  +GS  V D+GRGIPV+ H KT  STVETV T+LHAGGKF   +YKVSGGLHGVGA+VVNALS  L + V +    + +EF +GGK +  L+   +  + ++GT V F+PD EI E  EFD++ I +RL+  A+LN+G+ I FIDE+   +  F +  G++ +V+ LN  +EP+    +Y       KA + ++     +E+A QY   Y+ +  +F NNI T EGG+HE G K AL ++IN +A + KLLK+ ++ +S ED  EG+TAI+S+K   PQ+EGQTK KLG+SE+  FV+  VSE    +L ENP  A  I++K L A  AR+ + +ARE  RRKS  E  +LPGKL DC+++D   SEL++VEGDSAGGSAK+GRDR  QA+LPL+GKI+NVEKA+ DKI SNEEI  LITA+GAG+G +F I K RY+K+I+MTDADVDGSHIR LLLTF FR+M PL+E G +YIA PPL+    GK   YAY E+  ++       V  + QRYKGLGEMNP+QLWETTMDP  R+L KVT+EDA  A  +F  LMG++V PRREFI++NA  V+NLD
  S:     9 YTGEQIQVLEGLEAVRRRPGMYIGGTSQRGLHHLIWEIIDNAVDERLAGFCDKIVVTLHSDGSVSVSDNGRGIPVDIHPKTGISTVETVYTMLHAGGKFGGGAYKVSGGLHGVGAAVVNALSRKLYIQVKQNGGVYEVEFANGGKTLYPLRRVGD--TKEHGTYVRFWPDPEIFESVEFDSEAIVTRLRDTAFLNQGLFIQFIDEKAGAEYRFKYNEGLQTFVQYLNRSREPLHAKPIY-----VFKATDTQE-----MELAIQYTDAYSENILSFANNIRTVEGGTHETGLKTALTRVINSYARKYKLLKDNEDNLSGEDIREGMTAILSVKLQEPQFEGQTKTKLGSSEMETFVAAAVSEGLSDFLEENPAIAKRIVEKALSAARAREAARKARELVRRKSALEITALPGKLTDCTSRDPSESELFLVEGDSAGGSAKMGRDRRIQAVLPLRGKILNVEKARLDKILSNEEIRTLITAVGAGIGDDFDISKCRYHKVIIMTDADVDGSHIRTLLLTFFFRFMRPLIEAGYLYIASPPLYMIRKGKQVYYAYSEQEKDQVIARIGGVTDKPQRYKGLGEMNPEQLWETTMDPSKRILYKVTMEDAAEATALFETLMGEKVEPRREFIQRNAHLVQNLD 635
>gi|29374666|ref|NP_813818.1| DNA gyrase subunit B [Enterococcus faecalis V583] >gi|29342124|gb|AAO79890.1| DNA gyrase, B subunit [Enterococcus faecalis V583] (642 aa)
Score = 1667, Expect = 0.0e+00, Identities = 357/644 (55%), Positives = 462/644 (71%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-----FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +   Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A  I + +  + S  V DDGRGIPV   AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK+ K +Y E++ G   V DLKV  E  + ++GT V F PD EI  E   +D D + +R+++LA+LN+G+ I+  D R   +DK+ + + GGIK +VE LN  K+ I P  ++ E E+           +I VEV+ QY   Y+++  +F NNI+T EGG+HE GFK +L ++IN +A ++KL+KE DEK++ ED  EGLTA+VSIKHP+PQ+EGQTK KLGNSEVR     + SE F K+L+ENP     I++K +LA +AR  +  ARE TRRK   E ++LPGKLADCS+KD E  EL+IVEGDSAGGSAK GR R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY+K+++MTDADVDG+HIR LLLT  +R+M P++E G VYIA PPL+    GK+  Y    K  EE      ++  +  K  +QRYKGLGEM+  QLWETTMDP+ RL+ +V+++DA+ AD++F +LMGD V PRR FIE+NA YVKNLDI
  S:     4 RAQEYDASQIQVLEGLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAV-VDDLKVIEE--TDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGGIKSYVEHLNANKDVIFPEPIFIEGEQQ----------DITVEVSMQYTDGYHSNILSFANNIHTYEGGTHESGFKTSLTRVINDYARKQKLMKENDEKLTGEDVREGLTAVVSIKHPDPQFEGQTKTKLGNSEVRTVTDRLFSEYFTKFLMENPTVGKQIVEKGMLASKARLAAKRAREVTRRKGALEISNLPGKLADCSSKDPEKCELFIVEGDSAGGSAKQGRSREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGEDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRFMRPIVEAGYVYIAQPPLYGVKQGKNITYVQPGKHAEEELAKVLEELPASPKPSVQRYKGLGEMDDHQLWETTMDPEKRLMARVSVDDAIEADQIFEMLMGDRVEPRRAFIEENAHYVKNLDI 642
>gi|15982567|dbj|BAB69478.1| DNA gyrase B subunit [Enterococcus faecalis] (649 aa)
Score = 1664, Expect = 0.0e+00, Identities = 358/648 (55%), Positives = 463/648 (71%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-----FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N   +   Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A  I + +  + S  V DDGRGIPV   AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK+ K +Y E++ G   V DLKV  E  + ++GT V F PD EI  E   +D D + +R+++LA+LN+G+ I+  D R   +DK+ + + GGIK +VE LN  K+ I P  ++ E E+           +I VEV+ QY   Y+++  +F NNI+T EGG+HE GFK +L ++IN +A ++KL+KE DEK++ ED  EGLTA+VSIKHP+PQ+EGQTK KLGNSEVR     + SE F K+L+ENP     I++K +LA +AR  +  ARE TRRK   E ++LPGKLADCS+KD E  EL+IVEGDSAGGSAK GR R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY+K+++MTDADVDG+HIR LLLT  +R+M P++E G VYIA PPL+    GK+  Y    K  EE      ++  +  K  +QRYKGLGEM+  QLWETTMDP+ RL+ +V+++DA+ AD++F +LMGD V PRR FIE+NA YVKNLDI
  S:     7 NMRERAQEYDASQIQVLEGLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAV-VDDLKVIEE--TDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGGIKSYVEHLNANKDVIFPEPIFIEGEQQ----------DITVEVSMQYTDGYHSNILSFANNIHTYEGGTHESGFKTSLTRVINDYARKQKLMKENDEKLTGEDVREGLTAVVSIKHPDPQFEGQTKTKLGNSEVRTVTDRLFSEYFTKFLMENPTVGKQIVEKGMLASKARLAAKRAREVTRRKGALEISNLPGKLADCSSKDPEKCELFIVEGDSAGGSAKQGRSREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGEDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRFMRPIVEAGYVYIAQPPLYGVKQGKNITYVQPGKHAEEELAKVLEELPASPKPSVQRYKGLGEMDDHQLWETTMDPEKRLMARVSVDDAIEADQIFEMLMGDRVEPRRAFIEENAHYVKNLDI 649
>gi|72080449|ref|YP_287507.1| DNA gyrase subunit B [Mycoplasma hyopneumoniae 7448] >gi|71913573|gb|AAZ53484.1| DNA gyrase subunit B [Mycoplasma hyopneumoniae 7448] (639 aa)
Score = 1661, Expect = 0.0e+00, Identities = 354/636 (55%), Positives = 453/636 (71%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           Y A NI +LEGLEAVRKRPGMYIG T I  LHH+VWEIVDN++DEA+ G AS+I +T+  +    ++DDGRGIP   H K + S  E V TVLHAGGKFD  SYKVSGGLHGVGASVVNALS  L+V++ ++ K  Y +F +GG+  ADL V +   S ++GT + F PDFEI+E+  F   TI +RLK  AYL +GI+   ID+R+D  +TF F GGI  +V+EL+   + +  TI+Y E +      +N+D   I+VE A  Y +  ++   ++ NNI+  EGGSHE G    L +I+N +A+  K +K   +K  K+D  +GL AIVSIKH NP +EGQTK KL N EVR FV+   SE+F++YL ENPEDA  II + LLA +A + +  AREA +RKS F+  +LPGKLADC+TK+ EI+ELYIVEG+SAGGSAK+GRDR FQAILPL+GK+IN ++ + +K+  NEEI+++ITA G GVGPEF I K+RY KII+MTDAD DGSHIR LLLTFLFRY   L+E G VYIA PPL+K S GK   YAY+EK  E+F     KENS  K+ IQRYKGLGEMNP+QLWETTMDP+ R + +V I D     +VF  LMG +V  R+ FIE+NA+Y K
  S:     5 YQAENIVVLEGLEAVRKRPGMYIGGTGINELHHLVWEIVDNAVDEALAGFASKIKVTILDDFKISIEDDGRGIPTGIHPKYEISAAEVVFTVLHAGGKFDGKSYKVSGGLHGVGASVVNALSKELEVFIKRDGKLWYQKFINGGQKTADLSVISNLDSSQSGTKIIFSPDFEILEKNSFQLLTIFNRLKNTAYLTRGIEFELIDKRSDFSQTFCFEGGISDYVDELSKNFKKLTNTIIYSENQYE----HNQD--TIKVEFALNYVQEDHSQIKSYTNNIHNPEGGSHENGLCDGLLRILNNYALSNKFIKSETDKFVKQDIKDGLIAIVSIKHTNPIFEGQTKAKLNNKEVRQFVNKAFSEVFQRYLAENPEDAKKIIARNLLAQKAARAAKSAREAIKRKSAFDIGTLPGKLADCATKNSEIAELYIVEGNSAGGSAKMGRDRHFQAILPLRGKVINSQRFQLEKVLKNEEILSMITAFGTGVGPEFDISKIRYQKIIIMTDADSDGSHIRSLLLTFLFRYFKKLIEFGFVYIAIPPLYKISQGKKIFYAYNEKEKEKFLAEILKENS--KFTIQRYKGLGEMNPEQLWETTMDPQTRRMYQVQIHDLEVVAQVFDSLMGTDVTMRKIFIEENAQYAK 636
>gi|108802861|ref|YP_642798.1| DNA gyrase subunit B [Rubrobacter xylanophilus DSM 9941] >gi|108764104|gb|ABG02986.1| DNA gyrase, B subunit [Rubrobacter xylanophilus DSM 9941] (644 aa)
Score = 1661, Expect = 0.0e+00, Identities = 338/642 (52%), Positives = 447/642 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIK-NGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET-FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           K+ Y AS+I++LEGLEAV++RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G  +EI++T+  + S  V DDGRG+PV    K  KS  E ++T LHAGGKFD  +YKVSGGLHGVGASVVNALS WL++ + ++    + +  + G PV  L+   +    +  GT V F PD +I E  EF  DT+  R ++ A+LNKG++I   DER + +E  + + GGIK +V  +N  K+P+  TI+Y  REE              VEVA Q+N  Y +S FTF NNINT EGG+H  GF+ AL + IN++A +K LLKE +E ++ +D  EGL A++S+K   PQ+EGQTK KLGN+E++  V +  +    ++L ENP  A  I+ K + A  AR  + +AR+A R K   ES++LPGKLADCS+KD   SELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA  +K+ SN EI  +I+AIGAGVG  F I++ RY+KI++MTDADVDGSHIR L+LTFL+R M  L+E G VYIA PPL+K +  +   Y Y +  L+E  ++  +     + R+KGLGEMNP QLWETTMDP NR LL+VTI+ A  AD++F+ LMGD+V PR+ FIE NA+  KN+D
  S:    11 KSDYDASSIQVLEGLEAVKRRPGMYIGSTGPRGLHHLVWEIVDNSIDEALAGYCTEISVTVHPDNSVTVSDDGRGMPVGVMEKYGKSAAEVIMTTLHAGGKFDGQTYKVSGGLHGVGASVVNALSEWLELEIRRD-GHLWTQRYERGFPVTGLERGRKLGKREGTGTTVRFRPDPQIFETVEFSFDTLSRRFRESAFLNKGLRIRLADEREEGREVVYRYEGGIKDFVAHINEAKDPVHKTILYFHREEEAG----------DVEVAMQWNSGYQDSVFTFANNINTHEGGTHLSGFRAALTRTINEYARQKGLLKEKEENLTGDDIREGLAAVISVKLREPQFEGQTKTKLGNTEIKGLVESATNRHLAEFLEENPGQARAIVTKAINASRARLAASKARKAIR-KGYLESSTLPGKLADCSSKDPARSELYIVEGDSAGGSAKQGRDRNFQAILPLRGKILNVEKANINKVLSNAEIQAMISAIGAGVGDSFNIEEARYHKIVIMTDADVDGSHIRTLVLTFLYRNMPELIEAGYVYIAQPPLYKITHNRRDVYVYSDAELQETLRRLRADGSATVSRFKGLGEMNPQQLWETTMDPANRTLLQVTIDSAATADELFTALMGDKVEPRKAFIEANAREAKNID 643
>gi|164686442|ref|ZP_02210470.1| hypothetical protein CLOBAR_00007 [Clostridium bartlettii DSM 16795] >gi|164604453|gb|EDQ97918.1| hypothetical protein CLOBAR_00007 [Clostridium bartlettii DSM 16795] (633 aa)
Score = 1658, Expect = 0.0e+00, Identities = 356/643 (55%), Positives = 461/643 (71%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  Y A+ I++LEGLEAVR RPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + ++GS   +DDGRGIPVE H KT KST+ETVLT+LHAGGKF    YKVSGGLHGVG SVVN LS WL   VY+  K +   +K G   + D ++     S   GTI++F PD  I +   FD  T+++RL++LA+LNKG++I F D+R   + K+ FL+ GGI+++VE LN+ K PI   +VY +          K   +  VE+A QY   Y+ +  +F NNI+T EGG+H  GFK AL K +N++A   KLLKE D  +S ED  EGLTA+VS+K P+PQ+EGQTK KLGN+ +R  V  V  E    +L ENP+ + +I+ K L A  AR+ +  ARE TRRK+  ES SLPGKLADC+ KD   SE+++VEGDSAGGSAK GRDR  QAILPL+GKI+NVEK++ D+I S++EI N+ITA G GVG +F ++K RY+KI++MTDADVDG+HIR LLLTF FRYM PL++NG VYIA PPL+K    K   Y Y +K LE   +E  K   ++QRYKGLGEMNP+QLWETTM+P+ R LL+VTI+DA  AD++FS+LMGD+V PR+EFIE+NA++VKNLDI
  S:     2 KQEYGANQIQVLEGLEAVRLRPGMYIGSTGPRGLHHLVYEIVDNSIDEALQGYCDRIYVCINEDGSVTTKDDGRGIPVETHPKTGKSTLETVLTILHAGGKFGGGGYKVSGGLHGVGISVVNGLSEWLVAEVYRNGKIYRQSYKKG---ITDSELEIVGESDHTGTIIQFMPDATIFDDIVFDYKTLETRLRELAFLNKGVRIVFEDKRPGQEQKKEFLYDGGIREFVEYLNSTKTPIHENVVYID----------KKIQDCMVEIAIQYTDGYSENILSFANNIDTHEGGAHLAGFKAALTKTVNEYAKRNKLLKENDANLSGEDIREGLTAVVSVKLPDPQFEGQTKTKLGNTRMRGIVDAVTVEELGAFLEENPQTSRIIVDKALRAQRAREAAKRARELTRRKTVLESTSLPGKLADCAEKDPAKSEIFLVEGDSAGGSAKQGRDRYTQAILPLRGKILNVEKSRLDRILSSDEIKNMITAYGCGVGNDFDLEKARYHKIVIMTDADVDGAHIRTLLLTFFFRYMRPLIDNGYVYIAQPPLYKVKKQKKEYYVYSDKQLEALLEEIGKSGIELQRYKGLGEMNPEQLWETTMNPETRTLLQVTIDDATEADRIFSMLMGDKVGPRKEFIEENAEFVKNLDI 633
>gi|16799085|ref|NP_469353.1| DNA gyrase subunit B [Listeria innocua Clip11262] >gi|16412427|emb|CAC95239.1| DNA gyrase subunit B [Listeria innocua] (646 aa)
Score = 1658, Expect = 0.0e+00, Identities = 350/648 (54%), Positives = 470/648 (72%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N     + Y+   I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDN+IDEA+ G  +EI IT+  + S  V+D+GRGIP   + K  + TVE + TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E +++Y  F + G  V D++V  E  +   GTIV F PD +I  E  EFD DT+++R ++LA+LN+G+ I+  D+R + K  + F + GGI+ +VE LN  K+ I    +Y E E            +I VE++ QYN  ++++  +F NNI+T EGG+HE GFK AL ++IN +A   KL K++D+ +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + SE   K+++ENP+ A  I++K ++A  AR  +  ARE  R+ S  E +SLPGKLADCS+++ EISELYIVEGDSAGGSAK GRDR+FQAILP++GKI+NVEKA+ D+I +NEEI  + TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  +RYM PLL+ G +YIA PPL++   GK  +Y Y +  LE++    +   KY IQRYKGLGEMNP+QLW+TTM+P++R LL+V I+DA++AD+ F +LMGD V PRR+FIE NA+YVKNLD+
  S:     8 NVHESASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRF-ERGDVVMDMEVQGE--TDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEHKVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERD----------DIMVEISMQYNTGFSSNIISFANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKRAREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPIRGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKYSIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIEDNAQYVKNLDV 646
>gi|110003910|emb|CAK98250.1| dna gyrase subunit b protein [Spiroplasma citri] (639 aa)
Score = 1657, Expect = 0.0e+00, Identities = 359/642 (55%), Positives = 465/642 (72%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK---PVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET---FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFAL-QKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK--TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + Y++ +I+ILEGLEA+RKRPGMYIG+T+ +GLHH+VWEIVDNSIDE +   A++I I L K+ S  V D+GRGIP+E H KTK ST+ETV T+LHAGGKFD+++YK+SGGLHGVGASVVNALS +LKV V K  K++ +EF +GG+   P+ ++  T+E      GT V F PD +I  E   F   TI++R+KQL +LNKG++I+ +D R +D+E    + F  GIK +V ELN      +  + Y E  E           NI VE   QYN  Y+ + F+FCNNINT EGG+HEEG + A+ ++I N F    K  K  ++K + +D  EG+T I+SI+HP PQYEGQTK KLGNSEV+  VSN+V +    YLLENPEDA  II+K  L+++AR  +  A+E TRRK   +S SLPGKL+DC TKD +I+ELYIVEGDSAGGSAK GR+R FQAILPL+GKI+NVEKAK  KIF N EI ++ITA+GAG+   F   KLRY K+I+MTDADVDG+HIRILLLTF +RYM  L+ENGN+YIA PPL+K       +Y Y +    L + +       Y IQRYKGLGEMNP+QLWETTMDP+ RLLLKV++ +A  A+ + + LMG+ V PR++FI +NAKYVKNLD+
  S:     3 DNYNSESIQILEGLEAIRKRPGMYIGATNARGLHHLVWEIVDNSIDEVLANFANKIKIILNKDESITVIDNGRGIPIEIHPKTKVSTLETVFTILHAGGKFDSNTYKISGGLHGVGASVVNALSKYLKVEVRKNNKKYVMEFHNGGQILTPIKEVGSTSE-----TGTTVTFLPDEKIFKETTIFSFSTIQNRIKQLVFLNKGLEISLVDLREEDEEKTVLYQFNNGIKDYVLELNKTIGTPLNDVFYVEGIED----------NIVVEFGLQYNDNYSENIFSFCNNINTHEGGTHEEGARLAIVREINNYFKNINKNNKGNEDKFTWDDIKEGMTIIISIRHPEPQYEGQTKTKLGNSEVKKIVSNIVGKGLSSYLLENPEDAKKIIEKISLSLKARIVAQRAKETTRRKIVMDSFSLPGKLSDCETKDAKIAELYIVEGDSAGGSAKSGRNRKFQAILPLRGKILNVEKAKQIKIFENNEINSIITALGAGIKDNFNDKKLRYQKVIIMTDADVDGAHIRILLLTFFYRYMKDLIENGNIYIAQPPLYKVENSNQIRYVYSDNELELYKEELLKQNKNYTIQRYKGLGEMNPEQLWETTMDPERRLLLKVSVNNAFEANLICNELMGENVEPRKKFIRENAKYVKNLDV 639
>gi|116871428|ref|YP_848209.1| DNA gyrase subunit B [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116740306|emb|CAK19424.1| gyrB [Listeria welshimeri serovar 6b str. SLCC5334] (646 aa)
Score = 1657, Expect = 0.0e+00, Identities = 350/648 (54%), Positives = 471/648 (72%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSK-VKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N     + Y+   I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDN+IDEA+ G  +EI IT+  + S  V+D+GRGIP   + K  + TVE + TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E +++Y  F + G  V D++V  E  +   GTIV F PD +I  E  EFD DT+++R ++LA+LN+G+ I+  D+R + K  + F + GGI+ +VE LN  K+ I    +Y E E            +I VE++ QYN  ++++  +F NNI+T EGG+HE GFK AL ++IN +A   K+ K++D+ +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + SE   K+++ENP+ A  I++K ++A  AR  +  ARE  R+ S  E +SLPGKLADCS+++ EISELYIVEGDSAGGSAK GRDR+FQAILP++GKI+NVEKA+ D+I +NEEI  + TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  +RYM PLL+ G +YIA PPL++   GK  +Y Y +  LE++     K  KY IQRYKGLGEMNP+QLW+TTM+P++R LL+V I+DA++AD+ F +LMGD V PRR+FIE+NA+YVKNLD+
  S:     8 NVHESASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRF-ERGDVVMDMEVQGE--TDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEHKVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERD----------DIMVEISMQYNTGFSSNIISFANNIHTYEGGTHESGFKTALTRVINDYARRNKVFKDSDDNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKRAREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPIRGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDKDTKYSIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIEENAQYVKNLDV 646
>gi|56961788|ref|YP_173510.1| DNA gyrase subunit B [Bacillus clausii KSM-K16] >gi|56908022|dbj|BAD62549.1| DNA gyrase subunit B [Bacillus clausii KSM-K16] (641 aa)
Score = 1657, Expect = 0.0e+00, Identities = 360/644 (55%), Positives = 454/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSS-KYAYDEKTLE-EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +  TY  S I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEAM G   EI +T+ +  +  V+D+GRGIPV    K  +  VE ++T LHAGGKF    YKVSGGLHGVGASVVNALS+ L V V+ + K H   +  G  P ADL V  E  + K GT + F PD EI  E  EFD +T+ +R+++LA+LNKG+ I   D+RT+D  K T+ + GGI  +V+ LN  KE +    +Y E E          K  I VEVA QYN  + +S ++F NNINT EGG+HE GFK  L ++IN +A +  L KE D  +S ED  EGLTAI+S+K P PQ+EGQTK KLGNSE R    ++ SE F ++L ENP  A  I+ K L+A  AR+ + +ARE TRRKS  E +SLPGKL DC++KD  ISEL+IVEGDSAGGSAK GRD  FQAILPL+GKI+NVEKA+ DKI +N EI  +ITAIG G+G EF I K RY+KI++MTDADVDG+HIR L+LTF +RYM  LLENG VYIA PPL+K   GK++  Y Y ++ L+        + K  +QRYKGLGEMN  QLWETTMDP+ R +L+VT+ DA+ AD++F +LMGD V PRR+FI++NA YVKNLD+
  S:     6 QNQTYDESQIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNSIDEAMAGFCDEIKVTIEEGNALTVEDNGRGIPVGIQEKMGRPAVEVIMTTLHAGGKFGGGGYKVSGGLHGVGASVVNALSTHLTVNVHLDGKIHSQSYSRG-VPDADLTVIGE--TDKTGTTITFQPDPEIFRETVEFDYETLAARIRELAFLNKGLTIKIEDKRTEDGKKATYHYEGGISSFVKHLNRSKETLHEEPIYVESE----------KDGISVEVAVQYNDGFTSSIYSFANNINTHEGGTHESGFKTGLTRVINDYARKNGLFKENDPNLSGEDVREGLTAIISVKIPEPQFEGQTKTKLGNSEARTITDSLFSESFARFLSENPGVARKIVDKGLMASRAREAAKKARELTRRKSALEVSSLPGKLTDCTSKDASISELFIVEGDSAGGSAKGGRDPHFQAILPLRGKILNVEKARLDKILANNEIRMIITAIGTGIGDEFDISKARYHKIVIMTDADVDGAHIRTLILTFFYRYMRELLENGYVYIAQPPLYKIEQGKNNVTYVYSDRELDAHLATVADRSKVSVQRYKGLGEMNAGQLWETTMDPQVRNMLQVTLADAIKADEIFEILMGDRVEPRRDFIQENAHYVKNLDV 641
>gi|54020117|ref|YP_115783.1| DNA gyrase subunit B [Mycoplasma hyopneumoniae 232] >gi|53987290|gb|AAV27491.1| DNA gyrase subunit B [Mycoplasma hyopneumoniae 232] (639 aa)
Score = 1655, Expect = 0.0e+00, Identities = 353/636 (55%), Positives = 451/636 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           Y A NI +LEGLEAVRKRPGMYIG T I  LHH+VWEIVDN++DEA+ G AS+I +T+  +    ++DDGRGIP   H K + S  E V TVLHAGGKFD  SYKVSGGLHGVGASVVNALS  L+V++ ++ K  Y +F +GG+  ADL V +   S ++GT + F PDFEI+E+  F   TI +RLK  AYL + I+   ID+R+D  +TF F GGI  +VEEL+   + +  TI+Y E +      +N+D   I+VE A  Y +  ++   ++ NNI+  EGGSHE G    L +I+N +A+  K +K   +K  K+D  +GL AIVSIKH NP +EGQTK KL N EVR FV+   SE+F++YL ENPEDA  II + LLA +A + +  AREA +RKS F+  +LPGKLADC TK+ EI+ELYIVEG+SAGGSAK+GRDR FQAILPL+GK+IN ++ + +K+  NEEI+++ITA G GVGPEF I K+RY KII+MTDAD DGSHIR LLLTFLFRY   L+E G VYIA PPL+K S GK   YAY+E+  E+F     KENS  K+ IQRYKGLGEMNP+QLWETTMDP+ R + +V I D     +VF  LMG +V  R+ FIE+NA+Y K
  S:     5 YQAENIVVLEGLEAVRKRPGMYIGGTGINELHHLVWEIVDNAVDEALAGFASKIKVTILDDFKISIEDDGRGIPTGIHPKYEISAAEVVFTVLHAGGKFDGKSYKVSGGLHGVGASVVNALSKELEVFIKRDGKLWYQKFINGGQKTADLSVISNLDSSQSGTKIIFSPDFEILEKNSFQLLTIFNRLKNTAYLTRRIQFELIDKRSDFSQTFCFEGGISDYVEELSKNFKKLTNTIIYSENQYE----HNQD--TIKVEFALNYVQEDHSQIKSYTNNIHNPEGGSHENGLCDGLLRILNNYALSNKFIKSETDKFVKQDIKDGLIAIVSIKHTNPIFEGQTKAKLNNKEVRQFVNKAFSEVFQRYLAENPEDAKKIIARNLLAQKAARAAKSAREAIKRKSAFDIGTLPGKLADCGTKNSEIAELYIVEGNSAGGSAKMGRDRHFQAILPLRGKVINSQRFQLEKVLKNEEILSMITAFGTGVGPEFDISKIRYQKIIIMTDADSDGSHIRSLLLTFLFRYFKKLIEFGFVYIAIPPLYKISQGKKIFYAYNEREKEKFLAEILKENS--KFTIQRYKGLGEMNPEQLWETTMDPQTRRMYQVQIHDLEVVAQVFDSLMGTDVTMRKIFIEENAQYAK 636
>gi|168267048|ref|ZP_02689013.1| DNA gyrase, B subunit [Listeria monocytogenes FSL J2-071] (646 aa)
Score = 1654, Expect = 0.0e+00, Identities = 349/648 (53%), Positives = 470/648 (72%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N +   + Y+   I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDN+IDEA+ G  +EI IT+  + S  V+D+GRGIP   + K  + TVE + TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E +++Y  F + G  V D++   E  +   GTIV F PD +I  E  EFD DT+++R ++LA+LN+G+ I+  D+R + K  + F + GGI+ +VE LN  K+ I    +Y E E            +I VE++ QYN  ++++  +F NNI+T EGG+HE GFK AL ++IN +A   KL K++D+ +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + SE   K+++ENP+ A  I++K ++A  AR  +  ARE  R+ S  E +SLPGKLADCS+++ EISELYIVEGDSAGGSAK GRDR+FQAILP++GKI+NVEKA+ D+I +NEEI  + TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  +RYM PLL+ G +YIA PPL++   GK  +Y Y +  LE++    +   KY IQRYKGLGEMNP+QLW+TTM+P++R LL+V I+DA++AD+ F +LMGD V PRR+FIE NA+YVKNLD+
  S:     8 NVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRF-ERGDVVMDMEEQGE--TDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEHKVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERD----------DIMVEISMQYNTGFSSNIISFANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKRAREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPIRGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQVEYVYSDGQLEDYLASLDGDTKYSIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIEDNAQYVKNLDV 646
>gi|16802054|ref|NP_463539.1| DNA gyrase subunit B [Listeria monocytogenes EGD-e] >gi|46906230|ref|YP_012619.1| DNA gyrase, B subunit [Listeria monocytogenes str. 4b F2365] >gi|47093016|ref|ZP_00230795.1| DNA gyrase, B subunit [Listeria monocytogenes str. 4b H7858] >gi|47097288|ref|ZP_00234846.1| DNA gyrase, B subunit [Listeria monocytogenes str. 1/2a F6854] >gi|153169036|ref|ZP_01928775.1| DNA gyrase, B subunit [Listeria monocytogenes FSL N1-017] >gi|153176168|ref|ZP_01931427.1| DNA gyrase, B subunit [Listeria monocytogenes FSL N3-165] >gi|153181036|ref|ZP_01934003.1| DNA gyrase, B subunit [Listeria monocytogenes F6900] >gi|153184358|ref|ZP_01935117.1| DNA gyrase, B subunit [Listeria monocytogenes J0161] >gi|153197972|ref|ZP_01942142.1| DNA gyrase, B subunit [Listeria monocytogenes 10403S] >gi|153204495|ref|ZP_01945292.1| DNA gyrase, B subunit [Listeria monocytogenes HPB2262] >gi|167015927|ref|ZP_02278460.1| DNA gyrase, B subunit [Listeria monocytogenes FSL J1-194] >gi|167215467|ref|ZP_02285774.1| DNA gyrase, B subunit [Listeria monocytogenes FSL R2-503] >gi|167216322|ref|ZP_02285958.1| DNA gyrase, B subunit [Listeria monocytogenes FSL J1-175] >gi|167452747|ref|ZP_02318970.1| DNA gyrase, B subunit [Listeria monocytogenes FSL J2-064] >gi|21328234|gb|AAM48481.1|AF084042_1 DNA gyrase subunit B [Listeria monocytogenes] >gi|16409365|emb|CAC98221.1| DNA gyrase subunit B [Listeria monocytogenes] >gi|46879494|gb|AAT02796.1| DNA gyrase, B subunit [Listeria monocytogenes str. 4b F2365] >gi|47014333|gb|EAL05308.1| DNA gyrase, B subunit [Listeria monocytogenes str. 1/2a F6854] >gi|47018584|gb|EAL09338.1| DNA gyrase, B subunit [Listeria monocytogenes str. 4b H7858] >gi|126942861|gb|EBA20595.1| DNA gyrase, B subunit [Listeria monocytogenes J0161] >gi|127632308|gb|EBA21990.1| DNA gyrase, B subunit [Listeria monocytogenes 10403S] >gi|133725984|gb|EBA27682.1| DNA gyrase, B subunit [Listeria monocytogenes FSL N1-017] >gi|133728881|gb|EBA30579.1| DNA gyrase, B subunit [Listeria monocytogenes FSL N3-165] >gi|133731554|gb|EBA33252.1| DNA gyrase, B subunit [Listeria monocytogenes F6900] >gi|133734275|gb|EBA35973.1| DNA gyrase, B subunit [Listeria monocytogenes HPB2262] (646 aa)
Score = 1654, Expect = 0.0e+00, Identities = 349/648 (53%), Positives = 470/648 (72%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N +   + Y+   I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDN+IDEA+ G  +EI IT+  + S  V+D+GRGIP   + K  + TVE + TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V++E +++Y  F + G  V D++   E  +   GTIV F PD +I  E  EFD DT+++R ++LA+LN+G+ I+  D+R + K  + F + GGI+ +VE LN  K+ I    +Y E E            +I VE++ QYN  ++++  +F NNI+T EGG+HE GFK AL ++IN +A   KL K++D+ +S ED  EGLTAI+SIKHP+PQ+EGQTK KLGNSE R     + SE   K+++ENP+ A  I++K ++A  AR  +  ARE  R+ S  E +SLPGKLADCS+++ EISELYIVEGDSAGGSAK GRDR+FQAILP++GKI+NVEKA+ D+I +NEEI  + TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  +RYM PLL+ G +YIA PPL++   GK  +Y Y +  LE++    +   KY IQRYKGLGEMNP+QLW+TTM+P++R LL+V I+DA++AD+ F +LMGD V PRR+FIE NA+YVKNLD+
  S:     8 NVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRF-ERGDVVMDMEEQGE--TDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEHKVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERD----------DIMVEISMQYNTGFSSNIISFANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKRAREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPIRGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKYSIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIEDNAQYVKNLDV 646
>gi|71893463|ref|YP_278909.1| DNA gyrase subunit B [Mycoplasma hyopneumoniae J] >gi|71851590|gb|AAZ44198.1| DNA gyrase subunit B [Mycoplasma hyopneumoniae J] (639 aa)
Score = 1653, Expect = 0.0e+00, Identities = 354/636 (55%), Positives = 450/636 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKT----LEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           Y A NI +LEGLEAVRKRPGMYIG T I  LHH+VWEIVDN++DEA+ G AS+I +T+  +    ++DDGRGIP   H K + S  E V TVLHAGGKFD  SYKVSGGLHGVGASVVNALS  L+V++ ++ K  Y +F +GG+  ADL V +   S ++GT + F PDFEI+E+  F   TI +RLK  AYL + I+   ID+R+D  +TF F GGI  +VEEL+   + +  TI+Y E +      +N+D   I+VE A  Y +  ++   ++ NNI+  EGGSHE G    L +I+N +A+  K +K   +K  K+D  +GL AIVSIKH NP +EGQTK KL N EVR FV+   SE+F++YL ENPEDA  II + LLA +A + +  AREA +RKS F+  +LPGKLADC TK+ EI+ELYIVEG+SAGGSAK+GRDR FQAILPL+GK+IN ++ + +K+  NEEI+++ITA G GVGPEF I K+RY KII+MTDAD DGSHIR LLLTFLFRY   L+E G VYIA PPL+K S GK   YAY+EK     L E  KENS  K+ IQRYKGLGEMNP+QLWETTMDP+ R + +V I D     +VF  LMG +V  R+ FIE+NA+Y K
  S:     5 YQAENIVVLEGLEAVRKRPGMYIGGTGINELHHLVWEIVDNAVDEALAGFASKIKVTILDDFKISIEDDGRGIPTGIHPKYEISAAEVVFTVLHAGGKFDGKSYKVSGGLHGVGASVVNALSKELEVFIKRDGKLWYQKFINGGQKTADLSVISNLDSSQSGTKIIFSPDFEILEKNSFQLLTIFNRLKNTAYLTRRIQFELIDKRSDFSQTFCFEGGISDYVEELSKNFKKLTNTIIYSENQYE----HNQD--TIKVEFALNYVQEDHSQIKSYTNNIHNPEGGSHENGLCDGLLRILNNYALSNKFIKSETDKFVKQDIKDGLIAIVSIKHTNPIFEGQTKAKLNNKEVRQFVNKAFSEVFQRYLAENPEDAKKIIARNLLAQKAARAAKSAREAIKRKSAFDIGTLPGKLADCGTKNSEIAELYIVEGNSAGGSAKMGRDRHFQAILPLRGKVINSQRFQLEKVLKNEEILSMITAFGTGVGPEFDISKIRYQKIIIMTDADSDGSHIRSLLLTFLFRYFKKLIEFGFVYIAIPPLYKISQGKKIFYAYNEKEKEKYLTEILKENS--KFTIQRYKGLGEMNPEQLWETTMDPQTRRMYQVQIHDLEVVAQVFDSLMGTDVTMRKIFIEENAQYAK 636
>gi|73661314|ref|YP_300095.1| DNA gyrase subunit B [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72493829|dbj|BAE17150.1| DNA gyrase subunit B [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (641 aa)
Score = 1652, Expect = 0.0e+00, Identities = 356/648 (54%), Positives = 458/648 (70%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADT-IKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M+       Y A  I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G A  I + + K+   KV D+GRGIPV    K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+VYK+ K ++  +K G  P  DLKV  E      GT++ F  D EI           ++ R ++LA+LNKGI I   DER ++  ++T+ + GGIK +VE LN  K+P+         EE +     KD  +I VE+A QYNK +  +  T+ NNI+T EGG+HEEGFK AL +++N + +  K++KE  E++S ED  EGLTAIVSIKH +PQ+EGQTK KLGNSEVR  V  + SE+FE++L E+P+   ++++K ++A  AR  + +ARE TRRKS  E +SLPGKLADCS+KD   SE++IVEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI ++ITA G G+G EF + K RY+KI+LMTDADVDG+HIR LLLTF +R+M PLLE G VYIA PPLFK + GK   Y ++E+ LE+ K E     K+ I RYKGLGEMN DQLWETTM+P+NR +L+V+++DA+ AD+VF +LMGD V  RR+FIE NA Y  NLD
  S:     1 MSDVNNTEDYGAGQIQVLEGLEAVRKRPGMYIGSTSEKGLHHLVWEIVDNSIDEALAGYADTIEVVIEKDNWIKVTDNGRGIPVGIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSEDLEVYVYKDRKVYHQGYKKG-VPQFDLKVIEETDDDNTGTVIRFKADSEIFTETTTYHYETLQQRTRELAFLNKGISITLRDERGEEVREDTYHYEGGIKSYVEMLNENKQPL--------HEEPIYVHQTKD--DIEVEIALQYNKGFATNLLTYANNIHTYEGGTHEEGFKRALSRVLNSYGLNSKIIKEDKERLSGEDTREGLTAIVSIKHGDPQFEGQTKTKLGNSEVRQIVDKLFSELFERFLYEHPQVGRIVVEKGIMASHARLAAKKAREVTRRKSALEISSLPGKLADCSSKDPSRSEIFIVEGDSAGGSTKSGRDSETQAILPLRGKILNVEKARLDRILNNNEIRSMITAFGTGIGGEFDLSKARYHKIVLMTDADVDGAHIRTLLLTFFYRFMRPLLEAGYVYIAQPPLFKLTQGKQKYYVFNERELEKLKAELEPTPKWSISRYKGLGEMNADQLWETTMNPENRAMLQVSLDDAIEADQVFEMLMGDVVENRRQFIEDNAVYA-NLD 640
>gi|125974861|ref|YP_001038771.1| DNA gyrase subunit B [Clostridium thermocellum ATCC 27405] >gi|196251640|ref|ZP_03150308.1| DNA gyrase, B subunit [Clostridium thermocellum DSM 4150] >gi|125715086|gb|ABN53578.1| DNA gyrase subunit B [Clostridium thermocellum ATCC 27405] >gi|196199017|gb|EDX93846.1| DNA gyrase, B subunit [Clostridium thermocellum DSM 4150] (641 aa)
Score = 1651, Expect = 0.0e+00, Identities = 343/649 (52%), Positives = 469/649 (72%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNK-TYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENS--KVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +N E  K  Y  SNI++LEGLEAVRKRPGMYIGST  +GLHH+V+EI+DNSIDEA+ G  +EI + + K+ S    D+GRGIPV  H K   STVE V T+LHAGGKFD   YKVSGGLHGVGASVVNALS +L+V V+++   Y++ Y    + GKPV  +++  +  +   GT   F PD EI E  EFD + + +RL++LA+LNKG+KI   DER ++  ++   + GGI  +VE ++  K+P+   I +D  ++              VE+A QYNK  Y  +  +F NNI+T EGG+H  GFK A+ K++N +A +   LKE D+ +  ED  EGLTA++S+K P+PQ+EGQTK KLGNSEVR FV ++++E F  +L ENP    +I+ KC+++  AR+ + +ARE TRRK+  E+++LPGKLADC+ +D  + E++IVEGDSAGGSAK GR+R FQAILPL GK++NVEKA+ DK++ N+++  +I A+G  +G +F I KLRY+KII+M DADVDG+HIR LLLTF +RYM PL+ NG VYIA PPL+K + GK+  YAY++  LE+  +EN   K +  IQR+KGLGEMNP+QLW TTMDP+ R +L+V +EDA+ AD++F++LMGD+V PR+EFI+ NAK V NLDI
  S:     4 INNEMSK--YDESNIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIMDNSIDEALAGFCNEIKVIIHKDNSITNIDNGRGIPVGIHPKLGISTVEVVHTILHAGGKFDGQGYKVSGGLHGVGASVVNALSEFLEVEVFRDGHIYRQRY----ERGKPVTPVEIIGD--TNLTGTKTTFKPDPEIFEVTEFDFEVLLTRLRELAFLNKGLKIILRDERPEEPVEKHLHYEGGIVSFVEYMDRNKDPLHEPIYFDGYKDGC-----------YVEIAMQYNKDVYVENIHSFANNISTAEGGTHLTGFKTAITKVLNDYAKKFNFLKENDKNLLGEDVREGLTAVISVKIPDPQFEGQTKTKLGNSEVRSFVESIINEKFASFLEENPSVTRLILDKCIMSARAREAARKARELTRRKNVLETSTLPGKLADCTERDPSLCEIFIVEGDSAGGSAKQGRNRRFQAILPLWGKMLNVEKARVDKVYGNDKLTPVIMALGTNIGQDFDITKLRYHKIIIMADADVDGAHIRTLLLTFFYRYMTPLITNGYVYIAQPPLYKITKGKTELYAYNDSELEKIIRENQWKKEECTIQRFKGLGEMNPEQLWTTTMDPETRTILRVELEDAIAADEIFTILMGDKVEPRKEFIQANAKLVTNLDI 641
>gi|147676340|ref|YP_001210555.1| type IIA topoisomerase, B subunit [Pelotomaculum thermopropionicum SI] >gi|146272437|dbj|BAF58186.1| type IIA topoisomerase, B subunit [Pelotomaculum thermopropionicum SI] (643 aa)
Score = 1645, Expect = 0.0e+00, Identities = 352/640 (55%), Positives = 448/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A  I+ILEGLEAVR+RPGMYIGST  +GLHH+V+E+VDNSIDEAM G    I + L ++GSA V D+GRGIPV+ H KT +  VE V+T+LHAGGKF    YKVSGGLHGVG SVVNALS WL+V V ++ K +Y  +  G  PV  L V  + ++   GT V F PD EI E   F+ D +  RL++L++LN G+KI   D R+  +  F   GGI  +V  LN  K P+    +Y +          K K ++ VEVA QY  TY  S  ++ NNINT +GG+HE GFK AL ++IN +  +  LLK     +S ED  EGLTA++S+K P PQ+EGQTK KLGNSEVR  V +VV E    +L ENP  A  I++K + A  AR+ + +ARE TRRKS  E ++LPGKLADCS +D  +SELY+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI +NEEI  +ITA+G G+G EF + K RY+KIILM+DADVDG+HIR LLLTF +RYM PL+E G V+IA PPL++   GK  KYAY +  LE+   +  +    IQRYKGLGEMN +QLWETTMDP+ R +++V +EDA+ AD VFS+LMGD V PRR+FI++NA+ V+NLDI
  S:    17 YGAEEIQILEGLEAVRRRPGMYIGSTSARGLHHLVYEVVDNSIDEAMAGFCDRIEVILNEDGSATVIDNGRGIPVDIHPKTGRPAVEVVMTMLHAGGKFGGGGYKVSGGLHGVGVSVVNALSLWLEVEVKRDGKVYYQRYSRG-IPVTGLLVKGKSSA--TGTKVTFMPDPEIFEDLIFNQDILAQRLRELSFLNMGVKIILKDRRSGQETVFQHDGGIMDFVRYLNKSKTPLHGKPIYIQ----------KQKDDVLVEVALQYTDTYVESILSYANNINTIDGGTHEAGFKAALTRVINDYGRKYNLLKNGAGNLSGEDIREGLTAVISVKVPEPQFEGQTKTKLGNSEVRSIVDSVVGEGLGIFLEENPSIARRILEKAVTASRAREAARKARELTRRKSALEGSTLPGKLADCSERDPSVSELYLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKILANEEIRAMITALGTGIGEEFDVSKARYHKIILMSDADVDGAHIRTLLLTFFYRYMRPLIEKGYVFIAQPPLYRVKKGKLEKYAYSDAELEKLLDQIGRDGVSIQRYKGLGEMNAEQLWETTMDPETRTVMQVNLEDAIEADAVFSMLMGDRVEPRRDFIQENARLVRNLDI 643
>gi|87123248|ref|ZP_01079099.1| DNA gyrase, B subunit [Synechococcus sp. RS9917] >gi|86168968|gb|EAQ70224.1| DNA gyrase, B subunit [Synechococcus sp. RS9917] (705 aa)
Score = 1645, Expect = 0.0e+00, Identities = 336/641 (52%), Positives = 446/641 (69%)
  Q:     1 MNKETK-KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIK--NGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD--------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLE-EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           M++ +K +  Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDNS+DEA+ G+ SEI + L  +GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ + H   F+ G  P+  L    +    K   GT V F PD EI      FD  T+ +RL++LAYLN G++I F DER           +E + + GGIK++V  +N EK+P+ P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   KE+D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V ++V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    +I+ N EI  LITA+G G+ G +F    LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E+ L+        K  Y IQR+KGLGEM P QLWETTMDP  RL+ +V IEDAL AD++F++LMGD+VAPRREFIE  A
  S:     1 MSEASKVQAAYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGHCSEIEVVLGDDGSASVTDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGQVHRQRFERGA-PIGSLASAPQPVEEKGRTGTSVCFKPDLEIFTGGIVFDYATLSARLRELAYLNGGVRIVFRDERESALNAEGDAHEEVYFYEGGIKEYVAYMNAEKDPLHPEIIY----------VNAEKDGVQVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKRGKRKESDSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGEALSQYLEFNPSVIDMILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPAESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDARIYKNTEIQALITALGLGIKGEDFDAKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVEGGFIYIACPPLYKVERGKNHTYCYNEQDLQTTLAGFGEKANYNIQRFKGLGEMMPKQLWETTMDPTTRLMKRVEIEDALEADRIFTILMGDKVAPRREFIETTA 645
>gi|164510799|emb|CAK18881.1| topoisomerase II subunit B [Staphylococcus intermedius] (640 aa)
Score = 1644, Expect = 0.0e+00, Identities = 345/639 (53%), Positives = 463/639 (72%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A  I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V+++ + H+  +  G  P  DLK   +  + + GT++ F  D  I  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE +N  KEP+         EE +     +D  +I VE+A QYN  +  +  T+ NNI+T EGG+HE+GFK AL +++N +  + KL+KE  +++S ED  EGLTA+VSIKH +PQ+EGQTK KLGNSEVR  V  V SE+FE++L E+P+ A +I++K ++A  AR  + +ARE TRRKS  + +SLPGKLADCS+KD   SE+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ DKI SN EI  ++TA G G+G EF I K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y ++++ L++ K K N   K+ I RYKGLGEMN DQLWETTM+P+NR +L+VT++DA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    10 YGASQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYADNIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSDTLEVYVHRDGRIHHQAYHKG-VPAFDLKQVGD--TDQTGTVIRFKADGTIFQETTVYNYETLQKRIRELAFLNKGIRITLTDERDEENVREDSYHYEGGIKSYVELINENKEPL--------HEEPIYVHQTRD--DIEVEIALQYNSGFATNLLTYANNIHTYEGGTHEDGFKRALTRVLNNYGAQSKLIKEDKDRLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQIVDRVFSELFERFLFEHPQVARIIVEKGIMASRARIAAKKAREVTRRKSALDISSLPGKLADCSSKDPSESEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDKILSNNEIRQMVTAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVFNDRELDKLKEKLNPTPKWSIARYKGLGEMNADQLWETTMNPENRAMLQVTLDDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 639
>gi|158319065|ref|YP_001511572.1| DNA gyrase, B subunit [Alkaliphilus oremlandii OhILAs] >gi|158139264|gb|ABW17576.1| DNA gyrase, B subunit [Alkaliphilus oremlandii OhILAs] (636 aa)
Score = 1644, Expect = 0.0e+00, Identities = 355/646 (54%), Positives = 462/646 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K   YSA  I++LEGL+ VRKRPGMYIG+T  +GLHH+V+E+VDNSIDEA+ G    I +T+ ++ S +V D+GRGIPV+ H +T KST+ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS +L+  +  + K ++  F + G PV D+K+  E  + + GT + F PD EI E   F  +T++ RL++LA+LNKGIKI  ID+R   + ++ F + GGI ++V+ LN  K  +   I++ E+E+              VEVA QY  TY  + F++ NNINT EGG+H  GF+ +L +I+N +A +   LKE D     ED  EGLTA++S+K   PQ+EGQTK KLGNSE+R  V N VSE  E +L ENP DA +I++K L A  AR+ + +ARE TRRK   ES +LPGKLADCS KD  +SE+YIVEG+SAGGSAK GRDR  QAILPL+GKI+NVEKA+ DK+ +++EI N+ITA G  +G EF I+KLRY+KI++MTDADVDG+HIR LLLTFLFR+M PL+E G +YIA PPL+K   GK  +YAY E+ + + K         IQRYKGLGEMNP+QLWETTM+P+ R  L+VTIEDA  AD +F+ LMGD+V PRREFIE+N+KYV NLDI
  S:     3 KIKTQEYSAEQIQVLEGLDPVRKRPGMYIGTTGPRGLHHLVYEVVDNSIDEALGGYCDTILVTIKEDDSIEVIDNGRGIPVDVHPQTGKSTLETVLTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEYLEATIKLDGKVYWQRF-ERGNPVEDIKIIGE--TKEKGTTILFKPDAEIFEETVFQYETLEYRLRELAFLNKGIKIVLIDKREGKEQEKVFYYDGGIMEYVKYLNKNKSVLHEKIIHFEKEKETSV----------VEVAMQYTDTYTENIFSYANNINTHEGGTHLSGFRASLTRIVNDYAKKAGFLKEKDANFLGEDIREGLTAVISVKLTEPQFEGQTKTKLGNSEMRGIVENSVSEALEAFLEENPSDAKIIVEKSLRAQRAREAAKKARELTRRKGALESMALPGKLADCSEKDPALSEIYIVEGNSAGGSAKQGRDRSIQAILPLRGKILNVEKARLDKMLNSDEIRNMITAFGTSIGEEFDIEKLRYHKIVIMTDADVDGAHIRTLLLTFLFRFMKPLIERGYIYIAQPPLYKLKKGKVEEYAYSEEEM-QVKLSEMGGNVDIQRYKGLGEMNPEQLWETTMNPETRTFLQVTIEDAAAADNIFTTLMGDKVEPRREFIEQNSKYVTNLDI 636
>gi|50364821|ref|YP_053246.1| DNA gyrase subunit B [Mesoplasma florum L1] >gi|50363377|gb|AAT75362.1| DNA gyrase subunit B [Mesoplasma florum L1] (635 aa)
Score = 1644, Expect = 0.0e+00, Identities = 343/642 (53%), Positives = 456/642 (71%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEI-MERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVY-DEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSK-VKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +  Y A +IK+L+GLEAVRKRPGMYIGST   GLHH+VWEI+DNS+DEAM G A++I +T+TKEG   VQD+GRGIPV   A + KS +E V T LHAGGKFD+DSYK+SGGLHGVGASVVNALS ++ V V +E K H+  F  GG    ++++  E  + + GTIV F PD EI +E  EFD +TI++++KQL+YLNKG+ I   D R D    + F  GI  +V+E N  K  I P+I Y D++ +           +I VEVA QYN  Y  +  TF NNINT EGG+HE+G + +L ++IN++A +     +   K S +D  EG+  IVSI+H +PQYEGQTK KL N + +  V  VV + FE++LL++PEDA  II K   A +AR  +  ARE TRRKS  ++ SLPGKLADC +KD EI+ELY+VEGDSAGGSAK GR+R FQAILPL+GK++NVE+    + F+N EI +++TAIG G+  +  + KLRY KI++MTDADVDG+HIR LLLTF +RYM  L+ +G+VYIA PPL+K   GK   YAY +  LEE K  + K  ++ IQRYKGLGEM+P QLWETTMDP+ R +L++ +EDA  A++VFS LMG++   RR +I++NA++V+N+D
  S:     3 EQNYGAESIKVLKGLEAVRKRPGMYIGSTSKAGLHHLVWEIMDNSVDEAMAGFANKIILTITKEGEIIVQDNGRGIPVGIQADSGKSALELVFTQLHAGGKFDSDSYKISGGLHGVGASVVNALSLYVDVQVKREGKIHHQVFSGGGTQQTEIEIIGE--TNETGTIVRFKPDPEIFLEGTEFDYETIRNKVKQLSYLNKGLVIELNDLRIDKHVEYHFPNGILDYVKEKNETKVKINPSIFYVDDKHD-----------DIEVEVALQYNAEYQENLITFVNNINTHEGGTHEDGLRQSLVRVINRYAEKVATGNKPAAKYSWDDIKEGMVCIVSIRHTDPQYEGQTKTKLANPDAKKAVDAVVGDAFEEFLLKSPEDAKAIIDKNANAQKARIAAQRAREETRRKSALDTFSLPGKLADCESKDPEIAELYLVEGDSAGGSAKTGRNRRFQAILPLRGKVLNVERVAEVRAFANNEIKSIVTAIGTGIKEDIDLSKLRYGKIVIMTDADVDGAHIRTLLLTFFYRYMKQLVVDGHVYIAQPPLYKIEAGKKVAYAYSDVELEELKAGDFKDSRFTIQRYKGLGEMDPIQLWETTMDPEKRTMLQIKLEDAAIANEVFSDLMGEDPELRRNYIQENAEFVENID 634
>gi|158337618|ref|YP_001518793.1| DNA gyrase subunit B [Acaryochloris marina MBIC11017] >gi|158307859|gb|ABW29476.1| DNA gyrase, B subunit [Acaryochloris marina MBIC11017] (646 aa)
Score = 1643, Expect = 0.0e+00, Identities = 338/632 (53%), Positives = 448/632 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKV--TNEKASIKNGTIVEFYPDFEIME-RAEFDADTIKSRLKQLAYLNKGIKINFIDERTD-------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNK-TYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKEN--SKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           YSA  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+   I I L ++GS +V DDGRGIP +KH  T KS +ETV+TVLHAGGKFD DSYKVSGGLHGVG SVVNALS W++  V++  K H   F + G P ++L V  T+ K S   GT + F PD  I     EFD  T+ SRL++LAYLN G++I+F D R +         ET+ + GGIK++V+ +N +KEPI    +Y E E +          N++VEVA Q+ +  Y+++   F NNI T +GG+H EG K  L + +N  A ++  LK+ D  +  E   EGLTA++S+K P P++EGQTK KLGN+EVR  V ++V E+  +YL  +P  A+ +I+K L A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF + +LRY++IILMTDADVDG+HIR LLLTF +RY   L++ G +YIACPPL+K   G+S  Y Y ++ L+   +    +   Y IQR+KGLGEM P QLW+TTM+P+ R L ++ IEDA  AD++F++LMGD VAPRREFIE + 
  S:     5 YSADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCKHIHIYLNEDGSVRVTDDGRGIPTDKHPTTGKSALETVMTVLHAGGKFDGDSYKVSGGLHGVGISVVNALSEWVEAKVWRNGKVHTQRF-ERGIPKSELVVEPTDRKES---GTAITFLPDDTIFTVTTEFDYKTLASRLRELAYLNAGVEISFHDNRLELLEADEPKVETYRYDGGIKEYVDYMNRDKEPIHEECIYVEGERN----------NVQVEVALQWCRDAYSDNLLGFANNIRTIDGGTHLEGLKTVLTRTMNSLARKRSKLKDGDSNLGGEHIREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGEVLTEYLDFHPNVADSVIEKALQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSTSEIYIVEGDSAGGSAKQGRDRGFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIKGEEFDVSQLRYHRIILMTDADVDGAHIRTLLLTFFYRYQRELIDQGYIYIACPPLYKIERGRSHYYCYSDRELQNLVQHEFPANANYTIQRFKGLGEMMPTQLWDTTMNPETRTLKQIDIEDAAEADRIFTILMGDRVAPRREFIETHG 636
>gi|126697571|ref|YP_001086468.1| DNA gyrase subunit B [Clostridium difficile 630] >gi|145952522|ref|ZP_01801532.1| hypothetical protein CdifQ_04004274 [Clostridium difficile QCD-32g58] >gi|168696002|ref|ZP_02728279.1| DNA gyrase subunit B [Clostridium difficile QCD-37x79] >gi|168714850|ref|ZP_02747127.1| DNA gyrase subunit B [Clostridium difficile QCD-63q42] >gi|168724979|ref|ZP_02757256.1| DNA gyrase subunit B [Clostridium difficile QCD-76w55] >gi|168732216|ref|ZP_02764493.1| DNA gyrase subunit B [Clostridium difficile QCD-97b34] >gi|196124310|ref|ZP_03116059.1| DNA gyrase subunit B [Clostridium difficile ATCC 43255] >gi|196160225|ref|ZP_03120786.1| DNA gyrase subunit B [Clostridium difficile CIP 107932] >gi|115249008|emb|CAJ66819.1| DNA gyrase subunit B [Clostridium difficile 630] (633 aa)
Score = 1642, Expect = 1.1e-180, Identities = 356/643 (55%), Positives = 460/643 (71%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVY---KEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+V+E+VDNSIDEA+ G  S+I +++ ++GS  V+D+GRGIPVE H KT KST+ETVLT LHAGGKF    YKVSGGLHGVG SVVNALS W+   VY   K YK+ Y    + G P + L+V  E  S   GT+++F PD  I +  EF  +T++ RL++L++LNKGIKI F D+R   + ++ F + GG+ ++++ LN  +  I   IVY +++            +  VE+A QY   Y  + ++F NNINT EGGSH  GFK AL K +N +A   K LKE D  +  ED  EGLTA+VS+K P PQ+EGQTK KLGNS +R  V +V  +    +L ENP  A +I+ K L A  AR+ + +ARE TRRKS  ES SLPGKLADC+ KD   SE+++VEGDSAGGSAK GRDR  QAILPL+GKI+NVEK++ D+I S++EI N+ITA G G+G +F IDK RY+KII+MTDADVDG+HIR LLLTF FRYM PL++ G VY A PPL+K +  K   Y Y +K L     E  +   ++QRYKGLGEMN +QLWETTM+P+ R LL+VT+EDA  AD+VFS+LMGD+VAPR+EFIE+NA++V+NLDI
  S:     2 KQEYGASQIQVLEGLEAVRKRPGMYIGSTSPRGLHHLVYEVVDNSIDEALQGYCSDIYVSINEDGSVLVKDNGRGIPVEIHPKTGKSTLETVLTNLHAGGKFGGGGYKVSGGLHGVGVSVVNALSKWMVAEVYLNGKIYKQTY----EKGLPTSKLEVVGE--SQDKGTMIQFMPDETIFDEIEFKYETLEYRLRELSFLNKGIKIVFEDKREGQEKRKEFHYTGGLVEYIKYLNKSRTGIHDDIVYIDKKVD----------DCFVELAMQYTDGYTENIYSFANNINTHEGGSHLSGFKAALTKTVNDYAKRNKFLKENDVNLLGEDIREGLTAVVSVKLPEPQFEGQTKTKLGNSFMRGIVDSVTVDELGSFLEENPSTARIIVDKALRAQRAREAAKKARELTRRKSVLESTSLPGKLADCAEKDPSKSEIFLVEGDSAGGSAKQGRDRNSQAILPLRGKILNVEKSRLDRILSSDEIKNMITAYGCGIGEDFDIDKARYHKIIIMTDADVDGAHIRTLLLTFFFRYMRPLIDEGYVYAAQPPLYKVTKQKKEHYVYSDKELNILLDEIGRNGVELQRYKGLGEMNAEQLWETTMNPETRTLLQVTVEDAAIADEVFSMLMGDKVAPRKEFIEENARFVRNLDI 633
>gi|462227|sp|P34031|GYRB_SPICI DNA gyrase subunit B >gi|49348|emb|CAA79523.1| DNA gyrase subunit B [Spiroplasma citri] >gi|745458|prf||2016285C DNA gyrase:SUBUNIT=B (640 aa)
Score = 1641, Expect = 1.7e-180, Identities = 355/642 (55%), Positives = 463/642 (72%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK---PVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET---FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEK--KLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK--TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + Y++ +I+ILEGLEA+RKRPGMYIG+T+ +GLHH+VWEIVDNSIDE +   A++I I L K+ S  V D+GRGIP+E H KTK ST+ETV T+LHAGGKFD+++YK+SGGLHGVGASVVNALS +LKV V K  K++ +EF +GG+   P+ ++  T+E      GT V F PD +I  E   F   TI++R+KQL +LNKG++I+ +D R +D+E    + F  GIK +V ELN      +  + Y E  E           NI VE   QYN  Y+ + F+FCNNINT EGG+HEEG + A+ + IN +   +  K  K  ++K + +D  EG+T I+SI+HP PQYEGQT +KL NSEV+  VSN+V +    YLLENPEDA  II+K  L+++A   +  A+E TRRK   +S SLPGKL+DC TKD +I+ELYIVEGDSAGGSAK GR+R FQAILPL+GKI+NVEKAK  KIF N EI ++ITA+GAG+   F   KLRY K+I+MTDADVDG+HIRILLLTF +RYM  L+ENGN+YIA PPL+K       +Y Y +    L + +       Y IQRYKGLGEMNP+QLWETTMDP+ RLLLKV++ +A  A+ + + LMG+ V PR++FI +NAKYVKNLD+
  S:     3 DNYNSESIQILEGLEAIRKRPGMYIGATNARGLHHLVWEIVDNSIDEVLANFANKIKIILNKDESITVIDNGRGIPIEIHPKTKVSTLETVFTILHAGGKFDSNTYKISGGLHGVGASVVNALSKYLKVEVRKNNKKYVMEFHNGGQILTPIKEVGSTSE-----TGTTVTFLPDEKIFKETTIFSFSTIQNRIKQLVFLNKGLEISLVDLREEDEEKTVLYQFNNGIKDYVLELNKTIGTPLNDVFYVEGIED----------NIVVEFGLQYNDNYSENIFSFCNNINTHEGGTHEEGARLAIVREINNYFKNQINKNNKGNEDKFTWDDIKEGMTIIISIRHPEPQYEGQTNQKLLNSEVKKIVSNIVGKGLSSYLLENPEDAKKIIEKISLSLKATIVAQRAKEITRRKIVMDSFSLPGKLSDCETKDAKIAELYIVEGDSAGGSAKSGRNRKFQAILPLRGKILNVEKAKQIKIFENNEINSIITALGAGIKDNFNDKKLRYQKVIIMTDADVDGAHIRILLLTFFYRYMKDLIENGNIYIAQPPLYKVENSNQIRYVYSDNELELYKEELLKQNKNYTIQRYKGLGEMNPEQLWETTMDPERRLLLKVSVNNAFEANLICNELMGENVEPRKKFIRENAKYVKNLDV 640
>gi|69246710|ref|ZP_00604078.1| DNA gyrase, B subunit [Enterococcus faecium DO] >gi|68195124|gb|EAN09583.1| DNA gyrase, B subunit [Enterococcus faecium DO] (648 aa)
Score = 1640, Expect = 2.0e-180, Identities = 357/644 (55%), Positives = 461/644 (71%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-----NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +   Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDE + G A++I + + K+ S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYKE   +Y E++ G   V DLK+  +  + ++GT V F PD EI  E  EFD   + +R+++LA+LN+G++I+  D+R ++     + + GGIK +VE LN  K  I P  VY E E+           +I VEV+ QY   Y+++  +F NNI+T EGG+HE GFK AL ++IN +A ++KL+KE D+ ++ ED  EGLTA++SIKHP+PQ+EGQTK KLGNSEVR     + SE F K+LLENP     I++K LLA  AR  +  ARE TRRK   E ++LPGKLADCS+ D E  EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY+K+++MTDADVDG+HIR LLLT  +RYM P++E G VYIA PPL+    GK+  Y    K  EE  K+      +  K  +QRYKGLGEM+  QLWETTMDP NR++ +V+++DA+ AD++F +LMGD V PRR FIE+NA YVKNLDI
  S:    10 RAKEYDASQIQVLEGLEAVRKRPGMYIGSTSSEGLHHLVWEIVDNSIDEVLAGFATKIHVIIEKDNSITVIDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKEGNVYYQEYRRGAV-VDDLKIIEQ--TDRHGTTVHFTPDPEIFTETTEFDFSKLATRIRELAFLNRGMRISIEDKREEEPVINEYHYDGGIKSYVEYLNANKTVIFPEPVYLEGEQQ----------DIAVEVSMQYTDGYHSNIMSFANNIHTYEGGTHESGFKTALTRVINDYARKQKLMKENDDNLTGEDVREGLTAVISIKHPDPQFEGQTKTKLGNSEVRTVTDRLFSEHFMKFLLENPSVGRQIVEKGLLASRARLAAKRAREVTRRKGALEISNLPGKLADCSSNDPEKCELFIVEGDSAGGSAKQGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGEDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPIVEAGYVYIAQPPLYGVKQGKNITYVQPGKNAEEELKQVVASLPASPKPSVQRYKGLGEMDDHQLWETTMDPSNRMMARVSVDDAIAADQIFEMLMGDRVEPRRAFIEENAHYVKNLDI 648
>gi|28376979|ref|NP_783871.1| DNA gyrase, B subunit [Lactobacillus plantarum WCFS1] >gi|28269810|emb|CAD62707.1| DNA gyrase, B subunit [Lactobacillus plantarum WCFS1] (648 aa)
Score = 1639, Expect = 2.4e-180, Identities = 357/647 (55%), Positives = 461/647 (71%)
  Q:     3 KETK---KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYA-YDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KETK      Y AS I++LEGLEAVRKRPGMYIG+T  +GLHH+VWEIVDN IDEA+ G A+ I +T+ K+ S  V D+GRGIPV+   KT K  +ETV T+LHAGGKF    YKVSGGLHGVGASVVNALSS L V V +    +Y++F + GK    +K+  +     +GT V F PD +I  E   +D + + +R+++LA+LNKG++I   D R D+  ++ FL+ GGI+ +VE L+  K  + P  +Y E E++           I VEVA QY   Y+++  TF NNI+T EGG+HEEGFK AL ++IN +A +  LLKE+D  +S ED  EG+TA+VS+KHP+PQ+EGQTK KLGNS+ R  V  + SE F KYL+ENP  A  ++ K LLA +AR  +  ARE TR+KS  E ++LPGKLAD S+KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K  Y+K+I+MTDADVDG+HIR LLLT  +RYM PL++ G VYIA PPL++   GK  KY   DE+  E   +     K  +QRYKGLGEM+ +QLWETTMDP  R LL+V  EDA +AD VFS+LMGD+V PRREFIE NAK+V++LD+
  S:     6 KETKLEQAREYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIVDNGIDEALAGFANVIHVTVEKDNSITVTDNGRGIPVDIQEKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSTLDVKVTRNGHVYYMDF-ERGKVKTPMKIIGDAPDDAHGTAVHFVPDPDIFRETTTYDINILTTRIRELAFLNKGLRITIRDNRPDEPTEDDFLYEGGIRHYVEYLDKNKTVLFPEPIYVEGEQN----------GITVEVALQYTDDYHSNLMTFTNNIHTYEGGTHEEGFKRALTRVINDYARKNNLLKESDANLSGEDVREGMTAVVSVKHPDPQFEGQTKTKLGNSDARAAVDRLFSEHFSKYLMENPSVARKVVDKGLLASKARVAAKRAREVTRKKSGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASIDKILANEEIRSLFTAMGTGFGGDFDLSKANYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLVDAGFVYIAQPPLYQVRQGKFVKYIDSDEELSEVMGQLAPSPKPVVQRYKGLGEMDAEQLWETTMDPDKRRLLRVRDEDAADADGVFSMLMGDQVKPRREFIEDNAKFVQDLDV 648
>gi|55377342|ref|YP_135192.1| DNA gyrase subunit B [Haloarcula marismortui ATCC 43049] >gi|55230067|gb|AAV45486.1| DNA gyrase subunit B [Haloarcula marismortui ATCC 43049] (642 aa)
Score = 1638, Expect = 3.2e-180, Identities = 338/644 (52%), Positives = 452/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLK-VTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVK-YQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + + Y A +I+ LEGLEAV+KRP MYIGSTD +GLHH+V+E+VDN+IDEA+ G    I +T+  +GS  V DDGRGIPV+ H +  +  VE V+T+LHAGGKFDN SY+VSGGLHGVG SVVNALS WL+V V ++   +K+ +    D GKP  DLK V + K   + GT V F+PD EI E  EF   T+ SRL++LA+LN G+ I+  DER  + ETF + GGI+++VE LN  K+P+   I+Y E EE +          ++VE+A Q       S   F NNINT EGG+H  GFK +L ++IN +A +  LLK+ D+ +  +D  EGLTA++S+KHP+PQ+EGQTK KLGNSEVR  V + + +    +  ENP+ A  I+ K + A +ARK + +A E TRRKS  +S +LPGKLADC T+D E +EL+I EGDSAGGSAK GR+  FQAILP+KGKI+NVEK + D+I  N EI NLITA+G G+G EF I+ LRY KIILMTDADVDG+HIR LLLT  +R+M PLLE G VY + PPL++     ++  A  +   ++  +E        +QR+KGLGEMNP+QLWETTM+P NR+L ++TIEDA  ADK+F++LMGD V PR+EFI++++   + +DI
  S:     4 ESDEYGAKSIQTLEGLEAVQKRPAMYIGSTDARGLHHLVYEVVDNAIDEALAGYCDNIDVTIHDDGSVSVSDDGRGIPVDTHEEHGRPAVEVVMTILHAGGKFDNKSYQVSGGLHGVGVSVVNALSKWLEVEVRRDGALWKQRF----DHGKPEYDLKKVRDLKPDEETGTTVRFWPDDEIFETGEFKFSTLSSRLRELAFLNSGVAISIDDERDGETETFAYDGGIREFVEYLNETKDPLHRDIIYFEDEEEIAEGP------VQVEIAMQGTDDLQGSIHAFANNINTREGGTHLTGFKTSLTRVINDYATDNNLLKDLDDTLKGDDIREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESAMHDGLATFFEENPDTAEAIVGKAVEAAKARKAAQKAEELTRRKSALDSTALPGKLADCQTRDPEEAELFIAEGDSAGGSAKQGRNPDFQAILPIKGKILNVEKHRLDRILENNEIRNLITALGTGIGDEFDIEDLRYEKIILMTDADVDGAHIRTLLLTLFYRHMKPLLEAGYVYASQPPLYRIRYRGNTYDAMTDAERDQIIEEKCDGNPTHVQRFKGLGEMNPEQLWETTMNPDNRILKQITIEDAAAADKMFNILMGDAVEPRKEFIKEHSPEAEWVDI 642
>gi|194476918|ref|YP_002049097.1| DNA topoisomerase IV subunit B [Paulinella chromatophora] >gi|171191925|gb|ACB42887.1| DNA topoisomerase IV subunit B [Paulinella chromatophora] (652 aa)
Score = 1638, Expect = 3.7e-180, Identities = 335/632 (53%), Positives = 447/632 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDD--------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLE-EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           Y A  I++LEGL  VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+  EI ++L+++GSA + D+GRGIP + H  T KS +ETVLTVLHAGGKF  DSYKVSGGLHGVG SVVNALS WL+V VY++ + H+  F + G P+  L     + + + GT + F PD +I   +  FD  T+  RL++LAYLN G++I+F DER           +E + + GGIK++V  +N EK+P+   I+Y           N  K  ++VE A Q+   TY++S   F NNI T +GG+H EG K  L + +N FA ++   K++D  ++ E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V ++V E   +YL  NP    +I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G EF    LRY++I++MTDADVDG+HIR LLLTF +RY   LLE G +YIACPPL+K   GK+  Y YDE  L    K+   K  Y IQR+KGLGEM P QLW TTMDP++R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:    11 YGAEQIQVLEGLAPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDEILVSLSEDGSATISDNGRGIPTDIHPHTGKSALETVLTVLHAGGKFGGDSYKVSGGLHGVGVSVVNALSEWLEVTVYRKSQLHHQRF-ERGVPIGLLTAQPGEEN-RTGTSLTFKPDTKIFTTSITFDYSTLAGRLRELAYLNGGVRISFRDERISSGGENGIAYEEVYCYKGGIKEYVAYINKEKDPLHSEIIY----------VNSHKDGVQVEAALQWCVDTYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNSFAKKRGKRKDSDNNLAGENIREGLTAVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGEALTQYLEFNPSVIELILEKAIQAFNAAEAARRARELVRRKSILESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEEFDEKSLRYHRIVIMTDADVDGAHIRTLLLTFFYRYQKSLLEGGYIYIACPPLYKVERGKNHTYCYDENDLSTTLKRFREKSNYSIQRFKGLGEMMPKQLWSTTMDPQSRMMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 642
>gi|10644698|gb|AAG21374.1|AF288224_1 DNA Gyrase B subunit [Brachyspira hyodysenteriae] (636 aa)
Score = 1636, Expect = 5.4e-180, Identities = 339/643 (52%), Positives = 447/643 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSS-KYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + TYS+ NI++LEGL+ VRKRPGMYIGST  +GLHH+V+E+VDNSIDEAM G    IT+T+ K    +V+DDGRGIPV+ H K K S +E V+T LHAGGKFDN++YKVSGGLHGVG SVVNALS+ L   V K+ K +   +  G   + +  V     S K GT V F  D EI E   +D   + +RL++LA+LN+GI+I   DER  +     F + GGI+ ++  LN  K+ +    +Y  +        N+DK +  VEVA QY   YN + FT+CNNINTTEGG+H  GF+ AL ++   FA + +L K+       ED  EGL A+VS+K PNPQ+EGQTK KLGN+EVR     +V E    Y  +NP+    I++K + A +AR+ + +AR+  RRK+  ES+SLPGKLADCS ++ +  E+Y+VEGDSAGG+AK GRDR FQAILPL+GK++NVEKA+ DKI  NE +  +I A+G GVG  F I K+RY ++I+M DAD+DGSHIR LLLTF FRYM PL++ G+++IA PPL+K S  K +  YAY ++  ++   EN   KY IQRYKGLGEMN DQLWETTM+P+ RL+ +V  EDA  AD++FS+LMGDEV PRR+FIE NA+YVKNLD+
  S:     4 EKTYSSKNIQVLEGLDPVRKRPGMYIGSTGAQGLHHLVYEVVDNSIDEAMAGYCKNITVTIKKGNIIQVEDDGRGIPVDMHPKLKISALEVVMTKLHAGGKFDNETYKVSGGLHGVGVSVVNALSTELIAEVNKDGKLYRQVYHRG---IPEEPVKEVGTSKKTGTTVTFKADDEIFETTVYDYKILANRLRELAFLNRGIRITLKDEREAEVVSNEFYYEGGIEMFITHLNENKKALHDKPIYLHK--------NEDKTD--VEVAMQYVDAYNENIFTYCNNINTTEGGTHLVGFRTALTRVYTDFAKKLELDKKNKITFMGEDTREGLVAVVSVKIPNPQFEGQTKTKLGNTEVRAVTEKLVVEGLNDYFSQNPKVIKAILEKIISAAQAREAARKARDLARRKNALESDSLPGKLADCSEQEVDKCEVYLVEGDSAGGTAKGGRDRHFQAILPLRGKVLNVEKARLDKIIDNESLKPIIAALGCGVGASFDISKIRYGRVIIMADADIDGSHIRTLLLTFFFRYMRPLIDLGHIFIAVPPLYKISFDKKNFLYAYSDEQRDKILAENKDRKYDIQRYKGLGEMNADQLWETTMNPETRLMYQVLTEDAEKADQLFSMLMGDEVKPRRDFIESNARYVKNLDV 636
>gi|116332686|ref|YP_794213.1| DNA gyrase, B subunit [Lactobacillus brevis ATCC 367] >gi|116098033|gb|ABJ63182.1| DNA gyrase subunit B [Lactobacillus brevis ATCC 367] (647 aa)
Score = 1636, Expect = 6.4e-180, Identities = 349/647 (53%), Positives = 466/647 (72%)
  Q:     3 KETKKNT---YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEK-ASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KETK      Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDN IDEA+ G A EI +T+ ++ S  V D+GRGIP+    KT K  +ETV T+LHAGGKF    YKVSGGLHGVGASVVNALS+ L+  V ++ K + I F D G     + V  E     ++GT V F PD +I  E   FD  T+ +R+++LA+LNKG++I   DER +   +E FL+ GGI+ +V+ LN  KE +    +Y E +E+           I VEVA QY   Y+N+  TF NNI+T EGG+HEEGFK AL +++N +A + KL+K+ +  ++ +D  EGLTA+VS+KHP+PQ+EGQTK KLGNS+ R  V +  ++ F ++++E+P+ A  I+ K  LA +AR  +  ARE TR+KS  E ++LPGKLAD ++KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +NEEI +L TA+G G G +F + K+ Y+K+ILMTDADVDG+HIR LLLT ++RYM PLL+ G VYIACPPL++   GK  +Y   ++ L++   +     K QIQRYKGLGEM+ +QLWETTM+P+NR LL+V  +DA+NAD+VF++LMGD+VAPRREFIE NA + + LD+
  S:     5 KETKAQQAREYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIVDNGIDEALAGFADEIHVTVNQDNSITVTDNGRGIPIGIQKKTGKPALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTDLEAQVTRDGKTYAIAF-DHGHVKTPMHVIKEGLPQDQHGTAVHFLPDPDIFRETTVFDIKTLTTRIRELAFLNKGLRITIRDERPEKPTEEDFLYEGGIRHYVDYLNENKETLFEPPIYVEGQEN----------GITVEVALQYTDDYHNNLLTFTNNIHTYEGGTHEEGFKRALTRVVNDYARQNKLMKDNEANLTGDDVREGLTAVVSVKHPDPQFEGQTKTKLGNSDARTAVDHTFADHFMRFMMEHPDVARKIVDKGTLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGNDFDVSKVNYHKLILMTDADVDGAHIRTLLLTLVYRYMRPLLDAGFVYIACPPLYRVRQGKMQRYLDSDEELKDLLGQLPPSPKPQIQRYKGLGEMDAEQLWETTMNPENRRLLRVDAQDAINADQVFTMLMGDKVAPRREFIENNATFAE-LDV 647
>gi|78043837|ref|YP_361487.1| DNA gyrase, B subunit [Carboxydothermus hydrogenoformans Z-2901] >gi|77995952|gb|ABB14851.1| DNA gyrase, B subunit [Carboxydothermus hydrogenoformans Z-2901] (635 aa)
Score = 1636, Expect = 6.5e-180, Identities = 355/649 (54%), Positives = 463/649 (71%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M  E     Y A  I++L+GLE VRKRP MYIGST+ KGLHH+V+E+VDNSIDEA+ G  + I + + K+GS  V D+GRGIPV+ H +  K  VE VLT+LHAGGKF    YKVSGGLHGVG SVVNALS WL+V + ++   +Y +F  G +P+ +LK+  +  S   GTI+ F PD EI E  EF+ DT+  RL +L+YLNK +KI   DER + +E F  +GGIK +++ LN  KEP+   I ++           K+K  + VEVA QY  +++ +  +F NNINTTEGG+HE GFK AL ++IN +A +  L+KE +  +  ED  EGLTAI+S+K P+PQ+EGQTK KL N+EVR  V ++VS+    YL ENP     +I+  + A  AR+ + +ARE  RRK+  ESN+LPGKLADCS KD  + ELY+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEK++ DKI +NEEI  +ITA+G GV  +F I+K RY+++I+MTDADVDG+HIR LLLTF +RY+ PL+ENG VYIA PPL+K   GK  KY Y +  LE +  E  +    IQRYKGLGEM+P+QLWETTM+P+ R +LKVT+EDA  AD++F++LMGD+V PRREFIEKNAK V+NLDI
  S:     1 MELEKNGIKYGAEEIQVLKGLEGVRKRPAMYIGSTNEKGLHHLVYEVVDNSIDEALAGFCNRIEVIIHKDGSITVADNGRGIPVDIHPEVGKPAVEVVLTMLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWLEVRIKRDGNLYYQKFSRG-EPITELKIIGKSKS--TGTIITFKPDAEIFETVEFNYDTLAKRLLELSYLNKNVKIILKDERINKEEIFEHSGGIKDYLKYLNKNKEPLHKIIYFE-----------KEKDEVVVEVALQYCNSFSENILSFTNNINTTEGGTHEIGFKTALTRVINDYAKKYNLIKENNLSLQGEDIREGLTAIISVKVPDPQFEGQTKTKLVNTEVRSIVDSIVSDYLSTYLEENPAVGKKLIENAIRAARAREAARKARELARRKTALESNTLPGKLADCSEKDPSLCELYLVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDKILANEEIRAMITALGTGVDKDFDIEKARYHRLIIMTDADVDGAHIRTLLLTFFYRYLRPLIENGYVYIAQPPLYKVKKGKLEKYLYSDDELERYLNEIGREGVTIQRYKGLGEMDPEQLWETTMNPETRTILKVTLEDAAKADEIFTILMGDKVEPRREFIEKNAKLVRNLDI 635
>gi|110637817|ref|YP_678024.1| DNA gyrase subunit B [Cytophaga hutchinsonii ATCC 33406] >gi|110280498|gb|ABG58684.1| DNA gyrase subunit B [Cytophaga hutchinsonii ATCC 33406] (652 aa)
Score = 1635, Expect = 6.9e-180, Identities = 343/645 (53%), Positives = 456/645 (70%)
  Q:     1 MNKETKKNT--YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE------TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLE----EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           M++ T++N   YSA +I++LEGLEAVRKRP MYIG   IKGLHH+VWE+VDNSIDEA+ G+ ++IT+ + +  S  V D+GRGIP    AK  KS +E VLTVLHAGGKFD DSYKVSGGLHGVG S VNALS+ +KV VY   K H  E+K G  P  D+K   E  S  +GT V+F PD  I   +E+  +TI +RL++L++LNKGI+I   D R  D E       F   GG++++V+ L++ +E ++PT +Y E           DK  I VEVA  YN +Y+ + F++ NNINT EGG+H  GF+ AL + +  +A +  +L++   +++ +D  EGLTA++S+K   PQ+EGQTK KLGNS+V   V  VV E+   YL ENP++A +I++K +LA +AR  + +ARE  +RK+    + LPGKLADCS  D E  ELY+VEGDSAGGSAK GRDR + AILPL+GKI+NVEKA+  +I+ N+EI N+ITA+G   G E       + KLRY+K+I+MTDAD+DGSHIR L+LTF FRYM  L++ G+VYIA PPL+    GK  KY + E+  E    E  K+  +    IQRYKGLGEMNP+QLW TTMDP+ R L +V++E A  AD +FS+LMGDEVAPRR+FIEKNA+Y K
  S:     1 MSEITEQNAAGYSADSIQVLEGLEAVRKRPAMYIGDIGIKGLHHLVWEVVDNSIDEALAGHCTDITVEINENNSITVTDNGRGIPTGVIAKYGKSALEVVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSTDMKVTVYSHGKVHQQEYKKG-IPQYDVKEIGE--SDLHGTKVQFLPDDTIFTSSEYKYETIANRLRELSFLNKGIRITLQDHRQVDAEGKSEIEMFHSEGGLREFVDYLDSTREKLIPTPLYME----------SDKGPIPVEVAMLYNTSYSENVFSYVNNINTIEGGTHVAGFRRALTRTLKSYADKSGMLEKLKMEVTGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSDVMGAVDQVVGEMLNTYLEENPKEAKIIVQKVILAAQARNAARKAREMVQRKNVLSGSGLPGKLADCSESDPEKCELYLVEGDSAGGSAKQGRDRKYHAILPLRGKILNVEKAQEHRIYENDEIKNMITALGVSFGTEEGEKVLNLTKLRYHKVIIMTDADIDGSHIRTLILTFFFRYMRALIDGGHVYIAQPPLYLVKRGKEEKYCWTEEQREAAVKELAKDGKEDSVGIQRYKGLGEMNPEQLWSTTMDPEKRSLKQVSVESAAEADHLFSMLMGDEVAPRRDFIEKNARYAK 649
>gi|148322566|gb|EDK87816.1| DNA topoisomerase (ATP-hydrolyzing) [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (635 aa)
Score = 1634, Expect = 9.7e-180, Identities = 348/641 (54%), Positives = 440/641 (68%)
  Q:     9 TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF--KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +Y A NI +LEGLEAVRKRPGMYIG+T  +GLHH+VWEIVDNS+DEA+ G   +I + +  +   +V D+GRGIP + H K  KS +E VLTVLHAGGKF+ND+YKVSGGLHGVG SVVNALS WL+V V K    HY ++  G KP  D+K+       ++GTIV F  D EI E   ++  T+ +RLK+LAYLNKG+ I   D R D+K  ET+ F GGI  ++ E+  E   I+    Y   E+           N+ V+V F Y  + N   ++F NNINT EGG+H +GF+ AL K+IN     + LLK+ D K+   D  EG+  IVS K P PQ+EGQTK KLGNSEV   V+ +VS   + +L +NP    +II+K L + +AR+ + +ARE   RKS  E  SLPGKLADC++K  E  E++IVEGDSAGGSAK GRDR  QAILPL+GKIINVEKA   K   + EI  ++TA G  +G  F I KLRY KIILMTDADVDG+HIR L+LTFL+RYM  L+  GNVYIACPPL+K S GK   YAY++  L+    +      KY IQRYKGLGEMNP+QLWETTM+P  RLLLKV+I++A  AD +F  LMGD+V PRREFIE++A+YVKN+DI
  S:     2 SYEAQNITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCDKIEVKILPDNIIEVVDNGRGIPTDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVEVRKAGVIHYQKYHRG-KPEEDVKIIGSCDENEHGTIVRFKADGEIFETLIYNYFTLSNRLKELAYLNKGLTITLSDLRKDEKKEETYKFDGGILDFLNEIVKEDTTIIEKPFYISSEQD----------NVGVDVTFTYTTSQNEVIYSFVNNINTHEGGTHVQGFRTALTKVINDVGKAQGLLKDKDGKLMGNDIREGVVGIVSTKIPQPQFEGQTKGKLGNSEVSGIVNTIVSNSLKIFLEDNPNITKIIIEKILNSKKAREAAQKARELVLRKSVLEVGSLPGKLADCTSKKAEECEIFIVEGDSAGGSAKQGRDRYNQAILPLRGKIINVEKAGLHKSLESSEIRAMVTAFGTSIGETFDISKLRYGKIILMTDADVDGAHIRTLILTFLYRYMIDLIYAGNVYIACPPLYKVSSGKQIVYAYNDLELKNVLGQMNQDNKKYTIQRYKGLGEMNPEQLWETTMNPDGRLLLKVSIDNAREADMLFDKLMGDKVEPRREFIEEHAEYVKNIDI 635
>gi|183219432|ref|YP_001837428.1| DNA gyrase subunit B [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189909578|ref|YP_001961133.1| DNA gyrase subunit B [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167774254|gb|ABZ92555.1| DNA gyrase subunit B [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167777854|gb|ABZ96152.1| DNA gyrase subunit B [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (639 aa)
Score = 1634, Expect = 1.0e-179, Identities = 339/649 (52%), Positives = 448/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINK-FAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+ +T +N YSAS IKILEGLEAVRKRPGMYIG+ D  GLH MV+E+VDNS+DEAM G+ +EI + +  E   +V+D+GRGIP   H    KST+E VLT+LHAGGKF+ND+YKVSGGLHGVG SVVNALS++L+V V++E K HY +++  G PV D+K+  E  +   GT+V F PD  I    +F  DT+ +R +++A+LNKG+ I   D+R ++  K  F F GGI  +VE +   K P+   + +   +E+V A           E+A QY  TY+ + F F N IN   GG+H EGF+ AL + +N     ++ L K+    +  +D  EGL A++SIK P PQ+  QTK KL N+EV+  +  +  E   +Y  ENP     I++KC+LA +AR+ +  AR+ TRRK+  E   LPGKLADCS KD E  EL++VEGDSAGGSAK GRDR  QAILPLKGKI+NVEKA+ DKI SNEEI  LIT +G G+G  EF ++KLRY KII+MTDADVDGSHIR LLLTF FRYM P++E G++Y+A PPL+    GK + Y Y ++  +E  K     K  IQRYKGLGEMNP+QLW+TTMDPK R++L+V ++D + A+  F++LMGDEV+PRR FIE N+  V NLD+
  S:     1 MSNQTDQNAYSASKIKILEGLEAVRKRPGMYIGTQDESGLHKMVYEVVDNSVDEAMAGHCTEIDVRILPENIIEVRDNGRGIPTGIHPDKGKSTIEVVLTILHAGGKFENDAYKVSGGLHGVGVSVVNALSTYLEVEVHQEGKLHYQKYQ-AGVPVEDVKIIGE--TTHRGTVVRFRPDHTIFTTVDFSFDTLSARFREIAFLNKGLLIRIEDQRKEEFAKHEFKFDGGIVSFVEYITESKHPLHKVLHFVGEKENVWA-----------EIALQYCDTYSENIFCFTNAINNNLGGTHLEGFRTALTRTLNDHLKKDQTLFKKQPNGLQGDDIKEGLCAVISIKIPQPQFNSQTKEKLVNAEVKGLMQTITGEGLNRYFEENPAIIKKILEKCILASKAREAARRARDLTRRKTVLEGGGLPGKLADCSEKDPEHCELFLVEGDSAGGSAKQGRDRNTQAILPLKGKILNVEKARLDKILSNEEIRTLITVMGTGIGDDEFNVEKLRYRKIIIMTDADVDGSHIRTLLLTFFFRYMKPVIERGSLYVAQPPLYLLKFGKEAVYVYSDREKDEILKARPNDKVVIQRYKGLGEMNPEQLWDTTMDPKERVMLQVKLQDFVEAEDTFNILMGDEVSPRRRFIEANSYKVANLDL 639
>gi|118727518|ref|ZP_01576116.1| DNA gyrase, B subunit [Clostridium cellulolyticum H10] >gi|118663095|gb|EAV69758.1| DNA gyrase, B subunit [Clostridium cellulolyticum H10] (642 aa)
Score = 1632, Expect = 1.6e-179, Identities = 350/649 (53%), Positives = 457/649 (70%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVK----YQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+     + Y  S I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIV NSIDEA+ G    I + + K+ S  V D+G GIPV  H K    T+E V T+LHAGGKF + +Y VSGGLHGVGASVVNALS  ++V V +E   Y++ Y      GKP+  + +  +  + + GTI  F PD EI E   +D D + SR +++A+LNKGI I  IDER ++  ++   + GGI  +VE LN  KEP+   ++Y E              NI VEVA QYN +YN S FT+ NNI TTEGG+H  GF+ A+ K++N +A +  +LKE D+ +S ED  EGLTA++S+K P PQ+EGQTK KLGNSE+R  V NVVS+    +L E+P  A +I+ K + A  AR+ + +ARE TRRKS  +S++LPGKLADCS KD   +E++IVEGDSAGGSAK GRDR  QAILPL GK++NVEK++ DK++ NE++  +I A+GAG+G EF   KLRY+KII+M DADVDGSHIR+LLLTF FRYM PL+E G+VYIA PPLFK   GK   YAYD+  L++  KE    K      IQR+KGLGEMNPDQLWETTM+P+ R ++KV +EDA++AD+VF   MGD+V PRRE+I+ +A+ V NLDI
  S:     1 MSDINNNSIYDESQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVANSIDEALAGRCDIIKVIVHKDNSVTVTDNGSGIPVGIHPKMGIPTLEVVHTILHAGGKFGSGAYSVSGGLHGVGASVVNALSESMEVEVKREGHIYRQKYSR----GKPLTSVDIVGD--TDETGTITTFKPDPEIFEEIVYDFDAMISRYREMAFLNKGINIKLIDERPEESVEKNLHYEGGIISFVEYLNKSKEPLHDEVIYLEGSRDA---------NI-VEVAMQYNDSYNESVFTYANNIATTEGGTHLTGFRAAITKVLNDYARKFNILKENDKNLSGEDVREGLTAVLSVKLPEPQFEGQTKTKLGNSEIRTLVENVVSDKLFIFLEEHPAVAKIILDKSITAARAREAARKARELTRRKSAMDSSTLPGKLADCSEKDPTKTEIFIVEGDSAGGSAKQGRDRKIQAILPLWGKMLNVEKSRMDKVYDNEKLSPVIIALGAGIGDEFDTSKLRYDKIIIMADADVDGSHIRMLLLTFFFRYMRPLVEQGHVYIAMPPLFKVYKGKEEYYAYDDIELDKIFKERGWRKDDPNVNIQRFKGLGEMNPDQLWETTMNPETRTIIKVDLEDAISADEVFCKFMGDKVEPRREYIQMHARDVSNLDI 642
>gi|123967056|ref|YP_001012137.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9515] >gi|123201422|gb|ABM73030.1| DNA gyrase, subunit B [Prochlorococcus marinus str. MIT 9515] (655 aa)
Score = 1630, Expect = 2.8e-179, Identities = 340/642 (52%), Positives = 457/642 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEK-ASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+  +I I L  +GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W+ V V++E  E    F+ G     +LK   ++  S++ GTI+ F PD  I  +  EFD   + SRL++LAYLN G+KI FIDER         +E +L+ GGIK++V+ +N EKE I   I+Y + +          K N+ VE A Q+ +  Y+++   F NNI T +GG+H EG K  L +  N  A ++   KE D+ +S E+  EGLT ++S+K P+P++EGQTK KLGN+EVR  V +++ E   KY+  NP   ++I++K + +  A + +  AR+  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF ++ LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+ KY Y+E    KT+E+F     K  Y IQR+KGLGEM P QLW+TTM+P+ R++ KV IEDAL AD++F++LMGD+VAPRREFIE ++    NLDI
  S:    12 NDYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDQIEIVLKDDGSASISDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVNVTVFREGSEFTQRFERGITK-GELKTQKQQNKSLRKGTIICFKPDTTIFTDGIEFDYALLSSRLRELAYLNGGVKIIFIDERQKLPDGSFKEEIYLYDGGIKEYVQYINKEKESIHSEIIYVDSQ----------KDNVYVEAALQWCSDVYSDNILGFANNIRTIDGGTHIEGLKTVLTRTFNAIAKKRGKRKEVDKNLSGENIREGLTVVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLIGESLTKYMEFNPNVFDLILEKAIQSFNAAEAAKRARDLVRRKSVLESSTLPGKLADCSSRDPSGSEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNIEKTDDTKIYKNTEIQSLITALGLGIKGEEFDVNSLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVEKGFIYIACPPLYKVERGKNHKYCYNEGQLKKTIEDF---GEKANYNIQRFKGLGEMMPKQLWDTTMNPETRMMKKVEIEDALEADRIFNILMGDKVAPRREFIETHS---ANLDI 650
>gi|167770843|ref|ZP_02442896.1| hypothetical protein ANACOL_02196 [Anaerotruncus colihominis DSM 17241] >gi|167666883|gb|EDS11013.1| hypothetical protein ANACOL_02196 [Anaerotruncus colihominis DSM 17241] (662 aa)
Score = 1630, Expect = 2.9e-179, Identities = 345/640 (53%), Positives = 456/640 (71%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEK--EPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE---NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y  S I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G+ ++I + L      KV D+GRGIPV    K     V  V TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V V      +Y  F+ G   VA   + N   + + GT V F  D  I E   E+D DT+  RL++ A+LN G+ I   D+R  +  +E   + GGI+ +VE ++  K  EPI   I+Y        AA + D      EVA QYN +Y +   +F NNI+TT+GG+HE GFK AL + +N +A + KLLK+ DEK S ED +EGLTAIVS+K  + Q+EGQTK +LGN+++R  VS++V E    Y  ENP  A  II+K + A  AR+ +  AR+  RRKS  E+ SLPGKLADCS + ++ +E+YIVEGDSAGGSAK+GRDR FQAILPL GK++NVEKA+ DK++ N++++ +ITA+G G+G EF I+KLRY K+I+M DADVDGSHIR LLLTF FR+M PL+E+G+V IA PPLFK S GK  +YA+ ++  +++ +E   +   K  +QRYKGLGEM+P+QLWETTMDP+NR +L+V + DA+ AD++F++LMGD+VAPR++FIE+NAKYV+NLDI
  S:    29 YDGSQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNSIDEALAGHCTKIEVDLLPGNIVKVSDNGRGIPVGIQPKLGIPAVTVVFTVLHAGGKFGGSGYKVSGGLHGVGASVVNALSEWLEVEVCDGSARYYQRFERG---VAVEPLKNTGPTEEKGTSVAFKADAAIFEETTEYDYDTLLRRLREQAFLNAGVYIVLRDQRGTEPVEEHLHYEGGIRSFVEHIHKSKGVEPIHDEIIY-------LAARDGDN---TAEVAMQYNDSYTDLILSFANNIHTTDGGTHESGFKTALTRTMNDYAHKYKLLKD-DEKFSGEDVLEGLTAIVSVKLTDAQFEGQTKARLGNTQMRAMVSSLVYEKLTTYYEENPAVAKAIIEKSINASRAREAARRARDVARRKSALETASLPGKLADCSQRGRDGTEIYIVEGDSAGGSAKMGRDRRFQAILPLWGKMLNVEKARLDKVYGNDKLMPVITALGTGIGDEFDIEKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMRPLIEHGHVCIAQPPLFKVSRGKQVRYAFSDEERDQYIRELCPDGSGKADVQRYKGLGEMDPEQLWETTMDPRNRTMLRVEMADAIRADEIFTVLMGDKVAPRKDFIEQNAKYVQNLDI 662
>gi|194246593|ref|YP_002004232.1| DNA gyrase, beta subunit [Candidatus Phytoplasma mali] >gi|193806950|emb|CAP18382.1| DNA gyrase, beta subunit [Candidatus Phytoplasma mali] (633 aa)
Score = 1630, Expect = 2.9e-179, Identities = 349/644 (54%), Positives = 468/644 (72%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLF--AGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV--KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K   Y+A +I++LEGLEAVR RPGMYIGST+ KGL+H+VWEIVDN+IDE++ G A+EI + +  E   +V D+GRGIPV+ H KT K+ VET+LT LHAGGKFDN SYK+SGGLHGVGASVVNALSSW  V ++ + K ++ +++ G KPV  L++     + K GT++ F PD EI  E   ++ + +K R++QLA+LNKGIK+  ID+R D +E F F    G+K++++ LN  K  +      ++  E            +  E+ FQY + YNN+ ++F NNI T +GG+HEEGFK AL +I+NK+  +K +LK+    IS ED +EGLT ++S+KHPNP +E QTK K  NSEVR  +S    E  EKYLLENP++A  II+KCLL+ +AR  + +AREATRRKSP E+     KLADC  K+ + SELYIVEGDSAGGSAK GRD  +QAILPLKGK++NVEKA+ +KI SN+EII+LI A+G G G +F IDK+RY++II+MTDADVDG+HIR LLLTF FR + PL+E G +Y A  PL+K   GK   YAY+E   +E KK  S++  K+ IQRYKGLGEMNP+QLWETTM+P+ R LL+V  E+ L +D+VF++LMG+EV+ R++FI+ NA Y  +LD+
  S:     4 KTKIYNAESIQVLEGLEAVRIRPGMYIGSTNEKGLNHLVWEIVDNAIDESLEGYANEIILEVLPENIIRVTDNGRGIPVDIHPKTNKTVVETILTTLHAGGKFDNSSYKISGGLHGVGASVVNALSSWFLVEIHLQGKIYFQKYEKG-KPVTKLEIKGN--TNKKGTVITFLPDNEIFKETTNYNFEILKIRMQQLAFLNKGIKLIIIDKRKDIEEKFEFYYKEGLKEYIKYLNQNKTSLNKEFYQEKFFEK-----------MFFEIVFQYTEVYNNNIYSFVNNIPTHDGGTHEEGFKMALNRILNKYVKDKNMLKKNINFIS-EDTLEGLTVVISLKHPNPSFESQTKTKFLNSEVRQIISKFFGEELEKYLLENPQEAKKIIEKCLLSSKARIDAKKAREATRRKSPLETLGFASKLADCYNKNPQESELYIVEGDSAGGSAKQGRDSKYQAILPLKGKVLNVEKARLEKILSNKEIISLIQAVGTGFGKDFNIDKVRYHRIIIMTDADVDGAHIRTLLLTFFFRNLKPLIEKGYIYFAKSPLYKIQYGKKITYAYEE---QELKKILSRISGKFYIQRYKGLGEMNPEQLWETTMNPETRTLLQVNSENDLESDQVFNMLMGEEVSVRKKFIQDNAIYA-DLDV 633
>gi|118046939|ref|ZP_01515583.1| DNA gyrase, B subunit [Chloroflexus aggregans DSM 9485] >gi|117996521|gb|EAV10718.1| DNA gyrase, B subunit [Chloroflexus aggregans DSM 9485] (636 aa)
Score = 1629, Expect = 3.5e-179, Identities = 327/649 (50%), Positives = 439/649 (67%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYN-NSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M  ET   TY  S I++LEG+EAVRKRPGMYIG TDI GLH MV E+VDNS+DE M G A+ +++T+ ++GS  V DDG GIPV  H K   ST+  V+T LHAGGKF +  YKVS GLHGVG S VNALSS+++V VY+  + +Y E++  G PV D  V + + + ++GT   F PD  I++  +++ DT+  R ++++YLNKG++  F+DERT+ +  F F GGI  +V  LN +K  +     Y ER              + VEVA QY  T++ ++ +TF NNIN ++GGSH  GF+ AL ++IN +A  K LLKE +  ++ +D  EGLTA++S+K  +PQ+  QTK KL + E    V+ V  + F  +L ENP DA  II+K + A   R    + RE T RKS  E  SLPGKLADCS  +    ELYIVEGDSAGG+AK GRDR FQAILPL+GKI+NVEK++ D++ SN E+  LITAIG  +G +F + KLRY++I LMTDADVDGSHIR LLLTF FR+M PL+ NG+++IA PPL++   G+   Y Y +   + +  K     K +IQRYKGLGEMN +QLWETTM+P+NR++L+VT+EDA  AD+ F++LMGD V PRR FI+ +A  V  LDI
  S:     1 MTNETP-TTYDESQIQVLEGMEAVRKRPGMYIGPTDINGLHTMVREVVDNSVDEVMAGRATSVSVTIHRDGSVTVSDDGSGIPVGIHPKEGISTLTLVMTRLHAGGKFGSGGYKVSSGLHGVGVSAVNALSSYMRVDVYRNGRHYYQEYR-AGVPVTD--VIDLEPTDRHGTTTRFLPDTSIIQTLDYNFDTLAQRFREMSYLNKGLRFKFVDERTNRELNFYFEGGIVSYVRHLNKDKVVLHRQPFYVERVVD----------EVMVEVALQYTDTFDTDNVYTFANNINNSDGGSHLSGFRTALTRVINSYARAKGLLKENESNLTGDDVREGLTAVISVKLKDPQFSSQTKEKLVSPEAASAVATVFGDAFSAWLDENPADARRIIEKAITAARTRLAVQKVRE-TARKSAMEGFSLPGKLADCSDPNPARCELYIVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKSRLDRMLSNAEVRALITAIGTSIGDQFDLSKLRYHRIFLMTDADVDGSHIRTLLLTFFFRHMRPLITNGHLFIAQPPLYRIKHGREQVYTYSDAERDAYLSKLPPGTKVEIQRYKGLGEMNAEQLWETTMNPQNRVILQVTLEDAARADETFTMLMGDLVPPRRRFIQTHANEVVELDI 636
>gi|33864631|ref|NP_896190.1| DNA gyrase subunit B [Synechococcus sp. WH 8102] >gi|33632154|emb|CAE06610.1| DNA gyrase subunit B [Synechococcus sp. WH 8102] (655 aa)
Score = 1627, Expect = 6.2e-179, Identities = 335/635 (52%), Positives = 446/635 (70%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASI--KNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           +N Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDNS+DEA+ G+   I +TL ++GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ + H   F+ G   +  L   ++ AS   + GT V F PD EI      FD  T+ +RL++LAYLN G++I F DER   +        ET+ + GGIK++V  +N EK+ + P I+Y           N +K  ++VE A Q+ +  Y++S   F NNI T +GG+H EG K  L + +N FA +    KE+D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V N+V E   ++L  NP    +I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G +F +  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E    KTL+ F     K  Y IQR+KGLGEM P QLWETTMDP  R + +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:     8 QNAYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGHCDRILVTLGEDGSASISDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVQVTVRRQGQVHRQRFERGAA-IGSLASEDQPASEAGETGTTVCFKPDIEIFTGGIVFDYATLSARLRELAYLNGGVRIVFRDERESARNEVGEAHEETYFYEGGIKEYVAYMNTEKDALHPDIIY----------VNSEKDGVQVEAALQWCSDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKLGKRKESDSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGEGLSQFLEFNPSVIGLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEDFDVKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKALVEGGYIYIACPPLYKVERGKNHTYCYNEGDLQKTLQSF---GEKANYTIQRFKGLGEMMPKQLWETTMDPTTRTMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|163790923|ref|ZP_02185346.1| DNA gyrase, B subunit [Carnobacterium sp. AT7] >gi|159873765|gb|EDP67846.1| DNA gyrase, B subunit [Carnobacterium sp. AT7] (645 aa)
Score = 1627, Expect = 6.3e-179, Identities = 360/648 (55%), Positives = 470/648 (72%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFL---FAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENS-KVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +K+   N Y AS I++LEGLEAVRKRPGMYIG+T  +GLHH+VWEIVDNSIDEA+ G A EI +++ K+GS  V D+GRGIPV+  AKT +  +ETV T+LHAGGKF    YKVSGGLHGVG+SVVNALS+ L V+VYK  K ++ ++  G K V D++V  E  + K+GT V F PD EI  E  EF+ D + +R+++LA+LNKG+KI   D+R +DK+ FL   + GGIK +VE LN  K  +    ++ E E+            I +EVA Q+   Y+N+  +F NNI+T EGG+HE GFK AL ++IN +A + K++KE +E ++ ED  EGLT ++SIKHP+PQ+EGQTK KLGNSE R     + S  FEK+L+ENP  A  I++K LLA  AR  +  ARE TR+KS  E ++LPGKLADCS+KD  ISEL+IVEGDSAGGSAK GR R+FQAILP++GKI+NVEKA  D+I +NEEI +L TA+G G G +F + K RY+K+++MTDADVDG+HIR LLLT  +RYM P++E G VYIA PPL++   GK   Y   E  L E+ KE     K  IQRYKGLGEM+ +QLWETTM+P+NR +L+VT++DA+ ADK   +LMGD V PRR FIE+NA+YV+NLDI
  S:     7 SKQDLANEYDASQIQVLEGLEAVRKRPGMYIGATSSEGLHHLVWEIVDNSIDEALAGFADEINLSIEKDGSIIVMDNGRGIPVDIQAKTGRPALETVFTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSTTLDVYVYKNSKIYHQQYAQG-KVVHDVEVIGE--TDKHGTTVHFVPDPEIFKETVEFNFDKLATRVRELAFLNKGLKITVEDKR-EDKQAFLEYHYEGGIKSYVEFLNENKVVLYDEPIFLEGEQQ----------GITIEVAMQHTDGYHNNLMSFANNIHTYEGGTHEFGFKTALTRVINDYAKKNKIIKENEENLTGEDVREGLTIVLSIKHPDPQFEGQTKTKLGNSEARTITDRLFSAHFEKFLMENPPVARQIVEKGLLAARARLAAKRAREVTRKKSGLEISNLPGKLADCSSKDPSISELFIVEGDSAGGSAKQGRSRLFQAILPIRGKILNVEKATLDRILANEEIRSLFTAMGTGFGGDFDVSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPIVEAGYVYIAQPPLYQVRQGKKMVYLDSEDELNEYLKEIPLSPKPAIQRYKGLGEMDAEQLWETTMNPENRRMLQVTVDDAIEADKSCDMLMGDRVEPRRIFIEENARYVQNLDI 645
>gi|194332868|ref|YP_002014728.1| DNA gyrase, B subunit [Prosthecochloris aestuarii DSM 271] >gi|194310686|gb|ACF45081.1| DNA gyrase, B subunit [Prosthecochloris aestuarii DSM 271] (644 aa)
Score = 1625, Expect = 1.0e-178, Identities = 343/645 (53%), Positives = 449/645 (69%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIV--PTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGP-EFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE---KTLEEFKKENSKVK--YQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +  ++Y A+NI+IL+G+E VRKRP MYIG  +++GLHH+++EIVDNSIDE + G    I ++L  +GS  V D+GRGIPV+ H + KKS +E V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +V V ++ K  Y  +  G  P  ++K+  E  + K GT   F PD  I +  EF  D I  R+++LA+LN  +KI  + +  D +ETF + GGIK++V   ++ +  +V  P  +Y ER+ +V            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTAI+S+K   PQ+EGQTK KLGNSE +  V ++V+E   ++L  NP     II+K   A  +R  + +A+E TRRKS  ES  LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF  DKLRY KII+MTDADVDG+HIR LLLTF FR+M PL+E G V+IA PPL+    GK  KYA+DE    T+ E  K++ K K    IQRYKGLGEMNP+QLW TTMDP++R LL+VT+E+A+ AD+VFS LMGD+V PRREFIEKNA+YV+ LD+
  S:     8 SASSSYLATNIQILDGIEHVRKRPAMYIGDINVRGLHHLIYEIVDNSIDETLAGYNDTIEMSLNDDGSVTVSDNGRGIPVDMHPQKKKSALELVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVSRDGKVWYQRYHRG-VPQCEVKIIGE--TDKTGTKTTFMPDASIFKTTEFRKDVIIDRMRELAFLNSVLKI-VVKDTDDSEETFHYEGGIKEFVTYTDHNRIALVKEPVYLYGERDTTV------------VEIALQYNDSYQENVFSYVNNINTHEGGTHMTGFRKALTRTLNAYAQKNDLLKNLKLSLTGDDFKEGLTAIISVKVAEPQFEGQTKTKLGNSETQSIVESIVNEQLAEFLESNPNVLKTIIEKVKSAALSRDAARKAKELTRRKSVLESTGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTNFGEDEFMADKLRYGKIIIMTDADVDGAHIRTLLLTFFFRHMRPLIEAGKVFIAQPPLYLIKAGKEQKYAWDEDERTTIMEMMKKSQKGKTNINIQRYKGLGEMNPEQLWSTTMDPEHRSLLQVTVENAMEADQVFSTLMGDKVDPRREFIEKNARYVRRLDV 644
>gi|78211642|ref|YP_380421.1| DNA gyrase subunit B [Synechococcus sp. CC9605] >gi|78196101|gb|ABB33866.1| DNA gyrase, B subunit [Synechococcus sp. CC9605] (655 aa)
Score = 1625, Expect = 1.2e-178, Identities = 337/635 (53%), Positives = 445/635 (70%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKA--SIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           +N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+   I + L ++GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ + H   F+ G   +  L   ++ A  S + GT V F PD EI      FD  T+ +RL++LAYLN G++I F DER   +        ET+ + GGIK++V  +N EK+ + P I+Y           N +K  ++VE A Q+ +  Y++S   F NNI T +GG+H EG K  L + +N FA +    KE+D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V N+V E   ++L  NP    +I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G +F +  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E    KTLE F     K  Y IQR+KGLGEM P QLWETTMDP  R + +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:     8 QNAYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDRIVVVLGEDGSASVSDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVQVTVRRQGQVHRQRFERGAA-IGVLASESQPAAESGETGTTVCFKPDLEIFTGGIVFDYATLSARLRELAYLNGGVRIVFRDERESARDGEGNPHEETYFYEGGIKEYVAYMNKEKDALHPDIIY----------VNSEKDGVQVEAALQWCSDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKLGKRKESDSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGEALSQFLEFNPSVIGLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPGESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEDFDVKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNEGDLQKTLEGF---GEKANYTIQRFKGLGEMMPKQLWETTMDPTTRTMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|87301672|ref|ZP_01084512.1| DNA topoisomerase IV subunit B [Synechococcus sp. WH 5701] >gi|87283889|gb|EAQ75843.1| DNA topoisomerase IV subunit B [Synechococcus sp. WH 5701] (652 aa)
Score = 1623, Expect = 1.9e-178, Identities = 333/635 (52%), Positives = 447/635 (70%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           ++ Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDNS+DEA+ G+  EI + L ++GSA++ D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V ++ + H   F + G P+  L+ + +  S   GT V F PD EI     +FD  T+  RL++LAYLN G++I F DER   K        E + + GGI+++V  +N  K+P+ P I+Y           N  K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   K+TD  ++ E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V +VV E   ++L  +P+  ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LIT +G G+ G EF +  LRY++I++MTDADVDG+HIR LLLTF +RY   LLE G +YIACPPL+K   GK+  Y Y+E    KTL+ F     K  Y IQR+KGLGEM P QLWETTMDP  R + +V IEDA  AD++F++LMGD+VAPRREFIE ++
  S:     8 QHAYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGHCDEILVRLCEDGSAEITDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVEVTVRRQGQVHRQRF-ERGTPIGSLR-SEDDPSGATGTAVRFKPDIEIFSGGIDFDYATLSGRLRELAYLNGGVRIVFRDEREAAKGSDGSPHEEIYHYEGGIREYVTYMNAGKDPLHPDIIY----------VNASKDGVQVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFAKKRGKRKDTDSNLAGENIREGLTAVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSVVGEALGEFLEFHPQVIDLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITGLGLGIKGEEFNLSALRYHRIVIMTDADVDGAHIRTLLLTFFYRYQKTLLEGGYIYIACPPLYKVERGKNHTYCYNEQDLKKTLDGF---GEKANYTIQRFKGLGEMMPKQLWETTMDPTTRTMKRVEIEDAAEADRIFTILMGDKVAPRREFIETHS 642
>gi|19705416|ref|NP_602911.1| DNA gyrase subunit B [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713409|gb|AAL94210.1| DNA gyrase subunit B [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (639 aa)
Score = 1623, Expect = 2.1e-178, Identities = 347/644 (53%), Positives = 442/644 (68%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF--KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +K +Y A NI +LEGLEAVRKRPGMYIG+T  +GLHH+VWEIVDNS+DEA+ G   +I + +  E   +V D+GRGIP + H K  KS +E VLT+LHAGGKF+ND+YKVSGGLHGVG SVVNALS WL+V V K    HY ++  G KP  D+KV       ++GTIV F  D EI E   ++  T+ +RLK+LAYLNKG+ I   D R ++K+  T+ F GGI  ++ E+  E   I+    Y   E+           N+ V+V F Y  + N   ++F NNINT EGG+H +GF+ AL K+IN     + LLK+ D K+   D  EG+  IVS K P PQ+EGQTK KLGNSEV   V+ +VS   + +L +NP    +II+K L + +AR+ + +ARE   RKS  E  SLPGKLADC++K  E  E++IVEGDSAGGSAK GRDR  QAILPL+GKIINVEKA   K   + EI  ++TA G  +G  F I KLRY KIILMTDADVDG+HIR L+LTFL+RYM  L+  GN+YIACPPL+K S GK   YAY++  L+    +      KY IQRYKGLGEMNP+QLWETTM+P  RLLLKV+I++A  AD +F  LMGD+V PRREFIE++A+YVKN+DI
  S:     3 EKMSYEAQNITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCDKIEVKILPENIIEVMDNGRGIPTDIHPKYGKSAMEIVLTILHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVEVRKNGVVHYQKYHRG-KPEEDVKVIGSCDESEHGTIVRFKADGEIFETLIYNYFTLSNRLKELAYLNKGLTIILSDLRKEEKKEETYKFDGGILDFLNEIVKEDTTIIEKPFYVSSEQD----------NVGVDVTFTYTTSQNEVIYSFVNNINTHEGGTHVQGFRTALTKVINDVGKAQGLLKDKDGKLMGNDIREGVVGIVSTKIPQPQFEGQTKGKLGNSEVSGIVNTIVSSSLKIFLEDNPNITKIIIEKILNSKKAREAAQKARELVLRKSVLEVGSLPGKLADCTSKKAEECEIFIVEGDSAGGSAKQGRDRYNQAILPLRGKIINVEKAGLHKSLESSEIRAMVTAFGTSIGETFDIAKLRYGKIILMTDADVDGAHIRTLILTFLYRYMKDLITEGNIYIACPPLYKVSSGKQIIYAYNDLELKNILGQMNQDNKKYTIQRYKGLGEMNPEQLWETTMNPDGRLLLKVSIDNAREADMLFDKLMGDKVEPRREFIEEHAEYVKNIDI 639
>gi|72383051|ref|YP_292406.1| DNA gyrase subunit B [Prochlorococcus marinus str. NATL2A] >gi|72002901|gb|AAZ58703.1| DNA gyrase subunit B [Prochlorococcus marinus str. NATL2A] (655 aa)
Score = 1622, Expect = 2.3e-178, Identities = 338/641 (52%), Positives = 457/641 (71%)
  Q:     1 MNKETK-KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKN--GTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--------TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           M+K++K +  Y A  I++LEGLE VRKRPGMYIGST  KGLHH+V+E+VDN++DEA+ G+  +ITI L ++GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V ++ + H+  F+ G   +  LK  N   S KN  GT V F PD +I  +   F+   + SRL++LAYLN G++I F DER        T  +E + + GGIK++VE +   K+ + P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   K+ D  ++ E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V ++V     +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    K++ N EI +LITA+G G+ G +F++  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K + GK+ KY Y+E    KTL  F     K  Y IQR+KGLGEM P QLWETTMDP  R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:     1 MSKDSKVQAAYGAEQIQVLEGLEPVRKRPGMYIGSTGSKGLHHLVYEVVDNAVDEALAGHCDQITILLCEDGSASVSDNGRGIPTDLHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVEVTVRRQQQVHFQRFERGAS-IGSLKSENLSKSDKNLTGTTVCFKPDDQIFTDGISFEYGILSSRLRELAYLNGGVRIVFRDERKQSNDSSQTPYEEVYFYEGGIKEYVEYMTKAKDSLHPEIIY----------VNSEKDGVQVEAAMQWCVDAYSDSILGFANNIRTIDGGTHIEGLKTVLTRTLNSFAKKRGKRKDGDSNLAGENIREGLTAVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGTALSQYLEFNPGVIDLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNIEKTDDAKMYKNTEIQSLITALGLGIKGEDFEVKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKDLVEGGYIYIACPPLYKVTRGKNHKYCYNESDMQKTLASF---GEKANYTIQRFKGLGEMMPKQLWETTMDPTTRMMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|148238483|ref|YP_001223870.1| DNA gyrase subunit B [Synechococcus sp. WH 7803] >gi|147847022|emb|CAK22573.1| DNA gyrase subunit B [Synechococcus sp. WH 7803] (655 aa)
Score = 1622, Expect = 2.5e-178, Identities = 337/632 (53%), Positives = 443/632 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASI--KNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+ SEI + L ++GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ + H   F+ G  P+  L    + A    + GT V F PD EI      FD  T+ +RL++LAYLN G++I F DER   +        ET+ + GGIK++V  +N EK+ + P I+Y           N +K  + VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   KE D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V ++V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G +F +  LRY+++++MTDADVDG+HIR LLLTF +RY   L++ G +YIACPPL+K   GK+  Y Y+E    KTLE F     K  Y IQR+KGLGEM P QLWETTMDP  R + +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:    11 YGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCSEIQVVLGEDGSASVTDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGQVHRQRFERGA-PIGSLASEPQPAEEDGRTGTSVCFKPDIEIFSVGIVFDYATLSARLRELAYLNGGVRIVFRDERESARDAEGNPHEETYFYEGGIKEYVAYMNAEKDALHPEIIY----------VNAEKDGVSVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFARKRGKRKEADSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGEALGQYLEFNPGVIDMILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEDFDVKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVDGGYIYIACPPLYKVERGKNHTYCYNEPELQKTLEGF---GEKANYNIQRFKGLGEMMPQQLWETTMDPTTRTMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|124026793|ref|YP_001015908.1| DNA gyrase subunit B [Prochlorococcus marinus str. NATL1A] >gi|123961861|gb|ABM76644.1| DNA gyrase, subunit B [Prochlorococcus marinus str. NATL1A] (655 aa)
Score = 1622, Expect = 2.5e-178, Identities = 337/641 (52%), Positives = 457/641 (71%)
  Q:     1 MNKETK-KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKN--GTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--------TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           M+K++K +  Y A  I++LEGLE VRKRPGMYIGST  KGLHH+V+E+VDN++DEA+ G+  +ITI L ++GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V ++ + H+  F+ G   +  LK  N   S KN  GT V F PD +I  +   F+   + SRL++LAYLN G++I F DER        T  +E + + GGIK++VE +   K+ + P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   K+ D  ++ E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V ++V     +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    K++ N EI +LITA+G G+ G +F++  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K + GK+ KY Y+E    KTL  F     K  Y IQR+KGLGEM P QLW+TTMDP  R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:     1 MSKDSKVQEAYGAEQIQVLEGLEPVRKRPGMYIGSTGSKGLHHLVYEVVDNAVDEALAGHCDQITILLCEDGSASVSDNGRGIPTDLHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVEVTVRRQQQVHFQRFERGAS-IGSLKSENLSKSDKNLTGTTVCFKPDDQIFTDGISFEYGILSSRLRELAYLNGGVRIVFRDERKQSNDSSQTPHEEVYFYEGGIKEYVEYMTKAKDSLHPEIIY----------VNSEKDGVQVEAAMQWCVDAYSDSILGFANNIRTIDGGTHIEGLKTVLTRTLNSFAKKRGKRKDGDSNLAGENIREGLTAVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGTSLSQYLEFNPNVIDLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNIEKTDDAKMYKNTEIQSLITALGLGIKGEDFEVKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKDLVEGGYIYIACPPLYKVTRGKNHKYCYNESDMQKTLASF---GEKANYTIQRFKGLGEMMPKQLWDTTMDPTTRMMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|21904202|gb|AAM79083.1| putative DNA gyrase, subunit B [Streptococcus pyogenes MGAS315] (620 aa)
Score = 1622, Expect = 2.5e-178, Identities = 341/623 (54%), Positives = 442/623 (70%)
  Q:    27 RPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF   SYKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL+V          T V F PD EI  E  +FD   +  R+++LA+LN+G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     2 RPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQVKTGRPAVETVFTVLHAGGKFGGGSYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEVIGTTDVTG--TTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 620
>gi|88602335|ref|YP_502513.1| DNA gyrase, B subunit [Methanospirillum hungatei JF-1] >gi|88187797|gb|ABD40794.1| DNA gyrase subunit B [Methanospirillum hungatei JF-1] (675 aa)
Score = 1622, Expect = 2.8e-178, Identities = 340/642 (52%), Positives = 454/642 (70%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKT-KKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLK------------------------------VTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD----KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDK-YNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           NTY++ NIKIL GLE VR+RP MYIGSTD +GLHH+V+E+VDNSIDEA+ G  + I + + ++GS  V+D+GRGIP++       K+ +ETVLTVLHAGGKFD ++Y+VSGGLHGVG SVVNALS  L   V+K+  E+ + F  G +P  DL+                                N   S  +GT++ F PD +I E  EFD D +  RL++LA+LN GI I+  DER +D     E F + GGI ++V  LN+E +PI          ESV + + KD+   + V++AFQY   Y+   +T+ N++NT EGG+H EGF+ AL K INK   E K +K+ +  +  +D  EGLTAI+S++  NPQ+EGQTK KLGNSEV+  V ++V     +Y  E+P++   I+ K +LA +AR+ + +A+E  RRKS  ES+ LPGKLADCS +  E SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA   KI  N EI  LI+AIG GVG  F I+K RY+ II+MTDADVDG+HI  LL+TF FRY+ PL+E G +Y+A PPL++ + GK  KYAY E+ ++E  +E  +    +QRYKGLGEMN  QLW TTMDP+ R+L +V IEDA  A+++F  LMGD+V  RR+FI+++AK V NLDI
  S:     8 NTYNSENIKILRGLEPVRERPAMYIGSTDSRGLHHLVYEVVDNSIDEALAGYCTHIQVVIHQDGSVSVEDNGRGIPIDPMKDNDNKTALETVLTVLHAGGKFDKNTYQVSGGLHGVGVSVVNALSVELTATVWKDGYEYRMFFSRG-QPQTDLEKKEEDFEEIKDRYIKRYGSLPDNCPETKEEFLNRYLSKISGTMIRFKPDSKIFETIEFDYDILAHRLRELAFLNSGITISIADERCEDLEECSEVFSYEGGISEYVRYLNHEAQPI---------HESVISFSRKDEEARVEVDIAFQYAAAYSEKVYTYVNSVNTKEGGTHLEGFRSALTKAINKMGKENKAIKDQNLSLKGDDVREGLTAIISVRMANPQFEGQTKMKLGNSEVKGIVDSLVYASLCEYFEEHPKELAAIVDKAVLAYQAREAARKAKELARRKSTLESSGLPGKLADCSERSAEKSEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKATVHKILKNNEIQALISAIGTGVGESFDIEKARYHHIIIMTDADVDGAHISTLLMTFFFRYLQPLIEAGYIYLAQPPLYRIAKGKQEKYAYTEEEMKEILQEMGEKGVNVQRYKGLGEMNASQLWATTMDPETRVLKRVVIEDAAYANEIFEKLMGDDVTARRDFIKRHAKEVTNLDI 675
>gi|163848553|ref|YP_001636597.1| DNA gyrase, B subunit [Chloroflexus aurantiacus J-10-fl] >gi|187600963|ref|ZP_02987193.1| DNA gyrase, B subunit [Chloroflexus sp. Y-400-fl] >gi|163669842|gb|ABY36208.1| DNA gyrase, B subunit [Chloroflexus aurantiacus J-10-fl] >gi|187486791|gb|EDU24762.1| DNA gyrase, B subunit [Chloroflexus sp. Y-400-fl] (636 aa)
Score = 1622, Expect = 2.8e-178, Identities = 325/649 (50%), Positives = 440/649 (67%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYN-NSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M  ET   TY  S I++LEG+EAVRKRPGMYIG TDI GLH MV E+VDNS+DE M G A+ +++T+ ++GS  V DDG GIPV  H K   ST+  V+T LHAGGKF +  YKVS GLHGVG S VNALS++++V VY+  + +Y E++  G PV D  V + + + ++GT   F PD  I++  +++ DT+  R ++++YLNKG++  F+DERT+ +  F F GGI  +V  LN EK  +     Y ER             ++ VEVA QY  +++ ++ +TF NNIN  +GGSH  GF+ AL ++IN +A  K LLK+ +  ++ +D  EGLTA++S+K  +PQ+  QTK KL + E    V+ V S+ F  +L ENP +A  II+K + A   R    + RE T RKS  E  SLPGKLADCS  +    ELYIVEGDSAGG+AK GRDR FQAILPL+GKI+NVEK++ D++ SN E+  LITAIG  +G +F + KLRY++I LMTDADVDGSHIR LLLTF FR+M PL+ NG+++IA PPL++   G+   Y Y +   + +  K     K +IQRYKGLGEMN +QLWETTM+P+NR++L+VT+EDA  AD+ F++LMGD V PRR FI+ +A  V  LDI
  S:     1 MTSETP-TTYDESQIQVLEGMEAVRKRPGMYIGPTDINGLHTMVREVVDNSVDEVMAGRATSVSVTIHRDGSVTVSDDGSGIPVGIHPKEGISTLTLVMTRLHAGGKFGSGGYKVSSGLHGVGVSAVNALSAYMRVDVYRNGRHYYQEYR-AGVPVTD--VIDLEPTDRHGTTTRFLPDTSIIQTLDYNFDTLAQRFREMSYLNKGLRFKFVDERTNRELNFYFEGGIVSYVRHLNKEKTVLHRQPFYVERIVD----------DVMVEVALQYTDSFDTDNVYTFANNINNADGGSHLSGFRTALTRVINNYARAKGLLKDNESNLTGDDVREGLTAVISVKLKDPQFSSQTKEKLVSPEAASAVATVFSDAFSAWLDENPTEARRIIEKAISAARTRLAVQKVRE-TARKSAMEGFSLPGKLADCSDPNPARCELYIVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKSRLDRMLSNAEVRALITAIGTSIGDQFDLSKLRYHRIFLMTDADVDGSHIRTLLLTFFFRHMRPLITNGHLFIAQPPLYRIKHGREQVYTYSDAERDAYLSKLPPGTKVEIQRYKGLGEMNAEQLWETTMNPQNRVILQVTLEDAARADETFTMLMGDLVPPRRRFIQTHANEVVELDI 636
>gi|134297887|ref|YP_001111383.1| DNA gyrase, B subunit [Desulfotomaculum reducens MI-1] >gi|134050587|gb|ABO48558.1| DNA gyrase subunit B [Desulfotomaculum reducens MI-1] (638 aa)
Score = 1621, Expect = 3.6e-178, Identities = 349/649 (53%), Positives = 452/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+++ + N YSA  I++LEGLEAVR+RPGMYIGST  +GLHH+V+E+VDNSIDEA+ G   +I +T+ ++ S  V+D+GRGIPV+ H K  +  VE VLT+LHAGGKF    YKVSGGLHGVG SVVNALS +L V + +  K +  E+  G  P  +L++     S   GT V F PD EI E   F  +T+  R+++LAYLNKGIKI   D+R D   ++ F + GGIK +V+ LN  K+ I    +Y   E          K  I VEVA QYN  Y  +  ++ NNI+T +GG+HE G K AL ++IN +  +  +LK  D  +S ED  EG T ++S+K P PQ+EGQTK KLGNSEVR  V ++ +E    YL+ENP  A  II+K + A  AR+ + +ARE TRRKS  E+ SLPGKLADCS KD  +SE+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEKA+ DKI +NEEI  +ITA+G G+G +F I K RY+KI++MTDADVDG+HIR LL+TF +RYM  L+E G V++A PPL++   GK   Y Y +  LEE        +  IQRYKGLGEMNP+QLWETTMDP  R +L+VT+EDA+ AD  FS+LMGD V PRR+FI++NAKYV+NLDI
  S:     1 MDQQQQNNKYSADQIQVLEGLEAVRRRPGMYIGSTSARGLHHLVYEVVDNSIDEALAGYCDKIIVTIQEDNSITVEDNGRGIPVDLHPKVGRPAVEVVLTMLHAGGKFGGGGYKVSGGLHGVGVSVVNALSKYLSVEIKRNGKIYKQEYSRG-IPTTELQIVGN--SKTTGTKVTFKPDEEIFEELVFSLETLSQRIRELAYLNKGIKIILQDKRKDPVAEQIFQYDGGIKDFVKHLNRNKQTIHTKPIYVSGE----------KEQIVVEVAIQYNDGYTENMLSYANNIHTVDGGTHEVGLKTALTRVINDYGRQHGVLKNNDANLSGEDIREGATIVISVKVPEPQFEGQTKTKLGNSEVRGIVDSIFAEKLSTYLVENPSVAKKIIEKGITAARAREAARKARELTRRKSALETMSLPGKLADCSEKDPSVSEIYLVEGDSAGGSAKQGRERRFQAILPLKGKILNVEKARMDKILANEEIRAMITAMGTGIGEDFDIAKARYHKIVIMTDADVDGAHIRTLLMTFFYRYMRQLIEAGYVFVAQPPLYRVRKGKHDSYCYSDNELEELLNRIGHDRVNIQRYKGLGEMNPEQLWETTMDPDTRTMLQVTLEDAIEADATFSMLMGDRVEPRRDFIQENAKYVRNLDI 638
>gi|15674782|ref|NP_268956.1| DNA gyrase subunit B [Streptococcus pyogenes M1 GAS] >gi|71910366|ref|YP_281916.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS5005] >gi|73919732|sp|Q9A0L0|GYRB_STRP1 DNA gyrase subunit B >gi|13621909|gb|AAK33677.1| putative DNA gyrase, subunit B [Streptococcus pyogenes M1 GAS] >gi|71853148|gb|AAZ51171.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS5005] (650 aa)
Score = 1620, Expect = 3.8e-178, Identities = 356/646 (55%), Positives = 459/646 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL+V          T V F PD EI  E  +FD   +  R+++LA+LN+G+KI+  D+R+  + +E FL+ GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEVIGTTDVTG--TTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFLYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 650
>gi|70725006|ref|YP_251920.1| DNA gyrase (topoisomerase II) subunit B [Staphylococcus haemolyticus JCSC1435] >gi|68445730|dbj|BAE03314.1| DNA gyrase (topoisomerase II) subunit B [Staphylococcus haemolyticus JCSC1435] (644 aa)
Score = 1620, Expect = 4.3e-178, Identities = 347/641 (54%), Positives = 462/641 (72%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD---DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK     ++ K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI I   DER D    ++T+ + GGIK +VE LN  KEPI         EE +     KD  ++ +E+A QYN  Y  +  ++ NNI+T EGG+HE+GFK AL +I+N +  + K++K+  E++S ED  EGLTA+VSIKH +PQ+EGQTK KLGNSEVR  V  + +E FE++L E+P  A ++++K ++A  AR  + +ARE TRRKS  E +SLPGKLADCS+K  E SE+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G EF I K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y ++++ L++ K E S   K+QI RYKGLGEMN DQLWETTM+P+NR++L+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVIIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSEDLEVYVHRNDTIYHQAYKKG-VPQFDLKEVG--STDKTGTVIRFKADSEIFTETTVYNYETLQKRIRELAFLNKGISITLRDEREDVEQREDTYHYEGGIKSYVELLNENKEPI--------HEEPIYIHQTKD--DVEIEIAMQYNSGYATNLLSYANNIHTYEGGTHEDGFKRALTRILNSYGTQSKIIKDDKERLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQIVDRLFAEHFERFLYEHPNVARIVVEKGIMASRARVAAKKAREVTRRKSALEISSLPGKLADCSSKKPEESEIFLVEGDSAGGSTKEGRDSKTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLAQGKQKYYVFNDRELDKLKSELSPTPKWQISRYKGLGEMNADQLWETTMNPENRMMLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 643
>gi|114565581|ref|YP_752735.1| DNA topoisomerase (ATP-hydrolyzing) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336516|gb|ABI67364.1| DNA gyrase subunit B [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (633 aa)
Score = 1620, Expect = 4.5e-178, Identities = 337/640 (52%), Positives = 454/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y+AS+I++LEGLEAVRKRPGMYIGST  KGLHH+V+EIVDNSIDEA+ G   +I +T+ ++ S  V DDGRGIPV+ H       ++ +LT LH+GGKF    Y +SGGLHGVG SVVNALS  ++V V ++   Y++ Y    + G PV ++++  E  S + GT + F+ D EI E   F+ + +  RL++L++LN+ +KI+  DER ++   + F ++ G+K +V  +N  KE I    +Y E        N KD  ++ V+VA QYN +Y+ + ++F NNI T EGG+HE GFK AL ++IN +A +  +LKE D  +S ED  EG+ AI+S+   +PQ+EGQTK KLGN+ +R  V ++V E  E YL ENP  A  ++ K + A  AR+ + +ARE TRRK+  ES +LPGKLADCS K+   SEL+IVEGDSAGGSAK GRDR +QAILPL+GKI+NVEKA+ D++ S+EEI NLITA+G G+G +F I K RY+K+ +MTDADVDGSHIR+LLLTF +RYM  L+E G +YIA PPL+    GK  KY Y++  L  F  +  + K+ IQRYKGLGEM+P+QLW TTMD ++R +LKVTIEDA+ A+ +FS LMGD V PRREFIE NA+YV NLDI
  S:     6 YNASDIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVFEIVDNSIDEAVAGFCKKIEVTINQDNSITVCDDGRGIPVDIHPAMGIPALQVILTTLHSGGKFGGSGYNISGGLHGVGLSVVNALSRRMEVRVKRDGHIYQQDY----ERGNPVNEIRIIGE--SKETGTSICFFADDEIFEEINFEREILLQRLRELSFLNRNLKISLRDEREEEVFYQEFHYSHGLKDFVAYINKNKEVINDNPIYFE--------NKKD--DVIVQVAIQYNNSYSENLYSFANNIRTQEGGTHEIGFKNALTRVINDYAKKNNILKENDNNLSGEDIREGIAAIISVLVKDPQFEGQTKTKLGNTYIRGIVESIVFEHVEDYLNENPAAARKLLDKAISARRAREAAKKARELTRRKNALESTALPGKLADCSNKNPAESELFIVEGDSAGGSAKQGRDRTYQAILPLRGKILNVEKARLDRVLSSEEIRNLITAMGTGIGEDFDIKKARYHKLFIMTDADVDGSHIRVLLLTFFYRYMKELIEEGYLYIAQPPLYGLKRGKEIKYFYNDADLNAFLSQTEQ-KWSIQRYKGLGEMDPEQLWTTTMDAESRTVLKVTIEDAIKANDIFSALMGDNVQPRREFIESNARYVANLDI 633
>gi|166367564|ref|YP_001659837.1| DNA gyrase subunit B [Microcystis aeruginosa NIES-843] >gi|166089937|dbj|BAG04645.1| DNA gyrase subunit B [Microcystis aeruginosa NIES-843] (640 aa)
Score = 1619, Expect = 4.9e-178, Identities = 333/642 (51%), Positives = 447/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDNSIDEA+ G  + I + +  +GS  V DDGRGIP + H  T KS +ETVLT+LHAGGKF +  YKVSGGLHGVG SVVNALS+W+ V V++++K H   + + G PV +L V++     K GT V F PD EI  +  EFD  T+  RL++LAYLN G+KI F D R ++   ET+ + GGIK++V  +  EKE +   I+Y   E          K  I +EVAFQ+    Y+++   F NNI T +GG+H EG K  L + +N  A ++  +KE +  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V ++V E   +YL +NP+ A+ II+K + A +A + +  AR+  RRKS  ES+ LPGKLADCS +D E SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G +F   +LRY++I+LMTDADVDG+HIR LLLTF +RY   L++ G VYIACPPL+K   GK+  Y Y ++ L++   E  S   Y IQR+KGLGEM P QLW+TTM+P+ R L +V IEDA  A+++F++LMGD VAPRREFIE +   +   D+
  S:     3 SNYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSIDEALAGYCTHIEVDIKADGSVSVTDDGRGIPTDVHPTTGKSALETVLTILHAGGKFGSGGYKVSGGLHGVGISVVNALSAWVDVTVWRDHKVHTQRY-ERGIPVTEL-VSSPSQEEKTGTRVNFLPDTEIFSQGIEFDYSTLSGRLRELAYLNAGVKITFSDYRPEEPHIETYCYEGGIKEYVAYMCREKETLHKDIIYVSGE----------KNGINIEVAFQWCIDAYSDNILGFANNIRTIDGGTHLEGLKAVLTRTLNNVARKRNKIKENEPNLAGENVREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGETLNEYLEQNPQVADTIIEKAVQAYKAAEAARRARDLVRRKSVLESSPLPGKLADCSERDPERSEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQSLITALGLGIKGEDFDPSQLRYHRIVLMTDADVDGAHIRTLLLTFFYRYQKNLIDQGYVYIACPPLYKLERGKNHSYCYSDRELQQKIAEFPSNANYTIQRFKGLGEMMPQQLWDTTMNPETRTLKRVEIEDAAKAEELFTILMGDRVAPRREFIETHGSRLNLTDL 638
>gi|169830224|ref|YP_001716206.1| DNA gyrase, B subunit [Candidatus Desulforudis audaxviator MP104C] >gi|169637068|gb|ACA58574.1| DNA gyrase, B subunit [Candidatus Desulforudis audaxviator MP104C] (635 aa)
Score = 1619, Expect = 5.8e-178, Identities = 338/640 (52%), Positives = 451/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKE--PIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNS-TFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSK---YAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A +I++LEGLEAVRKRPGMYIGST  KGLHH+++E+VDNSIDEA+ G    I + +  + S  V D+GRGIPV+ H +  +  +E VLT LHAGGKF    YK+SGGLHGVG SVVNALS  ++V V +E   +  EF + G    +L++ +E  + + GT V F PD +I E  EF  D +  RL++L++LN G+ +   DERT   + + +AGGI+ +V  LN  KE  P  P  V D             K  + VEVA QY    +    F++ N I+T +GG+HE GFK AL + IN +A +  L+K  ++ +S ED  EGLTA++++K P PQ+EGQTK KLGNSEVR  V  VVS+    YL E+P +A  I+++ ++A  AR+ +  ARE T+RKS  ES +LPGKLADCS +D + SELY+VEGDSAGGSAK GRDR FQAILPL+GKI+N EKA+ DK+  NEEI  LITAIG G G +F + K RY++I++MTDADVDGSHIR LLLTF +RYM PL++ G VYIA PPL++ S GK  K   Y Y ++ LE+F +EN +  + IQRYKGLGEMNP+QLW+TT+DP+NR +L+VT+EDAL A+++ S LMG++V PRREFI+++A+ V+NLDI
  S:     8 YRAEDIQVLEGLEAVRKRPGMYIGSTGPKGLHHLIFEVVDNSIDEALAGFCDYIEVVIHADNSVTVSDNGRGIPVDIHPQVGRPALEVVLTRLHAGGKFGGTQYKISGGLHGVGVSVVNALSRRMEVEVKREGYRYRQEF-ERGLATGELELLDE--ADETGTRVTFIPDPDIFEEVEFQYDVVAKRLRELSFLNAGVTLVLRDERTGRDKVYQYAGGIRDFVRHLNLHKEVLPADPIYVEDH------------KNGVWVEVAVQYVVNSDRELIFSYANTIHTVDGGTHEAGFKSALTRTINDYARKYNLVK--NDSLSGEDIREGLTAVINVKVPEPQFEGQTKTKLGNSEVRGLVDWVVSQRLAAYLEEHPTEARQIVQRAVVASRAREAARRARELTKRKSLLESATLPGKLADCSRRDPQHSELYLVEGDSAGGSAKQGRDREFQAILPLRGKILNAEKARRDKLLGNEEIRALITAIGTGFGEDFDLAKARYHRIVIMTDADVDGSHIRTLLLTFFYRYMKPLIDAGYVYIAQPPLYRVS-GKGRKNGVYLYSDQQLEQFFRENGRQNWSIQRYKGLGEMNPEQLWDTTLDPENRTMLQVTLEDALAAEQLLSTLMGEQVEPRREFIQQHAREVRNLDI 635
>gi|188159859|ref|ZP_02998944.1| DNA gyrase, B subunit [Mycoplasma mycoides subsp. mycoides LC str. GM12] (634 aa)
Score = 1619, Expect = 6.0e-178, Identities = 341/639 (53%), Positives = 452/639 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVY-DEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           YSA +IK+L+GLEAVR RPGMYIGST   GLHH+VWEI+DNSIDEAM G A  I +T+TKE    VQD+GRGIPV  ++ TKKS +  V T LHAGGKFD+++YK+SGGLHGVGASVVNALS +++V VY+    ++  F +GG   ++L+      +   GT V+F PD EI  E   FD + IK+++KQLA+LNKG+KI   DER +    +LF  GI  +++E N  K  I P I Y D + E           +I VE+A QYN  Y  +  TF NNINT EGG+HE+G K AL + IN++A       +T  K S +D  EG+  I+S++H +PQYEGQTK KL N + +  V+ ++   FE++LL++PEDA  I+ K + A +AR  + +ARE TRRKS  +S SLPGKLADC TKD  I+ELY+VEGDSAGGSAK GR+R FQAILPL+GK++NVE+    + FSN EI ++ITA+G G+  E  + KLRY KI++MTDADVDG+HIR LLLTF +RYM PL+ NG++YIA PPL+K   GK   YAY +  L+E K  E + +KY IQRYKGLGEM+P QLWETTMDP+ R +L++++EDA  A++VFS LMG++   R+ +I+ NAK+V+N+D
  S:     5 YSAESIKVLKGLEAVRTRPGMYIGSTSKTGLHHLVWEILDNSIDEAMAGYADLINVTITKENEVIVQDNGRGIPVGINSDTKKSALSLVFTQLHAGGKFDSETYKISGGLHGVGASVVNALSLYVEVEVYRNNIHYHQLFSEGGTKESELQQLGH--TDLRGTKVKFKPDPEIFKETVVFDYEIIKNKVKQLAFLNKGLKITLTDERIEKTVEYLFLNGILDYIKEKNETKNKINPNIFYVDSKYE-----------DIEVEMALQYNSDYQENIITFVNNINTHEGGTHEDGLKQALIRDINRYADTVIKNNKTPSKFSWDDIKEGMMCILSVRHTDPQYEGQTKTKLSNPDAKEAVNIIIGNAFEEFLLKSPEDAKAILDKNVNAQKARIAAQKAREETRRKSALDSFSLPGKLADCETKDSSIAELYLVEGDSAGGSAKTGRNRKFQAILPLRGKVLNVERVTEARAFSNNEIKSIITAVGTGIKEELDLSKLRYKKIVIMTDADVDGAHIRTLLLTFFYRYMKPLVANGHIYIAQPPLYKIEAGKKIAYAYTDSQLDELKNNEFNNLKYTIQRYKGLGEMDPLQLWETTMDPQQRTMLQISLEDATLANEVFSDLMGEDPELRKIYIQDNAKFVENID 633
>gi|159904302|ref|YP_001551646.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9211] >gi|159889478|gb|ABX09692.1| DNA gyrase, subunit B [Prochlorococcus marinus str. MIT 9211] (658 aa)
Score = 1619, Expect = 6.0e-178, Identities = 338/641 (52%), Positives = 453/641 (70%)
  Q:     1 MNKETKKNT----YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIK--NGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDD--------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           M++++K N     Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+  EI + L  +GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V ++ + H   F + G PV  L   ++ +S K   GT V F PD +I     EF+  T+ SRL++LAYLN G++I F DER           +E + + GGIK++V  +N+EK+ + P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   K+ D  ++ E+  EGLT ++S+K P P++EGQTK KLGN+EVR  V ++V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF    LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK  KY Y+E    KT++ F     K  Y IQR+KGLGEM P QLWETTMDP  R++ KV IEDAL AD++F++LMGD+VAPRR+FIE ++
  S:     1 MSEDSKVNKVQADYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDEIVVVLCNDGSASITDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQNQTHVQRF-ERGVPVGGLTSKDQPSSQKGVTGTTVCFKPDNQIFTSGIEFEYATLSSRLRELAYLNGGVRIVFRDERKTSLTTEGDPYEEIYFYQGGIKEYVSYINSEKDALHPEIIY----------VNSEKDGVQVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNSFARKRGKRKDGDNNLAGENIREGLTVVLSVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGESLSQYLEFNPSVIDLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNIEKTDDSKIYKNTEIQSLITALGLGIKGEEFSSKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVEGGYIYIACPPLYKVERGKKHKYCYNESDLKKTIDGF---GEKANYTIQRFKGLGEMMPKQLWETTMDPSTRMMKKVEIEDALEADRIFTILMGDKVAPRRQFIETHS 648
>gi|159028965|emb|CAO87426.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (640 aa)
Score = 1618, Expect = 6.9e-178, Identities = 333/642 (51%), Positives = 447/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDNSIDEA+ G  + I + +  +GS  V DDGRGIP + H  T KS +ETVLT+LHAGGKF +  YKVSGGLHGVG SVVNALS+W+ V V++++K H   + + G PV +L V++     K GT V F PD EI  +  EFD  T+  RL++LAYLN G+KI F D R ++   ET+ + GGIK++V  +  EKE +   I+Y   E          K  I +EVAFQ+    Y+++   F NNI T +GG+H EG K  L + +N  A ++  +KE +  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V ++V E   +YL +NP+ A+ II+K + A +A + +  AR+  RRKS  ES+ LPGKLADCS +D E SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G +F   +LRY++I+LMTDADVDG+HIR LLLTF +RY   L++ G VYIACPPL+K   GK+  Y Y ++ L++   E  S   Y IQR+KGLGEM P QLW+TTM+P+ R L +V IEDA  A+++F++LMGD VAPRREFIE +   +   D+
  S:     3 SNYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSIDEALAGYCTHIEVDIKADGSVSVTDDGRGIPTDVHPTTGKSALETVLTILHAGGKFGSGGYKVSGGLHGVGISVVNALSAWVDVTVWRDHKVHTQRY-ERGIPVTEL-VSSPSQEEKTGTRVNFLPDTEIFSQGIEFDYSTLSGRLRELAYLNAGVKITFSDYRAEEPHIETYCYEGGIKEYVAYMCREKETLHKDIIYVSGE----------KNGINIEVAFQWCIDAYSDNILGFANNIRTIDGGTHLEGLKAVLTRTLNNVARKRNKIKENEPNLAGENVREGLTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGETLNEYLEQNPQVADTIIEKAVQAYKAAEAARRARDLVRRKSVLESSPLPGKLADCSERDPEKSEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQSLITALGLGIKGEDFDPSQLRYHRIVLMTDADVDGAHIRTLLLTFFYRYQKNLIDQGYVYIACPPLYKLERGKNHSYCYSDRELQQKIAEFPSNANYTIQRFKGLGEMMPQQLWDTTMNPETRTLKRVEIEDAAKAEELFTILMGDRVAPRREFIETHGPRLNLTDL 638
>gi|113954544|ref|YP_729329.1| DNA gyrase subunit B [Synechococcus sp. CC9311] >gi|113881895|gb|ABI46853.1| DNA gyrase, B subunit [Synechococcus sp. CC9311] (655 aa)
Score = 1618, Expect = 7.0e-178, Identities = 330/632 (52%), Positives = 444/632 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIK--NGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDN++DEA+ G+ +EIT+ L ++GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ + H   F+ G   +  L    + A  K   GT V F PD +I     EFD  T+ +RL++LAYLN G++I F DER   +        E + + GGIK++V  +N EK+P+ P I+Y           N +K  + VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   KE D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V N+V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G +F +  LRY+++++MTDADVDG+HIR L+LTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E+ L++       K  Y IQR+KGLGEM P QLWETTMDP  R++ +V ++DAL AD++F++LMGD+VAPRREFIE ++
  S:    11 YGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNAVDEALAGHCNEITVVLGEDGSAFVSDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGQVHRQRFERGAA-IGSLASEPQPAEEKGLTGTSVCFKPDHQIFTVGIEFDYSTLSARLRELAYLNGGVRIVFRDERQAARDQEGKPREELYFYEGGIKEYVAYMNAEKDPLHPEIIY----------VNSEKDGVSVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFAKKRGKRKEADSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGESLSQYLEFNPGVIDMILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEDFDVKNLRYHRVVIMTDADVDGAHIRTLILTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNEQQLQKTLAGFGEKANYNIQRFKGLGEMMPKQLWETTMDPSTRMMKRVEVQDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|42560566|ref|NP_975017.1| DNA gyrase subunit B [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492062|emb|CAE76659.1| DNA Gyrase Subunit B [Mycoplasma mycoides subsp. mycoides SC str. PG1] (634 aa)
Score = 1618, Expect = 7.2e-178, Identities = 342/639 (53%), Positives = 451/639 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVY-DEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           YSA +IK+L+GLEAVR RPGMYIGST   GLHH+VWEI+DNSIDEAM G A  I +T+TKE    VQD+GRGIPV  ++ TKKS +  V T LHAGGKFD++SYK+SGGLHGVGASVVNALS +++V VY+    ++  F +GG   ++L+      +   GT V+F PD EI  E   FD + IK+++KQLA+LNKG+KI   DER +    +LF  GI  +++E N  K  I P I Y D + E           +I VE+A QYN  Y  +  TF NNINT EGG+HE+G K  L + IN++A       +T  K S +D  EG+  I+S++H +PQYEGQTK KL N + +  V+ ++   FE++LL++PEDA  I+ K + A +AR  + +ARE TRRKS  +S SLPGKLADC TKD  I+ELY+VEGDSAGGSAK GR+R FQAILPL+GK++NVE+    + FSN EI ++ITAIG G+  E  + KLRY KI++MTDADVDG+HIR LLLTF +RYM PL+ NG++YIA PPL+K   GK   YAY +  L+E K  E + +KY IQRYKGLGEM+P QLWETTMDP+ R +L++++EDA  A++VFS LMG++   R+ +I+ NAK+V+N+D
  S:     5 YSAESIKVLKGLEAVRTRPGMYIGSTSKTGLHHLVWEILDNSIDEAMAGYADLINVTITKENEIIVQDNGRGIPVGINSDTKKSALSLVFTQLHAGGKFDSESYKISGGLHGVGASVVNALSLYVEVEVYRNNIHYHQLFSEGGTKESELQQLGH--TDLRGTKVKFKPDPEIFKETVVFDYEVIKNKVKQLAFLNKGLKITLTDERIEKTVEYLFLNGILDYIKEKNETKNKINPNIFYVDSKYE-----------DIEVEMALQYNSDYQENIITFVNNINTHEGGTHEDGLKQVLIRDINRYADTVIKNNKTPSKFSWDDIKEGMMCILSVRHTDPQYEGQTKTKLSNPDAKEAVNIIIGNAFEEFLLKSPEDAKAILDKNVNAQKARIAAQKAREETRRKSALDSFSLPGKLADCETKDSSIAELYLVEGDSAGGSAKTGRNRKFQAILPLRGKVLNVERVTEARAFSNNEIKSIITAIGTGIKEELDLSKLRYKKIVIMTDADVDGAHIRTLLLTFFYRYMKPLVANGHIYIAQPPLYKIEAGKKIAYAYTDSQLDELKNNEFNNLKYTIQRYKGLGEMDPLQLWETTMDPQQRTMLQISLEDATLANEVFSDLMGEDPELRKIYIQDNAKFVENID 633
>gi|89114226|gb|ABD61708.1| DNA gyrase subunit B [Acholeplasma oculi] >gi|89114230|gb|ABD61710.1| DNA gyrase subunit B [Acholeplasma oculi] (594 aa)
Score = 1618, Expect = 7.5e-178, Identities = 337/607 (55%), Positives = 439/607 (72%)
  Q:    17 ILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           ILEGLEAV+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G ASEITI + K    +V D+GRGIPV+ H KTK+  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+ K +  ++ + G P  DL+     ++ + GT   F  D  I  E   ++ +T+K+R++QLA+LNKG+K+  ID R  T  +ETF + GGI ++V+ LN  K  I   ++Y E+E+            + VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A + K+ K  D+ I  EDA EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S ++ E  E++LLENP+ A +I+ K LLA  AR  + +A+E TRRKSP ++     KLADC +KD   SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I KLRY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K + GK+ KY Y E  L E  K + + K  IQRYKGLGEMN +QLW+TTMDP  R LL++ +EDA+ AD+VFS
  S:     1 ILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYASEITIEVQKGNIIQVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSLWYLVEIHKDGKIYEQKY-ERGIPAYDLRELG--STEETGTRTTFLADPLIFTETTVYNLETLKNRIQQLAFLNKGLKLTLIDSRLETPYQETFHYEGGIVEYVQFLNQSKTKIHQDVIYTEKEQD----------GVTVEIAMQFVDSYSPNIHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKMKK--DDVILGEDAREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQILGESLERFLLENPQQAKLIVDKVLLATRARVAARKAKELTRRKSPLDALGFASKLADCRSKDPMKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKLRYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKVTWGKNLKYVYSEDELNETLK-SIETKPGIQRYKGLGEMNAEQLWDTTMDPATRTLLQIKLEDAIEADQVFS 594
>gi|124021870|ref|YP_001016177.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9303] >gi|123962156|gb|ABM76912.1| DNA gyrase, subunit B [Prochlorococcus marinus str. MIT 9303] (655 aa)
Score = 1617, Expect = 8.7e-178, Identities = 333/641 (51%), Positives = 450/641 (70%)
  Q:     1 MNKETK-KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIK--NGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDER--------TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLE-EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           M++++K +  Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+  EI + L  +GSA + D+GRGIP + H++T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V ++ + H   F + G  +  L+   + AS K   GT V F PD EI      FD  T+ +RL++LAYLN G++I F DER           +E + + GGIK++V  +N EK+ + P I+Y           N +K N++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   KE D  ++ E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V ++V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G EF    LRY+++++MTDADVDG+HIR L+LTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E  L+        K  Y IQR+KGLGEM P QLWETTMDP  R++ +V ++DAL AD++F++LMGD+VAPRREFIE ++
  S:     1 MSEDSKVQAAYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVFEVVDNSVDEALAGHCDEILVVLGPDGSASIADNGRGIPTDVHSRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGQVHRQRF-ERGTAIGSLRSEAQPASEKGRTGTSVCFKPDEEIFTVGIVFDYATLSARLRELAYLNGGVRIVFRDERQPVLDAEGAPHEEVYFYEGGIKEYVTYMNAEKDALHPEIIY----------VNSEKDNVQVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFARKRGKRKEADSNLAGENIREGLTAVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGEALSQYLEFNPAVIDLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEEFDAKNLRYHRVVIMTDADVDGAHIRTLILTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNEADLQTTLSGFPEKANYTIQRFKGLGEMMPKQLWETTMDPSTRMMKRVEVQDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|83319520|ref|YP_424038.1| DNA gyrase, B subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283406|gb|ABC01338.1| DNA gyrase, B subunit [Mycoplasma capricolum subsp. capricolum ATCC 27343] (634 aa)
Score = 1617, Expect = 9.2e-178, Identities = 339/639 (53%), Positives = 451/639 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVY-DEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           YSA +IK+L+GLEAVR RPGMYIGST   GLHH+VWEI+DNSIDEAM G A  I +T+TKE    +QD+GRGIPV  ++ TKKS +  V T LHAGGKFD+++YK+SGGLHGVGASVVNALS +++V VY+    ++  F +GG   ++L+      +   GT V+F PD EI  E   FD + IK+++KQLA+LNKG+KI   DER +    +LF  GI  +++E N  K  I P I Y D + E           +I VE+A QYN  Y  +  TF NNINT EGG+HE+G K AL + IN++A       +T  K S +D  EG+  I+S++H +PQYEGQTK KL N + +  V+ ++   FE++LL++PEDA  I+ K + A +AR  +  ARE TRRKS  +S SLPGKLADC TKD  I+ELY+VEGDSAGGSAK GR+R FQAILPL+GK++NVE+    + FSN EI +++TA+G G+  E  + KLRY KI++MTDADVDG+HIR LLLTF +RYM PL+ NG++YIA PPL+K   GK   YAY +  L+E K  E + +KY IQRYKGLGEM+P QLWETTMDP+ R +L++++EDA  A++VFS LMG++   R+ +I+ NAK+V+N+D
  S:     5 YSAESIKVLKGLEAVRTRPGMYIGSTSKTGLHHLVWEILDNSIDEAMAGYADLINVTITKENEVIIQDNGRGIPVGINSDTKKSALSLVFTQLHAGGKFDSETYKISGGLHGVGASVVNALSLYVEVEVYRNNIHYHQLFSEGGTKESELQQLGH--TDLRGTKVKFKPDPEIFKETVVFDYEVIKNKVKQLAFLNKGLKITLTDERIEKTVEYLFLNGILDYIKEKNETKNKINPNIFYVDSKYE-----------DIEVEMALQYNSDYQENIITFVNNINTHEGGTHEDGLKQALIRDINRYADTVIKNNKTPSKFSWDDIKEGMMCILSVRHTDPQYEGQTKTKLSNPDAKEAVNIIIGNAFEEFLLKSPEDAKAILDKNVNAQKARIAAQRAREETRRKSALDSFSLPGKLADCETKDSNIAELYLVEGDSAGGSAKTGRNRKFQAILPLRGKVLNVERVTEARAFSNNEIKSIVTAVGTGIKEELDLSKLRYKKIVIMTDADVDGAHIRTLLLTFFYRYMKPLVANGHIYIAQPPLYKIEAGKKIAYAYTDNQLDELKNNEFNNLKYTIQRYKGLGEMDPLQLWETTMDPQQRTMLQISLEDATLANEVFSDLMGEDPELRKIYIQDNAKFVENID 633
>gi|170016363|ref|YP_001727282.1| DNA gyrase, B subunit [Leuconostoc citreum KM20] >gi|169803220|gb|ACA81838.1| DNA gyrase, B subunit [Leuconostoc citreum KM20] (669 aa)
Score = 1616, Expect = 1.2e-177, Identities = 348/640 (54%), Positives = 459/640 (71%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAY---DEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y+A  I++LEGLEAVRKRPGMYIG+T  +GLHH+VWEIVDN IDEA+ G AS IT+T+  + S  V DDGRGIPV+   KT K  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ + +Y++FK G      +K+ +EK +I  GTIV F PD +I  E   F+ +T+ +R+++LA+LNKG++I+  D R +    E+F + GGIK++V+ LN EK  + P  VY E EE+           I VE A QY     +S  TF NNINT EGG+HE GFK AL ++IN +A +   LKE  E ++ ED  EG+TAIVSIKHP+PQ+EGQTK KLGNS+ R     + SE F ++++ENP  A  I++K +LA +AR  +  ARE TR++S  E  +LPGKLAD ++ D  ISEL+IVEGDSAGGSAK GR+R+ QAILP++GKI+NVEKA  DK+ +NEEI +L TA+G G G +F ++K  Y+K+I+MTDADVDG+HIR LLLT  +RYM PL+++G +YIA PPL+  ++G S    Y   DE+  +   +  + +K ++QRYKGLGEM+ DQL +TTMDP NR LL+V   DA  AD +F +LMGD+VAPRREFIE+NA +V+NLDI
  S:    35 YNADQIQVLEGLEAVRKRPGMYIGTTTAQGLHHLVWEIVDNGIDEALAGFASHITVTIEADNSITVTDDGRGIPVDIQTKTGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLDVKVVRDGQVYYMDFKVGRVNTRMVKL-DEKPTIARGTIVHFKPDADIFRETTTFNYNTLLTRVRELAFLNKGLRISITDNRAETPMTESFHYEGGIKEYVKYLNAEKVVVFPEPVYVEGEEN----------GIVVEAALQYTTDVKDSLRTFTNNINTYEGGTHETGFKTALTRVINDYARKNGQLKENAESLTGEDVREGMTAIVSIKHPDPQFEGQTKTKLGNSDARQATDRMFSETFSRFMMENPAVAKQIVEKGILAQKARLAAKRAREMTRKQSGLEIGNLPGKLADNTSNDPAISELFIVEGDSAGGSAKQGRNRLTQAILPIRGKILNVEKATLDKVLANEEIRSLFTAMGTGFGDDFNVEKANYHKVIIMTDADVDGAHIRTLLLTLFYRYMRPLVDSGYIYIAQPPLYGVALGNSKNREYLDSDEELEDYLAQLPANIKPKVQRYKGLGEMDFDQLADTTMDPLNRRLLRVDPADAEAADSIFDMLMGDDVAPRREFIEENAVFVENLDI 669
>gi|184154481|ref|YP_001842821.1| DNA gyrase subunit B [Lactobacillus fermentum IFO 3956] >gi|183225825|dbj|BAG26341.1| DNA gyrase subunit B [Lactobacillus fermentum IFO 3956] (649 aa)
Score = 1616, Expect = 1.3e-177, Identities = 334/640 (52%), Positives = 447/640 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y AS I++L+GLEAVRKRPGMYIGST ++GLHH+VWEIVDN IDEA+ G   EI + +  + S  V D+GRGIPV+   +T K  +ETV TVLHAGGKF N  YKVSGGLHGVGASVVNALS+ L V V ++ KE+Y++F  G    A   + ++     +GT V F PD EI  E   ++ +T+  RL++LA+LNKG+KI   D R   + +E+F + GGI+ +VE LN   E +    +Y E E             I VEV+ QY   Y ++  TF NNI+T EGG+HE GFK AL ++IN +  +   +K  +  +S ED  EGLTA+VSIKHPNPQ+EGQTK KL NS+ R    ++ +E   ++++ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLAD ++KD  ISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  +++ +NEEI +L TA+G G G +F ++K  Y+K+I+MTDADVDG+HIR LLLT  +R+M P++E G VYIA PPL++   GK  KY  +++ LE          K  IQRYKGLGEM+ +QLWETTMDP NR LL+V ++DA  AD++F +LMG +V PRREFIE+NA +V+NLD+
  S:    17 YDASQIQVLKGLEAVRKRPGMYIGSTTVQGLHHLVWEIVDNGIDEALAGFCDEINVIVEPDNSIIVTDNGRGIPVDIQKETGKPALETVFTVLHAGGKFGNGGYKVSGGLHGVGASVVNALSTELDVKVARQGKEYYMDFARGHVNTAMKVIKDDLPQSAHGTTVHFVPDPEIFRETTVYNINTLIDRLRELAFLNKGLKITVEDRREGKEKQESFHYEGGIRHYVEFLNEGHELLFDPPIYVEGEYK----------GITVEVSLQYTDDYRSNLLTFTNNIHTYEGGTHETGFKTALTRVINDYGRKSGQIK-GNVTLSGEDVREGLTAVVSIKHPNPQFEGQTKTKLSNSDARTATDHIFAETMTRFMMENPDVARKIVEKGMLASKARDAAKRAREVTRKKSGLEISNLPGKLADNTSKDPAISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASLNRVLANEEIRSLFTALGTGFGDDFDVNKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMRPMIEKGYVYIAQPPLYQVRQGKFVKYIENDEELERVVNSLQPSPKPVIQRYKGLGEMDAEQLWETTMDPANRHLLRVKLDDAKAADEIFQMLMGTKVGPRREFIEENATFVENLDL 649
>gi|148241191|ref|YP_001226348.1| DNA gyrase subunit B [Synechococcus sp. RCC307] >gi|147849501|emb|CAK26995.1| DNA gyrase subunit B [Synechococcus sp. RCC307] (657 aa)
Score = 1615, Expect = 1.4e-177, Identities = 337/640 (52%), Positives = 448/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKV-TNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD--------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK--NLDI 649
           Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+ + I + L  +GS  V D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V+++ K H   F+ G  P+  L     EK   + GT V F PD EI      FD  T+  RL++LAYLN G+KI F DER +         +E + + GGI+++V  +N EK+P+ P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   K++D  ++ E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V  VV E   +YL  +P+  ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR  QAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G EF +  LRY++I++MTDADVDG+HIR L+LTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E    KTL+ F     K  Y IQR+KGLGEM P QLWETTMDP  R + +V IEDA  AD++F++LMGD+VAPRREFIE ++  +   +LDI
  S:    16 YGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCNTIDVCLRADGSCSVADNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGVSVVNALSEWVEVTVHRQDKVHRQRFERGA-PIGSLASEAGEKG--RTGTSVCFKPDIEIFTGGISFDYATLSGRLRELAYLNGGVKIVFRDERPEAAGEDGQPHEEIYFYEGGIREYVNYMNAEKDPLHPDIIY----------VNSEKDGVQVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFARKRGKRKDSDGNLAGENIREGLTAVLSVKVPDPEFEGQTKTKLGNTEVRGIVDTVVGEALSEYLEFHPQVIDLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRNQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEEFDVSNLRYHRIVIMTDADVDGAHIRTLILTFFYRYQRELVEGGYIYIACPPLYKVERGKNHTYCYNEQDLKKTLDGF---GEKANYTIQRFKGLGEMMPQQLWETTMDPTTRTMKRVEIEDAAQADRIFTILMGDKVAPRREFIETHSAELNLADLDI 657
>gi|116074377|ref|ZP_01471639.1| DNA topoisomerase IV subunit B [Synechococcus sp. RS9916] >gi|116069682|gb|EAU75434.1| DNA topoisomerase IV subunit B [Synechococcus sp. RS9916] (655 aa)
Score = 1615, Expect = 1.5e-177, Identities = 342/649 (52%), Positives = 457/649 (70%)
  Q:     1 MNKETK-KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNG---TIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYV--KNLDI 649
           M++ +K +  Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+ SEI + L ++GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ K H   F+ G   +  L+ + E+ + +NG   T V F PD +I      FD  T+ +RL++LAYLN G++I F DER   +        E + + GGIK++V  +N EK+ + P I+Y           N +K  ++VE A Q+ +  Y++S   F NNI T +GG+H EG K  L + +N FA +    KE+D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V N+V E   ++L  NP    +I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G +F +  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E    KTL  F +   K  Y IQR+KGLGEM P QLWETTMDP  R + +V IEDAL AD++F++LMGD+VAPRREFIE ++  +   NLDI
  S:     1 MSEASKVQAAYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCSEIQVVLAEDGSASVTDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGKVHRQRFERGAA-IGSLR-SEEQPAEENGLTGTSVCFKPDIQIFTGGIVFDYATLAARLRELAYLNGGVRIVFRDEREAARTPEGEPHEEIYFYEGGIKEYVAYMNKEKDALHPDIIY----------VNSEKDGVQVEAALQWCSDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKLGKRKESDSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGEALSQFLEFNPSVIGLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEDFDVKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNEQDLQKTLAAFPE---KANYNIQRFKGLGEMMPAQLWETTMDPTTRTMKRVEIEDALEADRIFTILMGDKVAPRREFIETHSAELDMTNLDI 655
>gi|192809507|ref|ZP_03038182.1| DNA gyrase, B subunit [Geobacillus sp. Y412MC10] >gi|192802178|gb|EDV78683.1| DNA gyrase, B subunit [Geobacillus sp. Y412MC10] (636 aa)
Score = 1615, Expect = 1.7e-177, Identities = 358/641 (55%), Positives = 461/641 (71%)
  Q:     9 TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           TY  + I++LEGLEAVRKRPGMYIGST  KGLHH+VWE+VDNSIDEAM G    I I + ++ S  V D+GRGIPV ++AK KKST+E V+TVLHAGGKF    YKVSGGLHGVG SVVNALSS + V V ++   Y++ Y      G P  D+KV  +  S  +GT V F PD EI  E   +D  T+ +R+++LA+LNKGI +   DERT   + F + GGI ++V+ LN +KE +         E+ +    ++D  NI+VEV+ QYN +Y  + ++F NNINT EGG+HE GFK AL +IIN +A +  L+K+    +S +D  EGLTAI+S+K P PQ+EGQTK KLGNSEVR  V ++ +E  +++L ENP  +  I++K L A  AR+ + +ARE TRRKS  E ++LPGKLADCS+KD  ISELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ D+I SN EI  +ITA+G G+  +F + K RY+KII+MTDADVDG+HIR LLLTF +RYM  L+E G +YIA PPLFK    K  +YA  E+  +E  KE    VK  +QRYKGLGEMN  QLWETTMDP++R +L+VTIEDA+ AD +F  LMGD V PRR+FI+++AK V+NLD+
  S:     7 TYDENQIQVLEGLEAVRKRPGMYIGSTSAKGLHHLVWEVVDNSIDEAMAGICDHIEIIVHEDNSITVIDNGRGIPVGENAKLKKSTLEVVMTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSSKVVVQVKRDGHIYQQEYHR----GVPQYDIKVIGD--SDDHGTTVTFLPDPEIFTETTVYDYTTLLTRIRELAFLNKGIALTLTDERTGASDYFKYEGGIIEYVKFLNEKKEAL--------HEDPIYVEGSRD--NIQVEVSLQYNDSYTENIYSFANNINTHEGGTHESGFKSALTRIINDYARKTGLIKDNTSNLSGDDVREGLTAIISVKVPEPQFEGQTKTKLGNSEVRGIVESLFAEKLQEFLQENPAVSRRILEKALQASRAREAARKAREMTRRKSALEVSALPGKLADCSSKDASISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVEKARLDRILSNAEIRAIITALGTGIAEDFDLSKARYHKIIIMTDADVDGAHIRTLLLTFFYRYMRKLVEAGYIYIAQPPLFKIERNKVIRYAGSERERDEIIKEFGENVKINVQRYKGLGEMNAGQLWETTMDPESRTMLQVTIEDAILADTLFDTLMGDNVEPRRDFIQEHAKSVRNLDV 636
>gi|34763292|ref|ZP_00144250.1| DNA gyrase subunit B [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887040|gb|EAA24153.1| DNA gyrase subunit B [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (639 aa)
Score = 1614, Expect = 1.9e-177, Identities = 345/641 (53%), Positives = 439/641 (68%)
  Q:     9 TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF--KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +Y A NI +LEGLEAVRKRPGMYIG+T  +GLHH+VWEIVDNS+DEA+ G   +I + +  E   +V D+GRGIP + H K  KS +E VLTVLHAGGKF+ND+YKVSGGLHGVG SVVNALS WL+V V K    HY ++  G KP  D+K+       ++GTIV F  D EI E   ++  T+ +RLK+LAYLNKG+ I   D R ++K+   + F GGI  ++ E+  E   I+    Y   E+           N+ V+V F Y  + N   ++F NNINT EGG+H +GF+ AL K+IN     + LLK+ D K+   D  EG+  IVS K P PQ+EGQTK KLGNSEV   V+ +VS   + +L +NP    +II+K L + +AR+ + +ARE   RKS  E  SLPGKLADC++K  E  E++IVEGDSAGGSAK GRDR  QAILPL+GKIINVEKA   K   + EI  ++TA G  +G  F I KLRY KIILMTDADVDG+HIR L+LTFL+RYM  L+  GNVYIACPPL+K + GK   YAY++  L+    +      KY IQRYKGLGEMNP+QLWETTM+P  RLLLKV+I++A  AD +F  LMGD+V PRREFIE++A+YVKN+DI
  S:     6 SYEAQNITVLEGLEAVRKRPGMYIGTTSERGLHHLVWEIVDNSVDEALAGYCDKIEVKILPENIIEVVDNGRGIPTDIHPKYGKSALEIVLTVLHAGGKFENDNYKVSGGLHGVGVSVVNALSEWLEVEVRKNGTIHYQKYHRG-KPEEDVKIVGSCDINEHGTIVRFKADGEIFETLIYNYFTLSNRLKELAYLNKGLTIILSDLRKEEKKEEIYKFDGGILDFLNEIVKEDTTIIEKPFYVSSEQD----------NVGVDVTFTYTTSQNEVIYSFVNNINTHEGGTHVQGFRTALTKVINDVGKAQGLLKDKDGKLMGNDIREGVVGIVSTKIPQPQFEGQTKGKLGNSEVSGIVNTIVSNSLKIFLEDNPNITKIIIEKILNSKKAREAAQKARELVLRKSVLEVGSLPGKLADCTSKKAEECEIFIVEGDSAGGSAKQGRDRYNQAILPLRGKIINVEKAGLHKSLESSEIRAMVTAFGTSIGETFDISKLRYGKIILMTDADVDGAHIRTLILTFLYRYMIDLIYAGNVYIACPPLYKVASGKQIVYAYNDLELKNVLGQMNQDNKKYTIQRYKGLGEMNPEQLWETTMNPDGRLLLKVSIDNAREADMLFDKLMGDKVEPRREFIEEHAEYVKNIDI 639
>gi|187603405|ref|ZP_02989617.1| DNA gyrase, B subunit [Exiguobacterium sp. AT1b] >gi|187484180|gb|EDU22172.1| DNA gyrase, B subunit [Exiguobacterium sp. AT1b] (642 aa)
Score = 1614, Expect = 1.9e-177, Identities = 349/649 (53%), Positives = 456/649 (70%)
  Q:     1 MNKETKK--NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLE-EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+ E +K    Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G    IT+T+    S  V+D+GRGIPV+   KT +  VE + TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V+V ++   +Y  FK G  P  +L++     +    T V F+PD +I  E  E+D D + +RL++LA+LNKG++I   D+R D+  +  + + GGIK +VE LN  K  I         EE V     KD   I VE+A QYN+ + ++ ++F NNI T EGG+HE GFK AL + IN +A    L+KE D  +S +D  EGLTAIVS+KHP PQ+EGQTK KLGN++ R     + S+ FE++LLENP    +I+ K L+A  AR  +  ARE TRRK   E +SLPGKLADCS+KD   SELYIVEGDSAGGSAK GRDR FQAILP++GKIINVEKA+ DKI +N+E+  +ITA+G G+  EF + K RY+K+I+MTDADVDG+HIR LLLTF +RYM PL+E+G VYIA PPL+    GK + Y  +++ L+    +     +Y +QRYKGLGEM+P+QLW TTM+P+ R +L+V ++DA+ AD++F  LMGD V PRR+FI+ +A YVKNLDI
  S:     1 MSNENEKELQAYGADQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVWEIVDNSIDEALAGYCDTITVTVEPGNSIVVEDNGRGIPVDVQKKTGRPAVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLEVFVRRDGNVYYQSFKRG-VPQGELEIVGTTDTTG--TTVRFFPDGDIFQETLEYDFDLLATRLRELAFLNKGLRIVAKDDRNDETIERNYHYEGGIKSYVEHLNRSKASI--------HEEPVYVHGTKD--GIEVEIALQYNEGFASNIYSFTNNIPTHEGGTHETGFKTALTRSINDYAKRFGLMKEADGSLSGDDVREGLTAIVSVKHPAPQFEGQTKTKLGNADARTATDTLFSDTFEQFLLENPSVGRLIVDKGLMAARARLAAKRAREMTRRKGILEVSSLPGKLADCSSKDASKSELYIVEGDSAGGSAKSGRDRHFQAILPIRGKIINVEKARLDKILANQEVRTIITALGTGIADEFDLSKARYHKLIIMTDADVDGAHIRTLLLTFFYRYMRPLVESGYVYIAQPPLYGVKHGKETIYVQNDRELQAAIAQLPENARYSVQRYKGLGEMDPEQLWNTTMNPETRSMLRVDLQDAIEADEIFETLMGDNVEPRRDFIQSHAHYVKNLDI 642
>gi|94994032|ref|YP_602130.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS10750] >gi|94547540|gb|ABF37586.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS10750] (650 aa)
Score = 1614, Expect = 2.0e-177, Identities = 355/646 (54%), Positives = 459/646 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL+V          T V F PD EI  E  +FD + +  R+++LA+LN+G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEVIGTTDVTG--TTVHFTPDPEIFTETTQFDYNVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 650
>gi|33862394|ref|NP_893954.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9313] >gi|33640507|emb|CAE20296.1| DNA gyrase, subunit B [Prochlorococcus marinus str. MIT 9313] (655 aa)
Score = 1613, Expect = 2.4e-177, Identities = 335/641 (52%), Positives = 452/641 (70%)
  Q:     1 MNKETK-KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIK--NGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDER--------TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           M++++K +  Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+  EI + L  +GSA + D+GRGIP + H++T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V ++ + H   F + G  +  L+   + AS K   GT V F PD EI      FD  T+ +RL++LAYLN G++I F DER           +E + + GGIK++V  +N EK+ + P I+Y           N +K N++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   KE D  ++ E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V ++V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G EF    LRY+++++MTDADVDG+HIR L+LTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E     TL  F +   K  Y IQR+KGLGEM P QLWETTMDP  R++ +V ++DAL AD++F++LMGD+VAPRREFIE ++
  S:     1 MSEDSKVQAAYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVFEVVDNSVDEALAGHCDEILVVLGPDGSASISDNGRGIPTDVHSRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGQVHRQRF-ERGTAIGSLRSEAQPASEKGRTGTSVCFKPDEEIFTVGIVFDYATLSTRLRELAYLNGGVRIVFRDERQPVLDAEGAPHEEVYFYEGGIKEYVTYMNAEKDALHPEIIY----------VNSEKDNVQVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFARKRGKRKEADSNLAGENIREGLTAVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGEALSQYLEFNPAVIDLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEEFDSKNLRYHRVVIMTDADVDGAHIRTLILTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNEVDLQTTLSGFPE---KANYTIQRFKGLGEMMPKQLWETTMDPSARMMKRVEVQDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|124008106|ref|ZP_01692804.1| DNA gyrase, B subunit [Microscilla marina ATCC 23134] >gi|123986354|gb|EAY26167.1| DNA gyrase, B subunit [Microscilla marina ATCC 23134] (659 aa)
Score = 1613, Expect = 2.5e-177, Identities = 332/646 (51%), Positives = 448/646 (69%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK----TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K + YSA NI+ LEGLEAVR RP MYIG   ++GLHH++WE+VDNSIDEA+ G    IT+ +  + S  V D+GRGIP   +++ +KS +E V+TVLHAGGKFD D+Y+VSGGLHGVG S VNALS+ L+  V++E K    E+K G  P  +++V  E  S K GT++ F PD  I    E+  +TI  RL++L+YLNKGI++  +D R   +      E FL  GG+ ++V  L+  ++  +P  +Y E E+S           + V+VAF YN +Y+ + +++ NNINT EGG+H  GF+ AL + +  +A ++ +L++    ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSEV   V N  SE   K+L ENP+ A  II+K +LA +AR  + +ARE  +RK+    + LPGKLADCS KD  + ELY+VEGDSAGGSAK GRDR  QAILPL+GKI+NVEKA+  KI+ NEEI N+ITA+G   G +       ++KLRY+KII+MTDADVDGSHIR L+LTF FRYM  L+E+G VYIA PP +    GK   YA+++      ++E           +QRYKGLGEMNP+QLWETTM+P+NR L +VTIE A  AD +FS+LMGD+V PRREFIE+NAKY  N+DI
  S:    13 DAKNSEYSADNIRALEGLEAVRMRPSMYIGDVGVRGLHHLIWEVVDNSIDEALAGYCDHITVEVNTDNSITVTDNGRGIPTGFNSQMQKSALEVVMTVLHAGGKFDKDTYQVSGGLHGVGVSCVNALSTLLRATVHREGKIFQQEYKQG-DPQTEVEVIGE--SDKTGTVIHFVPDATIFTAIEYKYETISQRLRELSYLNKGIRLTMVDHRVKGEDGKALTEDFLSEGGLTEFVRYLDETRQSFLPEPIYVEGEKS----------GVPVQVAFTYNHSYSENVYSYVNNINTIEGGTHISGFRRALTRTLKSYADKEGMLEKAKVDVTGDDFREGLTAVISVKVAEPQFEGQTKTKLGNSEVMGVVDNATSEALSKFLEENPKQAKSIIQKVILAAQARHAARKAREMVQRKNVLSGSGLPGKLADCSEKDPGLCELYLVEGDSAGGSAKQGRDRNTQAILPLRGKILNVEKAQEYKIYDNEEIKNIITALGVTFGKDDDDKALNMEKLRYHKIIIMTDADVDGSHIRTLILTFFFRYMRDLIESGYVYIALPPFYLVKKGKKELYAWNDDDRDVAIKELAGNGKPESVHVQRYKGLGEMNPEQLWETTMNPENRSLKQVTIESAAGADHLFSMLMGDDVPPRREFIEENAKYA-NVDI 659
>gi|7387745|sp|Q9ZAQ6|GYRB_MYCAT DNA gyrase subunit B >gi|4099106|gb|AAD09234.1| gyrase B [Mycoplasma arthritidis] (638 aa)
Score = 1613, Expect = 2.6e-177, Identities = 331/622 (53%), Positives = 435/622 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF--KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVF 622
           M+K+ + + Y A NI+ LEGLEAVRKRPGMYIGS   +GLHH++WEIVDNS+DEAM G A+ I + L      +V D+GRG+PV+ H  TKKS VET+LTVL+AGGKFD+ +YKVSGGLHGVG SVVNALS   +VWV +  K +Y ++ +GG PV  L+V  E    + GT ++F+PD++IM++  FD  TI    KQ+AYLNKG+ I+  D   +    F F GGI  +V ELN  K+ I+P I+Y E     K  N +D   + V VA QYN+TY ++  ++ NNI T EGG+HE+GF  AL +I NK+A + KL K  +EKIS+ED  +GL AI+SIKH +P +EGQTK KL N + R   + ++SE  E+Y+ ENP  A  II+KCLL   +R  +  AREA+R+K   E  +LPGKLADCS+K+ E+ EL+IVEG+SAGGSAK+GRDR  QAILPL+GKIIN EK     + SN+E+ ++I A+G G+  EF I+KL+Y+KI++MTDADVDG+HI  LLLTF +RYM PL+E G VYIA PPL+K S  K ++YAY++   EE   K E+SK    IQRYKGLGEM+P+QLWETTM+P  R   K      L A + F
  S:     1 MSKQEEISKYGAKNIQFLEGLEAVRKRPGMYIGSIGFRGLHHLIWEIVDNSVDEAMAGFATNIEVKLHPNNEIEVIDNGRGMPVDIHPTTKKSAVETILTVLYAGGKFDSTNYKVSGGLHGVGVSVVNALSDSFEVWVKRGGKFYYQKYINGGHPVKPLEVIGEVNKDETGTRIKFHPDYQIMDKVAFDFGTIIDHAKQIAYLNKGLSISCEDITKNTIRNFCFEGGIIDYVSELNRGKKVIIPDIIYAEGTFRDKTPNAQD---VIVNVAIQYNETYTSNIVSYANNIQTGEGGTHEQGFYDALTRIYNKYAEDNKLFKNNNEKISREDTKDGLVAIISIKHTDPIFEGQTKGKLENKDARIATNKIISEQLERYMAENPSHAKAIIEKCLLTQRSRLAANAAREASRKKEGSEFGNLPGKLADCSSKNAEVRELFIVEGNSAGGSAKMGRDRATQAILPLRGKIINAEKQDFTSVMSNKEVSSMIHALGTGITDEFNINKLKYHKIVIMTDADVDGAHIATLLLTFFYRYMRPLIEYGFVYIAQPPLYKISTAKVTEYAYNDAQKEEILSKLEDSK-NISIQRYKGLGEMDPEQLWETTMNPATRKYCKFKSMTLLAAIQSF 620
>gi|34541335|ref|NP_905814.1| DNA gyrase, B subunit [Porphyromonas gingivalis W83] >gi|188994277|ref|YP_001928529.1| DNA gyrase B subunit [Porphyromonas gingivalis ATCC 33277] >gi|34397651|gb|AAQ66713.1| DNA gyrase, B subunit [Porphyromonas gingivalis W83] >gi|188593957|dbj|BAG32932.1| DNA gyrase B subunit [Porphyromonas gingivalis ATCC 33277] (654 aa)
Score = 1613, Expect = 2.6e-177, Identities = 338/645 (52%), Positives = 451/645 (69%)
  Q:     1 MNKETKKNT----YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DD-----KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF---KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           MN++ KKNT    YSASNI++LEGLEAVRKRP MYIG    KGLHH+V+E+VDNSIDEA+ G    + + + ++ S  V+D+GRGIPV+ H K  KS +E VLTVLHAGGKFD  SYKVSGGLHGVG S VNALS++L+  VY+  K H  EF   GKP+ D++V    ++ + GT ++F PD  I    E+    +  RL++L+YLN GI +   D+RT  +D     ++ F    G+K++V  L+  KEP+V  +++   E          K  I VEVA  YN +Y  + +++ N+INT EGG+H  GF+  L + + K+A + KLL +   +I+ +D  EGLTA++SIK   PQ+EGQTK KLGN+EV   V   VSE  E YL E+P++A +I+ K +LA  AR+ + +ARE  +RKSP     LPGKLADCS+KD E  EL++VEGDSAGG+AK GRDR FQAILPL+GKI+NVEKA   K+F +EEI N+ TA+G  +G E       + KLRY+K+++MTDADVDGSHI  L+LTF FR M  L+ENG V+IA PPL+    GK  +Y + E+  + F     + ++ +  +QRYKGLGEMN +QLWETTMDP+ R L KVTIE+A  AD +FS+LMGDEV PRREFIE+NA Y +
  S:     1 MNEDIKKNTSASEYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCDNVEVIIEEDNSITVRDNGRGIPVDYHEKEGKSALEVVLTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTYLRAEVYRNGKIHMQEFS-CGKPLHDVEVIG--STERTGTTIQFKPDSSIFSVTEYQYSILAKRLRELSYLNAGITLTLTDKRTLKEDGSGYKQDVFRSEEGLKEFVRHLDRMKEPLVDNVIHIVTE----------KQGIPVEVAMTYNTSYLENVYSYVNDINTIEGGTHLAGFRRGLTRTLKKYATDSKLLDKVKVEITGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVTGAVDMAVSEALEYYLEEHPKEAKLIVDKVVLAATARQAARKAREMVQRKSPLSGGGLPGKLADCSSKDPEQCELFLVEGDSAGGTAKQGRDREFQAILPLRGKILNVEKAMQHKVFESEEIRNIYTALGVTIGTEEDSKALNLSKLRYHKVVIMTDADVDGSHIATLILTFFFRNMRTLIENGYVFIATPPLYLCKKGKEQEYCWTEQQRQAFVDRYADGNESRVHVQRYKGLGEMNEEQLWETTMDPEKRTLRKVTIENAAEADAIFSMLMGDEVGPRREFIEENATYAR 651
>gi|73747960|ref|YP_307199.1| DNA gyrase, subunit B [Dehalococcoides sp. CBDB1] >gi|147668656|ref|YP_001213474.1| DNA gyrase subunit B [Dehalococcoides sp. BAV1] >gi|73659676|emb|CAI82283.1| DNA gyrase, subunit B [Dehalococcoides sp. CBDB1] >gi|146269604|gb|ABQ16596.1| DNA gyrase subunit B [Dehalococcoides sp. BAV1] (642 aa)
Score = 1613, Expect = 2.6e-177, Identities = 325/641 (50%), Positives = 445/641 (69%)
  Q:     9 TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           TY+AS+I++LEGL AVRKRPGMYIGSTD +GLHH+V+EIV NS+DEAM G    I + + K+GS  V+D+GRGIPV+ H+ TK S +ETV+TVLHAG KF   +Y+VSGGLHGVGASVVNALS W  V V +    Y++ Y+     GKP   L+      S  +GT   F  D +I    E+D +T+  RL+++AYLNKG+++   DE++D + T+ F GGI  +V  LN  +E      +Y  ++            +  +EVA QYN  Y++ST TF N +NT +GG+H  GF+ AL +  N +A + K LK+TD  +  +D  EG+ AIVS+K P PQ+EGQTK KLGN E++ FV + V+E    YL E+P+D   I++KC+ A +AR+ + +AR+   RKS  ++ +LPGKLADCS +D  + EL++VEGDSAGGSAK GR+R FQAILPL+GKI+NVEKA  DK+ ++EEI  +ITA+ AG+  +F   KLRYN+++LMTDADVDGSHIR LLLTF FR+M  L+   +++IA PPL+K  +G +  + Y++   E    +    K  IQRYKGLGEM+ +QLW TTMDP +R LL+V +EDA  AD++F+LLMG EVAPR+ FI+ +++ VKNLDI
  S:    15 TYTASDIQVLEGLAAVRKRPGMYIGSTDQRGLHHLVYEIVYNSVDEAMAGVCDRIKVIMFKDGSVSVEDNGRGIPVDIHSTTKISALETVMTVLHAGAKFGGKTYQVSGGLHGVGASVVNALSEWTTVKVRRNGKIYQQSYLR----GKPSTPLEEVG--VSEGSGTTTIFMADSQIFSTTEYDFETLTDRLREIAYLNKGLEVYIYDEKSDQERTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSD----------STILEVAIQYNDGYSDSTLTFANCVNTVDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSVKLPEPQFEGQTKGKLGNIEIKSFVESAVAEQLSLYLEEHPDDTKRILEKCITAAKAREAARKARDLIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQAILPLRGKILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPSKLRYNRLVLMTDADVDGSHIRTLLLTFFFRHMPRLITESHLFIAQPPLYKIKIGSTEHWVYNDAEKEAILAQTKSTKVDIQRYKGLGEMSAEQLWRTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVAPRKAFIQSHSRTVKNLDI 642
>gi|22298189|ref|NP_681436.1| DNA gyrase subunit B [Thermosynechococcus elongatus BP-1] >gi|22294368|dbj|BAC08198.1| DNA gyrase subunit B [Thermosynechococcus elongatus BP-1] (640 aa)
Score = 1613, Expect = 2.7e-177, Identities = 333/640 (52%), Positives = 440/640 (68%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTL-EEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY--VKNLDI 649
           YS++ +++L+GLE VR RPGMYIGST  KGLHH+V+E+VDNS+DEA+ G  S I + +  +GS  V DDGRGIP + H  T  S VETV+TVLHAGGKF +  YKVSGGLHGVG SVVNALS WL+V V++    H+  + + G P   L+ T +    + GT V F+PD +I  E  EFDA  + +RL++LAYLN GI+I F D R      ET+ + GGI+++V  +  EKEP+ P I+Y + E          K +++VE A Q+    Y+ +   F NNI T +GG+H EG K  L + +N    ++  LKE +  ++ E+  EGLTAI+S+K PNP++EGQTK KLGN+EVR  V  +V     +YL  +P   + I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D  +SE++IVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N E+ +LITA+G GV G EF   KLRY+KIILMTDADVDGSHIR LLLTF +RY   L+  G VYIACPPL+K   G+   Y Y ++ L ++         Y IQR+KGLGEM P+QLWETTM+P+ R+L +V IEDA  AD++F++LMGD VAPRREFIE       ++NLDI
  S:     5 YSSAQLRVLKGLEPVRTRPGMYIGSTGPKGLHHLVYEVVDNSVDEALAGYCSTILVQINADGSVTVTDDGRGIPTDIHPDTGVSGVETVMTVLHAGGKFGDGGYKVSGGLHGVGVSVVNALSEWLEVTVWRNGFVHHQRY-ERGVPTTPLEKTPDTEE-RRGTSVTFFPDRQIFTETIEFDAKVLMTRLRELAYLNAGIRIEFKDLRVTPPLSETYCYEGGIREYVRYMVQEKEPLHPEIIYIQGE----------KDDVQVEAALQWCADAYSENLLGFANNIRTIDGGTHMEGLKAVLTRTLNALGRKRNKLKENNANLAGENIREGLTAIISVKVPNPEFEGQTKTKLGNTEVRGIVDAIVGAALTEYLDFHPNVTDTILEKAIQAFNAAEAARRAREMVRRKSVLESSTLPGKLADCSSRDPAVSEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNNEVQSLITALGLGVKGEEFDPAKLRYHKIILMTDADVDGSHIRTLLLTFFYRYQQELVNQGFVYIACPPLYKVERGRQHFYCYSDRELQQQIASFPENANYTIQRFKGLGEMMPEQLWETTMNPETRILKRVEIEDAAEADRIFTILMGDRVAPRREFIETYGPQLALENLDI 640
>gi|139474074|ref|YP_001128790.1| DNA gyrase subunit B [Streptococcus pyogenes str. Manfredo] >gi|134272321|emb|CAM30575.1| DNA gyrase subunit B [Streptococcus pyogenes str. Manfredo] (650 aa)
Score = 1613, Expect = 2.8e-177, Identities = 354/646 (54%), Positives = 458/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL++          T V F PD EI  E  +FD   +  R+++LA+LN+G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEIIGTTDVTG--TTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPIVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 650
>gi|126179353|ref|YP_001047318.1| DNA gyrase, B subunit [Methanoculleus marisnigri JR1] >gi|125862147|gb|ABN57336.1| DNA gyrase subunit B [Methanoculleus marisnigri JR1] (656 aa)
Score = 1613, Expect = 2.8e-177, Identities = 331/642 (51%), Positives = 435/642 (67%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG--GKPVADLKVTNEKASIK------------------NGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +TY AS+I +LEGL  VR+RP MYIGST+ +GLHH+V+E+VDN++DEA+ G    I +T+ ++GS  V D+GRGIPV+   +  KS +E VLTVLHAGGKFD ++Y+VSGGLHGVG SVVNALSSWL   V+K+   + ++F+ G   KP+A    T  +   +                   GT + F PD  I E  EFD D +  RL++LAYLN G+ I   DERT D  T+ F  GI+Q+V  L   KE +   I+Y ++ +S        +  + VEVA QYN +Y+ + +T+ N++NT EGG+H EGF+ AL + IN  A    LLK  D ++  ED  EGL  ++S +  NPQ+EGQTK +LGNS VR  V ++V     +Y  E+P+    ++ K + A  AR+ +  ARE  RRKS  ES  LPGKLADC  +D   SELYIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA   KI  N EI  LI+AIG GVG  F  ++ RY++IILMTDADVDG+HIR LLLTF +RYM  L+ENG +YIA PPL++ + G+  +Y Y E+ + E   E  +    IQRYKGLGEMN  QLW TTMDP NR+L +V IEDA  A+++F  LMG+ V  RR+FI ++AK V NLD+
  S:     3 DTYDASHITVLEGLRPVRERPAMYIGSTESRGLHHLVYEVVDNAVDEALAGFCDLIQVTVNRDGSVSVDDNGRGIPVDLMPQYGKSALEIVLTVLHAGGKFDKNTYQVSGGLHGVGVSVVNALSSWLDATVFKDGNVYAMQFRQGLVAKPLASRPETEHEMEARYEERYGARDGQPLDYERLRGTRITFQPDRSIFETVEFDYDVLDHRLRELAYLNSGLTIVLRDERTGDVVTYCFEDGIRQFVAHLGEGKESLHDDIIYFQKRDS--------ESKVEVEVALQYNNSYSETIYTYVNSVNTREGGTHLEGFRSALTRAINSAAHRNNLLKNNDAQVKGEDVREGLACVISTRVANPQFEGQTKMRLGNSNVRGIVDSLVYSSLTEYFEEHPKTLQTVVDKAMAAARAREAARTARELARRKSTLESTGLPGKLADCQERDPAKSELYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKASEHKILKNAEIQALISAIGTGVGDSFDAERARYHRIILMTDADVDGAHIRTLLLTFFYRYMVGLVENGYIYIAQPPLYRVAKGRQEQYVYREEEMREILAEWGEKGVSIQRYKGLGEMNAGQLWSTTMDPANRILKQVKIEDAAYANEIFEKLMGENVDARRDFIRRHAKEVSNLDV 656
>gi|33469292|gb|AAQ19683.1| DNA gyrase subunit B [Staphylococcus haemolyticus] (644 aa)
Score = 1613, Expect = 2.8e-177, Identities = 346/641 (53%), Positives = 460/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD---DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK     ++ K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI I   DER D    ++T+ + GGIK +VE LN  KEPI         EE +     KD  ++ +E+A QYN  Y  +  ++ NNI+T EGG+HE+GFK AL +I+N +  + K++K+  E++S ED  EGLTA+VSIKH +PQ+EGQTK KLGNSEVR  V  + +E FE++L E+P  A ++++K ++A  AR  + +ARE TRRKS  E +SLPGKLADCS+K  E SE+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G EF I K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y ++++ L++ K E S   K+QI RYKGLGEMN DQLWETTM+P+NR++L+V +EDA+ AD    +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVIIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSEDLEVYVHRNDTIYHQAYKKG-VPQFDLKEVG--STDKTGTVIRFKADGEIFTETTVYNYETLQKRIRELAFLNKGISITLRDEREDVEQREDTYHYEGGIKSYVELLNENKEPI--------HEEPIYIHQTKD--DVEIEIAMQYNSGYATNLLSYANNIHTYEGGTHEDGFKRALTRILNSYGTQSKIIKDDKERLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQIVDRLFAEHFERFLYEHPNVARIVVEKGIMASRARVAAKKAREVTRRKSALEISSLPGKLADCSSKKPEESEIFLVEGDSAGGSTKEGRDSKTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLAQGKQKYYVFNDRELDKLKSELSPTPKWQISRYKGLGEMNADQLWETTMNPENRMMLQVKLEDAIEADHTCEMLMGDVVENRRQFIEDNAVYA-NLD 643
>gi|19745824|ref|NP_606960.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS8232] >gi|50913919|ref|YP_059891.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS10394] >gi|73919730|sp|Q5XD05|GYRB_STRP6 DNA gyrase subunit B >gi|73919731|sp|Q8P1M4|GYRB_STRP8 DNA gyrase subunit B >gi|19747970|gb|AAL97459.1| putative DNA gyrase, subunit B [Streptococcus pyogenes MGAS8232] >gi|50902993|gb|AAT86708.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS10394] (650 aa)
Score = 1612, Expect = 3.3e-177, Identities = 354/646 (54%), Positives = 458/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL++          T V F PD EI  E  +FD   +  R+++LA+LN+G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEIIGTTDVTG--TTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 650
>gi|94988237|ref|YP_596338.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS9429] >gi|94541745|gb|ABF31794.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS9429] (650 aa)
Score = 1612, Expect = 3.5e-177, Identities = 355/646 (54%), Positives = 457/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL+V          T V F PD EI  E  +FD   +  R+++LA+LN G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEVIGTTDVTG--TTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNHGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 650
>gi|193215259|ref|YP_001996458.1| DNA gyrase, B subunit [Chloroherpeton thalassium ATCC 35110] >gi|193088736|gb|ACF14011.1| DNA gyrase, B subunit [Chloroherpeton thalassium ATCC 35110] (644 aa)
Score = 1612, Expect = 3.6e-177, Identities = 338/647 (52%), Positives = 444/647 (68%)
  Q:     3 KETKKN-TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG--GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGP-EFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE---NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KE +K+  Y ASNI++L+G+E VR+RP MYIG   ++GLHH+V+EIVDNS+DEA+ G    I + +   GS  V+D GRGIP + H +   S ++ V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY+E K  +  ++ G    PV+ +  T+E     NGT   F PD  I +  EF  DT+  R+++LAYLNK + I   DER   ++ F F GGI+++V  +++ +  ++   +Y E E          K    VE+AFQYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +  +  L K     ++ ED  EGLTAI+S+K P PQ+EGQTK KLGNSE +  V ++V+E   +Y+ ++P +  +I++K + A  AR  + +A++ TRRKS  ES+SLPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+ +K+  NEEI  LI A+G  +G  EF   +LRY KIILMTDADVDG+HIR LLLTF FRYM  L+E G V+IA PPL+    GK   YA+D+   ++  K+     K  Y IQRYKGLGEMN DQLW TTMDP+ R LL VTIE+A+ ADK+FS LMGD+V PRR FIE NAKYV+ LD+
  S:     6 KEIEKSLEYGASNIQVLDGIEHVRRRPAMYIGDVGVRGLHHLVYEIVDNSVDEALGGYNDYIFVQIKSNGSILVRDKGRGIPTDIHPQKNTSALQLVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYREGKIFFQGYEKGIPKAPVSVIGTTSE-----NGTKTTFLPDESIFKNREFRYDTLADRMRELAYLNKNLTIVIEDERDGRRDEFHFKGGIQEFVTFMDSTRLKLIKEPIYFEGE----------KDGTVVEIAFQYNDSYQENAFSYVNNINTHEGGTHVTGFRKALTRTLNYYGQKNDLFKNLKISLTGEDFREGLTAILSVKVPEPQFEGQTKTKLGNSETQSIVESIVNEKLAEYIEQHPNEVKIILEKVVSAAIARDAARKAKDLTRRKSALESSSLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRRFQAILPLKGKILNVEKARLNKMLENEEIRTLIMALGTSIGEDEFDASRLRYGKIILMTDADVDGAHIRTLLLTFFFRYMRGLVEGGRVFIAQPPLYLIKSGKQQWYAWDDDERDDILKQFEVKGKENYGIQRYKGLGEMNADQLWSTTMDPEKRTLLMVTIENAMEADKIFSTLMGDQVEPRRAFIETNAKYVRRLDV 644
>gi|88809918|ref|ZP_01125423.1| DNA topoisomerase IV subunit B [Synechococcus sp. WH 7805] >gi|88786108|gb|EAR17270.1| DNA topoisomerase IV subunit B [Synechococcus sp. WH 7805] (655 aa)
Score = 1612, Expect = 4.0e-177, Identities = 334/632 (52%), Positives = 446/632 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG---GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDNS+DEA+ G+ +EI + L ++GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W+ V V ++ + H   F+ G   G  V++ +   E+   + GT V F PD EI      FD  T+ +RL++LAYLN G++I F DER + +        E + + GGIK++V  +N EK+ + P I+Y           N +K  + VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   KE+D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V ++V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G +F +  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E    KTLE F     K  Y IQR+KGLGEM P QLWETTMDP  R + +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:    11 YGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGHCTEIQVVLGEDGSACITDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVDVTVRRQAQVHRQRFERGAPIGSLVSEPQPAEEEG--RTGTSVRFKPDIEIFTVGIVFDYATLSARLRELAYLNGGVRIVFRDERENARDAEGNPHEEIYFYEGGIKEYVAYMNAEKDALHPEIIY----------VNAEKDGVSVEAALQWCVDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNTFAKKRGKRKESDSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGESLSQYLEFNPGVIDMILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQSLITALGLGIKGEDFDVKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVEGGYIYIACPPLYKVERGKNHTYCYNESELQKTLEGF---GEKANYNIQRFKGLGEMMPKQLWETTMDPTTRTMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 645
>gi|160941457|ref|ZP_02088792.1| hypothetical protein CLOBOL_06348 [Clostridium bolteae ATCC BAA-613] >gi|158435603|gb|EDP13370.1| hypothetical protein CLOBOL_06348 [Clostridium bolteae ATCC BAA-613] (637 aa)
Score = 1610, Expect = 5.9e-177, Identities = 347/640 (54%), Positives = 448/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE-TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNA--DKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A  I+ILEGLEAVRKRPGMYIGST  +GLHH+V+EIVDN++DEA+ G    I +T+ ++ S  V DDGRGIPV+   K     VE V T+LHAGGKF N  YKVSGGLHGVGASVVNALS WL+V VYK+   Y++ Y    + GK    LK+  +    ++GT V F PD EI E   +D DT+K RL++ A+L K +KI   D+R + KE  F + GGIK++V  LN  K PI   ++Y E            +  + VEV+ Q+N +Y  + +TF NNINT EGG+H  GFK AL K  N +A EKKLLK++++ +S ED  EGLTAI+S+K  +PQ+EGQTK+KLGNSE R  V N+VSE    +L +NP  A  + +K +LA  AR  + +AR+ TRRKS  +  +LPGKLADCS K+ E  E+YIVEGDSAGGSAK  R R  QAILPL+GKI+NVEKA+ D+I+ N EI  +ITA G G+  +F I KLRY+KII+MTDADVDG+HI  LLLTF++R+M  L++ G VY+A PPL+K    K   YAY +      L+E  ++NS    +IQRYKGLGEM+ +QLWETTMDP+ R+LL+VT+++   +  D  F+ LMGD+V PRREFIE NAK VKNLDI
  S:     5 YGADQIQILEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNAVDEALAGYCDSIDVTINEDNSITVMDDGRGIPVDIQKKAGLPAVEVVFTILHAGGKFGNGGYKVSGGLHGVGASVVNALSEWLEVQVYKDGNIYQQRY----ERGKVTYPLKIVGKCGPEQHGTRVTFLPDKEIFEETVYDYDTLKIRLRETAFLTKNLKIILKDDRDEKKEKVFHYEGGIKEFVTYLNKGKTPIYDQVIYCE----------GTREGVYVEVSMQHNDSYTENIYTFVNNINTPEGGTHLTGFKNALTKTFNDYAREKKLLKDSEDNLSGEDIREGLTAIISVKIEDPQFEGQTKQKLGNSEARAAVDNIVSEQLTYFLEQNPAVAKSMCEKSILAQRARAAARKARDLTRRKSALDGMALPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARMDRIYGNAEIKAMITAFGTGIHDDFDISKLRYHKIIIMTDADVDGAHISTLLLTFIYRFMPELIKQGYVYLAQPPLYKVEKNKKVWYAYSDDELNSILKEIGRDNSN---KIQRYKGLGEMDAEQLWETTMDPERRILLRVTMDEETTSEVDLTFTTLMGDQVEPRREFIEANAKKVKNLDI 637
>gi|42518089|ref|NP_964019.1| DNA gyrase subunit B [Lactobacillus johnsonii NCC 533] >gi|41582373|gb|AAS07985.1| DNA gyrase subunit B [Lactobacillus johnsonii NCC 533] (655 aa)
Score = 1610, Expect = 6.0e-177, Identities = 354/645 (54%), Positives = 460/645 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYA-YDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           E + +TY+AS I++L GLEAVRKRPGMYIGST  +GLHH+VWEI+DNSIDE + G A++I IT+ ++GS  VQDDGRGIPV+  AKT +  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L+V V ++ K++ I F D G+ V ++K        ++GTIV FYPD +I  E   FD   +K+R+++LA+LNKG+K+ F D+R +  ET  + F GGIK++V  LN  +E +    +Y E           +   I VEVA QY   Y  +  TF NNI+T EGG HE GFK AL +++N +A + K+LK+ D+ +S ED  EG+TAIVS+KHPNPQ+EGQTK KLGNS+ R  V    SE F ++L+ENP     I++K  LA  AR  +  ARE TR+KS  E  +LPGKLAD ++ D  ISEL+IVEG+SAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +N+EI +L TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  + YM P++E G VYIA PPL++   GK  KY   DE+  +         K  +QRYKGLGEM+P+QLWETTM+P+NR L +V+ E A +ADK+F LLMG+EV PRREFIEKNAKYV+NLD
  S:    17 EKRADTYNASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNSIDERLAGFATKIEITVNEDGSVTVQDDGRGIPVDIQAKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLEVTVMRDGKKYAISF-DHGRVVGEMKQVGTVPLEEHGTIVRFYPDPDIFTETTTFDDKILKNRIRELAFLNKGLKLTFTDKRKESAETDVYHFEGGIKEYVAFLNKGQEVLFDEPIYVE----------GNYEGIDVEVALQYTNGYKTTLMTFANNIHTYEGGMHEAGFKTALTRVVNDYAHKAKILKDKDDNLSGEDIREGITAIVSVKHPNPQFEGQTKTKLGNSDARTAVDRAFSETFSRFLMENPSVGRKIVEKGQLAERARTAAKRAREVTRKKSGLEIANLPGKLADNTSNDPSISELFIVEGNSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANQEIRSLFTALGTGFGADFDVSKARYHKLIIMTDADVDGAHIRTLLLTLFYNYMRPMIEKGYVYIARPPLYQVRQGKVEKYLDTDEELHDYLGTLQPSPKPIVQRYKGLGEMDPEQLWETTMNPENRRLDRVSPEYAEDADKIFDLLMGNEVGPRREFIEKNAKYVENLD 654
>gi|160946608|ref|ZP_02093811.1| hypothetical protein PEPMIC_00566 [Peptostreptococcus micros ATCC 33270] >gi|158446992|gb|EDP23987.1| hypothetical protein PEPMIC_00566 [Peptostreptococcus micros ATCC 33270] (638 aa)
Score = 1610, Expect = 6.9e-177, Identities = 334/648 (51%), Positives = 457/648 (70%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVG-KSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDA--LNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M+KE  +N Y A +I++L GLE VR RPGMYIGST +KGLHH+V+E+VDNSIDEA+ G    IT+T+ ++ S +V+D+G GIPVE H +T KST+ETVLT+LHAGGKF+N++Y+VSGGLHGVG SVVNALS WL   V ++ K +  +F  G    + L+V     S + GTI+ F PD EI +   ++ + +++R +++A+LNKG+KI F DER D  ETF + GGIK +VE +N  K  +   ++Y + +            + +VE++ QY   Y+ +  TF NNI+T EGGSH  GF+ AL + +N +  +  L+K+ D  +  +D  EGLT IVSIK PNPQ+EGQTK KLGNSE R  V   + +    +L ENP+   +II+K   +  AR+ + +AR+ TR+KS  ++ +LPGKL+DC   D  ++E+Y+VEGDSAGGSAK GRD  FQA+LPLKGKI+NVEKA+ DKI   EEI ++ITA G G+G +F +D LRY KI++MTDADVDG+HIR L+LTF +RYM  L+E G+VYIA PPL+    G K  KY + ++ L+    E  +  ++IQRYKGLGEMNP QLWETTM+P+NRL L+V I+D   ++ D+ FS LMGD+V PRREFIE+NAKYV+N+D
  S:     1 MSKEKIRN-YGAKDIRVLTGLEPVRLRPGMYIGSTGVKGLHHLVYEVVDNSIDEALAGVCDTITVTIFEDNSVRVEDNGSGIPVEVHPQTGKSTLETVLTILHAGGKFNNNAYQVSGGLHGVGVSVVNALSEWLIANVKRDGKLYEQQFSRGNT-TSKLEVVG--TSKETGTIITFKPDSEIFDTTIYEKEILRNRFREMAFLNKGVKIIFTDEREDFTETFHYEGGIKSFVEYMNRNKNNLHNEVIYFQGQRG----------DSQVEISMQYTDGYSENVLTFANNIHTPEGGSHLVGFRTALTRTLNDYGRKYNLIKDKDANLQGDDTREGLTGIVSIKLPNPQFEGQTKAKLGNSESRGIVETFLYDNLMTFLEENPKVGKIIIEKAQSSARAREAARKARDLTRKKSILDNTTLPGKLSDCQESDISVNEIYLVEGDSAGGSAKQGRDSKFQAVLPLKGKIMNVEKARIDKILGYEEIKSMITAFGTGIGKDFNLDNLRYGKIVIMTDADVDGAHIRTLILTFFYRYMKELIEQGHVYIAQPPLYGIIKGVKVVKYCWTDEELQASLDELGRDSHRIQRYKGLGEMNPAQLWETTMNPENRLFLQVNIDDEELVSIDETFSTLMGDKVEPRREFIEQNAKYVENID 637
>gi|116628688|ref|YP_813860.1| DNA gyrase, B subunit [Lactobacillus gasseri ATCC 33323] >gi|116094270|gb|ABJ59422.1| DNA gyrase subunit B [Lactobacillus gasseri ATCC 33323] (655 aa)
Score = 1609, Expect = 8.3e-177, Identities = 354/645 (54%), Positives = 459/645 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYA-YDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           E + +TY+AS I++L GLEAVRKRPGMYIGST  +GLHH+VWEI+DNSIDE + G A++I IT+ ++GS  VQDDGRGIPV+  AKT +  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K++ I F D G+ V ++K        ++GTIV FYPD +I  E   FD   +K+R+++LA+LNKG+K+ F D+R +  ET  + F GGIK++V  LN  +E +    +Y E           +   I VEVA QY   Y  +  TF NNI+T EGG HE GFK AL +++N +A + K+LK+ D+ +S ED  EG+TA+VS+KHPNPQ+EGQTK KLGNS+ R  V    SE F ++L+ENP     I++K  LA  AR  +  ARE TR+KS  E  +LPGKLAD ++ D  ISEL+IVEG+SAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +N+EI +L TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  + YM P++E G VYIA PPL++   GK  KY   DE+  +         K  +QRYKGLGEM+P+QLWETTM+P+NR L +V+ E A +ADKVF LLMG+EV PRREFIEKNAKYV+NLD
  S:    17 EKRADTYNASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNSIDERLAGFATKIEITVNEDGSVTVQDDGRGIPVDIQAKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLDVTVMRDGKKYAISF-DHGRVVGEMKQIGTVPLEEHGTIVHFYPDPDIFTETTTFDDKILKNRIRELAFLNKGLKLTFTDKRKESAETDVYHFEGGIKEYVAFLNKGQEVLFDEPIYVE----------GNYEGIDVEVALQYTNGYKTTLMTFANNIHTYEGGMHEAGFKTALTRVVNDYAHKAKILKDKDDNLSGEDIREGITAVVSVKHPNPQFEGQTKTKLGNSDARTAVDRAFSETFSRFLMENPSVGRKIVEKGQLAERARTAAKRAREVTRKKSGLEIANLPGKLADNTSNDPSISELFIVEGNSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANQEIRSLFTALGTGFGADFDVSKARYHKLIIMTDADVDGAHIRTLLLTLFYNYMRPMIEKGYVYIARPPLYQVRQGKIEKYLDTDEELHDYLGTLQPSPKPVVQRYKGLGEMDPEQLWETTMNPENRRLDRVSPEYAEDADKVFDLLMGNEVGPRREFIEKNAKYVENLD 654
>gi|116071704|ref|ZP_01468972.1| DNA topoisomerase IV subunit B [Synechococcus sp. BL107] >gi|116065327|gb|EAU71085.1| DNA topoisomerase IV subunit B [Synechococcus sp. BL107] (655 aa)
Score = 1609, Expect = 8.6e-177, Identities = 328/636 (51%), Positives = 441/636 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASI-KNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDD--------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAK 642
           +N Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDN++DEA+ G+   IT+ L  +GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ + H   F+ G    + L  +  +A   + GT V F PD +I      FD  T+ +RL++LAYLN G++I F DER           +E + + GGIK++V  +N  K+ + P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA +    K+ D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V N+V E   ++L  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G EF    LRY+++++MTDADVDG+HIR L+LTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E  L++  K      KY IQR+KGLGEM P QLWETTMDP  R++ ++ IEDAL AD++F++LMGD+VAPRREFIE ++K
  S:     8 QNEYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNAVDEALAGHCDRITVILGADGSASVTDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVQVTVRRQGQVHRQRFERGAAIGSLLSESQSEAEQGETGTTVCFLPDLQIFTGGIVFDYATLSARLRELAYLNGGVQIVFRDEREASLSDAGDPHEEIYFYEGGIKEYVAYMNKAKDALHPDIIY----------VNSEKDGVQVEAALQWCADAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKLGKRKDADSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGEALSQFLEFNPSVISLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDSKIYKNTEIQALITALGLGIKGEEFDQKSLRYHRVVIMTDADVDGAHIRTLILTFFYRYKRELVEGGYIYIACPPLYKVERGKNHTYCYNESDLQKTLKGFGENAKYTIQRFKGLGEMMPKQLWETTMDPSTRMMKRIEIEDALEADRIFTILMGDKVAPRREFIETHSK 646
>gi|33241245|ref|NP_876187.1| DNA gyrase subunit B [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|33238775|gb|AAQ00840.1| DNA gyrase B subunit [Prochlorococcus marinus subsp. marinus str. CCMP1375] (658 aa)
Score = 1609, Expect = 8.7e-177, Identities = 333/632 (52%), Positives = 442/632 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIK--NGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKE------TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDN++DEA+ G+ +EI + L  +GSA + D+GRGIP + H KT KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W++V V ++   H   F+ G  P+ +L+ T +  S K   GT V F PD +I      FD   + SRL++LAYLN G+KI F DER    DKE       + + GGIK++V  +N+EK+ + P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA ++   K+ D  ++ E+  EGLT ++S+K P P++EGQTK KLGN+EVR  V ++V E   +YL  NP   ++I++K + A  A + +  ARE  RRKS  ES +LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LIT +G G+ G +F +  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G VYIACPPL+K   GK+  Y Y+E  L++       K  Y IQR+KGLGEM P QLWETTMDP  R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:    14 YGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNAVDEALAGHCNEIVVVLCSDGSASISDNGRGIPTDVHPKTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGVSVVNALSEWVEVTVRRQGHIHNQRFERGA-PIGNLRSTKQPVSEKKLTGTKVNFKPDTDIFTTGIVFDYSILSSRLRELAYLNGGVKIVFRDERQSVSDKEEKAYEEVYFYEGGIKEYVAYMNSEKDALHPEIIY----------VNSEKEGVQVEAALQWCIDAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNSFARKRGKRKDGDSNLAGENIREGLTVVLSVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGESLAQYLEFNPSVIDLILEKAIQAFNAAEAARRARELVRRKSVLESTTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITGLGLGIKGEDFSLKNLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQKELVEGGYVYIACPPLYKVERGKNHTYCYNEGDLQKTITSFGEKANYTIQRFKGLGEMMPKQLWETTMDPSTRMMKRVEIEDALEADRIFTILMGDKVAPRREFIETHS 648
>gi|18308988|ref|NP_560922.1| DNA gyrase subunit B [Clostridium perfringens str. 13] >gi|18143663|dbj|BAB79712.1| DNA gyrase subunit B [Clostridium perfringens str. 13] (638 aa)
Score = 1609, Expect = 8.9e-177, Identities = 359/646 (55%), Positives = 457/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYD----EKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E     Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + K+ S  V DDGRG+PV  H K  K TVE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS   +V V ++       +K G       ++   + S   GT V F PD EI E  E+D + +  RL++LA+LNKGI I  IDER D+  +E + + GGIK +V  LN  KE +         +E +     KD   I VEV+ QY+  +N + FTF NNI+T EGG+H  GFK AL +++N +      LKE+D+ +S +D  EGLTA+VS+K  +PQ+EGQTK KLGNSEVR  V ++  E    +L ENPE   +II+K LLA  AR+ +  ARE TR KS  E +SLPGKLADCS+KD +  E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI  ++ I +++TAIGAG+GPEF I+K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL+K S GK  +YAY     ++ +EEF  ++S V   +QRYKGLGEMN  QLWETTMDP++R+LL+  IEDA+ AD++F++LMGD+V PRREFI+KNAK V NLDI
  S:     3 EQNNQNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGYCKNIKVYIHKDNSVTVVDDGRGMPVGIHPKMGKPTVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSELCEVIVTRDGYVWKQSYKRGAVLTGLERIGEAEGS---GTKVHFKPDHEIFEETEYDFEILSQRLRELAFLNKGINITLIDEREDEVKEEVYHYEGGIKSFVSYLNRNKEVL--------HDEPIYVEGLKD--GIAVEVSLQYHDGFNENIFTFANNIDTVEGGTHLAGFKTALTRVMNDYGRRFGHLKESDKNLSGDDIREGLTAVVSVKISDPQFEGQTKTKLGNSEVRSAVDSISGEGISTFLEENPEVGKIIIEKALLASRAREAARRARELTR-KSVLERSSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEKQRLDKILGSDTIRSMVTAIGAGIGPEFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRDLVEQGHVYIAQPPLYKISKGKQERYAYSDAAADEIIEEFGGKDSSV--NVQRYKGLGEMNAGQLWETTMDPESRILLRADIEDAMVADEIFTILMGDKVEPRREFIQKNAKNVSNLDI 638
>gi|89114228|gb|ABD61709.1| DNA gyrase subunit B [Acholeplasma oculi] (594 aa)
Score = 1608, Expect = 9.6e-177, Identities = 336/607 (55%), Positives = 435/607 (71%)
  Q:    17 ILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           ILEGLEAV+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G ASEITI + K    +V D+GRGIPV+ H KTK+  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+ K +  ++ + G P  DL+           T   F  D  I  E   ++ +T+K+R++QLA+LNKG+K+  ID R  T  +ETF + GGI ++V+ LN  K  I   ++Y E+E+            + VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A + K+ K  D+ I  EDA EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S ++ E  E++LLENP+ A +I+ K LLA  AR  + +A+E TRRKSP ++     KLADC +KD   SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I KLRY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K + GK+ KY Y E  L E  K + + K  IQRYKGLGEMN +QLW+TTMDP  R LL++ +EDA+ AD+VFS
  S:     1 ILEGLEAVKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYASEITIEVQKGNIIQVTDNGRGIPVDIHPKTKRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSLWYLVEIHKDGKIYEQKY-ERGIPAYDLRELGTTEETG--TKTTFLADPLIFTETTVYNLETLKNRIQQLAFLNKGLKLTLIDSRLETPYQETFHYEGGIVEYVQFLNQSKTKIHQDVIYTEKEQD----------GVTVEIAMQFVDSYSPNIHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKMKK--DDVILGEDAREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQILGESLERFLLENPQQAKLIVDKVLLATRARVAARKAKELTRRKSPLDALGFASKLADCRSKDPMKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKLRYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKVTWGKNLKYVYSEDELNETLK-SIETKPGIQRYKGLGEMNAEQLWDTTMDPATRTLLQIKLEDAIEADQVFS 594
>gi|168183732|ref|ZP_02618396.1| DNA gyrase, B subunit [Clostridium botulinum Bf] >gi|182673147|gb|EDT85108.1| DNA gyrase, B subunit [Clostridium botulinum Bf] (637 aa)
Score = 1607, Expect = 1.4e-176, Identities = 351/646 (54%), Positives = 455/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +  K  Y  S I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G  + I + + K+ S  V DDGRG+PV  H+K KK  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS    V V ++    +++  + G P   L +  +    K+GT + F PD EI +  EF+ DT+  RL++LA+LNKGIKI+  DER D +E F + GG++ +V  LN  KE +    +Y ++        NKD     VE+A QYN  Y  + F+F NNI+T EGG+H  GFK AL + IN +A +   LK+TD+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGNSEVR  V  +V E    +L ENP    +II+K L A  AR+ +  ARE TRRKS  ES SLPGKLADCS+KD  + E+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEK + DKI +++EI  +ITA GAG+G EF ++K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL++    K   Y Y +K L+E   E         IQRYKGLGEM+P+QLWETTM+P++R LL+VTIEDA+ AD++F++LMG +V PRR+FIE NA  V NLDI
  S:     3 QENKQVYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGFCTHIEVFIHKDNSITVVDDGRGMPVGMHSKVKKPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEHCNVEVRRD-GHIWLQKYERGIPKTGLDIVGDTE--KHGTKIYFKPDVEIFDELEFEYDTLAQRLRELAFLNKGIKISLTDERYDKQEMFHYEGGLRSFVLYLNRNKEKLHQQPIYVDK--------NKD--GCIVEIAMQYNDGYAENIFSFANNIDTIEGGTHLAGFKSALTRAINDYARKFNYLKDTDKNLSGDDVREGLTAVISVKLTDPQFEGQTKTKLGNSEVRGIVDTIVGESIGSFLEENPNVGKIIIEKGLSASRAREAAKRARELTRRKSVLESTSLPGKLADCSSKDPSLCEIYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVEKQRLDKILASDEIRAMITAFGAGIGKEFNLEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELVEEGHVYIAQPPLYRIYKAKKELYVYSDKELDEALLELGGKDTNTNIQRYKGLGEMDPEQLWETTMNPEHRTLLQVTIEDAMAADEIFTILMGTKVEPRRDFIENNADKVVNLDI 637
>gi|94471626|gb|ABF21079.1| DNA gyrase subunit B [Acholeplasma hippikon] (599 aa)
Score = 1607, Expect = 1.5e-176, Identities = 332/612 (54%), Positives = 436/612 (71%)
  Q:    16 KILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMG 627
           +ILEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A+E+ I +  +   KV+D+GRGIPV+ H KT +  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+ K +  ++ + G P  DL+           T   F  D  I  E   ++ +T+++R++QLA+LNKGIK+   D+R +   KE F + GGI ++++ LN  K  I    +Y ++E+            + VE+A QY  TY  + ++F NNINTTEGG HE+GFK AL ++I+K+A + +L K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++LLENP  A +I++K + A  AR  + +A+E  RRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEK + DK+ +N+EI+NLI A G G+G EF I+KLRY+KI++MTDADVDG+HIR LLLTFLFR+  PL+E+G VY A PPL+K S GK+ +YAY ++ L      + + K  IQRYKGLGEMN +QLWETTMDP  R LL++ +EDA+ AD+VFS+LMG
  S:     1 QILEGLEAVRKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYANEVNIEILPDNIIKVRDNGRGIPVDIHPKTGRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSLWYLVQIHKDGKIYEQKY-ERGIPAYDLREIGTTTETG--TETTFLADPLIFTETTVYNYETLRNRVQQLAFLNKGIKLTLEDKRIEHPMKEEFHYEGGIVEYIQHLNQSKSKIHQDAIYIDKEQD----------GVTVEIALQYVDTYTPNIYSFTNNINTTEGGMHEDGFKLALTRVISKYADDNQLKK--DDAISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAIASQITSEALERFLLENPNQAKLIVEKVISATRARVAARKAKELARRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKVRFDKMLNNKEIVNLIQAFGTGIGDEFDINKLRYHKIVIMTDADVDGAHIRTLLLTFLFRHFKPLIEHGYVYAAQPPLYKVSYGKNIQYAYSDEQLNTILA-SIEGKPSIQRYKGLGEMNYEQLWETTMDPAARTLLQIKLEDAIEADQVFSMLMG 599
>gi|110799437|ref|YP_694481.1| DNA gyrase subunit B [Clostridium perfringens ATCC 13124] >gi|168207731|ref|ZP_02633736.1| DNA gyrase, B subunit [Clostridium perfringens E str. JGS1987] >gi|168215272|ref|ZP_02640897.1| DNA gyrase, B subunit [Clostridium perfringens CPE str. F4969] >gi|170764021|ref|ZP_02637634.2| DNA gyrase, B subunit [Clostridium perfringens B str. ATCC 3626] >gi|182420561|ref|ZP_02643926.2| DNA gyrase, B subunit [Clostridium perfringens NCTC 8239] >gi|182627057|ref|ZP_02954782.1| DNA gyrase, B subunit [Clostridium perfringens D str. JGS1721] >gi|110674084|gb|ABG83071.1| DNA gyrase, B subunit [Clostridium perfringens ATCC 13124] >gi|170660917|gb|EDT13600.1| DNA gyrase, B subunit [Clostridium perfringens E str. JGS1987] >gi|170710064|gb|EDT22246.1| DNA gyrase, B subunit [Clostridium perfringens B str. ATCC 3626] >gi|170713332|gb|EDT25514.1| DNA gyrase, B subunit [Clostridium perfringens CPE str. F4969] >gi|177907583|gb|EDT70222.1| DNA gyrase, B subunit [Clostridium perfringens D str. JGS1721] >gi|182379692|gb|EDT77171.1| DNA gyrase, B subunit [Clostridium perfringens NCTC 8239] (638 aa)
Score = 1606, Expect = 2.0e-176, Identities = 360/646 (55%), Positives = 456/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYD----EKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E     Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + K+ S  V DDGRG+PV  H K  K TVE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS   +V V ++       +K G       K+   + S   GT V F PD EI E  E+D + +  RL++LA+LNKGI I  IDER D+  +E + + GGIK +V  LN  KE +         +E +     KD   I VEV+ QY+  +N + FTF NNI+T EGG+H  GFK AL +++N +      LKE+D+ +S +D  EGLTA+VS+K   PQ+EGQTK KLGNSEVR  V ++  E    +L ENPE   +II+K LLA  AR+ +  ARE TR KS  E +SLPGKLADCS+KD +  E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI  ++ I +++TAIGAG+GPEF I+K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL+K S GK  +YAY     ++ +EEF  ++S V   +QRYKGLGEMN  QLWETTMDP++R+LL+  IEDA+ AD++F++LMGD+V PRREFI+KNAK V NLDI
  S:     3 EQNNQNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGYCKNIKVYIHKDNSVTVVDDGRGMPVGIHPKMGKPTVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSELCEVIVTRDGYVWKQSYKRGAVLTGLEKIGEAEGS---GTKVHFKPDHEIFEETEYDFEILSQRLRELAFLNKGINITLIDEREDEVKEEVYHYEGGIKSFVSYLNRNKEVL--------HDEPIYVEGLKD--GIAVEVSLQYHDGFNENIFTFANNIDTVEGGTHLAGFKTALTRVMNDYGRRFGHLKESDKNLSGDDIREGLTAVVSVKISEPQFEGQTKTKLGNSEVRSAVDSISGEGISTFLEENPEVGKIIIEKALLASRAREAARRARELTR-KSVLERSSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEKQRLDKILGSDTIRSMVTAIGAGIGPEFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRDLVEQGHVYIAQPPLYKISKGKQERYAYSDAAADEIIEEFGGKDSSV--NVQRYKGLGEMNAGQLWETTMDPESRILLRADIEDAMVADEIFTILMGDKVEPRREFIQKNAKNVSNLDI 638
>gi|78183717|ref|YP_376151.1| DNA gyrase subunit B [Synechococcus sp. CC9902] >gi|78168011|gb|ABB25108.1| DNA gyrase subunit B [Synechococcus sp. CC9902] (655 aa)
Score = 1605, Expect = 2.3e-176, Identities = 329/636 (51%), Positives = 440/636 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASI-KNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDD--------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAK 642
           +N Y A  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDN++DEA+ G+   IT+ L  +GSA V D+GRGIP + H +T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ + H   F+ G      L  +  +A   + GT V F PD +I      FD  T+ +RL++LAYLN G++I F DER           +E + + GGIK++V  +N  K+ + P I+Y           N +K  ++VE A Q+    Y++S   F NNI T +GG+H EG K  L + +N FA +    KE D  ++ E+  EGLTA++S+K P P++EGQTK KLGN+EVR  V N+V E   ++L  NP   ++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G EF    LRY+++++MTDADVDG+HIR L+LTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E  L++  K      KY IQR+KGLGEM P QLWETTMDP  R++ ++ IEDAL AD++F++LMGD+VAPRREFIE ++K
  S:     8 QNEYGAEQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNAVDEALAGHCDRITVILGADGSASVTDNGRGIPTDVHPRTGKSALETVLTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVQVTVRRQGQVHRQRFERGAAIGTLLSESQPEAEQGETGTTVCFLPDTQIFTGGIVFDYATLSARLRELAYLNGGVQIVFRDERESSLSDAGDPHEEIYFYEGGIKEYVAYMNKAKDALHPDIIY----------VNSEKDGVQVEAALQWCADAYSDSILGFANNIRTVDGGTHIEGLKTVLTRTLNAFAKKLGKRKEADSNLAGENIREGLTAVLSVKVPEPEFEGQTKTKLGNTEVRGIVDNLVGESLSQFLEFNPSVISLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDSKIYKNTEIQALITALGLGIKGEEFDQKSLRYHRVVIMTDADVDGAHIRTLILTFFYRYKRELVEGGYIYIACPPLYKVERGKNHTYCYNESDLQKTLKGFGENAKYTIQRFKGLGEMMPKQLWETTMDPSTRMMKRIEIEDALEADRIFTILMGDKVAPRREFIETHSK 646
>gi|78707341|gb|ABB46477.1| DNA gyrase subunit B [Acholeplasma brassicae] (591 aa)
Score = 1605, Expect = 2.5e-176, Identities = 337/600 (56%), Positives = 431/600 (71%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAE-FDADTIKSRLKQLAYLNKGIKINFIDERTDDKE-----TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           VRKRPGMYIGST  +GLHH+VWEIVDNSIDE M G A EITI L      KV D+GRGIPV+ H KT +  VET+LTVLHAGGKFD  SYKVSGGLHGVG+SVVNAL+ W +V + ++ K +  E+K G  P  DLKV  E  S   GT++EF  D EI +    +D + +++R+++LA+LN+ +KIN  D+R    E     ++ + GGI ++V  LN  K+ +  T++Y E+E             I VE+A QYN  Y+ + F+F NNI+T EGG HE+GFK AL +++ ++A E+ +LK+ DE    ED  EGLTAIVSIKHP+PQ+EGQTK KLGN EVR   S +  EI E+YL+ENP DA  II+K L+A  AR  + +AREATRRKSP +      KLADC  K  EISE+YIVEGDSAGGSAK GRD  FQAILPL+GK++NVEK++ DKI SN+EI+++I A G G+G +F   K RY+KI++MTDADVDG+HIR LLLTFL+R++  L++ G VYIA PPL+K   GK  +Y YDE    K LE F       + QIQRYKGLGEMNP+QLWETTMDP  R LL+V+++DA+NAD+VFS
  S:     1 VRKRPGMYIGSTGERGLHHLVWEIVDNSIDECMAGYADEITIELLPNNIVKVTDNGRGIPVDLHPKTHRPAVETILTVLHAGGKFDGKSYKVSGGLHGVGSSVVNALTVWFRVTIARDGKLYQQEYKRG-VPQYDLKVIGE--SSHTGTVIEFLADDEIFKEVNTYDFERLRNRIQELAFLNRNVKINISDQRDPKTEKHVYYSYQYEGGIIEYVHFLNTSKQEVNKTVIYIEKEID----------GITVELALQYNSDYSTNLFSFANNIHTHEGGMHEDGFKLALTRVLGRYAQEQNILKK-DESFIGEDTREGLTAIVSIKHPDPQFEGQTKTKLGNPEVRQITSQITGEILERYLMENPADAKAIIEKILMASRARIAARKAREATRRKSPLDMLGFASKLADCRNKSPEISEIYIVEGDSAGGSAKQGRDSEFQAILPLRGKVLNVEKSRLDKILSNKEILSMIQAFGTGIGEDFDAAKARYHKIVIMTDADVDGAHIRTLLLTFLYRHLKGLIDMGYVYIAQPPLYKVQSGKKVEYVYDEERLPKVLEAFGG-----RPQIQRYKGLGEMNPEQLWETTMDPTTRTLLRVSLQDAMNADQVFS 591
>gi|76802387|ref|YP_327395.1| DNA topoisomerase II subunit B (DNA gyrase) [Natronomonas pharaonis DSM 2160] >gi|76558252|emb|CAI49840.1| DNA topoisomerase II subunit B (DNA gyrase) [Natronomonas pharaonis DSM 2160] (639 aa)
Score = 1605, Expect = 2.6e-176, Identities = 335/645 (51%), Positives = 445/645 (68%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNE-KASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD--DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ + YSA  I++LEGLEAVRKRP MYIGSTD +GLHH+V+E+VDN+IDEA+ G    I + +  +GS  V+DDGRGIPV+ H    +  VE ++TVLHAGGKFD+ SY+VSGGLHGVG SVVNALS WL+V + ++    +  F D G+P   L+   E   +   GT + F+PD +I E  +F   T++SRL++LA+LN G+ I   DER +  D  TF + GGI+++V  LN  ++ +   I+Y E EE           +I VEVA Q       S   F NNINT EGG+H  GFK AL ++IN +A    +LK+ D  +  ED  EGLTA++SIKHP+PQ+EGQTK KLGN EVR  V + V E    +L E+P+ A  II K + A +ARK + +A E TRRKS  ES SLPGKL+DC T+D E SEL++VEGDSAGGSAK GR+  FQAILPL+GKI+NVEK + D+I  N EI NLITA+G G+G EF I++ RY KII++ DADVDG+HIR LLLTFL+R+M PL+E G VY A PPL++   G  +  A  E   +   +E       Q+QR+KGLGEMNP QLW+TTM+P+NR+L ++TIEDA  AD++FS+LMGD V PR++FI+++A   + +DI
  S:     2 SQDSEYSAGQIQVLEGLEAVRKRPAMYIGSTDTRGLHHLVYEVVDNAIDEALAGYCDTIEVVINDDGSVTVRDDGRGIPVDTHEDHDRPAVEVIMTVLHAGGKFDSKSYQVSGGLHGVGVSVVNALSKWLEVEIKRDGHVWHHRF-DHGEPENGLEQVREMDPNESTGTEIRFWPDDDIFETTDFTFSTLESRLRELAFLNPGVGITIRDERPEEPDASTFEYDGGIREFVAYLNETRDVLHENIIYFEDEED----------DIHVEVAMQATAGVQGSIHAFANNINTREGGTHLTGFKTALTRVINDYATSNGMLKDLDGNLKGEDIREGLTAVISIKHPDPQFEGQTKTKLGNGEVRGIVESAVHEELATHLEEHPDTAEAIISKAVEAAKARKAAKKAEELTRRKSALESTSLPGKLSDCQTRDPEESELFVVEGDSAGGSAKQGRNPEFQAILPLRGKILNVEKHRLDRILENNEIRNLITAVGTGIGEEFDIEEARYQKIIILCDADVDGAHIRTLLLTFLYRHMTPLIEAGYVYAAQPPLYRVRDGGDTYDAMTEAERDRIVEEVCDGSPDQVQRFKGLGEMNPKQLWDTTMNPENRILKQITIEDAAAADRMFSVLMGDAVEPRKQFIKEHADEAEWIDI 639
>gi|169343479|ref|ZP_02864479.1| DNA gyrase, B subunit [Clostridium perfringens C str. JGS1495] >gi|169298431|gb|EDS80520.1| DNA gyrase, B subunit [Clostridium perfringens C str. JGS1495] (637 aa)
Score = 1605, Expect = 2.6e-176, Identities = 360/646 (55%), Positives = 456/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYD----EKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E     Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + K+ S  V DDGRG+PV  H K  K TVE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS   +V V ++       +K G       K+   + S   GT V F PD EI E  E+D + +  RL++LA+LNKGI I  IDER D+  +E + + GGIK +V  LN  KE +         +E +     KD   I VEV+ QY+  +N + FTF NNI+T EGG+H  GFK AL +++N +      LKE+D+ +S +D  EGLTA+VS+K   PQ+EGQTK KLGNSEVR  V ++  E    +L ENPE   +II+K LLA  AR+ +  ARE TR KS  E +SLPGKLADCS+KD +  E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI  ++ I +++TAIGAG+GPEF I+K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL+K S GK  +YAY     ++ +EEF  ++S V   +QRYKGLGEMN  QLWETTMDP++R+LL+  IEDA+ AD++F++LMGD+V PRREFI+KNAK V NLDI
  S:     2 EQNNQNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGYCKNIKVYIHKDNSVTVVDDGRGMPVGIHPKMGKPTVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSELCEVIVTRDGYVWKQSYKRGAVLTGLEKIGEAEGS---GTKVHFKPDHEIFEETEYDFEILSQRLRELAFLNKGINITLIDEREDEVKEEVYHYEGGIKSFVSYLNRNKEVL--------HDEPIYVEGLKD--GIAVEVSLQYHDGFNENIFTFANNIDTVEGGTHLAGFKTALTRVMNDYGRRFGHLKESDKNLSGDDIREGLTAVVSVKISEPQFEGQTKTKLGNSEVRSAVDSISGEGISTFLEENPEVGKIIIEKALLASRAREAARRARELTR-KSVLERSSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEKQRLDKILGSDTIRSMVTAIGAGIGPEFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRDLVEQGHVYIAQPPLYKISKGKQERYAYSDAAADEIIEEFGGKDSSV--NVQRYKGLGEMNAGQLWETTMDPESRILLRADIEDAMVADEIFTILMGDKVEPRREFIQKNAKNVSNLDI 637
>gi|110803693|ref|YP_697357.1| DNA gyrase subunit B [Clostridium perfringens SM101] >gi|110684194|gb|ABG87564.1| DNA gyrase, B subunit [Clostridium perfringens SM101] (638 aa)
Score = 1604, Expect = 2.7e-176, Identities = 360/646 (55%), Positives = 456/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYD----EKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E     Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + K+ S  V DDGRG+PV  H K  K TVE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS   +V V ++       +K G       K+   + S   GT V F PD EI E  E+D + +  RL++LA+LNKGI I  IDER D+  +E + + GGIK +V  LN  KE +         +E +     KD   I VEV+ QY+  +N + FTF NNI+T EGG+H  GFK AL +++N +      LKE+D+ +S +D  EGLTA+VS+K   PQ+EGQTK KLGNSEVR  V ++  E    +L ENPE   +II+K LLA  AR+ +  ARE TR KS  E +SLPGKLADCS+KD +  E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI  ++ I +++TAIGAG+GPEF I+K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL+K S GK  +YAY     ++ +EEF  ++S V   +QRYKGLGEMN  QLWETTMDP++R+LL+  IEDA+ AD++F++LMGD+V PRREFI+KNAK V NLDI
  S:     3 EQNNQNYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNSIDEALAGYCKNIKVYIHKDNSITVVDDGRGMPVGIHPKMGKPTVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSELCEVIVTRDGYVWKQSYKRGAVLTGLEKIGEAEGS---GTKVHFKPDHEIFEETEYDFEILSQRLRELAFLNKGINITLIDEREDEVKEEVYHYEGGIKSFVSYLNRNKEVL--------HDEPIYVEGLKD--GIAVEVSLQYHDGFNENIFTFANNIDTVEGGTHLAGFKTALTRVMNDYGRRFGHLKESDKNLSGDDIREGLTAVVSVKISEPQFEGQTKTKLGNSEVRSAVDSISGEGISTFLEENPEVGKIIIEKALLASRAREAARRARELTR-KSVLERSSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEKQRLDKILGSDTIRSMVTAIGAGIGPEFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRDLVEQGHVYIAQPPLYKISKGKQERYAYSDAAADEIIEEFGGKDSSV--NVQRYKGLGEMNAGQLWETTMDPESRILLRADIEDAMVADEIFTILMGDKVEPRREFIQKNAKNVSNLDI 638
>gi|71903198|ref|YP_280001.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS6180] >gi|71802293|gb|AAX71646.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS6180] (650 aa)
Score = 1604, Expect = 2.9e-176, Identities = 354/646 (54%), Positives = 457/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL+V          T V F PD EI  E  +FD + +  R+++LA+LN+G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MT ADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEVIGTTDVTG--TTVHFTPDPEIFTETTQFDYNVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTIADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRNFIEENAVY-STLDI 650
>gi|169823702|ref|YP_001691313.1| DNA gyrase B subunit [Finegoldia magna ATCC 29328] >gi|167830507|dbj|BAG07423.1| DNA gyrase B subunit [Finegoldia magna ATCC 29328] (638 aa)
Score = 1604, Expect = 3.3e-176, Identities = 343/643 (53%), Positives = 446/643 (69%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVG-KSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTI--EDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           K   Y+A  I +LEGLE VR RPGMYIGSTD KGLHH+V+E+VDNSIDEA+ G    I +T+ K+ S  V+DDG GIPVE H KT KST+ETVLTVLHAGGKF ND+Y+ SGGLHGVG S VNALS++L   V ++ K +   F+ G K V  L V  E      GT +EF PD  I E   FD + +  R +++A+LNKG+KI F DER   KE F + GGIK +VE +N  K+P+   ++Y E E          K   +VE+A QY ++YN +  +F NNI T +GG+H  GFK AL + +N +A  K +LKE D+ +S +D  EG+TA+VS+K  NPQ+EGQTK KLGNSE R  V +VV E    Y  ENP+    II+K L + +AR  +  AR+  R+KS  ++ +LPGKLADC + D E +E+++VEGDSAGGSAK GRD  FQAILPL+GKI+NVEKA  +++ ++EEI  +ITA G G+G  F I KLRY KI++MTDADVDG+HIR LLLTFL+R+M PL+E G+VYIA PPL+    G K  +Y Y E+ LEE  +K   +   ++QRYKGLGEMN +QLW+TTM+P++R+L+KV I  ED    D  F +LMGD V PRREFIE+NA Y +N+D
  S:     3 KNREYTADQITVLEGLEPVRVRPGMYIGSTDEKGLHHLVYEVVDNSIDEALAGVCDLIKVTIKKDNSIIVEDDGSGIPVETHPKTGKSTLETVLTVLHAGGKFSNDAYQYSGGLHGVGVSCVNALSTYLIARVKRDGKMYEQRFEKG-KTVTGLTVVKENVR-GTGTTIEFMPDDTIFETLNFDKNVLAKRFREMAFLNKGVKIEFSDERDGYKELFHYEGGIKSFVEYINKSKKPLDHEVMYIEGE----------KDTTKVEIAMQYTESYNETIVSFTNNIKTVDGGTHVVGFKSALTRALNDYARNKNILKEKDDNLSGDDVREGITAVVSVKLNNPQFEGQTKGKLGNSEARTVVDSVVYEHLSFYFEENPKIVRTIIQKALASQKARLAARRARDLVRKKSVLDNTTLPGKLADCQSSDIEYNEIFLVEGDSAGGSAKGGRDNKFQAILPLRGKILNVEKAHLERVLNSEEIKAMITAFGTGIGKNFDISKLRYGKIVIMTDADVDGAHIRTLLLTFLYRFMKPLVEKGHVYIAQPPLYGIIKGVKVMEYCYTEQELEEALEKYGERSNIKVQRYKGLGEMNAEQLWDTTMNPEHRILIKVEIDGEDENELDNTFDVLMGDNVEPRREFIEQNAVYAQNID 637
>gi|121889|sp|P21558|GYRB_HALSQ DNA gyrase subunit B >gi|99223|pir||A39135 DNA topoisomerase chain B homolog - Haloferax sp >gi|149024|gb|AAB09605.1| DNA gyrase beta-subunit [Haloferax alicantei] >gi|1899004|gb|AAB49900.1| DNA gyrase beta-subunit [Shuttle vector pMDS20] (639 aa)
Score = 1603, Expect = 3.5e-176, Identities = 337/645 (52%), Positives = 447/645 (69%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADL-KVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETD-EKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ N Y A  I++LEGLEAVRKRP MYIGSTD +GLHH+V+E+VDNSIDEA+ G+   I + L ++GS  V D+GRGIPV  H +  +  +E ++TVLHAGGKFDN SY+VSGGLHGVG +VVNALSS L+V V  +       F+ G   V +  +V + +     GT + F+PD  I E  EFD  T+++RL++LA+LN G++I+  DERTD+  TFLF GGI+++VE LN  K  +   ++Y + E             I VE+A Q       S   F NNINT EGG+H  GFK AL +++N +A    +L + D + +  ED  EGLTA++S+KHP+PQ+EGQTK KLGNSEVR  V +V  +    +  ENP+ A  II K + A  ARK + +A E TRRKS  ES SLPGKLADC ++D   SEL+IVEGDSAGGSAK GRDR FQAILPLKGKI+NVEK + D+I  N+EI  LITAIG GVG EF I+K RY ++ILMTDADVDG+HIR LLLT L+R+M PL+E G VY A PPL++     ++  A DE   +   ++E +    Q+QR+KGLGEMNPDQLW+TTM+P+NR+L ++T+EDA  AD++F++LMGD V PR++FI+ +A   + +DI
  S:     2 SQDNEYGAGQIQVLEGLEAVRKRPAMYIGSTDSRGLHHLVYEVVDNSIDEALAGHCDAIEVALHEDGSVSVTDNGRGIPVGTHEQYDRPALEVIMTVLHAGGKFDNKSYQVSGGLHGVGVTVVNALSSELEVEVKHDGAVWTHRFEVGEPQVEEFERVRDLEPGEDTGTTIRFWPDDGIFETTEFDFKTLENRLRELAFLNSGVEISLSDERTDESSTFLFEGGIREFVEYLNETKTALHDDVIYYDDESE----------GIEVEIAMQATDELQGSIHAFANNINTREGGTHLTGFKTALTRVVNDYANSHDMLDDLDGDNLRGEDVREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESVTHQQLGTFFEENPDTATAIISKAVEAARARKAAKQAEELTRRKSALESTSLPGKLADCQSRDPSESELFIVEGDSAGGSAKQGRDRKFQAILPLKGKILNVEKHRLDRILENDEIRALITAIGGGVGDEFDIEKARYQRLILMTDADVDGAHIRTLLLTLLYRHMRPLIEAGYVYAAQPPLYRVRYRGNTYDAMDEAERDRIIEEECNGNPTQVQRFKGLGEMNPDQLWDTTMNPENRVLKRITVEDAAAADRMFNILMGDAVGPRKQFIKDHANDAEWVDI 639
>gi|78707365|gb|ABB46488.1| DNA gyrase subunit B [Acholeplasma pleciae] (587 aa)
Score = 1603, Expect = 3.5e-176, Identities = 329/600 (54%), Positives = 438/600 (73%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           V+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A EITI + K    +V D+GRGIPV+ H KT +  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+   Y++ Y    + G P  DLK      + ++GT++ F  D  I  E   ++ +T+++R++QLA+LNKG+K+N ID+R ++   E+F + GGI ++V+ LN  K  I P I+Y E+E+           +I +E+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A E K+ K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++L+ENP  A  I++K LLA  AR  + +A++ TRRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I K RY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K S G++S+YAY E+ L    K+  + K  IQRYKGLGEM+ +QLW+TTMDP  R LL++ +EDA++AD+VFS
  S:     1 VKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALGGYADEITIEILKGEIIRVTDNGRGIPVDTHPKTGRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEWFVVEIHKDGVIYEQKY----ERGIPAYDLKTLG--TTDRSGTVISFQSDPLIFKETVIYNYETLRTRIQQLAFLNKGLKLNLIDDRFEEVKTESFHYEGGIIEYVKFLNQAKTRIHPDIIYIEKEQD----------DITIELALQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALTRVISKYADELKMKK--DDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEALERFLMENPAQAKAIVEKVLLATRARVAARKAKDLTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGISDEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKVSWGRNSEYAYTEQELNIILKK-IETKPNIQRYKGLGEMDAEQLWDTTMDPAKRTLLQIKLEDAIDADQVFS 587
>gi|118445175|ref|YP_879293.1| DNA gyrase subunit B [Clostridium novyi NT] >gi|118135631|gb|ABK62675.1| DNA gyrase, B subunit [Clostridium novyi NT] (637 aa)
Score = 1603, Expect = 3.6e-176, Identities = 355/643 (55%), Positives = 461/643 (71%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  Y  S I++LEGLEAVRKRPGMYIG+T I+GLHH+V+EIVDNSIDEA+ G    I + + K+    V+DDGRG+PV  H K KK TVE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS    V V ++       +K G K V++L +  +  + ++GT V F PD EI E  EFD  T+  RL++LA+LNKGIKI  +DER   + ++ F + GGIK +V  LN  K+ +    +Y E         NKD Y   VEV  QYN TYN + F+F NNI+T EGG+H  GFK AL +++N +A     LKE D+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGN+EVR  V ++VSE    +L ENP+ A ++I+K L A  AR+ + +ARE TRRKS  ES SLPGKLADCS+KD    E+Y+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI ++++I  +ITA GAG+G +F I+K+RY++II+MTDADVDG+HI  LLLTF +RYM  L++ G+VYIA PPL++   GKS  YAY +  L+E   +        +IQRYKGLGEM+  QLW+TTM+P++R L+KVTI+DA+ AD+VF++LMGD+V PRREFIE+NAK V NLDI
  S:     4 KQVYDESQIQVLEGLEAVRKRPGMYIGTTGIRGLHHLVYEIVDNSIDEALAGFCQNIEVLIHKDNCITVKDDGRGMPVGIHPKMKKPTVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSKECNVEVRRDGHIWSQNYKKG-KVVSELTIVGD--TDEHGTSVYFKPDDEIFEEVEFDYSTLAQRLRELAFLNKGIKIILVDEREGNERRDEFHYEGGIKSFVSFLNRNKQTLHAEPIYVE--------GNKDDY--LVEVGLQYNDTYNENIFSFANNIDTVEGGTHLAGFKTALTRVLNDYARRYGFLKENDKNLSGDDTREGLTAVISVKLTDPQFEGQTKTKLGNTEVRGIVDSIVSERVSIFLEENPDTAKIVIEKSLTAARAREAAKKARELTRRKSVLESTSLPGKLADCSSKDPSECEIYLVEGDSAGGSAKQGRDRRFQAILPLRGKIMNVEKQRLDKILNSDQIRAMITAFGAGIGKDFDIEKIRYHRIIIMTDADVDGAHIATLLLTFFYRYMRELVDGGHVYIAQPPLYQVKKGKSVNYAYSDNELQEVLAQIGGKDKNTEIQRYKGLGEMDAGQLWDTTMNPEHRTLVKVTIDDAMRADEVFTILMGDKVEPRREFIEENAKKVVNLDI 637
>gi|187777362|ref|ZP_02993835.1| hypothetical protein CLOSPO_00918 [Clostridium sporogenes ATCC 15579] >gi|187774290|gb|EDU38092.1| hypothetical protein CLOSPO_00918 [Clostridium sporogenes ATCC 15579] (637 aa)
Score = 1603, Expect = 3.7e-176, Identities = 352/649 (54%), Positives = 458/649 (70%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E K+  Y  S I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G  + I + + K+ S  V DDGRG+PV  H+K KK  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS    V V ++    +++  + G P   L +  +     +GT + F PD EI +  EF+ DT+  RL++LA+LNKGIKI+  DER D +E F + GG++ +V  LN  KE +    +Y ++        NKD     VE+A QYN  Y  + F+F NNI+T EGG+H  GFK AL + IN +A +   LK+TD+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGNSEVR  V  +V E    +L ENP    +II+K L A  AR+ +  ARE TRRKS  ES SLPGKLADCS+KD  + E+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEK + DKI +++EI  +ITA GAG+G EF ++K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL++    K   Y Y +K L+E   E         IQRYKGLGEM+P+QLWETTM+P++R LL+VTIEDA+ AD++F++LMG +V PRR+FIE NA  V NLDI
  S:     1 MSQENKQ-VYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGFCTHIEVFIHKDNSITVVDDGRGMPVGMHSKVKKPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEHCNVEVRRD-GHIWLQKYERGIPKTGLDIVGDTED--HGTKIYFKPDVEIFDELEFEYDTLAQRLRELAFLNKGIKISLTDERYDKQEMFHYEGGLRSFVLYLNRNKEKLHQQPIYVDK--------NKD--GCIVEIAMQYNDGYAENIFSFANNIDTIEGGTHLAGFKSALTRAINDYARKFNYLKDTDKNLSGDDVREGLTAVISVKLTDPQFEGQTKTKLGNSEVRGIVDTIVGESIGSFLEENPNVGKIIIEKGLSASRAREAAKRARELTRRKSVLESTSLPGKLADCSSKDPSLCEIYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVEKQRLDKILASDEIRAMITAFGAGIGKEFNLEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELVEEGHVYIAQPPLYRIYKAKKELYVYSDKELDEALLELGGKDTNTNIQRYKGLGEMDPEQLWETTMNPEHRTLLQVTIEDAMAADEIFTILMGTKVEPRRDFIENNADKVVNLDI 637
>gi|169235747|ref|YP_001688947.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Halobacterium salinarum R1] >gi|167726813|emb|CAP13599.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Halobacterium salinarum R1] (637 aa)
Score = 1603, Expect = 3.8e-176, Identities = 333/645 (51%), Positives = 448/645 (69%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETD-EKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVK-YQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + ++ YSA  I++LEGLEAV+KRP MYIGSTD +GLHH+V+E+VDNSIDEA+ G    I +TL  +GS  V DDGRGIPV  H +  +  VE +LTVLHAGGKFD  SY+VSGGLHGVG SVVNALS  L V V ++   Y+E +    + G+PV DL+   +  S  +GT++ F PD EI E   +D  T+++RL++LA+LN G++I   DER D+  + TF + GGI+++VE LN  +  +   ++Y + E+            I VE+A Q ++   +ST  F NNINT EGG+H  GFK AL + +N +A +  LL E D E ++ +D  EGLTA++S+KHP+PQ+EGQTK KLGNSEVR  V   V++    Y  ENP  A  +++  + A +ARK + +A E TRRKS   S SLPGKLADC +K  E +EL++VEGDSAGGSAK GR+  FQAILPL GKI+NVEK + D+I  ++E+ ++ITA+G G+G EF ID+LRY  II+MTDADVDG+HIR LLLTF +R+M PLLE G VY A PPL++      +  A  E   E   +E       Q+QR+KGLGEMNP QLW+TTMDP+NR+L ++T+EDA  ADK+FS+LMGD V PR++FI++ A   + +DI
  S:     2 SDQSEYSAGQIQVLEGLEAVQKRPAMYIGSTDARGLHHLVYEVVDNSIDEALAGYCDRIDVTLHDDGSVSVTDDGRGIPVATHEEYDRPAVEVILTVLHAGGKFDAKSYQVSGGLHGVGVSVVNALSERLAVEVSRDGARYREQF----ERGEPVTDLQHVGD--SDDSGTLIRFRPDSEIFETTAYDFSTLENRLRELAFLNSGVEITLTDERGDEPTQSTFEYEGGIREFVEYLNETRNALHDDVIYFQGEDD----------GISVEIAMQASEDVQSSTHAFANNINTREGGTHLTGFKTALTRTVNDYANDNNLLSELDGENLTGDDIREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVERAVNDGLGTYFEENPATAKAVVRTAVEAAKARKAAKKAEELTRRKSALGSTSLPGKLADCQSKAPEDAELFVVEGDSAGGSAKQGRNPGFQAILPLGGKILNVEKHRLDRILEHDELRHIITALGTGIGDEFDIDELRYENIIMMTDADVDGAHIRTLLLTFFYRHMKPLLEAGYVYAAQPPLYRIRYRGKTYDAMTEADRERIVEEQCNGNPTQVQRFKGLGEMNPQQLWDTTMDPENRILKRITVEDAAAADKMFSVLMGDAVEPRKQFIQERAGDAEWVDI 637
>gi|169335585|ref|ZP_02862778.1| hypothetical protein ANASTE_02000 [Anaerofustis stercorihominis DSM 17244] >gi|169258323|gb|EDS72289.1| hypothetical protein ANASTE_02000 [Anaerofustis stercorihominis DSM 17244] (636 aa)
Score = 1603, Expect = 3.8e-176, Identities = 338/644 (52%), Positives = 453/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + + Y AS IK+LEGLEAVRKRPGMYIGST  KGLHH+V+EIVDNS+DEA+ G    I +T+ +  +  V+DDGRGIP   + K KKS VE  LT+LHAGGKFD+ +YKVSGGLHGVG SVVNALS  L V VY+    Y++ Y    + GKP+  L+V  +  + + GT V F PD EI     F+ DT+K R+++LA+LNKG+ I   D R   D +E+F + GGI ++V+  N  KE + P ++Y E+E  V            +EVA Q++ +Y+ S ++F NNINT EGG H  GFK AL + IN +A +  +LK+ +E +S +D  EGL  ++S+K  +P++EGQTK KLGN EVR +V   V +    YL E+P  A +I++K L A  ARK + +A++  RRKS  ES +LPGKLADC  KD    E+YIVEGDSAGGSAKLGR+   QAILPL+GKI+NVEKA+ D+I + + I ++ITA G G+  EF I+K RY+KI++MTDADVDG+HIR LLLTF +RYM  L++ G VYIA PPL+K    K   Y Y ++ LEE  +E  + K  +QRYKGLGEMN +QLW+TTM+P+NR LL+V+I+DA  AD++FS+LMGD+V PR++FI +NA+ V+NLDI
  S:     4 QNSNYDASKIKVLEGLEAVRKRPGMYIGSTGEKGLHHLVYEIVDNSVDEALAGFCKNIVVTIGEGDTITVEDDGRGIPTGMNEKYKKSAVEIALTMLHAGGKFDSGTYKVSGGLHGVGVSVVNALSEHLTVNVYQNGQVYEQKY----ERGKPITGLEVVGK--TKRTGTTVFFKPDGEIFSELVFNYDTLKHRIRELAFLNKGLNITLKDTREGKDQEESFHYEGGIIEFVDYANRGKEKLTPEVIYFEKESDV----------CMLEVAMQFSTSYSESIYSFANNINTVEGGMHVNGFKTALTRSINAYARKYNILKDNEENLSGDDIREGLCVVISVKLADPEFEGQTKTKLGNPEVRGYVDTTVGDNISSYLEEHPPVAKIIVEKALTAQRARKAARKAKDLVRRKSVLESTALPGKLADCREKDPSKCEIYIVEGDSAGGSAKLGRNSKTQAILPLRGKILNVEKARLDRILNTDTIRSMITAFGTGISEEFNIEKARYHKIVIMTDADVDGAHIRTLLLTFFYRYMRGLIDAGYVYIAQPPLYKLEKQKKVWYLYSDEQLEEKLQEIGRDKIGLQRYKGLGEMNGEQLWDTTMNPENRTLLQVSIDDAAYADEIFSILMGDQVQPRKDFITENARKVQNLDI 636
>gi|157151219|ref|YP_001450712.1| DNA gyrase subunit B [Streptococcus gordonii str. Challis substr. CH1] >gi|157076013|gb|ABV10696.1| DNA gyrase, B subunit [Streptococcus gordonii str. Challis substr. CH1] (649 aa)
Score = 1603, Expect = 4.2e-176, Identities = 348/647 (53%), Positives = 456/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + + K+ S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + H+ E+  G + VADLKV  E  + + GT V F PD EI  E  EFD + +  R+++LA+LN+G+ I+  D+R   +  + + + GGI  +V+ +N  KE I    +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +LLENP  A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F I K RY K+++MTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     7 QDIQSQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEKDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKNGQIHFQEYTRG-QVVADLKVIGE--TDRTGTTVHFTPDPEIFTETVEFDFEKLNKRIQELAFLNRGLSISITDKRDGMEQSKDYHYEGGIASYVQYINENKEVIFDNPIYTDGEME----------DITVEVAMQYTTGYHETVMSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKLLKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLLENPAVAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNNPVETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGADFDISKCRYQKLVIMTDADVDGAHIRTLLLTLIYRYMKPVLEAGYVYIAQPPIYGVKVGSEVKEYIQPGADQEIKLQEALARYSEGRSKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 649
>gi|171780013|ref|ZP_02920917.1| hypothetical protein STRINF_01800 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281361|gb|EDT46796.1| hypothetical protein STRINF_01800 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (650 aa)
Score = 1602, Expect = 5.0e-176, Identities = 346/640 (54%), Positives = 458/640 (71%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKY-----AYDEKTLEEF--KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A+ I + + K+ S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VY++ K HY E++ G   V DLKV  +  + ++GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   + ++ + + GGI  +VE +N  K+ I    +Y + E             I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLKE D+ ++ +D  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + S+ F ++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D  ++EL+IVEGDSAGGSAK GRDR  QAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY+K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K      A  E  L+    +  N + K  +QRYKGLGEM+  QLW TTMDP+NRL+ +V+++DA  ADK+F +LMGD+V PRREFIE+NA Y   LDI
  S:    15 YDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFATHIEVFIEKDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVSVYRDGKIHYQEYRRG-HVVDDLKVIGD--TDRHGTTVHFTPDGEIFTETTVFDFDKLAKRIQELAFLNRGLRISITDKREGIEQEQHYHYEGGISSYVEFINENKDVIFDKPIYTDGEMD----------GISVEVAMQYTTGYHETVMSFANNIHTHEGGTHEQGFRTALTRVINDYARQNKLLKEKDDNLTGDDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSDAFGRFLLENPQIAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDATMNELFIVEGDSAGGSAKSGRDREHQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGADFDVTKARYHKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGANQEAELQAAIERYSNGRSKPSVQRYKGLGEMDDHQLWATTMDPENRLMARVSVDDAAEADKIFDMLMGDKVEPRREFIEENAVY-STLDI 650
>gi|124485239|ref|YP_001029855.1| DNA gyrase subunit B [Methanocorpusculum labreanum Z] >gi|124362780|gb|ABN06588.1| DNA gyrase subunit B [Methanocorpusculum labreanum Z] (651 aa)
Score = 1601, Expect = 6.2e-176, Identities = 335/642 (52%), Positives = 440/642 (68%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGG--KPVADLKVTNEKASIKN--------------GTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + Y AS+I +LEGL  VR+RP MYIGSTD +GLHH+V+E+VDNSIDEA+ G    I I +   GS  V+DDGRGIPV+   K  KS +E V+TVLHAGGKFD ++Y+VSGGLHGVG SVVNALS+ L   VY++   + + F  G   +P+     T+E+  ++               GT + FYPD  I E  EFD D +  R ++LAYLNKG++I+  D RT D +TF + GG++Q+V  LN  KE + P  +Y ++ + V          I VEVA QYN TY    +T+ N++NT EGG+H EGF+ AL + IN  A   K LKE D  +  ED  EGLTA++S+K  NPQ+EGQTK +LGNS V+  V +++ +   ++  ENP+    I KK L A  AR+ +  A+E  RRK+  E + LPGKLADCS +D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA   K   N EI  LITAIGAG G +F  ++ RY+ I++MTDADVDG+HIRILLLTF +R+M PL+E G +YIA PPLF+ + GK  KY Y E+ +     E  +    +QRYKGLGEMN  QLW TTM+P+ R+L +V IEDA  A+++F  LMGD+V PR++FI+++A  VKNLDI
  S:     3 DNYDASHITVLEGLTPVRERPAMYIGSTDTRGLHHLVYEVVDNSIDEALAGFCKHIVIIINPNGSVSVEDDGRGIPVDIMPKQNKSALEVVMTVLHAGGKFDKNTYQVSGGLHGVGVSVVNALSTRLTAEVYRDGNIYSMVFGKGVLLQPLTSRPETDEEYLLRQKRLDKEGQPKETTTGTRITFYPDGSIFETTEFDYDVLAHRFRELAYLNKGLEIHVEDHRTGDSDTFCYEGGLRQFVAHLNEGKELLHPEPIYVDKSDDVN--------KIEVEVALQYNDTYGEILYTYVNSVNTREGGTHLEGFRSALTRAINNIAHANKHLKE-DVSVRGEDVREGLTAVISVKIANPQFEGQTKMRLGNSNVKGLVDSMMYQALTEFFEENPKVIAAIAKKSLDAANAREAARRAKELARRKTSLEMSGLPGKLADCSERDPAKSEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKALEHKALKNAEIQTLITAIGAGYGDKFDAERARYHHIVIMTDADVDGAHIRILLLTFFYRFMKPLVEMGYIYIAQPPLFRIAKGKQEKYVYTEEDMRLAIAEYGEKGISVQRYKGLGEMNAGQLWNTTMNPEFRILKQVRIEDASYANEIFEKLMGDDVMPRKDFIKRHAGEVKNLDI 651
>gi|78707349|gb|ABB46480.1| DNA gyrase subunit B [Acholeplasma granularum] >gi|78707351|gb|ABB46481.1| DNA gyrase subunit B [Acholeplasma granularum] >gi|78707353|gb|ABB46482.1| DNA gyrase subunit B [Acholeplasma granularum] (587 aa)
Score = 1600, Expect = 8.2e-176, Identities = 329/600 (54%), Positives = 434/600 (72%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           V+KRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A EI I + K    +V D+GRGIPV+ H KT +  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS +  V ++K+   Y++ Y    + G P  DLK      + K+GT++ F  D +I  E   ++ +T+K+R++QLA+LNKG+K++  D R D+   E+F + GGI ++V+ LN  K  I P I+Y ++E+            I VE+A Q+  +Y+ +  +F NNI+TTEGG HE+GFK AL ++I+K+A + K+ K  D+ IS ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S + SE  E++LLENP+ A +I++K LLA  AR  + +A+E TRRKSP ++     KLADC +KD E SE+YIVEGDSAGGSAK GRD  FQAI+PL+GK++NVEKA+ DK+ SN+EI+NLI A+G G+  EF I K RY+KI++MTDADVDG+HIR LLLTFLFR+M PL++ G VY A PPL+K S G++ KYAY ++ L E      + K  IQRYKGLGEMN +QLW+TTMDP  R LL++ +EDA+ AD+VFS
  S:     1 VKKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYADEINIEILKGNIVRVTDNGRGIPVDIHPKTGRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSEYFIVEIHKDGTIYEQRY----ERGIPAYDLKTIG--TTEKSGTVITFLADPKIFTETTVYNLETLKNRIQQLAFLNKGLKLHLTDSRPDEPIAESFHYEGGIVEYVKFLNQSKSKIHPDIIYIDKEQD----------GITVELALQFVDSYSPNLHSFTNNISTTEGGMHEDGFKMALTRVISKYADDLKMKK--DDSISGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQITSEAIERFLLENPQQAKMIVEKILLATRARVAARKAKELTRRKSPLDALGFASKLADCRSKDPEKSEIYIVEGDSAGGSAKQGRDSEFQAIMPLRGKVLNVEKARLDKMLSNKEIVNLIQAMGTGIADEFDITKARYHKIVIMTDADVDGAHIRTLLLTFLFRHMRPLIDAGYVYAAQPPLYKVSWGRNEKYAYTDEELNEI-VSGIETKPSIQRYKGLGEMNAEQLWDTTMDPAKRTLLQIKLEDAIEADQVFS 587
>gi|153939432|ref|YP_001389375.1| DNA gyrase subunit B [Clostridium botulinum F str. Langeland] >gi|152935328|gb|ABS40826.1| DNA gyrase, B subunit [Clostridium botulinum F str. Langeland] (637 aa)
Score = 1600, Expect = 8.3e-176, Identities = 357/649 (55%), Positives = 455/649 (70%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG-GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E K+  Y  S I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G  + I + + K+ S  V DDGRG+PV  H+K KK  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS   +V V +E       F+ G  K   D+    E     +GT + F PD EI +  EF+ DT+  RL++LA+LNKGIKI+  DER D KE F + GG++ +V  LN  KE +    +Y ++        NKD     VE+A QYN  Y  + F+F NNI+T EGG+H  GFK AL + IN +A +   LK+TD+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGNSEVR  V  +V E    +L ENP    +II+K L A  AR+ +  ARE TRRKS  ES SLPGKLADCS+KD  + E+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEK + DKI +++EI  +ITA GAG+G EF I+K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL++    K   Y Y +  L+    E         IQRYKGLGEMNP+QLW+TTMDP++R LL+VTIEDA+ AD++F++LMG +V PRREFIE NA  V NLDI
  S:     1 MSQENKQ-VYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGFCTHIEVFIHKDNSITVVDDGRGMPVGMHSKVKKPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEQCEVEVRREGHIWKQRFERGITKTGLDIVGDTED----HGTKIYFKPDIEIFDELEFEYDTLAQRLRELAFLNKGIKISLTDERYDKKEMFHYEGGLRSFVLYLNRNKEKLHQQPIYVDK--------NKD--GCIVEIAMQYNDGYAENIFSFANNIDTIEGGTHLAGFKSALTRAINDYARKFNYLKDTDKNLSGDDVREGLTAVISVKLTDPQFEGQTKTKLGNSEVRGIVDTIVGESIGSFLEENPNVGKIIIEKGLSASRAREAAKRARELTRRKSVLESTSLPGKLADCSSKDPSLCEIYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVEKQRLDKILASDEIRAMITAFGAGIGKEFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELIEEGHVYIAQPPLYRIFKAKKEIYVYSDPELDAALLELGGKDTNTNIQRYKGLGEMNPEQLWDTTMDPEHRTLLQVTIEDAMVADEIFTILMGTKVEPRREFIENNADKVVNLDI 637
>gi|1622792|gb|AAC44498.1| DNA topoisomerase II subunit B [Thermotoga maritima] (636 aa)
Score = 1600, Expect = 8.7e-176, Identities = 322/640 (50%), Positives = 453/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           YSA +IK+L+GLE VR RPGMYIGST  +GLHH+V+E+VDNS+DEA+ G    I +TL ++GS +V+D+GRGIPV+ H +  +S +E V TVLHAGGKF  DSYK+SGGLHGVG SVVNALS WL+V V+++   Y++ Y    + GKPV  ++V  E  + K+GTIV F PD  I    EFD D ++ RL+++A+L  G+KI F D    +K+TF F GGI ++V+ LN  K+ +   +++ +R E VK  N +D+  + VE+AFQY  +Y+    +F N I T +GG+H   FK  L +++N++  +   LK+ D+    ED  EGLTA++S+   NP++EGQTK KLGN EV+  V+  + E  +K    NPE    I+ K +   +AR+ +  ARE  RRK+  ++ +LPGKLADCS+  +E +EL+IVEGDSAGGSAK  RDR FQA+LP++GKI+NVEK+  D++  NE+I ++I A+G G+G +F   KLRY +II+MTDAD+DG+HIR LLLT  +RYM PL+E G VYIA PPL++   G+   Y Y ++ L E+K++    + +IQRYKGLGEMNP+QLWETTM+P+ R +++VTIEDA  AD++F +LMG++ + RREFIE++A  VK LDI
  S:     4 YSAESIKVLKGLEPVRMRPGMYIGSTGKRGLHHLVYEVVDNSVDEALAGYCDWIRVTLHEDGSVEVEDNGRGIPVDIHPEEGRSALEVVFTVLHAGGKFSKDSYKISGGLHGVGVSVVNALSEWLEVRVHRDGKIYRQRY----ERGKPVTPMEVIGE--TDKHGTIVRFKPDPLIFSETEFDPDILEHRLREIAFLVPGLKIEFEDRINGEKKTFKFDGGIVEYVKYLNRGKKAL-HDVIHIKRTEKVKTKNGEDE--VIVEIAFQYTDSYSEDIVSFANTIKTVDGGTHVTAFKSTLTRLMNEYGKKHNFLKK-DDSFQGEDVREGLTAVISVYVKNPEFEGQTKSKLGNEEVKEAVTKAMREELKKIFDANPELVKTILSKIMSTKQAREAAKRAREMVRRKNVLQNTTLPGKLADCSSTHREKTELFIVEGDSAGGSAKQARDREFQAVLPIRGKILNVEKSSLDRLLKNEQISDIIVAVGTGIGDDFDESKLRYGRIIIMTDADIDGAHIRTLLLTLFYRYMRPLIEQGRVYIALPPLYRIKAGREEFYVYSDQELAEYKEKLQGKRIEIQRYKGLGEMNPEQLWETTMNPETRKIIRVTIEDAEEADRLFEILMGNDPSSRREFIERHALKVKELDI 636
>gi|15672887|ref|NP_267061.1| DNA gyrase subunit B [Lactococcus lactis subsp. lactis Il1403] >gi|12723837|gb|AAK05003.1|AE006324_6 DNA gyrase subunit B (EC 5.99.1.3) [Lactococcus lactis subsp. lactis Il1403] (651 aa)
Score = 1600, Expect = 9.6e-176, Identities = 346/643 (53%), Positives = 462/643 (71%)
  Q:     1 MNKETKK-----NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG--GKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET---FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKY-----AYDEKTLEE--FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           MN+E K      + Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K+ +++Y E+  G  G    DLK+  E  + + GT V F PD EI  E  EFD D + +R+++LA+LN+G++I+  D+R  +++    F + GGI+ +VE LN  K  I    ++ E E             I VEVA QY  TY++   +F NNINT EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ +D  EGLTA++S+KHPNPQ+EGQTK KLGNSEV   V+ + +E    ++LENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ + E +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G ++ + K RY+K+++MTDADVDG+HIR LLLT  +RYM P++E G VYIA PP++   VG  +K         EK L+E   +    + K  +QRYKGLGEM+  QLW+TTMDP++RL+ +V++EDA  ADK+F +LMGD V PRREFIE NA+Y
  S:     1 MNEENKNLEMLADEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIEVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTVLDVTVHKDGQKYYQEYHRGLVGD---DLKIIGE--TDRRGTTVHFVPDPEIFTETVEFDFDKLATRVRELAFLNRGLRISLTDKREGNEKNEVHFHYEGGIQSYVEYLNENKTVIFEPAIFTEGEMD----------GIAVEVAMQYTDTYHSVVMSFANNINTHEGGTHEQGFRTALTRVINNYAKQNKILKENEDNLTGDDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVTGIVNKLFAEALTTFMLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNNPEQTELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADYDLSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGIKVGSETKEYIQPGENQEKDLQEALARWAQGRTKPTVQRYKGLGEMDDHQLWDTTMDPEHRLMARVSVEDAAEADKIFDMLMGDRVEPRREFIENNAQY 646
>gi|148378017|ref|YP_001252558.1| DNA gyrase, B subunit [Clostridium botulinum A str. ATCC 3502] >gi|153931278|ref|YP_001382416.1| DNA gyrase subunit B [Clostridium botulinum A str. ATCC 19397] >gi|153936801|ref|YP_001385968.1| DNA gyrase subunit B [Clostridium botulinum A str. Hall] >gi|148287501|emb|CAL81560.1| DNA gyrase subunit B [Clostridium botulinum A str. ATCC 3502] >gi|152927322|gb|ABS32822.1| DNA gyrase, B subunit [Clostridium botulinum A str. ATCC 19397] >gi|152932715|gb|ABS38214.1| DNA gyrase, B subunit [Clostridium botulinum A str. Hall] (637 aa)
Score = 1599, Expect = 1.0e-175, Identities = 353/649 (54%), Positives = 455/649 (70%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG-GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E K+  Y  S I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G  + I + + K+ S  V DDGRG+PV  H+K KK  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS   +V V +E      +F+ G  K   D+    E     +GT + F PD EI +  EF+ DT+  RL++LA+LNKGIKI+  DER D KE F + GG++ +V  LN  KE +         ++ +    NKD     VE+A QYN  Y  + F+F NNI+T EGG+H  GFK AL ++IN +A +   LK+TD+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGN EVR  V  +V +    +L ENP    +II+K L A  AR+ +  ARE TRRKS  ES SLPGKL+DCS+KD  + E+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEK + DKI +++EI  +ITA GAG+G EF IDK+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL++    K   Y Y +  L+    E         IQRYKGLGEMNP+QLWETTMDP++R LL+VT+EDA+ AD++F++LMG +V PRR+FIE NA  V NLDI
  S:     1 MSQENKQ-VYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGFCTHIEVFIHKDNSITVVDDGRGMPVGMHSKVKKPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEQCEVEVRREGHIWKQKFERGITKTGLDIVGDTED----HGTKIYFKPDIEIFDELEFEYDTLAHRLRELAFLNKGIKISLTDERYDKKEMFHYEGGLRSFVLYLNRNKEKL--------HQQPIYVDENKD--GCIVEIAMQYNDGYAENIFSFANNIDTIEGGTHLAGFKSALTRVINDYARKFNYLKDTDKNLSGDDVREGLTAVISVKLTDPQFEGQTKTKLGNGEVRGIVDTIVGQSIGSFLEENPNVGKIIIEKGLSASRAREAAKRARELTRRKSILESTSLPGKLSDCSSKDPSLCEIYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVEKQRLDKILASDEIRAMITAFGAGIGKEFDIDKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELIEEGHVYIAQPPLYRIYKAKKEIYVYSDPELDAALLELGGKDTNTNIQRYKGLGEMNPEQLWETTMDPEHRTLLQVTVEDAMEADEIFTILMGTKVEPRRDFIESNADKVVNLDI 637
>gi|15643596|ref|NP_228642.1| DNA gyrase, subunit B [Thermotoga maritima MSB8] >gi|6831559|sp|P77993|GYRB_THEMA DNA gyrase subunit B (Topoisomerase II subunit B) >gi|4981365|gb|AAD35915.1|AE001750_9 DNA gyrase, subunit B [Thermotoga maritima MSB8] (636 aa)
Score = 1599, Expect = 1.2e-175, Identities = 322/640 (50%), Positives = 453/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           YSA +IK+L+GLE VR RPGMYIGST  +GLHH+V+E+VDNS+DEA+ G    I +TL ++GS +V+D+GRGIPV+ H +  +S +E V TVLHAGGKF  DSYK+SGGLHGVG SVVNALS WL+V V+++   Y++ Y    + GKPV  ++V  E  + K+GTIV F PD  I    EFD D ++ RL+++A+L  G+KI F D    +K+TF F GGI ++V+ LN  K+ +   +++ +R E VK  N +D+  + VE+AFQY  +Y+    +F N I T +GG+H   FK  L +++N++  +   LK+ D+    ED  EGLTA++S+   NP++EGQTK KLGN EV+  V+  + E  +K    NPE    I+ K +   +AR+ +  ARE  RRK+  ++ +LPGKLADCS+  +E +EL+IVEGDSAGGSAK  RDR FQA+LP++GKI+NVEK+  D++  NE+I ++I A+G G+G +F   KLRY +II+MTDAD+DG+HIR LLLT  +RYM PL+E G VYIA PPL++   G+   Y Y ++ L E+K++    + +IQRYKGLGEMNP+QLWETTM+P+ R +++VTIEDA  AD++F +LMG++ + RREFIE++A  VK LDI
  S:     4 YSAESIKVLKGLEPVRMRPGMYIGSTGKRGLHHLVYEVVDNSVDEALAGYCDWIRVTLHEDGSVEVEDNGRGIPVDIHPEEGRSALEVVFTVLHAGGKFSKDSYKISGGLHGVGVSVVNALSEWLEVRVHRDGKIYRQRY----ERGKPVTPVEVIGE--TDKHGTIVRFKPDPLIFSETEFDPDILEHRLREIAFLVPGLKIEFEDRINGEKKTFKFDGGIVEYVKYLNRGKKAL-HDVIHIKRTEKVKTKNGEDE--VIVEIAFQYTDSYSEDIVSFANTIKTVDGGTHVTAFKSTLTRLMNEYGKKHNFLKK-DDSFQGEDVREGLTAVISVYVKNPEFEGQTKSKLGNEEVKEAVTKAMREELKKIFDANPELVKTILSKIMSTKQAREAAKRAREMVRRKNVLQNTTLPGKLADCSSTHREKTELFIVEGDSAGGSAKQARDREFQAVLPIRGKILNVEKSSLDRLLKNEQISDIIVAVGTGIGDDFDESKLRYGRIIIMTDADIDGAHIRTLLLTLFYRYMRPLIEQGRVYIALPPLYRIKAGREEFYVYSDQELAEYKEKLQGKRIEIQRYKGLGEMNPEQLWETTMNPETRKIIRVTIEDAEEADRLFEILMGNDPSSRREFIERHALKVKELDI 636
>gi|55821497|ref|YP_139939.1| DNA gyrase subunit B [Streptococcus thermophilus LMG 18311] >gi|55823426|ref|YP_141867.1| DNA gyrase subunit B [Streptococcus thermophilus CNRZ1066] >gi|116628216|ref|YP_820835.1| DNA gyrase subunit B [Streptococcus thermophilus LMD-9] >gi|55737482|gb|AAV61124.1| DNA gyrase B subunit [Streptococcus thermophilus LMG 18311] >gi|55739411|gb|AAV63052.1| DNA gyrase B subunit [Streptococcus thermophilus CNRZ1066] >gi|116101493|gb|ABJ66639.1| DNA gyrase subunit B [Streptococcus thermophilus LMD-9] (650 aa)
Score = 1599, Expect = 1.2e-175, Identities = 353/648 (54%), Positives = 457/648 (70%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK----KENSKV---KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK    H+ E+K G   V DL++  E    ++GT V F PD EI  E  EFD   +  R ++LA+LNKG++I+ ID+R   + ++ + + GGI  +V+ +N  K+ I    +Y   E             I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE D+ ++ +D  EGLTAI+S+KHPNPQ+EGQTK KLGNSEV    + + SE   ++LLENP  A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ + E++EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY+K+++MTDADVDG+HIR LLLT ++R+M+P+LE G VYIA PP++   VG   K        +E K     EN  V   K  +QRYKGLGEM+  QLWETTMDP+NRLL +V+++DA  ADK+F +LMGD+V PRREFIE+NA Y   LDI
  S:     7 NLEEKAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKNGHIHFQEYKRG-VVVDDLRIIGETE--EHGTTVHFIPDPEIFQETTEFDFGKLAKRFQELAFLNKGLRISIIDKREGLEQEKHYHYEGGITSYVKYINENKDVIFDEPIYTYGEMD----------GISVEVAMQYTTGYHETVMSFANNIHTHEGGTHEQGFRTALTRVINDYARQNKILKEKDDNLTGDDVREGLTAIISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEALSRFLLENPAIAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNNPEMNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGSEFDVSKARYHKLVIMTDADVDGAHIRTLLLTLIYRFMHPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEEKLRAALENYSVGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLLARVSVDDAAEADKIFDMLMGDKVEPRREFIEENAVY-STLDI 650
>gi|170760652|ref|YP_001785341.1| DNA gyrase, B subunit [Clostridium botulinum A3 str. Loch Maree] >gi|169407641|gb|ACA56052.1| DNA gyrase, B subunit [Clostridium botulinum A3 str. Loch Maree] (637 aa)
Score = 1598, Expect = 1.6e-175, Identities = 357/649 (55%), Positives = 456/649 (70%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG-GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E K+  Y  S I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G  + I + + K+ S  V DDGRG+PV  H+K KK  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS   +V V +E      +F+ G  K   D+    E     +GT + F PD EI +  EF+ DT+  RL++LA+LNKGIKI+  DER D KE F + GG++ +V  LN  KE +    +Y ++        NKD     VE+A QYN  Y  + F+F NNI+T EGG+H  GFK AL + IN +A +   LK+ D+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGNSEVR  V  +V E    +L ENP    +II+K L A  AR+ +  ARE TRRKS  ES SLPGKLADCS+KD  + E+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEK + DKI +++EI  +ITA GAG+G EF IDK+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL++    K   Y Y +  L+E   E         IQRYKGLGEMNP+QLW+TTM+P++R LL+VTIEDA+ AD++F++LMG +V PRREFIE NA  V NLDI
  S:     1 MSQENKQ-VYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGFCTHIEVFIHKDNSITVVDDGRGMPVGMHSKVKKPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEQCEVEVRREGHIWKQKFERGITKTGLDIVGDTED----HGTKIYFKPDIEIFDELEFEYDTLAQRLRELAFLNKGIKISLTDERYDKKEMFHYEGGLRSFVLYLNRNKEKLHQQPIYVDK--------NKD--GCIVEIAMQYNDGYAENIFSFANNIDTIEGGTHLAGFKSALTRAINDYARKFNYLKDIDKNLSGDDVREGLTAVISVKLTDPQFEGQTKTKLGNSEVRGIVDTIVGESIGSFLEENPNVGKIIIEKGLSASRAREAAKRARELTRRKSVLESTSLPGKLADCSSKDPSLCEIYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVEKQRLDKILASDEIRAMITAFGAGIGKEFDIDKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELIEEGHVYIAQPPLYRIFKAKKEIYVYSDPELDEALLELGGKDTNTNIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVTIEDAMAADEIFTILMGTKVEPRREFIEDNADKVVNLDI 637
>gi|27466922|ref|NP_763559.1| DNA gyrase subunit B [Staphylococcus epidermidis ATCC 12228] >gi|57865927|ref|YP_190090.1| DNA gyrase, B subunit [Staphylococcus epidermidis RP62A] >gi|38604835|sp|Q8CQK4|GYRB_STAES DNA gyrase subunit B >gi|81819302|sp|Q5HK03|GYRB_STAEQ DNA gyrase subunit B >gi|27314464|gb|AAO03601.1|AE016744_4 DNA gyrase subunit B [Staphylococcus epidermidis ATCC 12228] >gi|57636585|gb|AAW53373.1| DNA gyrase, B subunit [Staphylococcus epidermidis RP62A] (643 aa)
Score = 1598, Expect = 1.6e-175, Identities = 342/641 (53%), Positives = 459/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINF--IDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK   +  + K GT + F  D EI  E   ++ +T++ R+++LA+LNKGI+I      E    ++++ + GGIK +V+ LN  KEP+         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N +  + K++KE  +++S ED  EGLTA+VSIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP    +I++K ++A  AR  + +ARE TRRKS  + +SLPGKLADCS+K+ E SE+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G EF I K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y ++++ L++ K+E N   K+ I RYKGLGEMN DQLWETTM+P++R +L+V +EDA++AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYASHIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNGTIYHQAYKQG-VPQFDLKEIGD--TDKTGTAIRFKADKEIFTETTVYNYETLQKRIRELAFLNKGIQITLKDEREEEVREDSYHYEGGIKSYVDLLNENKEPL--------HDEPIYIHQSKD--DIEVEIALQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGTQSKIIKEDKDRLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQVVDRLFSEHFERFLYENPSVGRIIVEKGIMASRARVAAKKAREVTRRKSALDVSSLPGKLADCSSKNPEESEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVFNDRELDKLKQELNPSPKWSIARYKGLGEMNADQLWETTMNPEHRSMLQVRLEDAIDADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 642
>gi|170756292|ref|YP_001779632.1| DNA gyrase, B subunit [Clostridium botulinum B1 str. Okra] >gi|169121504|gb|ACA45340.1| DNA gyrase, B subunit [Clostridium botulinum B1 str. Okra] (637 aa)
Score = 1596, Expect = 2.6e-175, Identities = 352/649 (54%), Positives = 454/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG-GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E K+  Y  S I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G  + I + + K+ S  V DDGRG+PV  H+K KK  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS   +V V +E      +F+ G  K   D+    E     +GT + F PD EI +  EF+ DT+  RL++LA+LNKGIKI+  DER D KE F + GG++ +V  LN  KE +         ++ +    NKD     VE+A QYN  Y  + F+F NNI+T EGG+H  GFK AL ++IN +A +   LK+ D+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGN EVR  V  +V +    +L ENP    +II+K L A  AR+ +  ARE TRRKS  ES SLPGKL+DCS+KD  + E+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEK + DKI +++EI  +ITA GAG+G EF IDK+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL++    K   Y Y +  L+    E         IQRYKGLGEMNP+QLWETTMDP++R LL+VT+EDA+ AD++F++LMG +V PRR+FIE NA  V NLDI
  S:     1 MSQENKQ-VYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGFCTHIEVFIHKDNSITVVDDGRGMPVGMHSKVKKPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEQCEVEVRREGHIWKQKFERGITKTGLDIVGDTED----HGTKIYFKPDIEIFDELEFEYDTLAHRLRELAFLNKGIKISLTDERYDKKEMFHYEGGLRSFVLYLNRNKEKL--------HQQPIYVDENKD--GCIVEIAMQYNDGYAENIFSFANNIDTIEGGTHLAGFKSALTRVINDYARKFNYLKDIDKNLSGDDVREGLTAVISVKLTDPQFEGQTKTKLGNGEVRGIVDTIVGQSIGSFLEENPNVGKIIIEKGLSASRAREAAKRARELTRRKSILESTSLPGKLSDCSSKDPSLCEIYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVEKQRLDKILASDEIRAMITAFGAGIGKEFDIDKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELIEEGHVYIAQPPLYRIYKAKKETYVYSDPELDAALLELGGKDTNTNIQRYKGLGEMNPEQLWETTMDPEHRTLLQVTVEDAMEADEIFTILMGTKVEPRRDFIESNADKVVNLDI 637
>gi|125717721|ref|YP_001034854.1| DNA gyrase subunit B [Streptococcus sanguinis SK36] >gi|125497638|gb|ABN44304.1| DNA gyrase, putative [Streptococcus sanguinis SK36] (649 aa)
Score = 1595, Expect = 3.4e-175, Identities = 344/647 (53%), Positives = 459/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + + K+ S  V D+GRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY E++ G   VADL++  E  + + GT V F PD EI  E  EFD + +  R+++LA+LN+G++I+  D+R   +  + + + GGI  +V+ +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +LLENP  A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D + +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E + + +  +Y        IQRYKGLGEM+  QLWETTM+P++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     7 QDIQAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEKDNSITVVDNGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEYRRG-HVVADLEIIGE--TDRTGTTVHFTPDPEIFTETVEFDFEKLNKRVQELAFLNRGLRISITDKRDGMEQVKDYHYEGGIASYVQYINENKDVIFETPIYTDGEMD----------DITVEVAMQYTTGYHETVMSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKLLKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLLENPAVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDPQETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRYMKPVLEAGFVYIAQPPIYGVKVGSEVKEYIQPGANQEEELQAALARYSEGRSKPTIQRYKGLGEMDDHQLWETTMNPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 649
>gi|148654235|ref|YP_001274440.1| DNA gyrase, B subunit [Roseiflexus sp. RS-1] >gi|148566345|gb|ABQ88490.1| DNA gyrase subunit B [Roseiflexus sp. RS-1] (645 aa)
Score = 1595, Expect = 3.7e-175, Identities = 317/640 (49%), Positives = 437/640 (68%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVY--KEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYN-NSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF---KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y  + I++LEG+EAVR+RPGMYIG TD+ GLH MV E+VDNS+DE M G A+ + +T+ ++GS  V DDG GIP   H K   ST++ V+TVLHAGGKFDN SYKVS GLHGVG S VNALS++++V V+  ++   ++ E++ G   V   +V     + + GTI  F PD  I++  +++  T+  R +++AYLNKG++  F+DER  ++  F F GGI+ +V  LN ++  +     Y ER             ++ VEVA QY ++++ +S + F N IN T+GG+H  GF+ AL ++IN +A  K LLKE +  ++ +D  EGLTA++S+K  +PQ+  QTK KL +      V+ V  + F  +L ENP++A  II+KC+ A   R    + RE T RKS  E  SLPGKLADCS  +   +EL+IVEGDSAGGSAK GRDR +QAILPL+GKI+NVEK++ DK+ SN E+  LITAIGAGVG +F   KLRY++IILM DADVDGSHIR LLLTF FRYM  ++ NG++Y+A PPL++   GK+ KY + +   +++      + + K  I RYKGLGEMN  QLWETTM+P NRLLL+VT+EDA  AD+ F++LMGD V PR+ FI+ +A  V+NLDI
  S:    14 YDENQIQVLEGMEAVRRRPGMYIGPTDVNGLHTMVREVVDNSVDEVMAGRATTVEVTIHRDGSVTVADDGYGIPTGPHPKLGVSTLQVVMTVLHAGGKFDNKSYKVSSGLHGVGVSAVNALSAYMRVDVHNARDGMHYFQEYRCG---VPQCEVQKVGPTTRRGTITRFLPDTTIIQTLDYNFKTLAQRFREMAYLNKGLRFKFVDERDGNEVNFYFEGGIRSYVRHLNKDRNVLHKQPFYVERIVD----------DVMVEVALQYTESFDTDSVYAFANGINNTDGGAHVAGFRSALTRVINAYARSKGLLKENEGNLTGDDVREGLTAVISVKLRDPQFSSQTKEKLVSPAASGAVNTVFGDAFSAWLEENPQEARRIIEKCIAAARTRIAVQKVRE-TARKSAMEGFSLPGKLADCSDTNPARTELFIVEGDSAGGSAKQGRDRRYQAILPLRGKILNVEKSRLDKMLSNNEVKALITAIGAGVGDQFDPAKLRYHRIILMCDADVDGSHIRTLLLTFFFRYMRQIITNGHLYLAQPPLYRIVHGKTEKYVFTDAERDQYLATLSSSERNKATITRYKGLGEMNAAQLWETTMNPLNRLLLQVTLEDAQQADETFTMLMGDLVPPRKRFIQTHALEVRNLDI 645
>gi|170287901|ref|YP_001738139.1| DNA gyrase, B subunit [Thermotoga sp. RQ2] >gi|170175404|gb|ACB08456.1| DNA gyrase, B subunit [Thermotoga sp. RQ2] (636 aa)
Score = 1595, Expect = 3.7e-175, Identities = 321/640 (50%), Positives = 452/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           YSA +IK+L+GLE VR RPGMYIGST  +GLHH+V+E+VDNS+DE + G    I +TL ++GS +V+D+GRGIPV+ H +  +S +E V TVLHAGGKF  DSYK+SGGLHGVG SVVNALS WL+V V+++   Y++ Y    + GKPV  ++V  E  + K+GTIV F PD  I    EFD D ++ RL+++A+L  G+KI F D    +K+TF F GGI ++V+ LN  K+ +   +++ +R E VK  N +D+  + VE+AFQY  +Y+    +F N I T +GG+H   FK  L +++N++  +   LK+ D+    ED  EGLTA++S+   NP++EGQTK KLGN EV+  V+  + E  +K    NPE    I+ K +   +AR+ +  ARE  RRK+  ++ +LPGKLADCS+  +E +EL+IVEGDSAGGSAK  RDR FQA+LP++GKI+NVEK+  D++  NE+I ++I A+G G+G +F   KLRY +II+MTDAD+DG+HIR LLLT  +RYM PL+E G VYIA PPL++   G+   Y Y ++ L E+K++    + +IQRYKGLGEMNP+QLWETTM+P+ R +++VTIEDA  AD++F +LMG++ + RREFIE++A  VK LDI
  S:     4 YSAESIKVLKGLEPVRMRPGMYIGSTGKRGLHHLVYEVVDNSVDEVLAGYCDWIRVTLHEDGSVEVEDNGRGIPVDIHPEEGRSALEVVFTVLHAGGKFSKDSYKISGGLHGVGVSVVNALSEWLEVRVHRDGKIYRQRY----ERGKPVTPVEVIGE--TDKHGTIVRFKPDPLIFSETEFDPDILEHRLREIAFLVPGLKIEFEDRINGEKKTFKFDGGIVEYVKYLNRGKKAL-HDVIHIKRTEKVKTKNGEDE--VIVEIAFQYTDSYSEDIVSFANTIKTVDGGTHVTAFKSTLTRLMNEYGKKHNFLKK-DDSFQGEDVREGLTAVISVYVKNPEFEGQTKSKLGNEEVKEAVTKAMREELKKIFDANPELVKTILSKIMSTKQAREAAKRAREMVRRKNVLQNTTLPGKLADCSSTHREKTELFIVEGDSAGGSAKQARDREFQAVLPIRGKILNVEKSSLDRLLKNEQISDIIVAVGTGIGDDFDESKLRYGRIIIMTDADIDGAHIRTLLLTLFYRYMRPLIEQGRVYIALPPLYRIKAGREEFYVYSDQELAEYKEKLQGKRIEIQRYKGLGEMNPEQLWETTMNPETRKIIRVTIEDAEEADRLFEILMGNDPSSRREFIERHALKVKELDI 636
>gi|116511733|ref|YP_808949.1| DNA gyrase subunit B [Lactococcus lactis subsp. cremoris SK11] >gi|125624430|ref|YP_001032913.1| DNA gyrase subunit B [Lactococcus lactis subsp. cremoris MG1363] >gi|116107387|gb|ABJ72527.1| DNA gyrase subunit B [Lactococcus lactis subsp. cremoris SK11] >gi|124493238|emb|CAL98205.1| topoisomerase IV subunit B [Lactococcus lactis subsp. cremoris MG1363] (651 aa)
Score = 1594, Expect = 3.9e-175, Identities = 345/643 (53%), Positives = 460/643 (71%)
  Q:     1 MNKETKK-----NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET---FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKY-----AYDEKTLEE--FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           MN+E K      + Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K+ ++++ E+  G     DLK+  E  +   GT V F PD EI  E  EFD D + +R+++LA+LN+G++I+  D+R  +++    F + GGI+ +VE LN  K  I    ++ E E             I VEVA QY  TY++   +F NNINT EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ +D  EGLTA++S+KHPNPQ+EGQTK KLGNSEV   V+ + +E    ++LENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ + E +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G ++ + K RY+K+++MTDADVDG+HIR LLLT  +RYM P++E G VYIA PP++   VG  +K         EK L+E   +    + K  +QRYKGLGEM+  QLWETTMDP++RL+ +V++EDA  ADK+F +LMGD V PRREFIE NA+Y
  S:     1 MNEENKNLEMLADEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIEVFIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTTLDVTVHKDGQKYFQEYHRG-LVRDDLKIIGE--TDLRGTTVHFVPDPEIFTETVEFDFDKLATRVRELAFLNRGLRISLTDKREGNEKNEVHFHYEGGIQSYVEYLNENKTVIFEPAIFTEGEMD----------GIAVEVAMQYTDTYHSVVMSFANNINTHEGGTHEQGFRTALTRVINNYAKQNKILKENEDNLTGDDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVTGIVNKLFAEALTTFMLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNNPEQTELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGGDYDLSKARYHKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGIKVGSETKEYIQPGENQEKDLQEALARWAQGRTKPTVQRYKGLGEMDDHQLWETTMDPEHRLMARVSVEDAAEADKIFDMLMGDRVEPRREFIENNAQY 646
>gi|22536796|ref|NP_687647.1| DNA gyrase subunit B [Streptococcus agalactiae 2603V/R] >gi|25010667|ref|NP_735062.1| DNA gyrase subunit B [Streptococcus agalactiae NEM316] >gi|161486746|ref|YP_329336.2| DNA gyrase subunit B [Streptococcus agalactiae A909] >gi|22533641|gb|AAM99519.1|AE014219_11 DNA gyrase, B subunit [Streptococcus agalactiae 2603V/R] >gi|23095021|emb|CAD46247.1| DNA gyrase, subunit B [Streptococcus agalactiae NEM316] (650 aa)
Score = 1594, Expect = 4.0e-175, Identities = 349/648 (53%), Positives = 461/648 (71%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTL---EEFKK-----ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N E +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A  I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  K HY E++ G   V DL++  +  +  +GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   + ++ + + GGI  +VE +N  KE I    +Y + E             I VEVA QY   Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F ++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ + E++EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K+RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K AY +  +   EE ++      + + K  +QRYKGLGEM+  QLWETTMDP+NRL+ +V+++DA  ADK+F +LMGD V PRREFIE NA Y  NLDI
  S:     7 NMEQRAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFAGHIKVYIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKNGKVHYQEYQRG-VVVNDLEIIGD--TDLSGTTVHFTPDPEIFTETTVFDFDKLAKRIQELAFLNRGLRISISDKREGQEVEKEYHYEGGIGSYVEFINENKEVIFENPIYTDGELD----------GISVEVAMQYTTGYQETVMSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFNRFLLENPQVAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNNAEMNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKVRYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIK-AYIQPGVNQEEELRQALDTYSSGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEANAVY-SNLDI 650
>gi|168181121|ref|ZP_02615785.1| DNA gyrase, B subunit [Clostridium botulinum NCTC 2916] >gi|182668169|gb|EDT80148.1| DNA gyrase, B subunit [Clostridium botulinum NCTC 2916] (637 aa)
Score = 1594, Expect = 4.6e-175, Identities = 352/649 (54%), Positives = 454/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG-GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E K+  Y  S I++LEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G  + I + + K+ S  V DDGRG+PV  H+K KK  VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS   +V V +E      +F+ G  K   D+    E     +GT + F PD EI +  EF+ DT+  RL++LA+LNKGIKI+  DER D KE F + GG++ +V  LN  KE +         ++ +    NKD     VE+A QYN  Y  + F+F NNI+T EGG+H  GFK AL ++IN +A +   LK+ D+ +S +D  EGLTA++S+K  +PQ+EGQTK KLGN EVR  V  +V +    +L ENP    +II+K L A  AR+ +  ARE TRRKS  ES SLPGKL+DCS+KD  + E+Y+VEGDSAGGSAK GR+R FQAILPLKGKI+NVEK + DKI +++EI  +ITA GAG+G EF IDK+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPL++    K   Y Y +  L+    E         IQRYKGLGEMNP+QLWETTMDP++R LL+VT+EDA+ AD++F++LMG +V PRR+FIE NA  V NLDI
  S:     1 MSQENKQ-VYDESQIQVLEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGFCTHIEVFIHKDNSITVVDDGRGMPVGMHSKVKKPAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEQCEVEVRREGHIWKQKFERGITKTGLDIVGDTED----HGTKIYFKPDIEIFDELEFEYDTLAHRLRELAFLNKGIKISLTDERYDKKEMFHYEGGLRSFVLYLNRNKEKL--------HQQPIYVDENKD--GCIVEIAMQYNDGYAENIFSFANNIDTIEGGTHLAGFKSALTRVINDYARKFNYLKDIDKNLSGDDVREGLTAVISVKLTDPQFEGQTKTKLGNGEVRGIVDTIVGQSIGSFLEENPNVGKIIIEKGLSASRAREAAKRARELTRRKSILESTSLPGKLSDCSSKDPSLCEIYLVEGDSAGGSAKQGRNREFQAILPLKGKIMNVEKQRLDKILASDEIRAMITAFGAGIGKEFDIDKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELIEEGHVYIAQPPLYRIYKAKKEIYVYSDPELDAALLELGGKDTNTNIQRYKGLGEMNPEQLWETTMDPEHRTLLQVTVEDAMEADEIFTILMGTKVEPRRDFIESNADKVVNLDI 637
>gi|104773262|ref|YP_618242.1| DNA gyrase, subunit B [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422343|emb|CAI96851.1| DNA gyrase, subunit B [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (653 aa)
Score = 1593, Expect = 5.4e-175, Identities = 351/645 (54%), Positives = 458/645 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFL--FAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYN-IRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           E + + Y+AS I++L GLEAVRKRPGMYIGST  +GLHH+VWEI+DN IDEA+ G A++I +T+ ++ S  VQDDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K++YI F D G+ V +LK        ++GTIV F+PD  I  E   FD   +K+R+++LA+LNKG+K+ F D+R D  ET++  F GGIK++V  LN  +E +    +Y E            KY  I VEV+ QY   Y  +  TF NNI+T EGG HE GFK AL ++IN +A + K+LKE D+ +S ED  EG+TA++S+KHP+PQ+EGQTK KLGNS+ R  V    SE F  +L+ENP+ A  I++K  LA  AR  +  ARE TR+KS  E  +LPGKLAD ++ D  ISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +N+EI  L TA+GAG G +F + K RY+K+I+MTDADVDG+HIR LLLT  +RYM P+++ G VYIA PPL++   GK  KY   ++ L ++        K  +QRYKGLGEM+ +QLWETTMDP+NR L +V  E A +AD+VF +LMG+EV PRR+FIE NA+YV+NLD
  S:    15 EQEADKYNASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFATKIEVTVNEDNSVTVQDDGRGIPVDIEKKTGRPAVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLNVTVMRDGKKYYIAF-DHGRVVEELKEVGTVPLTEHGTIVHFWPDPNIFTETTVFDDKILKNRIRELAFLNKGLKLTFTDKRNDTAETYVYHFEGGIKEYVSFLNRGQEVLFDEPIYVE-----------GKYEGIDVEVSLQYTTGYKTTLMTFANNIHTYEGGMHEAGFKTALTRVINDYAHKAKILKENDDNLSGEDIREGMTAVISVKHPSPQFEGQTKTKLGNSDARTAVDRAFSETFSTFLMENPQVARKIVEKGQLAERARVAAKRAREVTRKKSGLEIANLPGKLADNTSNDPNISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANQEIRTLFTALGAGFGADFDVSKARYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPMIDKGYVYIARPPLYQVRQGKLIKYLDTDEELHDYLGSLQPSPKPIVQRYKGLGEMDAEQLWETTMDPENRRLDRVDPEYAKDADEVFEMLMGNEVGPRRKFIEDNAQYVENLD 652
>gi|76562223|gb|ABA44807.1| DNA gyrase, B subunit [Streptococcus agalactiae A909] (643 aa)
Score = 1593, Expect = 6.0e-175, Identities = 348/646 (53%), Positives = 460/646 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTL---EEFKK-----ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A  I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  K HY E++ G   V DL++  +  +  +GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   + ++ + + GGI  +VE +N  KE I    +Y + E             I VEVA QY   Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F ++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ + E++EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K+RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K AY +  +   EE ++      + + K  +QRYKGLGEM+  QLWETTMDP+NRL+ +V+++DA  ADK+F +LMGD V PRREFIE NA Y  NLDI
  S:     2 EQRAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFAGHIKVYIEPDNSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVKVYKNGKVHYQEYQRG-VVVNDLEIIGD--TDLSGTTVHFTPDPEIFTETTVFDFDKLAKRIQELAFLNRGLRISISDKREGQEVEKEYHYEGGIGSYVEFINENKEVIFENPIYTDGELD----------GISVEVAMQYTTGYQETVMSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFNRFLLENPQVAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNNAEMNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKVRYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIK-AYIQPGVNQEEELRQALDTYSSGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEANAVY-SNLDI 643
>gi|195977899|ref|YP_002123143.1| DNA gyrase subunit B GyrB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974604|gb|ACG62130.1| DNA gyrase subunit B GyrB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (650 aa)
Score = 1592, Expect = 6.9e-175, Identities = 349/646 (54%), Positives = 453/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKY-----AYDEKTLEEFKKENS--KVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK    HY EF+ G   V DL +          T V F PD EI  E  EFD   +  R+++LA+LN+G+KI+  D+R   + +E F + GGI  +V  LN++K+ I  T +Y + E             I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE  +++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + + RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K         E+ L+   + +S  + +  IQRYKGLGEM+  QLWETTMDP NRL+ +VT++DA  AD++F +LMGD V PRREFIE+NA Y   LDI
  S:     9 EDKAQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEADNSITVIDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGHIHYQEFRRGAV-VDDLAIIGTTDVTG--TTVHFTPDPEIFTETTEFDYQVLAKRIQELAFLNRGLKISITDKRAGLEREEHFHYEGGIGSYVAFLNDKKDVIFDTPIYSDGELE----------GITVEVAMQYTTGYHETVMSFANNIHTHEGGTHEQGFRTALTRVINDYAKKAKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEALQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDASQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSRARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGVNQEEELKAALERHSTGRSRPTIQRYKGLGEMDDHQLWETTMDPDNRLMARVTVDDAAEADRIFDMLMGDRVEPRREFIEENAVY-STLDI 650
>gi|191636829|ref|YP_001985995.1| DNA gyrase, B subunit [Lactobacillus casei] >gi|190711131|emb|CAQ65137.1| DNA gyrase, B subunit [Lactobacillus casei BL23] (653 aa)
Score = 1591, Expect = 9.5e-175, Identities = 342/639 (53%), Positives = 453/639 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYV--KNLD 648
           Y AS I++L GLEAVRKRPGMYIGST  +GLHH+VWEI+DN IDEA+ G A+ I + +  + S  V DDGRGIPV+  +KT +  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V +  K +YI+F  G K    +KV       ++GT V F PD +I  E   FD   + +R+++LA+LNKG+K+ F D+R  T +K  F + GG+K +V+ L  +KE ++   +Y E ++            I VEVA QY   Y+++  TF NNI+T EGG+HE GFK AL ++IN +A     LK++D+ +S +D  EGLTA+VS+KHP+PQ+EGQTK KLGNS+ R  V    S+ F K+L+E+P D  +II K +LA +AR  +  ARE TR+KS  E ++LPGKLAD ++KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  ++I +NEEI  L TA+G G G +F I+K RY+K+I+MTDADVDG+HIR LLLT ++RYM P+L+ G VYIA PPL++   GK ++Y   ++ L++   +     K +IQRYKGLGEM+ +QLWETTMDP NR LL+V+ +DA  AD VF +LMGD V PRR+FIE NA +V   N+D
  S:    19 YDASQIQVLSGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFATRIEVEVNPDNSVTVTDDGRGIPVDIQSKTGRPALETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDLDVTVTRGGKRYYIDFIRG-KVNTPMKVIGTAPEHEHGTKVHFLPDPDIFTEIRTFDDKILTTRIRELAFLNKGLKLTFTDKRAATHEKLVFHYEGGLKSYVDFLTEKKENLLQEPIYVEGQDK----------GITVEVALQYTNDYHSTLLTFANNIHTYEGGTHETGFKTALTRVINDYARRSGALKDSDDPLSGDDVREGLTAVVSVKHPDPQFEGQTKTKLGNSDARTVVDRTFSDHFNKFLMEHPADGKLIIDKAMLASKARLAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKASMERILANEEIRTLFTAMGTGFGQDFDINKARYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPVLDAGYVYIAQPPLYRLRQGKMTQYIDSDEELQDILGQLPPSPKPEIQRYKGLGEMDANQLWETTMDPDNRRLLRVSPKDAEAADGVFEMLMGDHVEPRRKFIEDNAVFVDPNNID 652
>gi|24753767|gb|AAN64015.1|AF434658_12 DNA gyrase subunit B [Leptospira interrogans] (639 aa)
Score = 1591, Expect = 9.9e-175, Identities = 336/644 (52%), Positives = 451/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD----KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKF-AVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGP-EFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ +YSA  IKILEGLEAVRKRPGMYIG+ D  GLH MV+E+VDNS+DEAM G+ +EI I++  +   +V+D+GRGIPV+ H   K ST+E V+T+LHAGGKF+ND+YKVSGGLHGVG SVVNALS +L+V V+++ K  Y +  + G PV+ +++  +  S + GTIV F PD  I    +F  D + +R ++LA+LNKG+ +   D R       +  F F+GGI  +VE +N  K P+   I ++  ++ V A           E++ QY++TY  + F F NNIN   GG+H EGF+ AL + +N F   +  L K+    +S ED  EGLTA++SIK P PQ+  QTK KL N+E++  +  + SE    +  ENP     I++KC+L+ +AR+ + +AR+ TRRK+  E   LPGKLADCS KD   SELY+VEGDSAGGSAK GRDR  QAILPLKGKI+NVEKA+ DKI S+EEI  L++A+G G+G  EF IDK+RY+KI++MTDAD+DGSHIR LLLTF FRYM P++E G +Y+A PPL+    GK+S Y Y +K  EE  K     K  IQRYKGLGEMNP+QLWETTMDP NR++LKV ++D + A++ F++LMGDEV PR++FIE NA  V NLD+
  S:     4 EETSYSAGQIKILEGLEAVRKRPGMYIGTQDETGLHKMVYEVVDNSVDEAMAGHCTEIKISILPDNIVEVKDNGRGIPVDIHPDKKISTIEVVMTILHAGGKFENDAYKVSGGLHGVGVSVVNALSEYLEVEVHQKGKV-YTQKYERGIPVSSVQIQGD--SSERGTIVRFKPDATIFTTVDFQFDVLSARFRELAFLNKGLVLVVEDHRRGKENILRNEFQFSGGIVSFVEHINENKHPMHKVIHFERNKDDVLA-----------EISIQYSETYTENIFCFTNNINNNLGGTHLEGFRAALTRTLNDFLKKDSTLSKKHPTGLSGEDVKEGLTAVISIKIPQPQFNSQTKEKLVNAEIKGIMQTLSSEGLTLFFEENPNITKKILEKCILSAKAREAARKARDLTRRKTVLEGGGLPGKLADCSEKDPAHSELYLVEGDSAGGSAKQGRDRNTQAILPLKGKILNVEKARLDKILSSEEIRVLVSALGTGIGEDEFNIDKIRYHKIMIMTDADIDGSHIRTLLLTFFFRYMRPVIERGYLYVAQPPLYLIKHGKNSTYVYSDKEKEELLKNIGAEKVVIQRYKGLGEMNPEQLWETTMDPSNRVVLKVKLDDFVEAEETFNILMGDEVQPRKQFIEVNAAKVANLDL 639
>gi|33862190|ref|NP_893751.1| DNA gyrase subunit B [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33634408|emb|CAE20093.1| DNA gyrase, subunit B [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (655 aa)
Score = 1590, Expect = 1.1e-174, Identities = 329/642 (51%), Positives = 449/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+   I I L ++GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W+ V V ++  E    F+ G           +K   + GT + F PD  I  +  +FD   + SRL++LAYLN G+KI F DER +       +E +L+ GGIK++VE +N EKE I   ++Y + +          K N+ VE A Q+ +  Y+++   F NNI T +GG+H +G K  L +  N  A ++   KE D+ +S E+  EGLT ++S+K P P++EGQTK KLGN+EVR  V +++ E   KY+  NP   ++I++K + +  A + +  AR+  RRKS  ES++LPGKLADCS++D   +E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF ++ LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+ KY Y+E    +T+E+F     K  Y IQR+KGLGEM P QLW+TTM+P+ R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++    NLD+
  S:    12 NDYGADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDHIEIVLKEDGSALISDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVHVTVSRDGYEFNQRFEKGIAKGELKSQKQQKKPFRKGTTICFKPDTSIFTDGIKFDYALLSSRLRELAYLNGGVKIIFRDERQNLSDGSFKEEIYLYDGGIKEYVEYINKEKESIHSEVIYVDSQ----------KDNVYVEAALQWCSDVYSDNILGFANNIRTIDGGTHIDGLKTVLTRTFNAIAKKRGKRKEVDKNLSGENIREGLTVVLSVKVPEPEFEGQTKTKLGNTEVRGIVDSLIGESLIKYMEFNPNVFDLILEKAIQSFNAAEAAKRARDLVRRKSVLESSTLPGKLADCSSRDPSGAEIYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQSLITALGLGIKGEEFNVNSLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRDLVEKGFIYIACPPLYKVERGKNHKYCYNENQLKQTIEDF---GEKANYNIQRFKGLGEMMPKQLWDTTMNPQTRMMKRVEIEDALEADRIFNILMGDKVAPRREFIETHS---ANLDM 650
>gi|163812391|ref|ZP_02204064.1| DNA gyrase, B subunit [Dehalococcoides sp. VS] >gi|157403957|gb|EDO70004.1| DNA gyrase, B subunit [Dehalococcoides sp. VS] (642 aa)
Score = 1590, Expect = 1.2e-174, Identities = 319/640 (49%), Positives = 443/640 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG--GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y+AS+I++LEGL AVRKRPGMYIGSTD +GLHH+V+EIV NS+DEAM G    I + + K+GS  V+D+GRGIPV+ H  TK S +ETV+TVLHAG KF   +Y+VSGGLHGVGASVVNAL+ W  V V +  K +   ++ G    P+ ++ V++      +GT   F  D +I    E+D + +  RL+++AYLNKG+++   DE++D + T+ F GGI  +V  LN  +E      +Y  ++            +  +EVA QYN  Y++ST TF N +NT +GG+H  GF+ AL +  N +A + K LK+TD  +  +D  EG+ AIVS+K P PQ+EGQTK KLGN E++ FV + V+E    YL E+P+D   I++KC+ A +AR+ + +AR+   RKS  ++ +LPGKLADCS +D  + EL++VEGDSAGGSAK GR+R FQAILPL+GKI+NVEKA  DK+ ++EEI  +ITA+ AG+  +F   KLRYN+++LMTDADVDGSHIR LLLTF FR+M  L+   +++IA PPL+K  +G +  + Y++   E    +    K  IQRYKGLGEM+ +QLW TTMDP +R LL+V +EDA  AD++F+LLMG EVAPR+ FI+ +++ VKNLDI
  S:    16 YTASDIQVLEGLAAVRKRPGMYIGSTDQRGLHHLVYEIVYNSVDEAMAGVCDRIKVIMFKDGSVSVEDNGRGIPVDIHPVTKISALETVMTVLHAGAKFGGKTYQVSGGLHGVGASVVNALAEWTTVKVRRNGKIYQQSYQRGKPSTPLEEIGVSD-----GSGTTTIFKADSQIFSTTEYDFEILTDRLREIAYLNKGLEVYIYDEQSDQERTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSD----------STILEVAIQYNDGYSDSTLTFANCVNTIDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSVKLPEPQFEGQTKGKLGNIEIKSFVESAVAEQLSLYLEEHPDDTKRILEKCITAAKAREAARKARDLIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQAILPLRGKILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPAKLRYNRLVLMTDADVDGSHIRTLLLTFFFRHMPRLITESHLFIAQPPLYKIKIGSTEHWVYNDAEKETLLSQTKSTKVDIQRYKGLGEMSAEQLWRTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVAPRKAFIQSHSRTVKNLDI 642
>gi|116493579|ref|YP_805313.1| DNA gyrase, B subunit [Lactobacillus casei ATCC 334] >gi|116103729|gb|ABJ68871.1| DNA gyrase subunit B [Lactobacillus casei ATCC 334] (653 aa)
Score = 1590, Expect = 1.2e-174, Identities = 342/639 (53%), Positives = 453/639 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYV--KNLD 648
           Y AS I++L GLEAVRKRPGMYIGST  +GLHH+VWEI+DN IDEA+ G A+ I + +  + S  V DDGRGIPV+  +KT +  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V +  K +YI+F  G K    +KV       ++GT V F PD +I  E   FD   + +R+++LA+LNKG+K+ F D+R  T +K  F + GG+K +V+ L  +KE ++   +Y E ++            I VEVA QY   Y+++  TF NNI+T EGG+HE GFK AL ++IN +A     LK++D+ +S +D  EGLTA+VS+KHP+PQ+EGQTK KLGNS+ R  V    S+ F K+L+E+P D  +II K +LA +AR  +  ARE TR+KS  E ++LPGKLAD ++KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  ++I +NEEI  L TA+G G G +F I+K RY+K+I+MTDADVDG+HIR LLLT ++RYM P+L+ G VYIA PPL++   GK ++Y   ++ L++   +     K +IQRYKGLGEM+ +QLWETTMDP NR LL+V+ +DA  AD VF +LMGD V PRR+FIE NA +V   N+D
  S:    19 YDASQIQVLSGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFATRIEVEVNPDNSVTVTDDGRGIPVDIQSKTGRPALETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDLDVTVTRGGKRYYIDFIRG-KVNMPMKVIGTAPEHEHGTKVHFLPDPDIFTEIRTFDDKILTTRIRELAFLNKGLKLTFTDKRAATHEKLVFHYEGGLKSYVDFLTEKKENLLQEPIYVEGQDK----------GITVEVALQYTNDYHSTLLTFANNIHTYEGGTHETGFKTALTRVINDYARRSGALKDSDDPLSGDDVREGLTAVVSVKHPDPQFEGQTKTKLGNSDARTVVDRTFSDHFNKFLMEHPADGKLIIDKAMLASKARLAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKASMERILANEEIRTLFTAMGTGFGQDFDINKARYHKLIIMTDADVDGAHIRTLLLTLIYRYMRPVLDAGYVYIAQPPLYRLRQGKMTQYIDSDEELQDILGQLPPSPKPEIQRYKGLGEMDANQLWETTMDPDNRRLLRVSPKDAEAADGVFEMLMGDHVEPRRKFIEDNAVFVDPNNID 652
>gi|189502463|ref|YP_001958180.1| hypothetical protein Aasi_1109 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497904|gb|ACE06451.1| hypothetical protein Aasi_1109 [Candidatus Amoebophilus asiaticus 5a2] (651 aa)
Score = 1589, Expect = 1.6e-174, Identities = 325/643 (50%), Positives = 439/643 (68%)
  Q:     3 KETKK--NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK--PVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE------TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK----TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           +ET+K  NTYSA +I++LEGLEAVRKRP MYIG    KGLHH+VWE+VDNSIDEA+ G  + I + +  + S  V D+GRGIP + HAK K+S +E V+TVLHAGGKFD  +YKVSGGLHGVG S VNALS+ L+  VY++ K +  E+  G    PV ++  T  +     GT + F PD  I     ++  TI +RL +LAYLN G+ I   D R  D+E      TF   GG+ ++V  L++ +E ++P  +Y E E          KY++ V+VA  YN  +  +  ++ NNINT EGG+H  GF+ AL + +  +A +  LL++   +I  +D  EGLTA++S+K   PQ+EGQTK KLGN+EV   V + VSE  + YL E+P++A +I+ K +LA +AR  + +ARE  +RK+      LPGKLADCS  D    ELY+VEGDSAGG+AK GRDR FQAILPL+GKI+NVEKA+  +I+ NE++ N+I A+G   G E       ++KLRY+K+I+MTDADVDGSHIR L+LTF +RY+  LLE G +YIA PPL+    G  S+Y + E+     +++F  +       IQRYKGLGEMN +QLW TTMDP  R L +VTIE A  AD +FS+LMGDEVAPRR+FI+ +AKY +
  S:     2 EETQKLQNTYSADSIQVLEGLEAVRKRPAMYIGDIGPKGLHHLVWEVVDNSIDEALAGYCTTIKVQIHSDNSITVSDNGRGIPTDIHAKEKRSALEVVMTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSTHLQATVYRDGKIYQQEYAKGAPLYPVKEVGTTTLR-----GTTIHFQPDDSIFTTTTYNYSTIAARLGELAYLNAGLTIELTDLREQDQEGNFLQETFHSEGGLAEFVAYLDDAREKLIPQPIYMEGE----------KYDVPVQVALSYNTGFTENVVSYVNNINTIEGGTHVAGFRRALTRTLKSYAEKSNLLEKAKVEIVGDDFREGLTAVISVKVSEPQFEGQTKTKLGNAEVVGAVDSCVSETLQNYLEEHPQEAKIIVSKVILAAQARHAARKAREMVQRKNVLTGGGLPGKLADCSDNDPAACELYLVEGDSAGGTAKQGRDRRFQAILPLRGKILNVEKAQEHRIYDNEQLRNMIMALGITFGTEEDAKAVNLEKLRYHKVIIMTDADVDGSHIRTLILTFFYRYLKVLLERGFLYIALPPLYLVKRGSESRYCWTEQDRIAAVKDFSPDGKTESVNIQRYKGLGEMNAEQLWTTTMDPAVRSLKQVTIESAAEADHLFSILMGDEVAPRRDFIQLHAKYAQ 648
>gi|24212705|ref|NP_710186.1| DNA gyrase subunit B [Leptospira interrogans serovar Lai str. 56601] >gi|45655919|ref|YP_000005.1| DNA gyrase subunit B [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24193336|gb|AAN47204.1|AE011192_5 DNA gyrase subunit B [Leptospira interrogans serovar Lai str. 56601] >gi|45599152|gb|AAS68642.1| DNA gyrase subunit B [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (639 aa)
Score = 1589, Expect = 1.6e-174, Identities = 336/644 (52%), Positives = 451/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD----KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKF-AVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGP-EFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ +YSA  IKILEGLEAVRKRPGMYIG+ D  GLH MV+E+VDNS+DEAM G+ +EI I++  +   +V+D+GRGIPV+ H   K ST+E V+T+LHAGGKF+ND+YKVSGGLHGVG SVVNALS +L+V V+++ K  Y +  + G PV+ +++  +  S + GTIV F PD  I    +F  D + +R ++LA+LNKG+ +   D R       +  F F+GGI  +VE +N  K P+   I ++  ++ V A           E++ QY++TY  + F F NNIN   GG+H EGF+ AL + +N F   +  L K+    +S ED  EGLTA++SIK P PQ+  QTK KL N+E++  +  + SE    +  ENP     I++KC+L+ +AR+ + +AR+ TRRK+  E   LPGKLADCS KD   SELY+VEGDSAGGSAK GRDR  QAILPLKGKI+NVEKA+ DKI S+EEI  L++A+G G+G  EF IDK+RY+KI++MTDAD+DGSHIR LLLTF FRYM P++E G +Y+A PPL+    GK+S Y Y +K  EE  K     K  IQRYKGLGEMNP+QLWETTMDP NR++LKV ++D + A++ F++LMGDEV PR++FIE NA  V NLD+
  S:     4 EETSYSAGQIKILEGLEAVRKRPGMYIGTQDETGLHKMVYEVVDNSVDEAMAGHCTEIKISILPDNIVEVKDNGRGIPVDIHPDKKISTIEVVMTILHAGGKFENDAYKVSGGLHGVGVSVVNALSEYLEVEVHQKGKV-YTQKYEKGVPVSSVQIQGD--SSERGTIVRFKPDATIFTTVDFQFDVLSARFRELAFLNKGLVLVVEDHRRGKENILRNEFQFSGGIVSFVEHINENKHPMHKVIHFERNKDDVLA-----------EISIQYSETYTENIFCFTNNINNNLGGTHLEGFRAALTRTLNDFLKKDSTLSKKHPTGLSGEDVKEGLTAVISIKIPQPQFNSQTKEKLVNAEIKGIMQTLSSEGLTLFFEENPNITKKILEKCILSAKAREAARKARDLTRRKTVLEGGGLPGKLADCSEKDPAHSELYLVEGDSAGGSAKQGRDRNTQAILPLKGKILNVEKARLDKILSSEEIRVLVSALGTGIGEDEFNIDKIRYHKIMIMTDADIDGSHIRTLLLTFFFRYMRPVIERGYLYVAQPPLYLIKHGKNSTYVYSDKEKEELLKNIGAEKVVIQRYKGLGEMNPEQLWETTMDPSNRVVLKVKLDDFVEAEETFNVLMGDEVQPRKQFIEVNAAKVANLDL 639
>gi|73916266|gb|AAZ93001.1| DNA gyrase subunit B [Streptococcus pneumoniae] (648 aa)
Score = 1589, Expect = 1.8e-174, Identities = 348/647 (53%), Positives = 458/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL+V  +  + + GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A +I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFTPDPEIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKLIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|168484465|ref|ZP_02709417.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC1873-00] >gi|73916352|gb|AAZ93044.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|172042299|gb|EDT50345.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC1873-00] (648 aa)
Score = 1588, Expect = 1.9e-174, Identities = 348/647 (53%), Positives = 458/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V+V+K  K HY E++ G   VADL+V  +  + + GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVYVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFTPDPEIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|57233676|ref|YP_180759.1| DNA gyrase, B subunit [Dehalococcoides ethenogenes 195] >gi|57224124|gb|AAW39181.1| DNA gyrase, B subunit [Dehalococcoides ethenogenes 195] (642 aa)
Score = 1588, Expect = 2.4e-174, Identities = 322/640 (50%), Positives = 443/640 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y+AS+I++LEGL AVRKRPGMYIGSTD +GLHH+V+EIV NS+DEAM G    I + + K+GS  V+D+GRGIP++ H  TK S +ETV+TVLHAG KF   +Y+VSGGLHGVGASVVNAL+ W  V V +  K +   ++ G KP   L+      S  +GT   F  D +I    E+D +T+  RL+++AYLNKG+++   DE++D + T+ F GGI  +V  LN  +E      +Y  ++            +  +EVA QYN  Y++ST TF N +NT +GG+H  GF+ AL +  N +A + K LK+TD  +  +D  EG+ AIVS+K P PQ+EGQTK KLGN E++ FV + V+E    YL E+P+D   I++KC+ A +AR+ + +AR+   RKS  ++ +LPGKLADCS +D  + EL++VEGDSAGGSAK GR+R FQAILPL+GKI+NVEKA  DK+ ++EEI  +ITA+ AG+  +F   KLRYN+++LMTDADVDGSHIR LLLTF FR+M  L+   +++IA PPL+K  +G +  + Y++   E    +    K  IQRYKGLGEM+ +QLW+TTMDP +R LL+V +EDA  AD++F+LLMG EVAPR+ FI+ ++K VKNLDI
  S:    16 YNASDIQVLEGLAAVRKRPGMYIGSTDQRGLHHLVYEIVYNSVDEAMAGVCDRIKVIIYKDGSVSVEDNGRGIPIDIHPVTKISALETVMTVLHAGAKFGGKTYQVSGGLHGVGASVVNALAEWTTVKVRRNGKIYQQSYQRG-KPSTPLEEVG--VSDGSGTTTIFKADSQIFSTTEYDFETLTDRLREIAYLNKGLEVYIYDEQSDQERTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSD----------STILEVAIQYNDGYSDSTLTFANCVNTIDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSVKLPEPQFEGQTKGKLGNIEIKSFVESAVTEQLSLYLEEHPDDTKRILEKCITAAKAREAARKARDLIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQAILPLRGKILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPAKLRYNRLVLMTDADVDGSHIRTLLLTFFFRHMPRLITESHLFIAQPPLYKIKIGSNEHWVYNDAEKETLLSQTKSNKVDIQRYKGLGEMSAEQLWKTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVAPRKAFIQSHSKTVKNLDI 642
>gi|148269239|ref|YP_001243699.1| DNA gyrase, B subunit [Thermotoga petrophila RKU-1] >gi|147734783|gb|ABQ46123.1| DNA gyrase subunit B [Thermotoga petrophila RKU-1] (636 aa)
Score = 1587, Expect = 2.6e-174, Identities = 319/640 (49%), Positives = 452/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           YSA +IK+L+GLE VR RPGMY+GST  +GLHH+V+E+VDNS+DEA+ G    I +TL ++GS +V+D+GRGIPV+ H +  +S +E V TVLHAGGKF  DSYK+SGGLHGVG SVVNALS WL+V V+++   Y++ Y    + GKPV  ++V  E  + K+GTIV F PD  I    EFD D ++ RL+++A+L  G+KI F D    +K+TF F GGI ++V+ LN  K+ +   +++ +R E VK  N +D+  + VE+AFQY  +Y+    +F N I T +GG+H   FK  L +++N++  +   LK+ D+    ED  EGLTA++S+   NP++EGQTK KLGN EV+  V+  + E  +K    N +    I+ K +   +AR+ +  ARE  RRK+  ++ +LPGKLADCS+  +E +EL+IVEGDSAGGSAK  RDR FQA+LP++GKI+NVEK+  D++  NE+I ++I A+G G+G +F   KLRY +II+MTDAD+DG+HIR LLLT  +RYM PL+E G VYIA PPL++   G+   Y Y ++ L E+K++    + +IQRYKGLGEMNP+QLWETTM+P+ R +++VTIEDA  AD++F +LMG++ + RREFIE++A  VK LDI
  S:     4 YSAESIKVLKGLEPVRMRPGMYVGSTGKRGLHHLVYEVVDNSVDEALAGYCDWIRVTLHEDGSVEVEDNGRGIPVDIHPEEGRSALEVVFTVLHAGGKFSKDSYKISGGLHGVGVSVVNALSEWLEVRVHRDGKIYRQRY----ERGKPVTPVEVIGE--TDKHGTIVRFKPDPLIFSETEFDPDVLEHRLREIAFLVPGLKIEFEDRINGEKKTFKFDGGIVEYVKYLNRGKKAL-HDVIHIKRTEKVKTKNGEDE--VIVEIAFQYTDSYSEDIVSFANTIKTVDGGTHVTAFKSTLTRLMNEYGKKHNFLKK-DDSFQGEDVREGLTAVISVYVKNPEFEGQTKSKLGNEEVKEAVTKAMREELKKIFDANSDLVKAILSKIMSTKQAREAAKRAREMVRRKNVLQNTALPGKLADCSSTHREKTELFIVEGDSAGGSAKQARDREFQAVLPIRGKILNVEKSSLDRLLKNEQISDIIVAVGTGIGDDFDESKLRYGRIIIMTDADIDGAHIRTLLLTLFYRYMRPLIEQGRVYIALPPLYRIKAGREEFYVYSDQELAEYKEKLQGKRIEIQRYKGLGEMNPEQLWETTMNPETRKIIRVTIEDAEEADRLFEILMGNDPSSRREFIERHALKVKELDI 636
>gi|59797755|sp|Q6GKU0|GYRB_STAAR DNA gyrase subunit B (644 aa)
Score = 1587, Expect = 2.6e-174, Identities = 343/641 (53%), Positives = 460/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K E N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEDKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 643
>gi|145592574|ref|YP_001156871.1| DNA gyrase, B subunit [Salinispora tropica CNB-440] >gi|145301911|gb|ABP52493.1| DNA gyrase subunit B [Salinispora tropica CNB-440] (719 aa)
Score = 1587, Expect = 2.8e-174, Identities = 337/643 (52%), Positives = 447/643 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE-------TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFS---VGKSSKYAYDEK------TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  Y A +I +LEGLEAVRKRPGMYIGST  +GLHH+VWE+VDN++DEA+ G+   I + L  +G  +V D+GRG PV+ H K KK  VE  LTVLHAGGKFD  +Y VSGGLHGVG SVVNALS+ + V + K+   +++ Y +     KP    K  +  A+   G+ V F+PD  + E   FD  TI  RL+++A+LN+G+ I+F+DER D+ +       TF + GGI  +V  LN  K  I  ++V    EE            + VE+A Q+N++Y  S +TF NNINT EGG+HEEGF+ AL  +IN++  EK+LLK +DEK+S ED  EGL AI+S+K  NPQ+EGQTK KLGN+ V+ FV  V +E    +L  NP +A VII K   A  AR  + +AR+  RRKS  ES S+PGKLADC + D    E++IVEGDSAGGSAK GRD   QAILP++GKI+NVEKA+ D++  N E+  LITA+G G+  +F I+KLRY+KI+LM DADVDG HI+ LLLT LFR+M PL+E G+VY+A PPL+K      G  ++YAY ++       L + KK N+K    IQR+KGLGEMN  +LWETTM+P  R L +VT++DA  AD++FS+LMG++V  RR FI++NAK V+ LDI
  S:    77 KQEYGAESITVLEGLEAVRKRPGMYIGSTGERGLHHLVWEVVDNAVDEALAGHCDTIDVVLLADGGVRVTDNGRGFPVDPHPKLKKPGVEVALTVLHAGGKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIQKDGYVWRQSYTD----SKPTPLEKGESTDAT---GSAVSFWPDPRVFETVAFDFQTIYRRLQEMAFLNRGLTIHFLDERVDEGDDGKMREVTFCYQGGIADFVRHLNASKTSIHKSVVEFGTEED----------GMSVEIAMQWNESYGESVYTFANNINTHEGGTHEEGFRSALTSVINRYGAEKRLLK-SDEKLSGEDIREGLAAIISVKLTNPQFEGQTKTKLGNTPVKSFVQRVCNEWLVDWLDRNPAEAKVIITKASQAARARVAAQQARKLARRKSLLESGSMPGKLADCQSTDPRECEVFIVEGDSAGGSAKQGRDPRTQAILPIRGKILNVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADADVDGQHIQTLLLTLLFRFMRPLVELGHVYLAAPPLYKIKWNRKGDDAQYAYSDRERDGLIALRQQKKPNAKPD-DIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSVLMGEDVEARRSFIQRNAKDVRFLDI 719
>gi|73916260|gb|AAZ92998.1| DNA gyrase subunit B [Streptococcus pneumoniae] (648 aa)
Score = 1587, Expect = 2.9e-174, Identities = 348/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V+V+K  K HY E++ G   VADL+V  +  + + GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI  L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVYVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFTPDPEIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRXLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|49482258|ref|YP_039482.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus MRSA252] >gi|49240387|emb|CAG39033.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus MRSA252] (643 aa)
Score = 1586, Expect = 3.4e-174, Identities = 343/641 (53%), Positives = 460/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K E N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    11 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEDKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 642
>gi|73916264|gb|AAZ93000.1| DNA gyrase subunit B [Streptococcus pneumoniae] (648 aa)
Score = 1586, Expect = 3.6e-174, Identities = 347/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL+V  +  + + GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  ++ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFTPDPEIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENRDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVIKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|116513233|ref|YP_812139.1| DNA gyrase, B subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092548|gb|ABJ57701.1| DNA gyrase subunit B [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (653 aa)
Score = 1586, Expect = 3.6e-174, Identities = 351/645 (54%), Positives = 457/645 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYN-IRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           E + + Y+AS I++L GLEAVRKRPGMYIGST  +GLHH+VWEI+DN IDEA+ G A++I +T+ ++ S  VQDDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K++YI F D G+ V +LK        ++GTIV F+PD  I  E   FD   +K+R+++LA+LNKG+K+ F D+R D  ET  + F GGIK++V  LN  +E +    +Y E            KY  I VEV+ QY   Y  +  TF NNI+T EGG HE GFK AL ++IN +A + K+LKE D+ +S ED  EG+TA++S+KHP+PQ+EGQTK KLGNS+ R  V    SE F  +L+ENP+ A  I++K  LA  AR  +  ARE TR+KS  E  +LPGKLAD ++ D  ISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +N+EI  L TA+GAG G +F + K RY+K+I+MTDADVDG+HIR LLLT  +RYM P+++ G VYIA PPL++   GK  KY   ++ L ++        K  +QRYKGLGEM+ +QLWETTMDP+NR L +V  E A +AD+VF +LMG+EV PRR+FIE NA+YV+NLD
  S:    15 EQEADKYNASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFATKIEVTVNEDNSVTVQDDGRGIPVDIEKKTGRPAVETVYTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLNVTVMRDGKKYYIAF-DHGRVVEELKEVGTVPLTEHGTIVHFWPDPNIFTETTVFDDKILKNRIRELAFLNKGLKLTFTDKRKDTAETDVYHFEGGIKEYVSFLNRGQEVLFDEPIYVE-----------GKYEGIDVEVSLQYTTGYKTTLMTFANNIHTYEGGMHEAGFKTALTRVINDYAHKAKILKENDDNLSGEDIREGMTAVISVKHPSPQFEGQTKTKLGNSDARTAVDRAFSETFSTFLMENPQVARKIVEKGQLAERARVAAKRAREVTRKKSGLEIANLPGKLADNTSNDPNISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANQEIRTLFTALGAGFGADFDVSKARYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPMIDKGYVYIARPPLYQVRQGKLIKYLDTDEELHDYLGSLQPSPKPIVQRYKGLGEMDAEQLWETTMDPENRRLDRVDPEYAKDADEVFEMLMGNEVGPRRKFIEDNAQYVENLD 652
>gi|116329807|ref|YP_799525.1| DNA gyrase subunit B [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116123496|gb|ABJ74767.1| DNA gyrase subunit B [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (641 aa)
Score = 1586, Expect = 3.7e-174, Identities = 338/644 (52%), Positives = 452/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKF-AVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGP-EFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ +YSAS IKILEGLEAVRKRPGMYIG+ D  GLH MV+E+VDNS+DEAM G+ +EI I++      +V+D+GRGIPV+ H   K ST+E V+T+LHAGGKF+ND+YKVSGGLHGVG SVVNALS +L+V V+++ K  Y +  + G PV+ +++  +  S + GTIV F PD  I    +F  D + +R ++LA+LNKG+ +   D R         +  F F+GGI  +VE +N  K P+   I ++  ++ V A           E++ QY++TY  + F F NNIN   GG+H EGF+ AL + +N F   +  L K+    +S ED  EGLTA++SIK P PQ+  QTK KL N+E++  +  + SE    +  ENP     I++KC+L+ +AR+ + +AR+ TRRK+  E   LPGKLADCS KD   SELY+VEGDSAGGSAK GRDR  QAILPLKGKI+NVEKA+ DKI S+EEI  L++A+G G+G  EF I+K+RY+KI++MTDAD+DGSHIR LLLTF FRYM P++E G +Y+A PPL+    GK+S YAY +K  EE  K     K  IQRYKGLGEMNP+QLWETTMDP NR++LKV ++D + A++ F++LMGDEV PR++FIE NA  V NLD+
  S:     4 KETSYSASQIKILEGLEAVRKRPGMYIGTQDETGLHKMVYEVVDNSVDEAMAGHCTEIRISILPNNIIEVKDNGRGIPVDIHPDKKISTIEVVMTILHAGGKFENDAYKVSGGLHGVGVSVVNALSEYLEVEVHQKGKI-YTQKYEKGIPVSPVEIKGD--SSERGTIVRFKPDATIFTTVDFQFDILSARFRELAFLNKGLVLIVEDRRRGAEGENLLRNEFQFSGGIVSFVEHINENKHPMHKVIHFERNKDDVLA-----------EISIQYSETYTENIFCFTNNINNNLGGTHLEGFRAALTRTLNDFLKKDTTLSKKHPTGLSGEDVKEGLTAVISIKIPQPQFNSQTKEKLVNAEIKGIMQTLSSEGLTLFFEENPNITKKILEKCILSAKAREAARKARDLTRRKTVLEGGGLPGKLADCSEKDPAFSELYLVEGDSAGGSAKQGRDRNTQAILPLKGKILNVEKARLDKILSSEEIRILVSALGTGIGEDEFNINKIRYHKIMIMTDADIDGSHIRTLLLTFFFRYMRPVIEKGYLYVAQPPLYLIKHGKNSTYAYSDKEKEELLKNVGTEKVVIQRYKGLGEMNPEQLWETTMDPSNRVVLKVKLDDFVEAEETFNILMGDEVQPRKQFIEINAAKVANLDL 641
>gi|170077957|ref|YP_001734595.1| DNA gyrase, B subunit [Synechococcus sp. PCC 7002] >gi|169885626|gb|ACA99339.1| DNA gyrase, B subunit [Synechococcus sp. PCC 7002] (640 aa)
Score = 1586, Expect = 3.7e-174, Identities = 327/642 (50%), Positives = 447/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLE-EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK--NLDI 649
           + YSA  I++LEGLE VRKRPGMYIG+T  +GLHH+V+E+VDNS+DEA+ G  +EI + +  +GS  V D+GRGIPV+ H  T KS +ETV+TVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V+++   YK+ Y    + G P  +L        + +GT V F PD +I  E   FD +T+  RL++LAYLN G++I F D R++ +   T+ + GGIK++V  +N EK P+   I+Y   E          K  +++EVA Q+    Y+++   F NNI T +GG+H EG K  L + +N  A ++  LK+ D  ++ E+  EGLTA++S+K P+P++EGQTK KLGNSEVR  V + V E+  +Y   N    + I++K + A +A + +  ARE  RRKS  ES+ LPGKLADCS +D   +E+Y+VEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF  +KLRY+++++MTDADVDG+HIR LLLTF +RY   L++ G +YIACPPL+K   GK+  Y Y ++ L+ +  +     KY IQR+KGLGEM P QLW+TTM+P++R L +V IEDA  AD++F++LMGD VAPRREFIE NA  +   +LDI
  S:     3 SNYSAQQIQVLEGLEPVRKRPGMYIGTTGPRGLHHLVYEVVDNSVDEALAGYCTEINVEINADGSVTVTDNGRGIPVDVHPSTGKSALETVMTVLHAGGKFGAGGYKVSGGLHGVGVSVVNALSEWVEVTVWRDETTYKQRY----ERGVPQGELTEAPAPQHL-SGTSVCFLPDAKIFTETTVFDYNTLAGRLRELAYLNAGVRIVFTDHRSEKQASNTYFYEGGIKEYVAYMNREKSPLHEEIIYVTGE----------KNGVQLEVALQWCTDAYSDNLLGFANNIRTVDGGTHLEGLKSVLTRTMNTVARKRNKLKDNDSNLAGENIREGLTAVISVKVPDPEFEGQTKTKLGNSEVRGIVDSFVGEVLTEYFEFNLNVVDAILEKAIQAFKAAEAARRARELVRRKSVLESSLLPGKLADCSERDPAKTEIYLVEGDSAGGSAKQGRDRAFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIKGEEFNPEKLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVDQGYIYIACPPLYKLERGKNHAYCYSDRELQDQISQLPDNAKYNIQRFKGLGEMMPQQLWDTTMNPESRTLKRVEIEDAAEADRIFTVLMGDRVAPRREFIEMNAPKLNMDDLDI 640
>gi|21281734|ref|NP_644820.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus MW2] >gi|87161454|ref|YP_492727.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus USA300] >gi|88193828|ref|YP_498613.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151220216|ref|YP_001331039.1| DNA gyrase B subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|161508271|ref|YP_001573930.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727086|ref|ZP_02759363.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|59797750|sp|Q6GD85|GYRB_STAAS DNA gyrase subunit B >gi|59799585|sp|P0A0K7|GYRB_STAAW DNA gyrase subunit B >gi|59799586|sp|P0A0K8|GYRB_STAAU DNA gyrase subunit B >gi|93204588|sp|Q2FKQ1|GYRB_STAA3 DNA gyrase subunit B >gi|296395|emb|CAA50570.1| DNA gyrase [Staphylococcus aureus] >gi|540541|dbj|BAA01369.1| DNA gyrase B [Staphylococcus aureus] >gi|21203169|dbj|BAB93870.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus MW2] >gi|87127428|gb|ABD21942.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87201386|gb|ABD29196.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150373016|dbj|BAF66276.1| DNA gyrase B subunit [Staphylococcus aureus subsp. aureus str. Newman] >gi|160367080|gb|ABX28051.1| DNA topoisomerase (ATP-hydrolyzing) subunit B [Staphylococcus aureus subsp. aureus USA300_TCH1516] (644 aa)
Score = 1586, Expect = 4.0e-174, Identities = 343/641 (53%), Positives = 460/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K E N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 643
>gi|49484917|ref|YP_042138.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus MSSA476] >gi|49243360|emb|CAG41777.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus MSSA476] (643 aa)
Score = 1585, Expect = 4.2e-174, Identities = 343/641 (53%), Positives = 460/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K E N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    11 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 642
>gi|168490903|ref|ZP_02715046.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC0288-04] >gi|169833521|ref|YP_001694269.1| DNA gyrase, B subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182683725|ref|YP_001835472.1| DNA gyrase subunit B [Streptococcus pneumoniae CGSP14] >gi|1490397|emb|CAA91553.1| DNA gyrase [Streptococcus pneumoniae] >gi|73916244|gb|AAZ92990.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916262|gb|AAZ92999.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916276|gb|AAZ93006.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916288|gb|AAZ93012.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916298|gb|AAZ93017.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916300|gb|AAZ93018.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916302|gb|AAZ93019.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916304|gb|AAZ93020.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916306|gb|AAZ93021.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916308|gb|AAZ93022.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916310|gb|AAZ93023.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916312|gb|AAZ93024.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916314|gb|AAZ93025.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916316|gb|AAZ93026.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916320|gb|AAZ93028.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916326|gb|AAZ93031.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916330|gb|AAZ93033.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916332|gb|AAZ93034.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916334|gb|AAZ93035.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916338|gb|AAZ93037.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916340|gb|AAZ93038.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916342|gb|AAZ93039.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916350|gb|AAZ93043.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|168996023|gb|ACA36635.1| DNA gyrase, B subunit [Streptococcus pneumoniae Hungary19A-6] >gi|182629059|gb|ACB90007.1| DNA gyrase subunit B [Streptococcus pneumoniae CGSP14] >gi|183574700|gb|EDT95228.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC0288-04] (648 aa)
Score = 1585, Expect = 4.4e-174, Identities = 348/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL+V  +  + + GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFTPDPEIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|86606189|ref|YP_474952.1| DNA gyrase subunit B [Synechococcus sp. JA-3-3Ab] >gi|86554731|gb|ABC99689.1| DNA gyrase, B subunit [Synechococcus sp. JA-3-3Ab] (642 aa)
Score = 1585, Expect = 4.5e-174, Identities = 343/632 (54%), Positives = 442/632 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASI-KNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD--DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSS-KYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           Y A  I++LEGLEAVR+RPGMYIGST  KGLHH+V+E+VDNS+DEA+ G  +EI +TL  +GS  V D+GRGIPV+ H KT +S + TV+TVLHAGGKF    YKVSGGLHGVG SVVNALS WL+  V++E K ++  F+ G   V  L+   + A   + GT V F PD  I    EFD   + +RL++LAYLN G+KI F D R D   +E + FAGGIK++V  +N+EK PI P I+Y   E             + VE A Q+    Y ++   F NNI TTEGG+H EG K AL   IN  A +   LK++D  ++ E+  EGLTAI+++K PNP++EGQTK KLGN+EVR  V  +VSE   +YL  NP  A  I++K + +  A + +  ARE  RRKS  ES++LPGKLADCS +D   SE+Y+VEGDSAGGSAK GRDR FQA+LPL+GKI+N+EKA   KI+ N EI  +ITA+G GV G EF   +LRY++IILMTDADVDGSHIR LLLTF +RY   LLE G VYIACPPL+K   G+++ +Y Y+E   E+  +   +  KY IQR+KGLGEM P+QLWETTM+P  R+L ++TIEDA  AD++F++LMGD V PRREFIE ++
  S:     5 YGAEQIQVLEGLEAVRRRPGMYIGSTGPKGLHHLVYEVVDNSVDEALAGYCNEIEVTLHPDGSVSVLDNGRGIPVDIHPKTGQSALVTVMTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWLEARVWREGKVYFQRFERGAV-VGSLQSEPQPAGAQRRGTEVRFKPDELIFPEREFDYSLLAARLRELAYLNAGLKIIFSDLRRDPPHREVYQFAGGIKEYVAFINHEKTPIHPDIIYVRGERD----------GVEVEAALQWCADVYTDTLIGFANNIRTTEGGTHLEGLKTALTLTINSQARKLNKLKDSDSNLAGENVREGLTAILAVKVPNPEFEGQTKTKLGNTEVRGIVQTLVSEALTEYLEFNPNVARGIVEKAIQSFNAAEAARRARELVRRKSALESSTLPGKLADCSCRDPAESEVYLVEGDSAGGSAKQGRDRQFQAVLPLRGKILNIEKADPAKIYKNAEIQAMITALGLGVKGEEFDPSQLRYHRIILMTDADVDGSHIRTLLLTFFYRYQKALLEQGYVYIACPPLYKIEWGRNNVRYCYNEAEKEQVLRSLPANTKYTIQRFKGLGEMMPEQLWETTMNPATRVLKQITIEDAAEADRIFTILMGDAVGPRREFIEAHS 632
>gi|148266452|ref|YP_001245395.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus JH9] >gi|150392485|ref|YP_001315160.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus JH1] >gi|147739521|gb|ABQ47819.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus JH9] >gi|149944937|gb|ABR50873.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus JH1] (640 aa)
Score = 1585, Expect = 4.6e-174, Identities = 344/648 (53%), Positives = 462/648 (71%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M+     + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K E N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:     1 MSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 639
>gi|73916248|gb|AAZ92992.1| DNA gyrase subunit B [Streptococcus pneumoniae] (648 aa)
Score = 1585, Expect = 5.0e-174, Identities = 348/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL+V  +  + + GT V F PD EI  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFTPDPEIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVIKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|148992476|ref|ZP_01822171.1| DNA gyrase subunit B [Streptococcus pneumoniae SP9-BS68] >gi|149021676|ref|ZP_01835707.1| DNA gyrase subunit B [Streptococcus pneumoniae SP23-BS72] >gi|168489810|ref|ZP_02714009.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP195] >gi|73916238|gb|AAZ92987.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916272|gb|AAZ93004.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916274|gb|AAZ93005.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916292|gb|AAZ93014.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916324|gb|AAZ93030.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|147928793|gb|EDK79806.1| DNA gyrase subunit B [Streptococcus pneumoniae SP9-BS68] >gi|147930137|gb|EDK81123.1| DNA gyrase subunit B [Streptococcus pneumoniae SP23-BS72] >gi|183571773|gb|EDT92301.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP195] (648 aa)
Score = 1584, Expect = 6.5e-174, Identities = 347/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL+V  +  + + GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFIPDPKIFTETTTFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|116326860|ref|YP_796580.1| DNA gyrase subunit B [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116119604|gb|ABJ77647.1| DNA gyrase subunit B [Leptospira borgpetersenii serovar Hardjo-bovis L550] (641 aa)
Score = 1583, Expect = 7.4e-174, Identities = 337/644 (52%), Positives = 451/644 (70%)
  Q:     6 KKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKF-AVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGP-EFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ +YSA  IKILEGLEAVRKRPGMYIG+ D  GLH MV+E+VDNS+DEAM G+ +EI I++      +V+D+GRGIPV+ H   K ST+E V+T+LHAGGKF+ND+YKVSGGLHGVG SVVNALS +L+V V+++ K  Y +  + G PV+ +++  +  S + GTIV F PD  I    +F  D + +R ++LA+LNKG+ +   D R         +  F F+GGI  +VE +N  K P+   I ++  ++ V A           E++ QY++TY  + F F NNIN   GG+H EGF+ AL + +N F   +  L K+    +S ED  EGLTA++SIK P PQ+  QTK KL N+E++  +  + SE    +  ENP     I++KC+L+ +AR+ + +AR+ TRRK+  E   LPGKLADCS KD   SELY+VEGDSAGGSAK GRDR  QAILPLKGKI+NVEKA+ DKI S+EEI  L++A+G G+G  EF I+K+RY+KI++MTDAD+DGSHIR LLLTF FRYM P++E G +Y+A PPL+    GK+S YAY +K  EE  K     K  IQRYKGLGEMNP+QLWETTMDP NR++LKV ++D + A++ F++LMGDEV PR++FIE NA  V NLD+
  S:     4 KETSYSAGQIKILEGLEAVRKRPGMYIGTQDETGLHKMVYEVVDNSVDEAMAGHCTEIRISILPNNIIEVKDNGRGIPVDIHPDKKISTIEVVMTILHAGGKFENDAYKVSGGLHGVGVSVVNALSEYLEVEVHQKGKI-YTQKYEKGIPVSPVEIKGD--SSERGTIVRFKPDATIFTTVDFQFDILSARFRELAFLNKGLVLIVEDRRRGAEGENLLRNEFQFSGGIVSFVEHINENKHPMHKVIHFERNKDDVLA-----------EISIQYSETYTENIFCFTNNINNNLGGTHLEGFRAALTRTLNDFLKKDTTLSKKHPTGLSGEDVKEGLTAVISIKIPQPQFNSQTKEKLVNAEIKGIMQTLSSEGLTLFFEENPNITKKILEKCILSAKAREAARKARDLTRRKTVLEGGGLPGKLADCSEKDPAFSELYLVEGDSAGGSAKQGRDRNTQAILPLKGKILNVEKARLDKILSSEEIRILVSALGTGIGEDEFNINKIRYHKIMIMTDADIDGSHIRTLLLTFFFRYMRPVIERGYLYVAQPPLYLIKHGKNSTYAYSDKEKEELLKNVGTEKVVIQRYKGLGEMNPEQLWETTMDPSNRVVLKVKLDDFVEAEETFNILMGDEVQPRKQFIEINAAKVANLDL 641
>gi|15922995|ref|NP_370529.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus Mu50] >gi|15925710|ref|NP_373243.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus N315] >gi|156978336|ref|YP_001440595.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus Mu3] >gi|54037243|sp|P66937|GYRB_STAAN DNA gyrase subunit B >gi|54041556|sp|P66936|GYRB_STAAM DNA gyrase subunit B >gi|13699922|dbj|BAB41221.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus N315] >gi|14245772|dbj|BAB56167.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus Mu50] >gi|156720471|dbj|BAF76888.1| DNA gyrase subunit B [Staphylococcus aureus subsp. aureus Mu3] (644 aa)
Score = 1583, Expect = 8.2e-174, Identities = 343/641 (53%), Positives = 460/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K E N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANKIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 643
>gi|161506639|ref|YP_001576587.1| DNA gyrase [Lactobacillus helveticus DPC 4571] >gi|160347628|gb|ABX26302.1| DNA gyrase [Lactobacillus helveticus DPC 4571] (654 aa)
Score = 1583, Expect = 8.6e-174, Identities = 349/645 (54%), Positives = 460/645 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYN-IRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           E + + Y+AS I++L GLEAVRKRPGMYIGST  +GLHH+VWEI+DNSIDE + G A++I IT+ ++GS  VQDDGRGIPV+   KT +  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K+++I+F D G+   ++K        ++GTIV FYPD +I  E   FD   +K+R+++LA+LNKG+K+ F D+R D  ET  + + GGIK++V  LN  +E +    +Y E             YN I VEVA QY   Y  +  TF NNI+T EGG HE GFK AL +++N +A + K+LK+ D+ +S ED  EG+TA+VS+KHP+PQ+EGQTK KLGNS+ R  V    SE F ++L+ENP     I++K  LA  AR  +  ARE TR+KS  E  +LPGKLAD ++ D  ISEL+IVEG+SAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +N+EI +L TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  + YM P++E G VYIA PPL++   GK  KY   ++ L ++        K  +QRYKGLGEM+P+QLWETTM+P+NR L +V+ E A +AD VF LLMG+EVAPRR+FI+KNAKYV+NLD
  S:    16 EKEADKYNASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNSIDERLAGFATKIEITVNEDGSVTVQDDGRGIPVDIQKKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLDVTVMRDGKKYFIDF-DHGRVKDEMKQIGTVPLEQHGTIVHFYPDPDIFTETTTFDDKILKNRIRELAFLNKGLKLTFTDKRKDSAETDVYKYEGGIKEYVAFLNKGQEVLFDEPIYVE-----------STYNGIDVEVALQYTNGYKTTLMTFANNIHTYEGGMHEAGFKTALTRVVNDYAHKAKILKDKDDNLSGEDIREGMTAVVSVKHPSPQFEGQTKTKLGNSDARTAVDKSFSETFSRFLMENPSVGRKIVEKGQLAERARTAAKRAREVTRKKSGLEIANLPGKLADNTSNDPSISELFIVEGNSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANQEIRSLFTALGTGFGADFDVSKARYHKLIIMTDADVDGAHIRTLLLTLFYNYMRPMIEKGYVYIARPPLYQVRQGKVIKYLDTDEELHDYLGSLQPSPKPVVQRYKGLGEMDPEQLWETTMNPENRRLDRVSPEYAKDADAVFELLMGNEVAPRRDFIQKNAKYVENLD 653
>gi|172039685|ref|YP_001799399.1| DNA gyrase subunit B [Corynebacterium urealyticum DSM 7109] >gi|171850989|emb|CAQ03965.1| DNA gyrase subunit B [Corynebacterium urealyticum DSM 7109] (699 aa)
Score = 1582, Expect = 9.5e-174, Identities = 341/646 (52%), Positives = 455/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE---------------------------------------TFLFAGGIKQWVEELNNEKEPIVPTIV-YDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSK-YAY-DEKTLEEFKK---ENSKVKYQ--IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS+I ILEGLEAVRKRPGMYIGST  +GLHH++WE+VDNS+DEAM G A ++++TL ++GS +V DDGRGIPVE H  +   TV+ V+T LHAGGKFD+DSY VSGGLHGVG SVVNALS+ ++  + ++  E Y EF +        ++   K    +GT   F+PD EI E  EF+ DT+  RL+++A+LNKG+ I   DER +  E                                       T+ +  G+K +V  +N +K+PI PTIV +D + E           +  VEVA Q+N  Y  S  TF N INT EGG+HEEGF+ A+  +IN++A ++KLLKE D  ++ +D  EGL A++S++  +PQ+EGQTK KLGN+E+R FV   ++E    +L  NP +A VI++K + +  AR+ + +AR+  RRKS  +   LPGKLADC +KD   SELY+VEGDSAGGSAK GRD ++QAILPL+GKI+NVEKA+ D++  N E+  +ITA+G G+  EF I+KLRY+KI+LM DADVDG HI  LLLT LFR M PL+E G VY+A PPL+K   GK    YA+ D +  E+ KK   E  K+     IQRYKGLGEMNP +LWETTMDP  R L +V++EDA  AD++FS+LMGD+V  RR FI +NA+ V+ LD+
  S:    23 EHKPGDYDASSITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNSVDEAMAGYAKKVSVTLKEDGSVEVSDDGRGIPVEMHP-SGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRVETRIVRDGFEWYQEFVNA----VPQELVQGKKKRGSGTTQRFWPDPEIFETVEFNFDTVAKRLQEMAFLNKGLTITLTDERPEAIEAEDPEEQLEDLTEQAEAPKSAEERQAEEEAKKKKGPRTKTYHYPEGLKDYVAFINRKKQPIHPTIVSFDAKGE-----------DHEVEVALQWNDGYQQSVHTFANTINTFEGGTHEEGFRAAMTSLINRYARDQKLLKEKDSNLTGDDVREGLAAVISVRVGDPQFEGQTKTKLGNTEIRGFVQRAINEHLSDWLDANPAEAKVIVQKAVASAHARQAARKARDLVRRKSASDMGGLPGKLADCRSKDPIKSELYVVEGDSAGGSAKSGRDSMYQAILPLRGKILNVEKARMDRVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRLMRPLVEGGYVYLAQPPLYKLKWGKGEPGYAFSDRERDEQLKKGLEEGRKIDTDDGIQRYKGLGEMNPKELWETTMDPTTRTLRQVSLEDAEAADELFSILMGDDVVARRSFITRNARDVRFLDV 699
>gi|82749782|ref|YP_415523.1| DNA gyrase subunit B [Staphylococcus aureus RF122] >gi|82655313|emb|CAI79693.1| DNA gyrase subunit B [Staphylococcus aureus RF122] (644 aa)
Score = 1582, Expect = 1.1e-173, Identities = 343/641 (53%), Positives = 460/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K K N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGDDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSKLNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 643
>gi|156744114|ref|YP_001434243.1| DNA gyrase, B subunit [Roseiflexus castenholzii DSM 13941] >gi|156235442|gb|ABU60225.1| DNA gyrase, B subunit [Roseiflexus castenholzii DSM 13941] (653 aa)
Score = 1582, Expect = 1.1e-173, Identities = 317/640 (49%), Positives = 433/640 (67%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVY--KEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYN-NSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV---KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y    I++LEG+EAVR+RPGMYIG TD+ GLH MV E+VDNS+DE M G A+ + +T+ ++GS  V DDG GIP   H K   ST++ V+TVLHAGGKFDN SYKVS GLHGVG S VNALS++++V V+  ++   +Y E++ G   V   +V     + + GTI  F PD  I++  +++  T+  R +++AYLNKG++  F+DER  ++  F F GGI+ +V  LN +K  +     Y ER              + VEVA QY ++++ +S + F N IN T+GG+H  GF+ AL ++IN +A  K  LKE +  ++ +D  EGLTA++S+K  +PQ+  QTK KL +      V+ V  + F  +L ENP++A  I++KC+ A   R    + RE T RKS  E  SLPGKLADCS  +   +EL+IVEGDSAGGSAK GRDR +QAILPL+GKI+NVEK++ DK+ SN E+  LITAIGAGVG +F   KLRY++IILM DADVDGSHIR LLLTF FRYM  ++ NG++Y+A PPL++   GK+ KY + +   +++    S     K  + RYKGLGEMN  QLWETTM+P NRLLL+VT+EDA  AD+ F++LMGD V PR+ FI+ +A  V+NLDI
  S:    22 YDEDQIQVLEGMEAVRRRPGMYIGPTDVNGLHTMVREVVDNSVDEVMAGRATTVEVTIHEDGSVTVADDGYGIPTGPHPKLGVSTLQVVMTVLHAGGKFDNKSYKVSSGLHGVGVSAVNALSAYMRVDVHNARDGMHYYQEYRCG---VPQCEVQKVGPTTRRGTITRFLPDTTIIQTLDYNFKTLAQRFREMAYLNKGLRFKFVDERDGNEINFYFEGGIRSYVRHLNKDKNVLHKHPFYVERTID----------EVMVEVALQYTESFDTDSVYAFANGINNTDGGAHVAGFRSALTRVINAYARSKGFLKENEGNLTGDDVREGLTAVISVKLRDPQFSSQTKEKLVSPSATGAVNTVFGDAFSAWLEENPQEARRIVEKCISAARTRIAVQKVRE-TARKSAMEGFSLPGKLADCSDTNPARTELFIVEGDSAGGSAKQGRDRRYQAILPLRGKILNVEKSRLDKMLSNNEVKALITAIGAGVGDQFDPSKLRYHRIILMCDADVDGSHIRTLLLTFFFRYMRQIITNGHLYLAQPPLYRIVHGKTEKYVFTDTERDQYLATLSSAERNKAVVTRYKGLGEMNAAQLWETTMNPLNRLLLQVTLEDAQQADETFTMLMGDLVPPRKRFIQTHALEVRNLDI 653
>gi|57651113|ref|YP_184916.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus COL] >gi|81859679|sp|Q5HJZ1|GYRB_STAAC DNA gyrase subunit B >gi|57285299|gb|AAW37393.1| DNA gyrase, B subunit [Staphylococcus aureus subsp. aureus COL] (644 aa)
Score = 1582, Expect = 1.2e-173, Identities = 342/641 (53%), Positives = 459/641 (71%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           + Y A  I++LEGLEA RKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A++I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V++    ++  +K G  P  DLK      + K GT++ F  D EI  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE LN  KEPI         +E +    +KD  +I VE+A QYN  Y  +  T+ NNI+T EGG+HE+GFK AL +++N + +  K++KE  +++S ED  EG+TAI+SIKH +PQ+EGQTK KLGNSEVR  V  + SE FE++L ENP+ A  +++K ++A  AR  + +ARE TRRKS  +  SLPGKLADCS+K  E  E+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ D+I +N EI  +ITA G G+G +F + K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y Y+++ L++ K E N   K+ I RYKGLGEMN DQLWETTM+P++R LL+V +EDA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:    12 DNYGAGQIQVLEGLEAARKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKG-VPQFDLKEVG--TTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELLNENKEPI--------HDEPIYIHQSKD--DIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 643
>gi|148543248|ref|YP_001270618.1| DNA gyrase subunit B [Lactobacillus reuteri F275] >gi|184152660|ref|YP_001841001.1| DNA gyrase subunit B [Lactobacillus reuteri F275] >gi|148530282|gb|ABQ82281.1| DNA gyrase subunit B [Lactobacillus reuteri F275] >gi|183224004|dbj|BAG24521.1| DNA gyrase subunit B [Lactobacillus reuteri F275] (649 aa)
Score = 1581, Expect = 1.4e-173, Identities = 345/647 (53%), Positives = 462/647 (71%)
  Q:     3 KETK---KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEK-ASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KETK    + Y AS I++L+GL+AVRKRPGMYIGST  +GLHH+VWEIVDN IDEA+ G   EI + +  + S  V+D+GRGIPV+   +T KS +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K +Y++F D G   + +KV  E     ++GT V F PD EI  E   ++  T+  RL++LA+LNKG+KI   D R  D E   F + GGI+ +VE LN ++  +    +Y E +E+          +I VEV+ QY  +Y ++  TF NNI+T EGG+HE GFK AL ++IN +  +  +LK ++E +S +D  EGLTA+VSIKHP+PQ+EGQTK KLGNS+ R    +V +  F ++LLE+P++A  II+K  LA +AR  +  ARE TR+KS  E ++LPGKLAD ++KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D++ +N+EI +L TA+G G G +F I K  Y+K+I+MTDADVDG+HIR LLLT  +R+M P++ +G VYIA PPL++   GK  KY   ++ LE+         K  IQRYKGLGEM+ +QLWETTMDP+NR LL+V ++DA  ADK+F +LMG +V PRR+FIE+NAK+V+NLD+
  S:     7 KETKMELASEYDASQIQVLKGLDAVRKRPGMYIGSTSAQGLHHLVWEIVDNGIDEALAGFCDEINVVVNPDNSITVKDNGRGIPVDTQKETGKSALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVARQGKRYYMDF-DHGHVKSAMKVIEEGLPETEHGTTVHFKPDPEIFRETTTYNIKTLTDRLRELAFLNKGLKITIEDLRQADHERKEFHYEGGIRHYVEYLNEDQNVLFDPPIYVEGKEN----------DITVEVSLQYTDSYRSNLLTFTNNIHTYEGGTHETGFKMALTRVINDYGHKAGILK-SNETLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTATDHVFAATFNRFLLEHPDEARQIIEKGQLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDRVLANDEIRSLFTALGTGFGDDFDITKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMKPMITHGYVYIAQPPLYQVRQGKFVKYIDSDEELEQVVSSLQPSPKPVIQRYKGLGEMDAEQLWETTMDPENRHLLRVKLDDAEQADKIFPMLMGTKVGPRRDFIEQNAKFVENLDL 649
>gi|194467407|ref|ZP_03073394.1| DNA gyrase, B subunit [Lactobacillus reuteri 100-23] >gi|194454443|gb|EDX43340.1| DNA gyrase, B subunit [Lactobacillus reuteri 100-23] (649 aa)
Score = 1580, Expect = 1.7e-173, Identities = 345/647 (53%), Positives = 462/647 (71%)
  Q:     3 KETK---KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEK-ASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KETK    + Y AS I++L+GL+AVRKRPGMYIGST  +GLHH+VWEIVDN IDEA+ G   EI + +  + S  V+D+GRGIPV+   +T KS +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K +Y++F D G   + +KV  E     ++GT V F PD EI  E   ++  T+  RL++LA+LNKG+KI   D R  D E   F + GGI+ +VE LN ++  +    +Y E +E+          +I VEV+ QY  +Y ++  TF NNI+T EGG+HE GFK AL ++IN +  +  +LK ++E +S +D  EGLTA+VSIKHP+PQ+EGQTK KLGNS+ R    +V +  F ++LLE+P++A  II+K  LA +AR  +  ARE TR+KS  E ++LPGKLAD ++KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D++ +N+EI +L TA+G G G +F I K  Y+K+I+MTDADVDG+HIR LLLT  +R+M P++ +G VYIA PPL++   GK  KY   ++ LE+         K  IQRYKGLGEM+ +QLWETTMDP+NR LL+V ++DA  ADK+F +LMG +V PRR+FIE+NAK+V+NLD+
  S:     7 KETKMELASEYDASQIQVLKGLDAVRKRPGMYIGSTSAQGLHHLVWEIVDNGIDEALAGFCDEINVVVNPDNSITVKDNGRGIPVDTQKETGKSALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVARQGKRYYMDF-DHGHVKSAMKVIEEGLPETEHGTTVHFKPDPEIFRETTTYNIKTLTDRLRELAFLNKGLKITIEDLRQADHERKEFHYEGGIRHYVEYLNEDQNVLFDPPIYVEGKEN----------DITVEVSLQYTDSYRSNLLTFTNNIHTYEGGTHETGFKMALTRVINDYGHKAGVLK-SNETLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTATDHVFAATFNRFLLEHPDEARQIIEKGQLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDRVLANDEIRSLFTALGTGFGDDFDITKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMKPMITHGYVYIAQPPLYQVRQGKFVKYIDSDEELEQVVSSLQPSPKPVIQRYKGLGEMDAEQLWETTMDPENRHLLRVKLDDAEQADKIFPMLMGTKVGPRRDFIEQNAKFVENLDL 649
>gi|169825626|ref|YP_001695784.1| DNA gyrase subunit B [Lysinibacillus sphaericus C3-41] >gi|168990114|gb|ACA37654.1| DNA gyrase subunit B [Lysinibacillus sphaericus C3-41] (644 aa)
Score = 1580, Expect = 1.7e-173, Identities = 357/648 (55%), Positives = 466/648 (71%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N+  +   Y A  I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  ++I +T+ KE   +V+D+GRGIPV    K  K  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS    V V++E   H I+F+ G K + +LK+  +  + +NGT   F  D EI  E   ++ D +  R+++LAYLN+GIKI   DER  ++   T+ + GGI+ +VE LN  KEPI          + +     KD   I VE+A QYN  ++++ F+F NNINT EGG+HE GFK AL ++IN +A +  LLKE D  ++ ED  EGLTAIVS+KHP+PQ+EGQTK KLGNSEV    +++ S+ FE+++LENP  A  +++K L+A  AR  + +ARE TRRK+  E +SLPGKLADCS+ +    E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN EI  +ITA G G+G EF ++K RY+KII+MTDADVDG+HIR LLLTF FR++ PL+E G +YIA PPL++   GK  +Y YD++TL+E  +   K+ K  +QRYKGLGEMN +QLW+TTMDP++R LL+V ++DA+ A++ F  LMGDEV PRR+FIE+NA Y  NLDI
  S:     8 NEGLQNQAYEADQIQVLEGLEAVRKRPGMYIGSTSSKGLHHLVWEIVDNSIDEALAGFCTDIQVTIEKENWIRVEDNGRGIPVSIQEKMGKPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSVETIVQVHREGHIHEIKFQRG-KTIQELKIIGD--TDRNGTTTRFKADPEIFKETTVYEYDILAHRIRELAYLNRGIKITIADEREGEERSTTYHYEGGIRSYVEHLNQSKEPI---------HDPIDVLGEKD--GISVEIAMQYNAGFSSNIFSFANNINTYEGGTHESGFKTALTRVINDYARKGGLLKEADANLTGEDVREGLTAIVSVKHPDPQFEGQTKTKLGNSEVSQITNSLFSDGFERFMLENPTVARKVVEKGLMAARARVAAKKAREFTRRKNALEVSSLPGKLADCSSTNPADCEIYIVEGDSAGGSAKSGRDRHFQAILPLRGKILNVEKARLDKILSNAEIRAMITAFGTGIGEEFNLEKARYHKIIIMTDADVDGAHIRTLLLTFFFRFLRPLIEAGYIYIAQPPLYQVKQGKHVEYCYDDETLKEILERLPKMPKPNVQRYKGLGEMNAEQLWDTTMDPEHRTLLQVELDDAIKANQAFERLMGDEVEPRRQFIEENAVYA-NLDI 644
>gi|15900699|ref|NP_345303.1| DNA gyrase subunit B [Streptococcus pneumoniae TIGR4] >gi|15902759|ref|NP_358309.1| DNA gyrase subunit B [Streptococcus pneumoniae R6] >gi|111658143|ref|ZP_01408840.1| hypothetical protein SpneT_02000668 [Streptococcus pneumoniae TIGR4] >gi|116516156|ref|YP_816203.1| DNA gyrase subunit B [Streptococcus pneumoniae D39] >gi|149007692|ref|ZP_01831309.1| DNA gyrase subunit B [Streptococcus pneumoniae SP18-BS74] >gi|168486180|ref|ZP_02710688.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC1087-00] >gi|61225463|sp|P0A4L9|GYRB_STRPN DNA gyrase subunit B >gi|61225464|sp|P0A4M0|GYRB_STRR6 DNA gyrase subunit B >gi|14972283|gb|AAK74943.1| DNA gyrase subunit B [Streptococcus pneumoniae TIGR4] >gi|15458306|gb|AAK99519.1| DNA gyrase [Streptococcus pneumoniae R6] >gi|73916240|gb|AAZ92988.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916246|gb|AAZ92991.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916250|gb|AAZ92993.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916256|gb|AAZ92996.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916258|gb|AAZ92997.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916270|gb|AAZ93003.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916328|gb|AAZ93032.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916336|gb|AAZ93036.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916346|gb|AAZ93041.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916348|gb|AAZ93042.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|116076732|gb|ABJ54452.1| DNA gyrase, B subunit [Streptococcus pneumoniae D39] >gi|147760847|gb|EDK67818.1| DNA gyrase subunit B [Streptococcus pneumoniae SP18-BS74] >gi|183570816|gb|EDT91344.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC1087-00] (648 aa)
Score = 1580, Expect = 2.0e-173, Identities = 347/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL++  +  + K GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEIVGD--TDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|86607821|ref|YP_476583.1| DNA gyrase subunit B [Synechococcus sp. JA-2-3B'a(2-13)] >gi|86556363|gb|ABD01320.1| DNA gyrase, B subunit [Synechococcus sp. JA-2-3B'a(2-13)] (642 aa)
Score = 1580, Expect = 2.0e-173, Identities = 343/635 (54%), Positives = 444/635 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNE-KASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSS-KYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYV 644
           Y A  I++LEGLEAVRKRPGMYIGST  KGLHH+V+E+VDNS+DEA+ G  ++I I+L  +GS  V D+GRGIPV+ H KT +S + TVLTVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V++E K ++  F+ G   V  LK   + K S + GT V F PD  I    EFD   + +R ++LAYLN G+KI F D R D    ET+ +AGGIK++V  +N+EK PI   I+Y + E             + VEVA Q+ +  Y ++   F NNI T EGG+H EG K +L   IN  A +   LK++D  ++ E+  EGLTAIVS+K PNP++EGQTK KLGN+EVR  V  +VSE   +YL  NP  A  I+ K + +  A + +  ARE  RRKS  ES++LPGKLADCS +D   SE+Y+VEGDSAGGSAK GRDR FQA+LPL+GKI+N+EKA   KI+ N EI  +ITA+G GV G EF   +LRY++IILMTDADVDGSHIR LLLTF +RY   LLE G VYIACPPL+K   G+++ +Y Y +   ++  +   +  KY IQR+KGLGEM P+QLWETTM+P  R L ++TIEDA+ AD++F++LMGD V PRREFIE ++ ++
  S:     5 YGAEQIQVLEGLEAVRKRPGMYIGSTGPKGLHHLVYEVVDNSVDEALAGYCNDIQISLHPDGSVSVLDNGRGIPVDIHPKTGQSALVTVLTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWVEVTVWREGKVYFQRFERGAV-VGSLKSEPQPKGSNRRGTEVRFKPDGLIFPEREFDYAVLAARFRELAYLNAGLKITFSDLRRDPPHCETYQYAGGIKEYVAFINHEKTPIHSDIIYIQGERD----------GVEVEVALQWCSDVYTDTLIGFANNIRTNEGGTHLEGLKTSLTLTINSQARKLNKLKDSDSNLAGENVREGLTAIVSVKVPNPEFEGQTKTKLGNTEVRGIVQTLVSEALTEYLEFNPNVARGIVDKAIQSFNAAEAARRARELVRRKSALESSTLPGKLADCSCRDPAESEVYLVEGDSAGGSAKQGRDRQFQAVLPLRGKILNIEKADPAKIYKNAEIQAMITALGLGVKGDEFDPSQLRYHRIILMTDADVDGSHIRTLLLTFFYRYQKALLEQGYVYIACPPLYKIEWGRNNVRYCYSDAEKDQILRGLPANAKYTIQRFKGLGEMMPEQLWETTMNPATRTLKQITIEDAVEADRIFTILMGDAVGPRREFIEAHSAHL 635
>gi|116617179|ref|YP_817550.1| DNA gyrase subunit B [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096026|gb|ABJ61177.1| DNA gyrase subunit B [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (672 aa)
Score = 1580, Expect = 2.1e-173, Identities = 343/646 (53%), Positives = 462/646 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVG--KSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K   Y+A  I++LEGLEAVRKRPGMYIG+T  +GLHH+VWEIVDN IDEA+ G AS IT+T+ K+ S  V DDGRGIPV+   KT K  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K +Y++FK  G+    ++  +E+ +I+ GTIV F PD +I  E   ++  T+ +R+++LA+LNKG++I+  D+R ++  KE+F F GGIK++V+ LN +K+ I P  VY E EE+           I VE A QY     +S  TF NNINT EGG+HE GFK AL ++IN +A +   +K+  E ++ ED  EG+TAIVSIKHP+PQ+EGQTK KLGNS+ R     + SE F ++++ENP  A  I++K +LA +AR  +  ARE TR++S  E  +LPGKLAD ++ D  ISEL+IVEGDSAGGSAK GR+R+ QAILP++GKI+NV KA  +++ +NEEI +L TA+G G G +F ++K  Y+K+I+MTDADVDG+HIR LLLT  +RYM PL++ G +YIA PPL+  ++G  KS  Y   ++ LE +  +  S VK ++QRYKGLGEM+ DQL +TTMD +NR LL+V   DA  A+ V  +LMG +V PRR+FIE NA +V+NLDI
  S:    32 DAKAGDYNADQIQVLEGLEAVRKRPGMYIGTTTAQGLHHLVWEIVDNGIDEALAGFASHITVTIEKDNSITVTDDGRGIPVDIQTKTGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTDLDVKVVRDNKVYYMDFK-VGRVHTTMRTLDEEPTIERGTIVHFKPDTDIFRETTTYNYKTLLTRVRELAFLNKGLRISIADKRLEEPIKESFHFEGGIKEYVQYLNEDKQVIFPEPVYVEGEEN----------GIVVEAALQYTTDIKDSLRTFANNINTYEGGTHETGFKTALTRVINDYARKSGQIKDGAESLTGEDVREGMTAIVSIKHPDPQFEGQTKTKLGNSDARQATDRMFSETFSRFMMENPNVAKQIVEKGVLAQKARLAAKRAREMTRKQSGLEIGNLPGKLADNTSNDPAISELFIVEGDSAGGSAKQGRNRVTQAILPIRGKILNVGKASLERVLANEEIRSLFTAMGTGFGDDFNVEKANYHKVIIMTDADVDGAHIRTLLLTLFYRYMRPLVDAGYIYIAQPPLYGVALGNNKSMTYLDSDEELESYLSQLPSNVKPKVQRYKGLGEMDYDQLADTTMDAQNRRLLRVDPADAEEAEAVIDMLMGGDVPPRRKFIEDNAVFVENLDI 672
>gi|149010561|ref|ZP_01831932.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP19-BS75] >gi|147765042|gb|EDK71971.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP19-BS75] (648 aa)
Score = 1579, Expect = 2.2e-173, Identities = 346/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G +S I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL+V  +  + + GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFSSHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFIPDPKIFTETTTFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|73916290|gb|AAZ93013.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916294|gb|AAZ93015.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916296|gb|AAZ93016.1| DNA gyrase subunit B [Streptococcus pneumoniae] (648 aa)
Score = 1579, Expect = 2.2e-173, Identities = 346/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL+V  +  + + GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ +L ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEVVGD--TDRTGTTVHFIPDPKIFTETTTFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTSLTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|146319164|ref|YP_001198876.1| DNA gyrase subunit B [Streptococcus suis 05ZYH33] >gi|145689970|gb|ABP90476.1| DNA gyrase [Streptococcus suis 05ZYH33] (650 aa)
Score = 1579, Expect = 2.3e-173, Identities = 346/646 (53%), Positives = 462/646 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKY-----AYDEKTLEEFKKENS--KVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A +I + +  + S  V D+GRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + ++ E+K G + VADL+V  E  + ++GT V F PD EI  E  EFD   +  R+++LA+LN+G+ ++  D+R   ++T  + + GGI  +VE LN  K+ I  T +Y E E            +I VEVA QY  +Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHP PQ+EGQTK KLGNSEV    + + S+ F ++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GRDR FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT  +RYM P++E G VYIA PP++   VG   K         E+ L++  + +S  + K  IQRYKGLGEM+  QLWETTM+P+NRL+ +V+++DA  ADK+F +LMGD+V PRREFIE+NA Y   LD+
  S:     9 QEKAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFADKIEVYIEPDNSITVIDNGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVYKNGQVYFQEYKRG-EVVADLEVVGE--TDRSGTTVHFTPDPEIFTETTEFDFAKLNKRIQELAFLNRGLNLSITDKREGVEQTKEYHYEGGIASYVEYLNENKDVIFETPIYTEGEMD----------DITVEVAMQYTTSYHENVVSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPGPQFEGQTKTKLGNSEVVKITNRLFSDAFAEFLLENPQIARRIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDAAKTELFIVEGDSAGGSAKSGRDREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGIKVGSEIKEYIQPGVNQEQELQDALERHSTGRSKPTIQRYKGLGEMDDHQLWETTMNPENRLMARVSVDDAAEADKIFDMLMGDKVEPRREFIEENAVY-STLDV 650
>gi|150387859|ref|YP_001317908.1| DNA gyrase, B subunit [Alkaliphilus metalliredigens QYMF] >gi|149947721|gb|ABR46249.1| DNA gyrase, B subunit [Alkaliphilus metalliredigens QYMF] (635 aa)
Score = 1579, Expect = 2.5e-173, Identities = 342/646 (52%), Positives = 457/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y A  I++LEGLEAVRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G    I +T+ ++ S KV D+GRGIP+E H +T KST+ETV+TVLHAGGKF    YKVSGGLHGVG SVVNALS +++V V K+   YK+ Y    + G P+ D++   E       T + F  D EI E   +   T+++RL+++A+LNKGIKI   D R ++  + +F + GGI+++V  LN  +E ++  ++Y E          K K    VEVA QY   Y  + F++ N INT EGG+H  GFK  L ++IN++A +  +LKE +  +  ED  EGLTAI+S+K  +PQ+EGQTK KLGNSE++  V +  S+  E +L ENP +A +II+K L A  AR+ + +ARE TRRK   E+ +LPGKLADC+ KD  +SE+YIVEG+SAGGSAK GRDR  QAILPL+GKI+NVEK++ D+I  + EI N+ITA G G+G EF I+K+RY+KI++MTDADVDG+HIR LLLTF FRYM PL+E G VYIA PPL+K   GK   YAY ++ +++   +       IQRYKGLGEMNP+QLW+TTM+P+ R  L+V+IEDA  AD +F+ LMGD+V PRR+FIE+N+KYV NLDI
  S:     2 ENKIQEYGAEQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCDVIDVTIYQDNSIKVVDNGRGIPIETHPQTGKSTLETVMTVLHAGGKFGGGGYKVSGGLHGVGISVVNALSEYVEVEVRKDGKLYKQRY----ERGIPITDVQEVGETTETG--TTITFKADSEIFEEILYVYTTLENRLREMAFLNKGIKITLRDLREEEVMESSFRYDGGIQEFVMHLNRNREALIDKVIYFE----------KQKEGSVVEVALQYTGAYTENIFSYANTINTHEGGTHLSGFKAGLTRVINEYARKNGILKEKEINLLGEDIREGLTAIISVKMADPQFEGQTKTKLGNSEMKGIVESSTSQYLEAFLEENPHEAKIIIEKSLRAQRAREAAKKARELTRRKGALENTALPGKLADCAEKDPALSEIYIVEGNSAGGSAKQGRDRATQAILPLRGKILNVEKSRLDRILGSAEIRNMITAFGTGIGIEFDIEKVRYHKIVIMTDADVDGAHIRTLLLTFFFRYMKPLIELGYVYIAQPPLYKLKKGKVENYAYSDEEMQKIIVQMGG-SADIQRYKGLGEMNPEQLWDTTMNPETRTFLQVSIEDAAGADDIFNTLMGDKVEPRRQFIEQNSKYVTNLDI 635
>gi|154705554|gb|ABS84203.1| DNA gyrase B subunit [Lactobacillus reuteri] (649 aa)
Score = 1579, Expect = 2.6e-173, Identities = 345/647 (53%), Positives = 462/647 (71%)
  Q:     3 KETK---KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEK-ASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KETK    + Y AS I++L+GL+AVRKRPGMYIGST  +GLHH+VWEIVDN IDEA+ G   EI + +  + S  V+D+GRGIPV+   +T KS +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K +Y++F D G   + +KV  E     ++GT V F PD EI  E   ++  T+  RL++LA+LNKG+KI   D R  D E   F + GGI+ +VE LN ++  +    +Y E +E+          +I VEV+ QY  +Y ++  TF NNI+T EGG+HE GFK AL ++IN +  +  +LK ++E +S +D  EGLTA+VSIKHP+PQ+EGQTK KLGNS+ R    +V +  F ++LLE+P++A  II+K  LA +AR  +  ARE TR+KS  E ++LPGKLAD ++KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D++ +N+EI +L TA+G G G +F I K  Y+K+I+MTDADVDG+HIR LLLT  +R+M P++ +G VYIA PPL++   GK  KY   ++ LE+         K  IQRYKGLGEM+ +QLWETTMDP+NR LL+V ++DA  ADK+F +LMG +V PRR+FIE+NAK+V+NLD+
  S:     7 KETKMELASEYDASQIQVLKGLDAVRKRPGMYIGSTSAQGLHHLVWEIVDNGIDEALAGFCDEINVVVNPDNSITVKDNGRGIPVDTQKETGKSALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVARQGKRYYMDF-DHGHVKSAMKVIEEGLPETEHGTTVHFKPDPEIFRETTTYNIKTLTDRLRELAFLNKGLKITIEDLREIDHERKEFHYEGGIRHYVEYLNEDQNVLFDPPIYVEGKEN----------DITVEVSLQYTDSYRSNLLTFTNNIHTYEGGTHETGFKMALTRVINDYGHKAGILK-SNETLSGDDVREGLTAVVSIKHPDPQFEGQTKTKLGNSDARTATDHVFAATFNRFLLEHPDEARQIIEKGQLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATLDRVLANDEIRSLFTALGTGFGDDFDITKANYHKLIIMTDADVDGAHIRTLLLTLFYRFMKPMITHGYVYIAQPPLYQVRQGKFVKYIDSDEELEQVVSSLQPSPKPVIQRYKGLGEMDAEQLWETTMDPENRHLLRVKLDDAEQADKIFPMLMGTKVGPRRDFIEQNAKFVENLDL 649
>gi|150010130|ref|YP_001304873.1| DNA gyrase, B subunit [Parabacteroides distasonis ATCC 8503] >gi|149938554|gb|ABR45251.1| DNA gyrase, B subunit [Parabacteroides distasonis ATCC 8503] (651 aa)
Score = 1579, Expect = 2.6e-173, Identities = 335/648 (51%), Positives = 447/648 (68%)
  Q:     1 MNKETKKNT--YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDER------TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF------KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M++E K  +  YSA +I++LEGLEAVRKRP MYIG T  KGLHH+V+E+VDNSIDEA+ G  + I + + ++ S  V DDGRGIPV+ H K  KS +E VLTVLHAGGKFD  +YKVSGGLHGVG S VNALS++LK  V +  K H  EF   GKP+ D++V +   + K GT + F PD  I    E+  D + +RL++LA+LN GI +   D+R      +   E F    G+K++V  ++  KE ++P +++   E          K  I VEVA  YN +YN S F++ N+INT EGG+H  GF+  L + + K+A + KLL++   +I  +D  EGLTA++SIK   PQ+EGQTK KLGNSEV   V   + E    YL E+P++A +I+ K +LA +AR  + +ARE  +RKSP     LPGKLADCS+KD  I EL++VEGDSAGG+AK GRDR FQAILPL+GKI+NVEKA   KIF +EEI N+  A+G  VG E       ++KLRY+K+I+MTDADVDGSHI  L+LTF FR M  L+ENG VY+A PPL+    GK  +Y + E+  ++F        ENS      QRYKGLGEMN  QLW+TTM+P+NR L ++TI++A  AD++F++LMG++V PRREFIE+NA Y  N+D
  S:     1 MSEEIKNTSTEYSADSIQVLEGLEAVRKRPSMYIGDTSEKGLHHLVYEVVDNSIDEALAGYCTYIDVVINEDNSITVTDDGRGIPVDIHEKEGKSALEVVLTVLHAGGKFDKGTYKVSGGLHGVGVSCVNALSTYLKAEVRRNGKVHMQEFS-CGKPLHDVQVIDN--TDKTGTTISFKPDGSIFTVTEYKYDILATRLRELAFLNAGITLRLTDKRVLKEDGSFKSEVFHSDEGLKEFVRYIDRSKEKLIPDVIHIVTE----------KQGIPVEVALTYNTSYNESVFSYVNDINTIEGGTHLAGFRRGLTRTLKKYAEDSKLLEKAKVEIQGDDFREGLTAVISIKVAEPQFEGQTKTKLGNSEVTGAVDMAIGEALGYYLEEHPKEAKIIVDKVILAAQARHAARKARELVQRKSPLTGGGLPGKLADCSSKDASICELFLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMDHKIFESEEIQNIYRAMGVTVGTEDDPKALNMEKLRYHKVIIMTDADVDGSHIATLILTFFFRRMRSLIENGYVYLATPPLYLCKKGKVEEYCWTEQQRQQFILKYGGGNENS---IHTQRYKGLGEMNDHQLWDTTMNPENRTLKQITIDNAAEADQIFAMLMGEDVGPRREFIEENATYA-NID 650
>gi|148997114|ref|ZP_01824768.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP11-BS70] >gi|168492965|ref|ZP_02717108.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC3059-06] >gi|168575469|ref|ZP_02721405.1| DNA gyrase, B subunit [Streptococcus pneumoniae MLV-016] >gi|194396954|ref|YP_002037451.1| DNA gyrase, B subunit [Streptococcus pneumoniae G54] >gi|73916242|gb|AAZ92989.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916254|gb|AAZ92995.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916268|gb|AAZ93002.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|147756814|gb|EDK63854.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP11-BS70] >gi|183577070|gb|EDT97598.1| DNA gyrase, B subunit [Streptococcus pneumoniae CDC3059-06] >gi|183578470|gb|EDT98998.1| DNA gyrase, B subunit [Streptococcus pneumoniae MLV-016] >gi|194356621|gb|ACF55069.1| DNA gyrase, B subunit [Streptococcus pneumoniae G54] (648 aa)
Score = 1578, Expect = 2.7e-173, Identities = 347/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL++  +  + K GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEIVGD--TDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKREGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|116491823|ref|YP_803558.1| DNA gyrase subunit B [Pediococcus pentosaceus ATCC 25745] >gi|116101973|gb|ABJ67116.1| DNA gyrase subunit B [Pediococcus pentosaceus ATCC 25745] (648 aa)
Score = 1577, Expect = 3.8e-173, Identities = 353/647 (54%), Positives = 457/647 (70%)
  Q:     3 KETKKN---TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENS-KVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           KETK      Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+VWEI+DN IDEA+ G A +I + + K+ S  V D+GRGIPV+   KT K  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L   V K+ K +YI+F  G        + + +    +GTIV F PD +I  E   +D + +K+R+++LA+LNKG++I   D R +   ++ FL+ GGI+ +VE LN  KE I P  +Y E               I VEVA QY + Y +   TF NNI+T EGG+HEEGFK AL ++IN +A    +LKE D+K+S +D  EGLTA+VS+KHP+PQ+EGQTK KLGNS+ R  V+ V +E F K+LLENP+ A  I+ K +LA +AR  +  ARE TR+KS  E N+LPGKLAD ++KD  ISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D++ +NEEI +L TA+G G G +F + K  Y+K+I+MTDADVDG+HIR LLLT  +RYM P+++ G VYIA PPL++   GK  +Y   ++ LE    + S   K  IQRYKGLGEM+ +QLWETTM+P+NR LL+V+ EDA  A   F +LMGD+V PRR+FIE+NA +VKNLDI
  S:     5 KETKAELAREYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFADKIDVIVEKDNSITVTDNGRGIPVDIQKKTGKPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDARVMKDGKIYYIDFALGKVKTPMKTIGDTEHPDDHGTIVHFVPDPDIFQETTTYDINILKTRIRELAFLNKGLRITLKDMRPEKPTEDDFLYEGGIRHYVEYLNEGKEVIFPEPIYVEGVTK----------GITVEVAMQYIEGYQSKLLTFTNNIHTYEGGTHEEGFKRALTRVINDYAKNNNILKENDDKLSGDDVREGLTAVVSVKHPDPQFEGQTKTKLGNSDARTAVNEVFAETFNKFLLENPKVARQIVDKGILAAKARVAAKRAREVTRKKSGLELNNLPGKLADNTSKDPSISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKATLDRVLANEEIRSLFTALGTGFGEDFDVSKANYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPMIDAGFVYIAQPPLYQVRQGKMIQYIDSDEELETVLGQLSPSPKPVIQRYKGLGEMDAEQLWETTMNPENRRLLRVSAEDADAASGDFEMLMGDKVEPRRKFIEENAVFVKNLDI 648
>gi|189345573|ref|YP_001942102.1| DNA gyrase, B subunit [Chlorobium limicola DSM 245] >gi|189339720|gb|ACD89123.1| DNA gyrase, B subunit [Chlorobium limicola DSM 245] (643 aa)
Score = 1577, Expect = 4.1e-173, Identities = 330/642 (51%), Positives = 442/642 (68%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIV--PTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK----TLEEFKK-ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++Y A+NI+IL+G+E VR RP MYIG    +GLHH+V+EIVDNSIDE + G    I + L  +GS  V D GRGIPV+ H + +KS +E V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY++ K ++  + + G P  D+K      S   GT   F PD EI +  EF  D I  R+++LA+LNK ++I  + +   ++E F + GG+ ++V+  +  +  ++  P  +Y ER+ ++            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSE +  V ++V+E   ++L  NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF  +KLRY KII+MTDADVDG+HIR LLLTF FRYM  L+E G V+IA PPL+    GK  +YA+D+      +E  +K +  K    IQRYKGLGEMNP+QLW TTMDP +R LL+V++E+A+ ADKVFS LMGD+V PRR+FIEKNA+YV+ LD+
  S:    10 SSYLATNIQILDGIEHVRMRPAMYIGDIHTRGLHHLVYEIVDNSIDETLGGYNDYIFVGLNPDGSVTVIDRGRGIPVDIHPEKQKSALELVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAYFQRY-ERGVPQGDVKEIG--PSDLRGTKTTFKPDHEIFKTTEFRRDIIIDRMRELAFLNKTLRIT-VQDSDGNEEVFHYEGGLNEFVQFTDQNRIKLLKEPVYIYGERDSTI------------VELALQYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNAYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVAEPQFEGQTKTKLGNSETQSIVESIVNEQLAEFLESNPNVLKLIIEKVKGAAMSREAARKAKELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSPEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRYMRSLIEAGKVFIAQPPLYLVKSGKDQQYAWDDDERNAVIESLRKMQKGKANVHIQRYKGLGEMNPEQLWSTTMDPAHRSLLQVSVENAMEADKVFSTLMGDKVEPRRDFIEKNARYVRRLDV 643
>gi|73916252|gb|AAZ92994.1| DNA gyrase subunit B [Streptococcus pneumoniae] (648 aa)
Score = 1577, Expect = 4.4e-173, Identities = 346/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   +ADL++  +  + K GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVIADLEIVGD--TDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGGDQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|126651999|ref|ZP_01724191.1| DNA gyrase subunit B [Bacillus sp. B14905] >gi|126591268|gb|EAZ85377.1| DNA gyrase subunit B [Bacillus sp. B14905] (644 aa)
Score = 1576, Expect = 5.8e-173, Identities = 356/648 (54%), Positives = 465/648 (71%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N+  +   Y A  I++LEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G  ++I +T+ KE   +V+D+GRGIPV    K  K  VE ++TVLHAGGKF    YKVSGGLHGVGASVVNALS    V V++E   H I+F+ G K + +LK+  +  + +NGT   F  D EI  E   ++ D +  R+++LAYLN+GI+I   DER  ++   T+ + GGI+ +VE LN  KEPI          + +     KD   I VE+A QYN  ++++ F+F NNINT EGG+HE GFK AL ++IN +A +  LLKE D  ++ ED  EGLTAIVS+KHP+PQ+EGQTK KLGNSEV    + + S+ FE+++LENP  A  +++K L+A  AR  + +ARE TRRK+  E +SLPGKLADCS+ +    E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEKA+ DKI SN EI  +ITA G G+G EF ++K RY+KII+MTDADVDG+HIR LLLTF FR++ PL+E G +YIA PPL++   GK  +Y YD++TL+E  +   K+ K  +QRYKGLGEMN +QLW+TTMDP++R LL+V ++DA+ A++ F  LMGDEV PRR+FIE+NA Y  NLDI
  S:     8 NEGLQNQAYEADQIQVLEGLEAVRKRPGMYIGSTSSKGLHHLVWEIVDNSIDEALAGFCTDIQVTIEKENWIRVEDNGRGIPVSIQEKMGKPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSVETIVQVHREGHIHEIKFQRG-KTIQELKIIGD--TDRNGTTTRFKADPEIFKETTVYEYDILAHRIRELAYLNRGIRITIADEREGEERSTTYHYEGGIRSYVEHLNQSKEPI---------HDPIDVLGEKD--GISVEIAMQYNAGFSSNIFSFANNINTYEGGTHESGFKTALTRVINDYARKGGLLKEADANLTGEDVREGLTAIVSVKHPDPQFEGQTKTKLGNSEVSQITNALFSDGFERFMLENPTVARKVVEKGLMAARARVAAKKAREFTRRKNALEVSSLPGKLADCSSTNPADCEIYIVEGDSAGGSAKSGRDRHFQAILPLRGKILNVEKARLDKILSNAEIRAMITAFGTGIGEEFNLEKARYHKIIIMTDADVDGAHIRTLLLTFFFRFLRPLIEAGYIYIAQPPLYQVKQGKHVEYCYDDETLKEILERLPKMPKPNVQRYKGLGEMNAEQLWDTTMDPEHRTLLQVELDDAIKANQAFERLMGDEVEPRRQFIEENAVYA-NLDI 644
>gi|94992112|ref|YP_600211.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS2096] >gi|94545620|gb|ABF35667.1| DNA gyrase subunit B [Streptococcus pyogenes MGAS2096] (651 aa)
Score = 1576, Expect = 6.0e-173, Identities = 352/646 (54%), Positives = 453/646 (70%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHM-VWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQI-------QRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E K   Y AS I++LEGLEAVR RPGMYIGST   G   + VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+  AKT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V VYK  + HY EFK G   VADL+V          T V F PD EI  E  +FD   +  R+++LA+LN G+KI+  D+R+  + +E F + GGI  +VE LN++K+ I  T +Y + E             I VEVA QY  +Y  +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F+++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G +F + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E + + +  KY I       QRYKGLGEM+  QLWETTMDP+NRL+ +VT++DA  ADKVF +LMGD V PRR+FIE+NA Y   LDI
  S:     9 EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKAGFASISVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAV-VADLEVIGTTDVTG--TTVHFTPDPEIFTETTQFDYSVLAKRIQELAFLNHGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIYTDGELE----------GIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDANQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGVKVGSEIKEYIQPGIDQEDQLKTALEKYSIGRSKPTVQRYKGLGEMDDHQLWETTMDPENRLMARVTVDDAAEADKVFDMLMGDRVEPRRDFIEENAVY-STLDI 651
>gi|58336359|ref|YP_192944.1| DNA gyrase subunit B [Lactobacillus acidophilus NCFM] >gi|58253676|gb|AAV41913.1| DNA gyrase subunit B [Lactobacillus acidophilus NCFM] (654 aa)
Score = 1575, Expect = 7.8e-173, Identities = 346/645 (53%), Positives = 461/645 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYN-IRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           E + + Y+AS I++L GLEAVRKRPGMYIGST  +GLHH+VWE++DNSIDE + G A++I IT+ ++GS  VQDDGRGIPV+   KT +  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V ++ K+++I+F D G+   ++K        ++GTIV FYPD +I  E   FD   +K+R+++LA+LNKG+++ F D+R +  ET  + F GGIK++V  LN  +E +    +Y E             YN I VEVA QY   Y  +  TF NNI+T EGG HE GFK AL +++N +A + K+LK+ D+ +S ED  EG+TA+VS+KHP+PQ+EGQTK KLGNS+ R  V    SE F ++L+ENP     I++K  LA  AR  +  ARE TR+KS  E  +LPGKLAD ++ D  ISEL+IVEG+SAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +N+EI +L TA+G G G +F + K RY+K+I+MTDADVDG+HIR LLLT  + YM P+++ G VYIA PPL++   GK  KY   ++ L ++        K  +QRYKGLGEM+P+QLWETTM+P+NR L +V+ E A +AD+VF LLMG+EVAPRR+FI+KNAKYV+NLD
  S:    16 EKEADKYNASQIQVLGGLEAVRKRPGMYIGSTSSQGLHHLVWEVIDNSIDERLAGFATKIEITINEDGSVTVQDDGRGIPVDIQEKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLDVTVMRDGKKYFIDF-DHGRVKDEMKQVGTVPLDQHGTIVHFYPDPDIFTETTTFDDKILKNRIRELAFLNKGLELTFTDKRKETAETDVYKFEGGIKEYVAFLNEGQEVLFDEPIYVE-----------STYNGIDVEVALQYTNGYKTTLMTFANNIHTYEGGMHEAGFKTALTRVVNDYAHKAKILKDKDDNLSGEDIREGMTAVVSVKHPSPQFEGQTKTKLGNSDARTAVDKSFSETFSRFLMENPSIGRKIVEKGQLAERARSAAKRAREVTRKKSGLEIANLPGKLADNTSNDPSISELFIVEGNSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANQEIRSLFTALGTGFGADFDVSKARYHKLIIMTDADVDGAHIRTLLLTLFYNYMRPMIDKGYVYIARPPLYQVRQGKVIKYLDTDEELHDYLGSLQPSPKPVVQRYKGLGEMDPEQLWETTMNPENRRLDRVSPEYAKDADEVFELLMGNEVAPRRDFIQKNAKYVENLD 653
>gi|81427621|ref|YP_394618.1| DNA gyrase, B subunit [Lactobacillus sakei subsp. sakei 23K] >gi|78609260|emb|CAI54307.1| DNA gyrase, B subunit [Lactobacillus sakei subsp. sakei 23K] (658 aa)
Score = 1574, Expect = 8.3e-173, Identities = 344/642 (53%), Positives = 450/642 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYA-YDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYV 644
           KE +  +Y AS I++LEGLEAVRKRPGMYIG+T  +GLHH+VWEI+DN IDEA+ G A+EI + +  + S  V DDGRGIPV   AKT KS +ETV T+LHAGGKF    YKVSGGLHGVGASVVNALS+ L   V +  K +YI+FK G K    +K+  +    ++GT V F PD +I  E   +D   + +R+++LA+LNKG+K+ F D+R D  E   F + GGIK +VE L+ +KE ++   +Y E E++           I VEVA QY   Y  +  TF NNI+T EGG+HE GFK AL ++IN +A ++ + K +D  +S ED  EGLTA+VS+KHP+PQ+EGQTK KLGN++ R     + S+ F K+L+ENP  A  I+ K  LA  AR  +  ARE TR+K+  E ++LPGKLAD S+KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  +KI +NEEI  L TA+G G G EF ++K RY+K+I+MTDADVDG+HIR LLLT  +RYM P++E G VYIA PPL++   GK  +Y   DE+  +         K ++QRYKGLGEM+  QLWETTMDP+NR +L+V +EDA  AD++F +LMGD V PRR FIE+NA Y+
  S:    17 KEERAKSYDASQIQVLEGLEAVRKRPGMYIGTTSSQGLHHLVWEIIDNGIDEALAGFATEINVVVEPDNSITVTDDGRGIPVGIQAKTGKSALETVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDAVVTQGGKRYYIDFKRG-KVQTPMKMIGDAPEHEHGTKVHFVPDPDIFTETTIYDDKILTTRIRELAFLNKGLKLTFTDKRADTHEKLEFHYEGGIKSYVEFLDEKKETLLDEPIYVEGEQN----------GITVEVALQYTNDYRTNLLTFANNIHTYEGGTHESGFKTALTRVINDYATKQNIFKASDANLSGEDVREGLTAVVSVKHPDPQFEGQTKTKLGNADARSVTDRMFSDHFTKFLMENPSIARQIVDKGSLAARARLAAKRAREVTRKKNGLEISNLPGKLADNSSKDPEISELFIVEGDSAGGSAKSGRSRLTQAILPIRGKILNVEKASMEKILANEEIRTLFTAMGTGFGQEFDVEKARYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPIVEAGYVYIAQPPLYRVKQGKMMRYIDSDEELQDVLGTLQPSPKPEVQRYKGLGEMDASQLWETTMDPENRRMLRVNVEDAEEADQIFEMLMGDRVEPRRLFIEENAVYM 651
>gi|78188013|ref|YP_378351.1| DNA gyrase, B subunit [Chlorobium chlorochromatii CaD3] >gi|78170212|gb|ABB27308.1| DNA gyrase subunit B [Chlorobium chlorochromatii CaD3] (637 aa)
Score = 1574, Expect = 9.2e-173, Identities = 336/640 (52%), Positives = 441/640 (68%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVE-----ELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKK-ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A+NI++L+G+E VR RP MYIG    +GLHH+V+EIVDNSIDE + G    I + L  +GS  V D GRGIPV+ H + +KS +E V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY++ K +Y  ++ G  P  D+KV  +  S + GT   F PD  I +  EF  + I  R+++LA+LNK ++I  + +   ++E F F GGI ++V       LN  +EPI    +Y ER+ +V            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSE +  V  VV++   ++   NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF ++KLRY KII+MTDADVDG+HIR LLLTF FR+M P++E G VYIA PPL+    GK   YA+D+      ++  KK + SK    IQRYKGLGEMNP+QLW TTMDP +R LL V++E+A+ AD+VFS LMGD+V PRREFIEKNA+YV+ LD+
  S:     6 YGATNIQVLDGIEHVRMRPAMYIGDIHSRGLHHLVYEIVDNSIDETLGGFNDYIFVALNADGSITVIDHGRGIPVDMHPEKQKSALELVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAYYQRYERG-VPQGDVKVIGD--SDQRGTKTTFMPDGTIFKTTEFRKEIIIDRMRELAFLNKNLRI-IVQDTNGEQEEFHFEGGICEFVRFTDQNRLNLLREPIY---LYGERDGTV------------VEIALQYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNSYAQKNDLLKNLKLTLTGDDFKEGLTAVISVKVAEPQFEGQTKTKLGNSETQSIVETVVNDQLAEFAESNPNTLKLIIEKVKGAAMSREAARKAKELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSFGDEEFAVEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRHMRPVIEAGRVYIAQPPLYLVKSGKDQHYAWDDDERNSIVDNMKKMQKSKANIHIQRYKGLGEMNPEQLWSTTMDPAHRSLLLVSVENAMEADQVFSTLMGDKVEPRREFIEKNARYVRRLDV 637
>gi|126697163|ref|YP_001092049.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9301] >gi|126544206|gb|ABO18448.1| DNA gyrase, subunit B [Prochlorococcus marinus str. MIT 9301] (655 aa)
Score = 1573, Expect = 1.0e-172, Identities = 332/642 (51%), Positives = 448/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG-GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+++E+VDNS+DEA+ G+   I I L  +GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W+KV VY++  E    F+ G  K   + K    K+S K GT + F PD  I     EF+   + SRL++LAYLN G+KI F DER         +E +L+ GGIK++VE +N EKE I P I+Y + +          K N+ VE A Q+ +  Y+++   F NNI T +GG+H EG K  L +  N  A ++   K+ ++ ++ E+  EGLT ++S+K P+P++EGQTK KLGN+EVR  V +++ E   KY+  NP   ++I++K + +  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF    LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E  L++  +       Y IQR+KGLGEM P QLW+TTM+P+ R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++    NLD+
  S:    12 NDYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLIYEVVDNSVDEALAGHCDHIEIVLRADGSALISDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVKVTVYRDGSEFNQRFEKGISKGELESKKQTGKSS-KKGTTICFKPDKTIFSGGIEFEYALLSSRLRELAYLNGGVKIVFRDERNQLSDGSFKEEIYLYQGGIKEYVEYMNAEKESIHPEIIYVDSQ----------KENVYVEAALQWCSDVYSDNILGFANNIRTIDGGTHIEGLKTVLTRTFNNLAKKRGKRKDIEKNLAGENIREGLTVVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLIGEALTKYMEFNPGILDLILEKAIQSFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRNFQAILPLRGKILNIEKTDDTKIYKNTEIQSLITALGLGIKGEEFDESSLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVEKGFIYIACPPLYKVERGKNHNYCYNENQLKDTIQGFGENANYNIQRFKGLGEMMPKQLWDTTMNPQTRMMKRVEIEDALEADRIFNILMGDKVAPRREFIETHS---SNLDM 650
>gi|90960995|ref|YP_534911.1| DNA gyrase subunit B [Lactobacillus salivarius UCC118] >gi|90820189|gb|ABD98828.1| DNA gyrase subunit B [Lactobacillus salivarius UCC118] (652 aa)
Score = 1573, Expect = 1.0e-172, Identities = 351/647 (54%), Positives = 458/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHY--IEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYA-YDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +E K   Y AS I++LEGLEAVRKRPGMYIGST  +GLHH+VWEI+DN IDEA+ G A EI +T+ ++ S  V+D+GRGIPV+   KT +  +ETV TVLHAGGKF    YKVSGGLHGVGASVVNALS+ L V V +E  E+   ++FK G K    + V  +    ++GTIV F PD +I  E   +D + +  R+++LA+LNKG+KI   D+R ++   E F +AGGIK ++E LN  KE I P  +Y E E++           I VEVA QY   ++++  +F NNI+T EGG+HE GFK AL ++IN +  +  L+KE D  +S ED  EGLTA+VSIKHPNPQ+EGQTK KLGNS+ R     + SE F K++LENP  A  I++K LLA +AR  +  ARE TR+K+  E ++LPGKLAD ++KD EISEL+IVEGDSAGGSAK GR R+ QAILP++GKI+NVEKA  D+I +NEEI +L TA+G G G EF + K  Y+K+I+MTDADVDG+HIR LLLT ++R+M P+L+ G VYIA PPL++   GK  KY   DE+  +         K  IQRYKGLGEM+ +QLWETTM+P+NR LL+V + DA  A++VF +LMGD V PRR+FIE NA +V NLD+
  S:    11 QEEKAKEYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIIDNGIDEALAGFADEINVTVEEDNSITVKDNGRGIPVDIQKKTGRPALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLDVKVMREDDENVYGMDFKLG-KVATSMTVVGKCPRHEHGTIVHFKPDPDIFTETTTYDINVLTKRIRELAFLNKGLKITIDDKRQEEPTHEEFHYAGGIKHYIEFLNKGKEVIFPEPIYVEGEQN----------GITVEVALQYTNDFHSNLLSFTNNIHTYEGGTHESGFKTALTRVINDYGRKSGLIKENDANLSGEDVREGLTAVVSIKHPNPQFEGQTKTKLGNSDARKVTDKLFSETFNKFMLENPTVAKQIVEKGLLAAKARIAAKRAREVTRKKNGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKATIDRILANEEIRSLFTALGTGFGEEFDVSKANYHKLIIMTDADVDGAHIRTLLLTLIYRFMKPMLDAGYVYIAQPPLYQVRQGKMIKYIDSDEELNDVLGSLPPSPKPVIQRYKGLGEMDAEQLWETTMNPENRRLLRVELSDAEEANEVFEMLMGDHVGPRRQFIEDNATFVNNLDV 652
>gi|1052804|emb|CAA58771.1| DNA gyrase B subunit; DNA topoisomerase (ATP-hydrolysing) [Streptococcus pneumoniae] (648 aa)
Score = 1573, Expect = 1.1e-172, Identities = 346/647 (53%), Positives = 455/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV    KT +  VETV TVLH+GGKF    YKVSGGLHGVG SVVNALS+ L V V+K  K HY E++ G   VADL++  +  + K GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVGIQEKTGRPAVETVFTVLHSGGKFGGGGYKVSGGLHGVGLSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEIVGD--TDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINSYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|189499015|ref|YP_001958485.1| DNA gyrase, B subunit [Chlorobium phaeobacteroides BS1] >gi|189494456|gb|ACE03004.1| DNA gyrase, B subunit [Chlorobium phaeobacteroides BS1] (644 aa)
Score = 1573, Expect = 1.3e-172, Identities = 333/649 (51%), Positives = 440/649 (67%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIV--PTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + K T    Y A+NI+IL+G+E VRKRP MYIG    +GLHH+++EIVDNSIDE + G    I ++L  +GS  V D+GRGIPV+ H + KKS +E V+T++ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY+E    +  +  G  P  D++V  E  S K GT   F PD +I +  EF  D +  R+++LA+LN  +KI  + +    +ETF + GGIK++V   ++ +  ++  P  +  ER+ +V            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTAI+S+K   PQ+EGQTK KLGNSE +  V ++V+E    +   NP     II+K   A  +R  + +A++ TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF ++KLRY KII+MTDADVDG+HIR LLLTF FRYM  L+E G V+IA PPL+    GK  KYA+D+           KK+  +    IQRYKGLGEMNP+QLW TTMDP++R LL+V++E+A+ AD+VFS LMGD+V PRR FIEKNA+YV+ LD+
  S:     4 IQKNTSPQAYEATNIQILDGIEHVRKRPAMYIGDLHSRGLHHLIYEIVDNSIDETLAGYNESIELSLNPDGSVTVTDNGRGIPVDIHPQKKKSALELVMTLIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYREGNIWFQRYHKG-IPQRDVEVIGE--STKTGTKTTFMPDPDIFKITEFRKDIVVDRMRELAFLNNILKI-VVKDIDGSEETFHYEGGIKEFVTFTDHNRISLLKEPVYISGERDSTV------------VEIALQYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNSYAQKNDLLKNLKLSLTGDDFKEGLTAIISVKVAEPQFEGQTKTKLGNSETQSIVESIVNEQLSDFAESNPGVLKTIIEKVKSAALSRDAARKAKDLTRRKSALESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSVEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRYMRSLIEAGKVFIAQPPLYLIKSGKEQKYAWDDDERNGIVESIRKKQKGRGNINIQRYKGLGEMNPEQLWSTTMDPEHRSLLQVSVENAMEADQVFSTLMGDKVEPRRNFIEKNARYVRRLDV 644
>gi|150003955|ref|YP_001298699.1| DNA gyrase B subunit [Bacteroides vulgatus ATCC 8482] >gi|149932379|gb|ABR39077.1| DNA gyrase B subunit [Bacteroides vulgatus ATCC 8482] (654 aa)
Score = 1572, Expect = 1.6e-172, Identities = 337/648 (52%), Positives = 449/648 (69%)
  Q:     1 MNKETK---KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-------PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKK---ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M++E K   +N YSASNI++LEGLEAVRKRP MYIG    KGLHH+V+E+VDNSIDEA+ G    I +T+ ++ S  VQD+GRGIPV+ H K KKS +E V+TVLHAGGKFD  SYKVSGGLHGVG S VNALS+ +   V++  K +  E+   G P+  +K     A I  GT   F+PD  I    E+  D +++R+++LAYLNKGI I+  D R  +      KE F    G+K++V  LN   E ++  ++Y           N +K N  +E A  YN  Y  S  ++ NNINT EGG+HE GF+ AL +++ K+A + K L++   +IS ED  EGL A++S+K   PQ+EGQTK KLGNSEV   V+  V E    YL E+P++A  I+ K +LA  AR  + +ARE+ +RKSP     LPGKLADCS+++ E  EL++VEGDSAGGSAK GR R FQAILPL+GKI+NVEKA   K F ++E+ N+ITA+G   G        +  IDKLRY+K+++MTDADVDGSHI  L++T  +RYM  ++ENG++YIA PPL+K S GK S+Y Y E+  + F +   +  +     QRYKGLGEMNP+QLWETTM+P+ R+L +VTI++A N D +FS+LMGD+VAPRREFIEKNA Y  N+D
  S:     1 MSEEEKINGENNYSASNIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTQVFRGGKIYQQEYS-CGHPLYSVKEVG-TADI-TGTKQTFWPDDTIFTVTEYKFDILQARMRELAYLNKGITISLTDRRIKEEDGSFKKEIFHSDEGVKEFVRFLNRNNEALINDVIY----------LNTEKNNTPIECAIMYNTGYRESLHSYVNNINTIEGGTHEAGFRSALTRVLKKYAEDTKALEKAKVEISGEDFREGLIAVISVKVAEPQFEGQTKTKLGNSEVSGAVNQAVGEALTYYLEEHPKEAKQIVDKVILAATARIAARKARESVQRKSPMGGGGLPGKLADCSSRNPEECELFLVEGDSAGGSAKQGRSRAFQAILPLRGKILNVEKAMWHKAFESDEVNNIITALGVRFGVDGNDDSKKANIDKLRYHKVVIMTDADVDGSHIDTLIMTLFYRYMPEIIENGHLYIANPPLYKCSKGKISEYCYTEEARQAFIQKYGDGQENGIHTQRYKGLGEMNPEQLWETTMNPETRILKQVTIDNAANVDYIFSMLMGDDVAPRREFIEKNATYA-NID 653
>gi|78780112|ref|YP_398224.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9312] >gi|78713611|gb|ABB50788.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9312] (655 aa)
Score = 1571, Expect = 1.9e-172, Identities = 324/634 (51%), Positives = 439/634 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNA 641
           N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+   I I L  +GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W+ V VY++  E    F+ G            K   K GT + F PD  I     EF+   + SRL++LAYLN G+KI F DER         +E +L+ GGIK++V+ +N EKE I P I+Y + +          K N+ VE A Q+ +  Y+++   F NNI T +GG+H EG K  L +  N  A ++   K+ ++ ++ E+  EGLT ++S+K P+P++EGQTK KLGN+EVR  V +++ E   K++  NP   +++++K + +  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF +  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+ KY Y+E  L++          Y IQR+KGLGEM P QLW+TTM+P+ R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++
  S:    12 NEYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDHIEIVLQSDGSALISDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVNVTVYRDGSEFNQRFEKGVSQNVLQSKKQTKKPFKKGTTICFKPDKTIFSGGIEFEYALLSSRLRELAYLNGGVKIVFRDERNKLSDGSFKEEIYLYQGGIKEYVQYMNAEKEAIHPDIIYVDSQ----------KENVYVEAALQWCSDVYSDNILGFANNIRTIDGGTHIEGLKTVLTRTFNNLAKKRGKRKDIEKNLAGENIREGLTVVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLIGEALTKFMEFNPGILDLVLEKAIQSFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPAESEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNIEKTDDTKIYKNTEIQSLITALGLGIKGEEFDVSSLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVEKGYIYIACPPLYKVERGKNHKYCYNENQLKDTIGSFGENANYNIQRFKGLGEMMPKQLWDTTMNPQTRMMKRVEIEDALEADRIFNILMGDKVAPRREFIETHS 645
>gi|194335198|ref|YP_002016992.1| DNA gyrase, B subunit [Pelodictyon phaeoclathratiforme BU-1] >gi|194307675|gb|ACF42375.1| DNA gyrase, B subunit [Pelodictyon phaeoclathratiforme BU-1] (649 aa)
Score = 1571, Expect = 1.9e-172, Identities = 334/641 (52%), Positives = 435/641 (67%)
  Q:     9 TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVE-----ELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +Y A+NI++L+G+E VR RP MYIG    +GLHH+V+EIVDNSIDE + G    I ++L  +GS  V D GRGIPV+ H + +KS +E V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +V V ++ K ++  F + G P  D+KV    +S   GT   F PD  I +  E   D I  R+++LA+LNK + I  + +    +E F + GGIK++V+      LN  KEPI    +Y ER+ ++            VE+A QYN TY  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSE +  V  V++E   ++   NP    +II+K   A  +R+ +  A+E TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF ++KLRY KII+MTDADVDG+HIR LLLTF FRYM  L+E G V+IA PPL+    GK  +YA+D++          K +  K    IQRYKGLGEMNP+QLW TTMDP +R LL V +E+A+ AD+VFS LMGD+V PRREFIEKNA+YV+ LD+
  S:    17 SYGATNIQVLDGIEHVRMRPAMYIGDIYSRGLHHLVYEIVDNSIDETLGGFNDYIFVSLNPDGSVTVIDHGRGIPVDIHPEKQKSALELVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVSRDGKLYFQRF-ERGVPQGDVKVIG--SSDHRGTKTTFLPDHLIFKTTELRKDIIIDRMRELAFLNKELSIT-VQDTEGFQEIFHYEGGIKEFVQFTDQNRLNLLKEPIY---LYGERDSTI------------VEIALQYNDTYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNAYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVAEPQFEGQTKTKLGNSETQSIVETVINEQLSEFAESNPNVLKMIIEKVKGAAMSREAARRAKELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSVEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRYMRALIEAGRVFIAQPPLYLVKSGKDQQYAWDDEERNSISDGMKKMQKGKANIHIQRYKGLGEMNPEQLWSTTMDPAHRSLLLVNVENAMEADQVFSTLMGDKVEPRREFIEKNARYVRRLDV 649
>gi|159035681|ref|YP_001534934.1| DNA gyrase, B subunit [Salinispora arenicola CNS-205] >gi|157914516|gb|ABV95943.1| DNA gyrase, B subunit [Salinispora arenicola CNS-205] (648 aa)
Score = 1571, Expect = 2.0e-172, Identities = 336/643 (52%), Positives = 446/643 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE-------TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFS---VGKSSKYAYDEK------TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  Y A +I +LEGLEAVRKRPGMYIGST  +GLHH+VWE+VDN++DEA+ G    I + L  +G  +V D+GRG PV+ H K KK  VE  LTVLHAGGKFD  +Y VSGGLHGVG SVVNALS+ + V + K+   +++ Y + K    P+   + T+       G+ V F+PD  + E  +FD  TI  RL+++A+LN+G+ I+F+DER    E       TF + GGI  +V  LN  K PI  ++V    EE            + VE+A Q+N++Y  S +TF NNINT EGG+HEEGF+ AL  +IN++  +K+LLK +DEK+S ED  EGL AI+S+K  NPQ+EGQTK KLGN+ V+ FV  V +E    +L  NP +A VII K   A  AR  + +AR+  RRKS  ES S+PGKLADC + D    E++IVEGDSAGGSAK GRD   QAILP++GKI+NVEKA+ D++  N E+  LITA+G G+  +F I+KLRY+KI+LM DADVDG HI+ LLLT LFR+M PL+E G+VY+A PPL+K      G  ++YAY ++       L + KK N+K    IQR+KGLGEMN  +LWETTM+P  R L +VT++DA  AD++FS+LMG++V  RR FI++NAK V+ LDI
  S:     6 KQEYGAESITVLEGLEAVRKRPGMYIGSTGERGLHHLVWEVVDNAVDEALAGYCDTIDVVLLADGGVRVTDNGRGFPVDPHPKLKKPGVEVALTVLHAGGKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIQKDGYFWRQSYTDSKP--SPLEKGEPTD-----ATGSAVSFWPDPAVFETVDFDFQTIYRRLQEMAFLNRGLTIHFLDERVAADEDGKMREVTFCYKGGIADFVRHLNASKTPIHKSVVEFGTEED----------GMSVEIAMQWNESYGESVYTFANNINTHEGGTHEEGFRAALTSVINRYGADKRLLK-SDEKLSGEDIREGLAAIISVKLTNPQFEGQTKTKLGNTPVKSFVQRVCNEWLVDWLDRNPAEAKVIITKASQAARARVAAQQARKLARRKSLLESGSMPGKLADCQSTDPRECEVFIVEGDSAGGSAKQGRDPRTQAILPIRGKILNVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADADVDGQHIQTLLLTLLFRFMRPLVELGHVYLAAPPLYKIKWNRKGDDAQYAYSDRERDGLIALRQQKKPNAKPD-DIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSVLMGEDVEARRSFIQRNAKDVRFLDI 648
>gi|146300010|ref|YP_001194601.1| DNA gyrase, B subunit [Flavobacterium johnsoniae UW101] >gi|146154428|gb|ABQ05282.1| DNA gyrase subunit B [Flavobacterium johnsoniae UW101] (646 aa)
Score = 1570, Expect = 2.3e-172, Identities = 337/648 (52%), Positives = 445/648 (68%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK--PVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDER-TDDK-----ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-----PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M++E KKN YSA +I+ LEG+E VR RP MYIG   ++GLHH+V+E+VDNSIDEAM G+   I +T+ ++GS  V+D+GRGIPV+ H K   S +E V+T + AGGKFD DSYKVSGGLHGVG SVVNALS  +K  V++E K +  E++ G    PV  +  T+     K GT   F+PD  I ++  EF  DT+ +R+++L++LNKGI I F D+R  DDK     E F    G+K+++  L+  +EPI+  ++  + E          K  I VEVA  YN +Y+ + F++ NNINT EGG+H +GF+  L + + K+A    LL +   +IS +D  EGLTAI+S+K   PQ+EGQTK KLGN EV   VS  V E+ E YL ENP DA +II+K +LA +AR  + +ARE  +RK+      LPGKL+DCS +D    E+Y+VEGDSAGG+AK GRDR FQAILPL+GKI+NVEKA   K+F NEEI N+ TA+G  VG         I+KLRY+K+I+M DADVDGSHI  L+LTF FR+M  L+E G+VYIA PPL+    G   +YA+++   ++   E       IQRYKGLGEMN +QLWETTMDP+ R L +VTI+    AD+VFS+LMGDEV PRREFIEKNA Y  N+D
  S:     1 MSEEIKKNNYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEAMGGHCDTIGVTINEDGSVTVEDNGRGIPVDLHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSVVNALSVHMKSTVFREGKIYEQEYERGKSLYPVKQIGETD-----KRGTRQTFFPDDTIFQQTTEFSYDTLSARMRELSFLNKGITITFTDKREVDDKGEFKSEVFHSDEGLKEYIRYLDGNREPIISHVISMDHE----------KGEIPVEVALIYNTSYSENIFSYVNNINTHEGGTHLQGFRSGLTRTLKKYADASGLLDKLKFEISGDDFREGLTAIISVKVSEPQFEGQTKTKLGNREVVSPVSQAVGEMLENYLEENPNDAKIIIQKVILAAQARHAAKKAREMVQRKTVMGGGGLPGKLSDCSEQDPARCEVYLVEGDSAGGTAKQGRDRNFQAILPLRGKILNVEKAMHHKVFENEEIRNIFTALGVTVGTAEDSKALNIEKLRYHKVIIMCDADVDGSHISTLILTFFFRFMKELIEEGHVYIAAPPLYLVKKGNKKEYAWNDVQRDQ-ANERMGGSANIQRYKGLGEMNAEQLWETTMDPQFRTLRQVTIDSLAEADRVFSMLMGDEVPPRREFIEKNAVYA-NID 645
>gi|98990338|gb|ABF60237.1| DNA gyrase subunit B [Entomoplasma freundtii] (608 aa)
Score = 1570, Expect = 2.6e-172, Identities = 327/616 (53%), Positives = 437/616 (70%)
  Q:    33 GSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYN-IRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLK---ETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSK-VKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           GST   GLHH+VWEI+DNSIDEAM G A+ I +T+TK+G   V+D+GRGIPV     T +S +E V T LHAGGKFD+DSYK+SGGLHGVGASVVNALS ++ V V +E K ++  F  GG   + L+V +   + + GT+V F PD  I  E   FD  TIK+++KQLAYLNKGI+I  ID R D   T+ F  GI  +V E N  K+PI P I Y +            KY+ + VEVA QYN  YN++  TF NNINT EGG+HE+G + AL + IN++A  +K+ K   ++ +K   +D  EG+  I+SI+H +P +EGQTK KL N   +  V NVV + FE++L+++P DA  I+ K   A +AR  +  ARE TRRK   ++ SLPGKLADC TKD  I+ELY+VEGDSAGGSAK GR+R FQAILPL+GK++NVEK +  + FSN EI +++TA+G G+  +  + KLRYNKI++MTDADVDG+HIR LLLTF +RYM  L+ +G++YIA PPL+K   GK   YAY ++ LE+FK  + K ++Y IQRYKGLGEM+P QLWETTM+P+ R +L+VT+EDA  A++VFS LMG++   RR+FI++NA +V+N+D
  S:     1 GSTSKAGLHHLVWEILDNSIDEAMAGYANRIVVTITKDGEVVVEDNGRGIPVGVQHDTGRSALELVFTQLHAGGKFDSDSYKISGGLHGVGASVVNALSEYVDVLVKREGKVYHQVFSHGGTKQSALEVID--TTNETGTVVRFKPDPTIFQETVIFDYITIKNKVKQLAYLNKGIEITLIDYRIDKTITYHFPNGILDYVREENANKQPINPNIFYVD-----------GKYDGVEVEVALQYNADYNDNLITFVNNINTHEGGTHEDGIRQALVRTINRYA--EKVAKNGAKSAQKFGWDDIKEGMIGILSIRHSDPSFEGQTKTKLSNLNAKKAVDNVVGDAFEEFLMKSPLDAKAILDKNSTAQKARLAAQRAREETRRKGALDTFSLPGKLADCETKDPTIAELYLVEGDSAGGSAKTGRNRFFQAILPLRGKVLNVEKVQEARAFSNNEIKSIVTAVGCGIKEDVNVCKLRYNKIVIMTDADVDGAHIRTLLLTFFYRYMKDLVRHGHIYIAQPPLYKIEAGKKVAYAYSDQQLEDFKNGDYKNLRYTIQRYKGLGEMDPLQLWETTMNPEFRTMLQVTLEDAAIANEVFSNLMGEDPELRRDFIQENASFVENID 607
>gi|148985841|ref|ZP_01818935.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP3-BS71] >gi|73916286|gb|AAZ93011.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916318|gb|AAZ93027.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916322|gb|AAZ93029.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916344|gb|AAZ93040.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|147921987|gb|EDK73111.1| DNA gyrase, B subunit [Streptococcus pneumoniae SP3-BS71] (648 aa)
Score = 1570, Expect = 2.7e-172, Identities = 345/647 (53%), Positives = 456/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VA+L++  +  + K GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGL A++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QLWETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVAELEIVGD--TDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLAAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|24379696|ref|NP_721651.1| DNA gyrase subunit B [Streptococcus mutans UA159] >gi|24377654|gb|AAN58957.1|AE014963_1 putative DNA gyrase subunit B [Streptococcus mutans UA159] (650 aa)
Score = 1570, Expect = 2.8e-172, Identities = 348/648 (53%), Positives = 452/648 (69%)
  Q:     2 NKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERT--DDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N +     Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + + ++ S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E+  G     DLKV  +  +   GTIV F PD EI  E  EFD D +  R+++LA+LNKG+KI+  D+R+  + KE F + GGI  +VE +N  KE I    +Y +               I VEVA QY   ++ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + K+LKE ++ ++ +D  EGLTAI+S+KHPNPQ+EGQTK KLGNSEV    + + S+   ++LLENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ D   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K+++MTDADVDG+HIR LLLT ++R+M P+LE G VYIA PP++   VG   K        +E K + +  KY        +QRYKGLGEM+  QLWETTM+P NRL+ +V+++DA  ADK+F +LMGD V PRR FIE+NA Y   LD+
  S:     7 NLDQLAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEEDNSITVIDDGRGIPVDIQQKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVHKNGKIHYQEYHRG-VVAEDLKVIGD--TDITGTIVHFTPDPEIFTETTEFDFDKLAKRIQELAFLNKGLKISITDKRSGQERKEEFHYEGGIVSYVEFINENKEVIFDKPIYTDGSLD----------GISVEVAMQYTTGFHENIMSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKILKENEDNLNGDDVREGLTAIISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSDALNRFLLENPQIAKKIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDPIQNELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKATMDKILANEEIRSLFTAMGTGFGAEFDVSKSRYQKLVIMTDADVDGAHIRTLLLTLIYRFMRPVLEAGYVYIAQPPIYGIKVGSDIKEYIQPGNDQEEKLQEALEKYSQGRSKPTVQRYKGLGEMDDHQLWETTMNPDNRLMARVSLDDAAEADKIFDMLMGDRVEPRRGFIEENAVY-STLDV 650
>gi|126662002|ref|ZP_01733001.1| DNA gyrase, B subunit [Flavobacteria bacterium BAL38] >gi|126625381|gb|EAZ96070.1| DNA gyrase, B subunit [Flavobacteria bacterium BAL38] (646 aa)
Score = 1570, Expect = 3.0e-172, Identities = 328/645 (50%), Positives = 439/645 (68%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK--PVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDER------TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-----PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           M++E KK +YSA +I+ LEG+E VR RP MYIG T ++GLHH+V+E+VDNSIDEA+ G+   I + + ++ S  V+D+GRGIPV+ H K   S +E V+T + AGGKFD DSYKVSGGLHGVG S VNALS  L+  VY+E K +  E++ G    PV  +  T      K GT+V F PD  I  +  E+  DT+ SRL++L++LNKGI I   D+R      +   ETF    G+K++V+ L+  +EPI+  ++  E E+S           I VEVA  YN +Y  + F++ NNINT EGG+H +GF+  L + + K+A    LL +   +IS +D  EGLTAI+S+K   PQ+EGQTK KLGN EV   VS  VSE+ E YL ENP DA +I++K +LA +AR  + +ARE  +RK+      LPGKL+DCS +D    E+++VEGDSAGG+AK GRDR FQAILPL+GKI+NVEKA   K+F NEEI N+ TA+G  +G         ++KLRY+K+++M DADVDGSHI  L+LTF FRYM  L+E G+VYIA PPL+    G   +YA+++    +   E       IQRYKGLGEMN +QLW+TT++P+NR   +VTI+    AD+VFS+LMGDEV PRREFIEKNA Y K
  S:     1 MSEENKKGSYSADSIQALEGMEHVRMRPSMYIGDTGVRGLHHLVYEVVDNSIDEALAGHCDTIYVAINEDNSITVEDNGRGIPVDLHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSDHLRATVYREGKVYEQEYERGKAMYPVKQIGTTE-----KRGTMVTFKPDATIFTQTLEYSYDTLASRLRELSFLNKGITITLTDKRHLAEDGSQPVETFHSKEGLKEFVKFLDGNREPIISHVISMEHEKS----------EIPVEVALIYNTSYTENIFSYVNNINTHEGGTHLQGFRMGLTRTLKKYADSSGLLDKLKFEISGDDFREGLTAIISVKVQEPQFEGQTKTKLGNREVVSPVSQAVSEMLENYLEENPNDAKIIVQKVILAAQARHAAKKAREMVQRKTVMGGGGLPGKLSDCSEQDPAKCEIFLVEGDSAGGTAKQGRDRFFQAILPLRGKILNVEKAMQHKVFENEEIRNIFTALGVTIGTAEDSKALNLEKLRYHKVVIMCDADVDGSHISTLILTFFFRYMKELIEKGHVYIAAPPLYLVKKGNKKEYAWND-VQRDVANERMGGSAAIQRYKGLGEMNAEQLWDTTLNPENRTFRQVTIDSLAEADRVFSMLMGDEVPPRREFIEKNASYAK 643
>gi|153815427|ref|ZP_01968095.1| hypothetical protein RUMTOR_01662 [Ruminococcus torques ATCC 27756] >gi|145847286|gb|EDK24204.1| hypothetical protein RUMTOR_01662 [Ruminococcus torques ATCC 27756] (645 aa)
Score = 1569, Expect = 3.2e-172, Identities = 349/640 (54%), Positives = 453/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSK-VKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNA--DKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A  I+ILEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNS+DEA+ G   EI + + K+ S  V D+GRGIPV  + K     VE V TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V +Y +   YK+ Y    + GK V  LKV  E    + GT V F+PD EI +   FD DT+K R +++A+L KG+KI   D R ++  + TF + GGIK++V  LN  K P+   I+Y E            K  + VE+A Q+N +Y+ +T+ F NNI T EGG+H EGF+ AL K  N +A + KLLK+++  +S +D  EGLTAIVS+K  +PQ+EGQTK+KLGNSE R  V++++S   E +L +NP  A + ++K ++A  AR+ + +AR+ TRRKS  E  SLPGKLADCS KD    E+YIVEGDSAGGSAK  RDR  QAILPL+GKI+NVEKA+ DKI++N EI  +ITA G G+  +F I KLRY+KII+MTDADVDG+HI  LLLTFL+R+M  L++ G VY+A PPL+K    K   YAY ++ L +   E  +    +IQRYKGLGEM+ DQLWETTMDP++R+LL+VT+++  ++  D  F+ LMGD+V PRREFIE+NAKYVKNLDI
  S:    12 YGADQIQILEGLEAVRKRPGMYIGSTSTRGLHHLVYEIVDNSVDEALAGYCDEIQVNINKDNSVTVCDNGRGIPVGINHKAGLPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVEIYHDGQIYKQRY----ERGKVVYKLKVVGECEPDRTGTTVTFFPDAEIFDDTVFDYDTLKQRFREMAFLTKGLKIVLRDWRGEELREHTFHYEGGIKEFVTYLNKSKTPLYEQIIYCEGM----------KDGVAVEIAMQHNDSYSENTYGFVNNITTPEGGTHIEGFRGALTKTFNDYARKNKLLKDSEPNLSGDDIREGLTAIVSVKIEDPQFEGQTKQKLGNSEARGAVNSILSTQLEIFLEQNPSVAKITVEKSVMAQRAREAARKARDLTRRKSALEGMSLPGKLADCSDKDPVNCEIYIVEGDSAGGSAKTARDRATQAILPLRGKILNVEKARLDKIYANAEIKAMITAFGTGIHEDFDISKLRYHKIIIMTDADVDGAHISTLLLTFLYRFMPDLIKEGYVYLAQPPLYKLEKNKKVWYAYSDEELNQILTEVGRDSNNKIQRYKGLGEMDADQLWETTMDPEHRILLRVTMDEETSSELDLTFTTLMGDKVEPRREFIEENAKYVKNLDI 645
>gi|153952676|ref|YP_001393441.1| DNA gyrase subunit B [Clostridium kluyveri DSM 555] >gi|146345557|gb|EDK32093.1| GyrB1 [Clostridium kluyveri DSM 555] (637 aa)
Score = 1569, Expect = 3.4e-172, Identities = 351/646 (54%), Positives = 459/646 (71%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLE----EFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           + KK TY  + I+ILEGLEAVRKRPGMYIGST ++GLHH+V+EIVDNSIDEA+ G   +I + + ++ S  V D+GRG+PV  H K KK TVE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS   +V V +E K  + +    GK    L++  +  S ++GT + F PD EI +  +FD D +  RL++LA+LNKGI I   DER+  +E F + GGIK +V  LN  K+ I         +E +     K  Y+  VE+AFQYN  Y+ + F+F NNI+T EGG+H  GFK AL ++ N +A +  +LKE D+ +S ED  EG+TA++SIK  +PQ+EGQTK KLGNSEVR  V N+++E    +L ENP+ A  II K L+A  AR+ + +ARE TRRK+  E+ SLPGKLADCS+KD    E+Y+VEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI   EEI  +ITA GAG+G +F I K+RYNKII+MTDADVDG+HIR LLLTF +RYM  L+E  +VYIA PPL+K +  K   YAY +K L+    E   +NS V   IQRYKGLGEM+ +QLW+TTM+P+ R L++V +ED + AD++F++LMGD+V PR++FI +NAK V NLDI
  S:     3 QEKKQTYDENQIQILEGLEAVRKRPGMYIGSTSLRGLHHLVYEIVDNSIDEALAGYCDKIDVVIHEDNSVTVADNGRGMPVGIHHKIKKPTVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEICEVEVKRE-KHVWKQVFKRGKVATGLEIIGD--SEEHGTKIYFKPDKEIFDEVDFDYDMLSQRLRELAFLNKGIAITLKDERSGKEELFHYEGGIKSFVTYLNRNKQTI--------HKEPIYVEGIKGDYS--VEIAFQYNNGYSENIFSFANNIDTIEGGTHLAGFKSALTRVFNDYAKKFNILKENDKNLSGEDIREGITAVISIKLVDPQFEGQTKTKLGNSEVRGIVDNIMAESLSDFLQENPQVAKTIIDKSLVASRAREAARKARELTRRKTVLENTSLPGKLADCSSKDPSECEIYLVEGDSAGGSAKQGRDRRFQAILPLRGKIMNVEKQRLDKILGYEEIRAMITAFGAGIGKDFDISKIRYNKIIIMTDADVDGAHIRTLLLTFFYRYMRELVEKCHVYIAQPPLYKVAKNKKDYYAYSDKELDILLNEIGGKNSNV--NIQRYKGLGEMDSEQLWDTTMNPETRTLIQVNVEDTIAADEIFTILMGDKVEPRKDFIIENAKKVVNLDI 637
>gi|188588443|ref|YP_001919471.1| DNA gyrase, B subunit [Clostridium botulinum E3 str. Alaska E43] >gi|188498724|gb|ACD51860.1| DNA gyrase, B subunit [Clostridium botulinum E3 str. Alaska E43] (635 aa)
Score = 1568, Expect = 4.9e-172, Identities = 352/646 (54%), Positives = 449/646 (69%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E     Y  + I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + K+ S    DDGRG+PV  H K  KS VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS    V V +E   +++ Y +    GK + DLK   +    ++GT + F PD EI +  EFD DT+  RL++LA+LNKGI I  ID R D +E + + GGIK +V  LN  K P+ P  +Y E          KDK  + VE+  QYN  Y  + F+F NNI+T EGG+H  GFK AL +  N +A     +KE D+  S +D  EGLTA++S+K  +PQ+EGQTK KLGNSEV+  V ++VSE    +L ENP  + +II K L+A  AR+ + +ARE TR KS  E  +LPGKLADCS+KD    E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI ++E I +++TA G G+G +F I+K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPLF+   GK   YAY +  L++       K+NS     IQRYKGLGEMN  QLW+TTMDP  R+LLK  IEDA+ AD++F++LMG++V PRREFIE+NAK V NLDI
  S:     2 EQNNQKYDENQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSIDEALAGYCKNIKVKINKDNSITSSDDGRGMPVGMHPKMHKSAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEQCIVTVKREGHIWQQEYSK----GKVLYDLKQIGDTE--ESGTTIYFKPDAEIFDEVEFDFDTLSQRLRELAFLNKGINITLIDCRDDREENYYYEGGIKSFVAYLNRNKTPLHPEPIYVE--------GIKDK--VTVELGLQYNDGYTENLFSFANNIDTIEGGTHLVGFKTALTRAFNDYAKRFGFIKENDKNFSGDDIREGLTAVISVKIEDPQFEGQTKTKLGNSEVKGIVDSIVSEYIGIFLEENPGTSKIIIDKALMAARAREAARKARELTR-KSVLERTTLPGKLADCSSKDPRECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEKQRLDKILNSETIRSMVTAFGGGIGKDFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRELVEQGHVYIAQPPLFRVGKGKKETYAYSDAELDQVLQDMGGKDNS---VDIQRYKGLGEMNATQLWDTTMDPSKRILLKAEIEDAMAADEIFTILMGEKVEPRREFIEQNAKNVVNLDI 635
>gi|78707345|gb|ABB46478.1| DNA gyrase subunit B [Acholeplasma equifetale] >gi|78707347|gb|ABB46479.1| DNA gyrase subunit B [Acholeplasma equifetale] (588 aa)
Score = 1568, Expect = 5.0e-172, Identities = 324/600 (54%), Positives = 427/600 (71%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           VRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A  I I + K+   +V D+GRGIPV+ H KT +  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVN LS W  V ++K+ K +  ++ + G P  DLK   E  + + GTI  F  D  I  E   +D +T+++R++QLA+LN+GI I+  D R ++   +ETF + GGI ++V+ LN  K+ I P I+Y E+E+            + VEVA QY  TY  +  +F NNI+TTEGG HE+G+K AL ++I+++A + K  K  D+ I  ED  EGLTAI+S+KHP PQ+EGQTK KLGN EVR   S V  E  E++LLENP+ A  I++K + A  AR  S +A+E  RRKSP +      KLADC +KD E SEL+IVEGDSAGGSAK GRD  FQAILPL+GK++NVEKA+ D +  N+EIIN+I AIG G+  EF I KLRY+KI++MTDADVDG+HIR LLLTF FR+M PL+ENG++Y A PPL+K S G++ KYAY ++ L E   +  + K  +QRYKGLGEMN +QLW+TTM+P+ R LL++ ++DA+ AD++F+
  S:     1 VRKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYADHIEIEVLKDNVIRVSDNGRGIPVDIHPKTGRPAVETILTTLHAGGKFDKGSYKVSGGLHGVGASVVNGLSVWYVVEIHKDGKIYEQKY-ERGIPAYDLKELGE--TNRTGTITTFKADPLIFTETTVYDIETLRTRIQQLAFLNRGITISLSDSRDENHIYQETFKYDGGIIEYVKFLNQNKKTIHPDIIYFEKEQD----------GVTVEVAMQYVDTYTPNIHSFTNNISTTEGGMHEDGYKMALTRVISRYADDMKAKK--DDAIIGEDTREGLTAIISVKHPEPQFEGQTKTKLGNPEVRAITSQVTQEALERFLLENPQQAKSIVEKVIEATRARVASRKAKELARRKSPLDQLDFASKLADCRSKDPEKSELFIVEGDSAGGSAKQGRDSEFQAILPLRGKVLNVEKARIDTMLKNKEIINIIQAIGTGISEEFDISKLRYHKIVIMTDADVDGAHIRTLLLTFFFRHMRPLIENGHIYAAQPPLYKVSYGRNVKYAYSDEELNEITSK-LETKPTLQRYKGLGEMNYEQLWDTTMNPETRTLLQIQLDDAIEADQIFT 588
>gi|21675071|ref|NP_663136.1| DNA gyrase subunit B [Chlorobium tepidum TLS] >gi|21648310|gb|AAM73478.1| DNA gyrase subunit B [Chlorobium tepidum TLS] (647 aa)
Score = 1566, Expect = 7.7e-172, Identities = 327/640 (51%), Positives = 439/640 (68%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIV--PTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKK-ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A+NI++L+G+E VRKRP MYIG    +GLHH+V+EIVDN+IDE + G    I + +  +GS  V D GRGIPV+ H   KKS +E V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY++ K     ++ G   V    V     + + GT V F PD EI +  EF  D I  R+++LA+LN  ++I  + +   ++E F + GG+K++V  +++ +  ++  P  +  ER+ ++            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K P PQ+EGQTK KLGNSE +  V  +V+E   ++   NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D +  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G  +G  EF  +KLRY KII+MTDADVDG+HIR LLLTF FRYM  L+E G V+IA PPL+    G+  +YA+DE      +E+ KK +  K    IQRYKGLGEMNP+QLW TTMDP +R LL+VT+E+A+ AD+VFS LMGD+V PRR+FIEKNA+YV+ LD+
  S:    16 YGATNIQVLDGIEHVRKRPAMYIGDIHSRGLHHLVYEIVDNAIDETLAGYNDYIHVAMNPDGSVTVTDHGRGIPVDIHPVKKKSALELVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYRDGKIFRQTYRRG---VPQGGVEEIGTTDQRGTKVTFKPDPEIFKITEFRKDIILDRMRELAFLNSNLRI-IVQDAEGNEEIFHYEGGLKEFVRFIDSNRLSLLKEPIFLSGERDSTM------------VEIALQYNDSYQENIFSYVNNINTHEGGTHVTGFRKALTRTLNAYAQKNDLLKNVKITLTGDDFKEGLTAVISVKVPEPQFEGQTKTKLGNSETQSIVETIVNEQLAEFAESNPGTLKLIIEKVKSAAISREAARKAKELTRRKSVLESSGLPGKLADCSINDPDHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSIGEEEFSPEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRYMRSLIEAGKVFIAQPPLYLVKSGREQQYAWDEDERLSIVEQMKKLQKGKANVSIQRYKGLGEMNPEQLWSTTMDPAHRSLLQVTVENAMEADQVFSTLMGDKVEPRRDFIEKNARYVRRLDV 647
>gi|145218835|ref|YP_001129544.1| DNA gyrase subunit B [Prosthecochloris vibrioformis DSM 265] >gi|145204999|gb|ABP36042.1| DNA gyrase subunit B [Prosthecochloris vibrioformis DSM 265] (642 aa)
Score = 1565, Expect = 8.9e-172, Identities = 331/640 (51%), Positives = 435/640 (67%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWV-----EELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKK--ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A+NI++L+G+  VR RP MYIG    +GLHH+++EIVDNSIDE + G    I ++L  +GS  V D GRGIPV+ H   KKS +E V+T++ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY++ K  +  +  G  P  D+K     A+ + GT   F PD EI +  EF  D I  R+++LA+LN  +KI  + +   ++ETF F GG+K++V       LN  KEP+    +Y E++ ++            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSE +  V +V++E    +   NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF  +KLRY KII+MTDADVDG+HIR LLLTF FR+M  L+E G VYIA PPL+    GK  +YA+D++            K    IQRYKGLGEMNP+QLW TTMDP++R LL+V++E+A+ ADKVFS LMGD+V PRREFIEKNA+YV+ LD+
  S:    14 YGATNIQVLDGIAHVRMRPAMYIGDIHSRGLHHLIYEIVDNSIDETLGGYNDYIFVSLNPDGSVTVIDHGRGIPVDIHPDKKKSALELVMTLIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAWFQRYHRG-VPEGDVKEIG--ATSERGTKTTFMPDPEIFKVTEFRKDIIIDRMRELAFLNSNLKI-VVQDIEGEQETFHFEGGLKEFVLFTDANRLNLIKEPVY---IYGEKDSTI------------VEIALQYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNSYAQKNDLLKNLKLALTGDDFKEGLTAVISVKVAEPQFEGQTKTKLGNSETQSIVESVLNEQLSDFAESNPNVIKMIIEKVKGAAMSREAARKAKELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKLLENEEIKTIILALGTNFGEEEFSQEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRHMRSLIEAGKVYIAQPPLYLVKAGKDQQYAWDDEERNSIADMMRKGKANVHIQRYKGLGEMNPEQLWSTTMDPEHRSLLQVSVENAMEADKVFSTLMGDKVEPRREFIEKNARYVRRLDV 642
>gi|157414241|ref|YP_001485107.1| DNA gyrase subunit B [Prochlorococcus marinus str. MIT 9215] >gi|157388816|gb|ABV51521.1| DNA gyrase, subunit B [Prochlorococcus marinus str. MIT 9215] (655 aa)
Score = 1565, Expect = 1.0e-171, Identities = 330/642 (51%), Positives = 446/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDG-GKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+   I I L  +GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W+ V VY++  E    F+ G  K     K    K+S K GT + F PD  I     EF+   + SRL++LAYLN G+KI F DER         +E +L+ GGIK++VE +N EK+ I P I+Y + +          + N+ VE A Q+ +  Y+++   F NNI T +GG+H EG K  L +  N  A ++   K+ ++ ++ E+  EGLT ++S+K P+P++EGQTK KLGN+EVR  V +++ E   KY+  NP   ++I++K + +  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF +  LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E  L+   +       Y IQR+KGLGEM P QLW+TTM+P+ R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++    NLD+
  S:    12 NDYGAEQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDHIEIVLRADGSALISDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVNVTVYRDGSEFNQRFEKGLSKGELQTKKQIGKSS-KKGTTICFKPDKTIFSGGIEFEYALLSSRLRELAYLNGGVKIVFRDERNQLSDGSFKEEIYLYQGGIKEYVEYMNAEKDSIHPEIIYVDSQ----------RENVYVEAALQWCSDVYSDNILGFANNIRTIDGGTHIEGLKTVLTRTFNNLAKKRGKRKDIEKNLAGENIREGLTVVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLIGEALTKYMEFNPGILDLILEKAIQSFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRNFQAILPLRGKILNIEKTDDTKIYKNTEIQSLITALGLGIKGEEFDVSSLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVEKGFIYIACPPLYKVERGKNHNYCYNENQLKNTIEGFGENANYNIQRFKGLGEMMPKQLWDTTMNPQTRMMKRVEIEDALEADRIFNILMGDKVAPRREFIETHS---SNLDM 650
>gi|120437084|ref|YP_862770.1| DNA gyrase subunit B [Gramella forsetii KT0803] >gi|117579234|emb|CAL67703.1| DNA gyrase subunit B [Gramella forsetii KT0803] (646 aa)
Score = 1565, Expect = 1.0e-171, Identities = 328/648 (50%), Positives = 449/648 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M++E KK+ YSA +I+ LEG+E VR RP MYIG T ++GLHH+V+E+VDNSIDEA+ G+   I +T+ ++ S   +D+GRGIP++ H K   S ++ V+T + AGGKFD DSYKVSGGLHGVG S VNALS  L   V+++ +    E+ + GKP+  +K T E     +GTIV F PD  I  +  E++ DT+ SR+++LAYLNKGI+I+  D+R  +       + F    G+K+++  L+  +EPI+  ++  E E          K +I VEVA  YN +++ +  ++ NNINT EGG+H  GF+  L   + K+A    LL +   +I+ +D  EGLTAI+S+K   PQ+EGQTK KLGN EV   VS  VSE+ E YL ENP DA  I++K +LA +AR  + +ARE  +RK+      LPGKL+DCS +D E  E+++VEGDSAGG+AK GRDR FQAILPL+GKI+NVEKA S ++F NEEI N+ TA+G  +G E       + KLRY+K+++M DADVDGSHI  L+LTF FRYM  L+ENG++YIA PPL+    G+  +YA+ EK  +E  +  S    QIQRYKGLGEMN +QLW+TTMDP+ R+L +V I++   AD++FS+LMGDEV PRREFIEKNAKY  N+D
  S:     1 MSEEAKKHNYSADSIQALEGMEHVRMRPSMYIGDTGVRGLHHLVYEVVDNSIDEALAGHCDNIKVTINEDNSITTEDNGRGIPIDLHKKEGVSALQVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSEHLTAIVFRDGQVWQQEY-ELGKPLYPVKPTGETEL--SGTIVTFKPDPSIFTQTLEYNYDTLASRMRELAYLNKGIRISLTDKRNKEDNGEFVHDDFHSEEGLKEFIRFLDGNREPIIGDVISMEGE----------KNDIPVEVAMVYNTSFSENLHSYVNNINTHEGGTHLSGFRRGLTTTLKKYADSSGLLDKVKFEITGDDFREGLTAIISVKVAEPQFEGQTKTKLGNREVTSAVSQAVSEMLENYLEENPNDAKTIVQKVILAAQARNAAKKAREMVQRKTVMSVGGLPGKLSDCSDQDPEQCEVFLVEGDSAGGTAKQGRDRKFQAILPLRGKILNVEKAMSHRVFDNEEIKNIYTALGVTIGTEEDSKALNLSKLRYHKVVIMCDADVDGSHIETLILTFFFRYMKELIENGHIYIATPPLYLVKKGQKKRYAWSEKERDEIAESYSG-GVQIQRYKGLGEMNAEQLWDTTMDPEFRILRQVNIDNGGEADRIFSMLMGDEVPPRREFIEKNAKYA-NID 645
>gi|110598305|ref|ZP_01386580.1| DNA gyrase, B subunit [Chlorobium ferrooxidans DSM 13031] >gi|110340113|gb|EAT58613.1| DNA gyrase, B subunit [Chlorobium ferrooxidans DSM 13031] (649 aa)
Score = 1565, Expect = 1.0e-171, Identities = 336/645 (52%), Positives = 436/645 (67%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVE-----ELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDE----KTLEEFKK-ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           T  +TY A+NI++L+G+E VR RP MYIG    +GLHH+V+EIVDNSIDE + G    I + L  EGS  V D GRGIPV+ H + +KS +E V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY++   ++  F + G P  D++V  +       T   F PD +I +  EF  D I  R+++LA+LNK + I   D    D E F + GGIK++V+      +N  KEPI    +Y ER+ ++            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSE +  V  +V+E   ++   NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF  +KLRY KII+MTDADVDG+HIR LLLTF FR+M  L+E G V+IA PPL+    GK  +YA+D+       E  KK +  K    IQRYKGLGEMNP+QLW TTMDP +R LL V +E+A+ AD+VFS LMGD+V PRREFIEKNA+YV+ LD+
  S:    13 TAPSTYGANNIQVLDGIEHVRMRPAMYIGDIHSRGLHHLVYEIVDNSIDETLGGFNDYIFVALNPEGSVTVIDRGRGIPVDIHPEKQKSALELVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYRDGNVYFQRF-ERGIPQGDVRVIGKTDKKG--TKTTFMPDHQIFKTTEFRKDIIIDRMRELAFLNKELSITVQDTEGID-EIFHYVGGIKEFVQFTDQNRINLLKEPIY---LYGERDSTI------------VEIALQYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNAYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVAEPQFEGQTKTKLGNSETQSIVETIVNEQLAEFAESNPNVLKMIIEKVKGAAMSREAARKAKELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSTEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRHMRSLIEAGRVFIAQPPLYLVKSGKEQQYAWDDDERNSITESMKKMQKGKANIHIQRYKGLGEMNPEQLWSTTMDPAHRSLLLVNVENAMEADQVFSTLMGDKVEPRREFIEKNARYVRRLDV 649
>gi|73916278|gb|AAZ93007.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916280|gb|AAZ93008.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916282|gb|AAZ93009.1| DNA gyrase subunit B [Streptococcus pneumoniae] >gi|73916284|gb|AAZ93010.1| DNA gyrase subunit B [Streptococcus pneumoniae] (648 aa)
Score = 1565, Expect = 1.1e-171, Identities = 346/647 (53%), Positives = 456/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKET--FLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQ-------IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K  +   Y AS I++LEGLEAVR RPGMYIGST  +GLHH+VWEIVDNSIDEA+ G AS I + +  + S  V DDGRGIPV+   KT +  VETV TVLHAGGKF    YKVSGGLHGVG+SVVNALS+ L V V+K  K HY E++ G   VADL++  +  + K GT V F PD +I  E   FD D +  R+++LA+LN+G++I+  D+R   ++T  + + GGI  +VE +N  K+ I  T +Y + E            +I VEVA QY   Y+ +  +F NNI+T EGG+HE+GF+ AL ++IN +A + KLLK+ ++ ++ ED  EGLTA++S+KHPNPQ+EGQTK KLGNSEV    + + SE F  +L+ENP+ A  I++K +LA +AR  +  ARE TR+KS  E ++LPGKLADCS+ +   +EL+IVEGDSAGGSAK GR+R FQAILP++GKI+NVEKA  DKI +NEEI +L TA+G G G EF + K RY K++LMTDADVDG+HIR LLLT ++RYM P+LE G VYIA PP++   VG   K        +E K + +  +Y        IQRYKGLGEM+  QL ETTMDP++RL+ +V+++DA  ADK+F +LMGD V PRREFIE+NA Y   LD+
  S:     6 KNLQAQDYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFASHIQVFIEPDDSITVVDDGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVHKNGKIHYQEYRRG-HVVADLEIVGD--TDKTGTTVHFTPDPKIFTETTIFDFDKLNKRIQELAFLNRGLQISITDKRQGLEQTKHYHYEGGIASYVEYINENKDVIFDTPIYTDGEMD----------DITVEVAMQYTTGYHENVMSFANNIHTHEGGTHEQGFRTALTRVINDYARKNKLLKDNEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFSDFLMENPQIAKRIVEKGILAAKARVAAKRAREVTRKKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLRETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY-STLDV 648
>gi|193211690|ref|YP_001997643.1| DNA gyrase, B subunit [Chlorobaculum parvum NCIB 8327] >gi|193085167|gb|ACF10443.1| DNA gyrase, B subunit [Chlorobaculum parvum NCIB 8327] (647 aa)
Score = 1564, Expect = 1.3e-171, Identities = 331/646 (51%), Positives = 441/646 (68%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKP--VADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIV--PTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK----TLEEFKK-ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +   N Y A+NI++L+G+E VRKRP MYIG    +GLHH+V+EIVDNSIDE + G    I + +  +GS  V D GRGIPV+ H   KKS +E V+TV+ AGGKFD  +YKVSGGLHGVGASVVNALS W +  VY++ K     +K G     V ++  T++K     GT V F PD +I +  EF  D I  R+++LA+LN  ++I  + +    +ETF F GG++++V   +  +  ++  P  +  ERE ++            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K P PQ+EGQTK KLGNSE +  V  +V+E   ++   NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D +  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G  +G  EF  +KLRY KII+MTDADVDG+HIR LLLTF FRYM  L+E G V+IA PPL+    G+  +YA+DE+      E+ KK +  K    IQRYKGLGEMNP+QLW TTMDP++R LL+VT+E+A+ AD+VFS LMGD+V PRR FIE+NAKYV+ LD+
  S:    10 QNAANDYGATNIQVLDGIEHVRKRPAMYIGDIHSRGLHHLVYEIVDNSIDETLAGFNDYIHVAMNPDGSVTVTDRGRGIPVDIHPVKKKSALELVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEAEVYRDGKIFRQTYKRGVPQGGVEEVGTTDQK-----GTKVTFKPDPDIFKITEFRKDIIIDRMRELAFLNSNLRI-IVQDAEGFEETFHFEGGLREFVRFTDANRLSLLKEPIFLSGERESTM------------VEIALQYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNAYAQKNDLLKNVKITLTGDDFKEGLTAVISVKVPEPQFEGQTKTKLGNSETQSIVETIVNEQLAEFAESNPGTLKLIIEKVKGAAISREAARKAKELTRRKSVLESSGLPGKLADCSINDPDHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSIGEEEFSPEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRYMRSLIEAGKVFIAQPPLYLVKAGREQQYAWDEEERASITEQMKKLQKGKANVSIQRYKGLGEMNPEQLWSTTMDPEHRSLLQVTVENAMEADQVFSTLMGDKVEPRRNFIEQNAKYVRRLDV 647
>gi|39938984|ref|NP_950750.1| DNA gyrase beta subunit [Onion yellows phytoplasma OY-M] >gi|39722093|dbj|BAD04583.1| DNA gyrase beta subunit [Onion yellows phytoplasma OY-M] (671 aa)
Score = 1564, Expect = 1.3e-171, Identities = 347/632 (54%), Positives = 456/632 (72%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAE-FDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFA--GGIKQWVEELN-NEKEPIVPTIVYDEREESVKAANNKDKYNIRV----------EVAFQYNK------TYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV----GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSS-KYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALN----------ADKVFSLLMGDEVAPRREFIEKNA 641
           Y+A +I+ILEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G+A++IT+ +       V D+GRGIPV+ H KT K  VET+LT LHAGGKFDN SYKVSGGLHGVGASVVNALS+W  V ++   K+ Y +  + G  V+ L+V  +  + K GT ++F  D EI +    ++ DT+K R++QL++LNKG+K+N  D+R + +  F F    G++ +++ +N + K+     I Y E+E    A     +Y  ++          E+  +  K      T N   F+F NNI T EGG+HEEGFK AL ++I+K+A E  LLK+ DE +  ED +EG+TAI+S+KH  PQ+EGQTK KL N+EVR   S +  E  EKYLLENP+D+  II KCLL+  AR  +  ARE  R K P +S     KLADC +KD  ISELYIVEGDSAGGSAK GRD  FQAILPL+GK++NVEK+   KI +N+EI +LI AIGAG+    G +F +DK+RY+KII+MTDADVDG+HIR LLLTF FR+   L+E G +Y A PPL+K+  GK + KY YDEK  + F  +N+ +K   QRYKGLGEMNP+QLWETTMDP+ R LLK +++DALN          AD+ F++LMG++V PR+ FI + A
  S:     4 YNADSIQILEGLEAVRKRPGMYIGSTAQKGLHHLVWEIVDNSIDEALAGHANKITLEILPGEIISVSDNGRGIPVDIHPKTGKPAVETILTTLHAGGKFDNSSYKVSGGLHGVGASVVNALSTWFTVEIHLN-KQIYFQKYEKGIAVSPLEVIGK--TNKRGTTIQFLADPEIFQETTIYNFDTLKERMQQLSFLNKGLKLNIADKRYEKETVFNFCHEKGLQDYLDFINTSHKQTPFHEIFYLEKEFQKLAFEIVFEYTTKIRPPKKDAQGNEIEEKEGKDAIPNYTQNQKIFSFVNNIPTHEGGTHEEGFKLALNRVISKYAKEFNLLKK-DEHLLSEDILEGITAIISLKHQYPQFEGQTKAKLANTEVRQITSQLFGEFLEKYLLENPQDSRKIIDKCLLSANARLAAKRAREVVRNK-PLDSLGFASKLADCRSKDPHISELYIVEGDSAGGSAKQGRDSRFQAILPLRGKVLNVEKSLDAKILTNKEIKSLIQAIGAGINIGKGKDFNMDKIRYHKIIIMTDADVDGAHIRTLLLTFFFRHFRKLIEKGYIYFARPPLYKYQKGKGAPKYFYDEKAKQTFATKNN-LKDGFQRYKGLGEMNPNQLWETTMDPETRTLLKASLKDALNALSDEEALMEADQTFNMLMGEKVLPRKNFILEKA 664
>gi|118470463|ref|YP_885621.1| DNA gyrase subunit B [Mycobacterium smegmatis str. MC2 155] >gi|118171750|gb|ABK72646.1| DNA gyrase, B subunit [Mycobacterium smegmatis str. MC2 155] (639 aa)
Score = 1563, Expect = 1.5e-171, Identities = 329/640 (51%), Positives = 443/640 (69%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYK---EYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLF--AGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSS-KYAYDEKT----LEEFKKENSKVKYQ--IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A +I ILEGL+ VRKRPGMYIGST  +GLHHMVWE+VDN +DEAM G+A+ + +TL  +G  +V DDGRGIPV  H +T   TV+ V+T LHAGGKFD++SY+VSGGLHGVG SVVNALS+ L+V +++   E+ +HY    D   P     +T    S   GT V F+ D ++ E   + A+TI  RL+++A+LNKG+ +   D+R  + +T  F   GG+  +V+ +N  K+PI P+I+  E E               VE+A Q+N  Y+ S  TF N INT EGG+HEEGF+ AL  ++N++A +KKLLK+ D  ++ +D  EGL A++S+K   PQ+EGQTK KLGN+ +R FV  V  E    +L  NP +A VII K   + +AR  + +ARE  RRKS  +   LPGKLADC + D   SELY+VEGDSAGGSAK GRD +FQAILPL+GKIINVEKA+ D++  N E+ ++ITA+G G+  EF I KLRY+KI+LM DADVDG HI  LLLT LFR+M PL+ENG++++A PPL+K    +S  ++AY ++     LE  +    K+     IQRYKGLGEM+  +LWETTMDP  R+L +VT++DA  AD++FS+LMGD+V  RR FI +NAK ++ LDI
  S:     6 YDAGSITILEGLDVVRKRPGMYIGSTSERGLHHMVWEVVDNGVDEAMAGHATRVDVTLLADGGVQVCDDGRGIPVAMH-ETGIPTVDVVMTQLHAGGKFDSESYQVSGGLHGVGVSVVNALSTRLEVDIHRDGYEWHQHY----DHSVPAT---LTRGNPSGGTGTTVRFWADPDVFETTTYSAETIARRLQEMAFLNKGLILTLTDQRDPEPQTRTFHHPGGLIDYVKHINRVKDPIQPSIIAFEGEGP----------GHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRAALTSVVNRYAKDKKLLKDKDPNLTGDDIREGLAAVISVKVAEPQFEGQTKTKLGNAAIRSFVQKVCHEQLTHWLEANPVEAKVIITKVASSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQSIITALGTGIHDEFDISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLVENGHIFLAQPPLYKLKWQRSEPEFAYSDRERDGLLEAGRAAGKKINVDDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGDDVEARRGFITRNAKDIRFLDI 639
>gi|123969376|ref|YP_001010234.1| DNA gyrase subunit B [Prochlorococcus marinus str. AS9601] >gi|123199486|gb|ABM71127.1| DNA gyrase, subunit B [Prochlorococcus marinus str. AS9601] (655 aa)
Score = 1563, Expect = 1.8e-171, Identities = 328/642 (51%), Positives = 445/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKAS-IKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N Y A  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G+   I I L  +GSA + D+GRGIP + H +T KS +ETVLTVLHAGGKF +  YKVSGGLHGVG SVVNALS W+ V VY++  E    F+ G     +L+   +     K GT + F PD  I     EF+   + SRL++LAYLN G+KI F DER         +E +L+ GGIK++VE +N EK+ I P I+Y + +          K N+ VE A Q+ +  Y+++   F NNI T +GG+H EG K  L +  N  A ++   K+ ++ ++ E+  EGLT ++S+K P+P++EGQTK KLGN+EVR  V +++ E   KY+  NP   ++I++K + +  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE+YIVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF    LRY+++++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   GK+  Y Y+E  L++  +       Y IQR+KGLGEM P QLW+TTM+P+ R++ +V IEDAL AD++F++LMGD+VAPRREFIE ++    NLD+
  S:    12 NDYGADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGHCDHIEIVLRADGSAFISDNGRGIPTDIHPRTGKSALETVLTVLHAGGKFGSGGYKVSGGLHGVGISVVNALSEWVNVTVYRDGSEFNQRFEKGVSK-GELQAKKQTGKPFKKGTSICFKPDKTIFSGGIEFEYALLSSRLRELAYLNGGVKIVFRDERNQLSDGSFKEEIYLYQGGIKEYVEYMNAEKDSIHPEIIYVDSQ----------KENVYVEAALQWCSDVYSDNILGFANNIRTIDGGTHIEGLKTVLTRTFNNLAKKRGKRKDIEKNLAGENIREGLTVVLSVKVPDPEFEGQTKTKLGNTEVRGIVDSLIGEALTKYMEFNPAILDLILEKAIQSFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPSESEIYIVEGDSAGGSAKQGRDRNFQAILPLRGKILNIEKTDDTKIYKNTEIQSLITALGLGIKGEEFDESSLRYHRVVIMTDADVDGAHIRTLLLTFFYRYQRELVEKGFIYIACPPLYKVERGKNHNYCYNENQLKDTIQGFGENANYNIQRFKGLGEMMPKQLWDTTMNPQTRMMKRVEIEDALEADRIFNILMGDKVAPRREFIETHS---GNLDM 650
>gi|78707333|gb|ABB46473.1| DNA gyrase subunit B [Acholeplasma axanthum] (589 aa)
Score = 1563, Expect = 1.9e-171, Identities = 322/600 (53%), Positives = 425/600 (70%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           VRKRPGMYIG+T   GLHH+VWEIVDNSIDEA+ G A +I + L      +V D+GRGIPV+ H  T +  VET+LT LHAGGKFD+DSYKVSGGLHGVGASVVNALS W  V V++  K +Y +  + G P  DL    +  S   GTI EF  D  I  E  E+D + ++ R++QLA+LN+GIKI   D RT+   + T+ + GG+ ++ E LN  +  +  ++ Y E+             +I VE+  QYN ++N + ++F NNI T EGG HE+GFK AL +I+N +A   K+LK+T++    ED  EGL  I+S+KHP+PQ+EGQTK KLGN+EVR  VS ++SE  +++LLENP+DA  II K +LA  AR  + +AREATRRK+P +S     KLADC TK+ E +ELYIVEGDSAGGSAK GR+  +QAILPL+GK++NVEKA+ DKI SN EI+ L  AIG+G+G E    K RY+KI++MTDADVDG+HIR LLLTF +R++ PL++ G +Y A PPL+K S GK  +Y YD++ L E        +YQ+QRYKGLGEMNP+QLWETTMDP+ R LL+VT++DA++AD+VFS
  S:     1 VRKRPGMYIGTTGTDGLHHLVWEIVDNSIDEALAGYADDIILELLPGEVVRVTDNGRGIPVDIHPHTGRPAVETILTTLHAGGKFDSDSYKVSGGLHGVGASVVNALSEWYTVNVHRNNKNYY-QMYNRGIPAGDL--IEKGLSEHTGTITEFKFDPTIFKETQEYDFERLRQRIQQLAFLNRGIKITIKDLRTEAVVENTYHYEGGLVEYAEFLNGNRVKVNKSLFYVEKMVD----------DINVEITMQYNDSFNQNIYSFTNNIPTREGGMHEDGFKMALTRILNNYAKANKMLKDTEDGFIGEDTREGLIVILSVKHPDPQFEGQTKTKLGNTEVRQIVSQILSEGLDRFLLENPQDAKAIIDKVVLAQRARVAARKAREATRRKNPLDSLGFASKLADCRTKNAEKAELYIVEGDSAGGSAKQGRESEYQAILPLRGKVLNVEKARLDKILSNNEILMLFQAIGSGIGDELDPSKARYHKIVIMTDADVDGAHIRTLLLTFFYRHLRPLIDLGYIYFAQPPLYKLSSGKRIEYVYDDEALPEIAATFDG-RYQMQRYKGLGEMNPEQLWETTMDPETRTLLRVTLKDAMDADQVFS 589
>gi|78707335|gb|ABB46474.1| DNA gyrase subunit B [Acholeplasma axanthum] >gi|78707337|gb|ABB46475.1| DNA gyrase subunit B [Acholeplasma axanthum] >gi|78707339|gb|ABB46476.1| DNA gyrase subunit B [Acholeplasma axanthum] (589 aa)
Score = 1562, Expect = 2.4e-171, Identities = 322/600 (53%), Positives = 424/600 (70%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           VRKRPGMYIG+T   GLHH+VWEIVDNSIDEA+ G A +I + L      +V D+GRGIPV+ H  T +  VET+LT LHAGGKFD+DSYKVSGGLHGVGASVVNALS W  V V++  K +Y +  + G P  DL    +  S   GTI EF  D  I  E  E+D + ++ R++QLA+LN+GIKI   D RT+   + T+ + GG+ ++ E LN  +  +  ++ Y E+             +I VE+  QYN ++N + ++F NNI T EGG HE+GFK AL +I+N +A   K+LK+T++    ED  EGL  I+S+KHP+PQ+EGQTK KLGN+EVR  VS ++SE  +++LLENP+DA  II K +LA  AR  + +AREATRRK+P +S     KLADC TK+ E +ELYIVEGDSAGGSAK GR+  +QAILPL+GK++NVEKA+ DKI SN EI+ L  AIG G+G E    K RY+KI++MTDADVDG+HIR LLLTF +R++ PL++ G +Y A PPL+K S GK  +Y YD++ L E        +YQ+QRYKGLGEMNP+QLWETTMDP+ R LL+VT++DA++AD+VFS
  S:     1 VRKRPGMYIGTTGADGLHHLVWEIVDNSIDEALAGYADDIILELLPGEVVRVTDNGRGIPVDIHPHTGRPAVETILTTLHAGGKFDSDSYKVSGGLHGVGASVVNALSEWYTVNVHRNNKNYY-QMYNRGIPAGDL--IEKGLSEHTGTITEFKFDPTIFKETQEYDFERLRQRIQQLAFLNRGIKITIKDLRTEAVVENTYHYEGGLVEYAEFLNGNRVKVNKSLFYVEKMVD----------DINVEITMQYNDSFNQNIYSFTNNIPTREGGMHEDGFKMALTRILNNYAKANKMLKDTEDGFIGEDTREGLIVILSVKHPDPQFEGQTKTKLGNTEVRQIVSQILSEGLDRFLLENPQDAKAIIDKVILAQRARVAARKAREATRRKNPLDSLGFASKLADCRTKNAEKAELYIVEGDSAGGSAKQGRESEYQAILPLRGKVLNVEKARLDKILSNNEILMLFQAIGTGIGDELDPSKARYHKIVIMTDADVDGAHIRTLLLTFFYRHLRPLIDLGYIYFAQPPLYKLSSGKRIEYVYDDEALPEIAATFDG-RYQMQRYKGLGEMNPEQLWETTMDPETRTLLRVTLKDAMDADQVFS 589
>gi|119355886|ref|YP_910530.1| DNA gyrase subunit B [Chlorobium phaeobacteroides DSM 266] >gi|119353235|gb|ABL64106.1| DNA gyrase subunit B [Chlorobium phaeobacteroides DSM 266] (643 aa)
Score = 1562, Expect = 2.5e-171, Identities = 329/640 (51%), Positives = 434/640 (67%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVY--DEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y ASNI+IL+G+E VRKRP MYIG    +GLHH+++EIVDNSIDE + G    I ++L  +GS  V D GRGIPV+ H + +KS +E V+TV+ AGGKFD  SYKVSGGLHGVGASVVNALS W +V VY++ K ++  F+ G   V    V     S + GT   F PD  I +  EF  D I  R+++LA+LNK + I  + +    +E F + GG+K++V   +  +  ++   +Y   ER+ ++            VE+A QYN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSE +  V ++V+E+  ++   NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF  +KLRY KII+MTDADVDG+HIR LLLTF FRYM  L+E G VYIA PPL+    GK  +YA+D++          K +  K    IQRYKGLGEMNP+QLW TTMDP +R LL+V++E+A  AD++FS LMGD+V PRREFIEKNA+YV+ LD+
  S:    12 YIASNIQILDGIEHVRKRPAMYIGDIHTRGLHHLIYEIVDNSIDETLGGFNEYIFVSLNPDGSVTVIDHGRGIPVDIHPQKQKSALELVMTVIGAGGKFDKGSYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAYFQRFERG---VPQGNVREIGLSDQKGTKTTFKPDNLIFKTTEFRKDIIIDRMRELAFLNKNLSIT-VQDADGAQEIFHYEGGLKEFVRFTDINRLSLIKEPIYFIGERDTTI------------VEIALQYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNLYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVEEPQFEGQTKTKLGNSETQSIVESIVNELLSEFAESNPNVIKMIIEKVKGAAMSREAARKAKELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSPEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRYMRSLIEAGKVYIAQPPLYLVKSGKDQQYAWDDEERNSITDTLKKMQKGKANIHIQRYKGLGEMNPEQLWSTTMDPAHRSLLQVSVENAREADQIFSTLMGDKVEPRREFIEKNARYVRRLDV 643
>gi|82798482|gb|ABB91904.1| DNA gyrase subunit B [Acholeplasma cavigenitalium] (588 aa)
Score = 1560, Expect = 3.6e-171, Identities = 319/600 (53%), Positives = 422/600 (70%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEI-MERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETF--LFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           VRKRPGMYIG+T   G HH+VWEIVDNSIDEA+ G A EI + +      +V DDGRGIPV+ H  T +  VET++T LH+GGKFD +SYKVSGGLHGVGA+VVNALS W  V V++  + +   FK G  P  DL+V  E A   +GTI+E+  D EI +E   +D + ++ R++QLA+LN+G+K+   D+R  +   F  L+ GG+ ++ E LN  K  I   + Y E  E V         +I +E+  QYN TYN + ++F NNI T EGG HE+GFK AL++++  +A + KL+KE +E  + ED  EGL AI+S+KHP+PQ+EGQTK KLGN+EVR   S V+    E++LLENP DA  II+K   A  AR  + +ARE TRRK+P +      KLADC TKD   +ELYIVEGDSAGGSAK GR+  FQAILPL+GK++NVEKA  ++I +N+EI+ L  AIG G G EF   K RY+KII+MTDADVDG+HIR LLLTFL+RY+ PL+E G +Y A PPL+K S G+  +Y Y ++ LEE  K   + +YQIQRYKGLGEMNP+QLW+TTM+P+ R LL+VT++DA++AD+VF+
  S:     1 VRKRPGMYIGTTGSDGFHHLVWEIVDNSIDEALAGYAKEILLEILPGEIIRVSDDGRGIPVDIHPHTGRPAVETIMTTLHSGGKFDGESYKVSGGLHGVGAAVVNALSEWFVVEVHRNNQAYRQSFKRG-IPDGDLEVCGESA--HSGTIIEYKFDPEIFIETTSYDFERLRQRIQQLAFLNRGVKLTIADKRKSEAVEFEYLYEGGLVEYAEFLNGGKAKINQELFYTE--EMVD--------DINIEITIQYNDTYNENIYSFANNIPTREGGMHEDGFKMALRRVLFNYAKDNKLVKE-EEAFAGEDVREGLVAIISVKHPDPQFEGQTKTKLGNTEVRAITSQVLQSGLERFLLENPNDAKAIIEKAKKARLARIAAHKAREQTRRKNPLDQLGFASKLADCRTKDATRAELYIVEGDSAGGSAKQGRESEFQAILPLRGKVLNVEKANIERILNNQEILTLFQAIGTGFGDEFDASKARYHKIIIMTDADVDGAHIRTLLLTFLYRYLRPLIELGYIYFAQPPLYKISYGRREEYVYSDQELEETLKTFGE-RYQIQRYKGLGEMNPEQLWDTTMNPETRTLLRVTLKDAMDADQVFT 588
>gi|72160412|ref|YP_288069.1| DNA gyrase subunit B [Thermobifida fusca YX] >gi|71914144|gb|AAZ54046.1| DNA gyrase subunit B [Thermobifida fusca YX] (661 aa)
Score = 1560, Expect = 4.2e-171, Identities = 335/640 (52%), Positives = 450/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFS---VGKSSKYAYDEKTLEE-------FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A +I +LEGLEAVRKRPGMYIGST  +GLHH+V E+VDNS+DEA+ G A+ I +TL  +G  +V D+GRGIPV+ H   KK  VE VLT LHAGGKFD+ SY VSGGLHGVG SVVNALS+ L+V V ++   + + Y    +  KPV +L     + + + GT + F+PD  I E   F+ +T+  RL+++A+LNKG+ I   DER +        +T+ + GG+  +V  LN  KEP+  +I+  E               I VE+A Q+N++Y +S  TF N INT EGG+HEEGF+ AL  I+N++A ++KLL++ DE ++ +D  EGLTAIVS+K  +PQ+EGQTK KLGN+E + FV  V  E    +L  NP +A  I+ K   A  AR  + +ARE TRRK+  ES SLPGKLADC + D E  E+YIVEGDSAGGSAK GRD  +QAILP++GKI+NVEKA+ D+I  N E+  +ITA+G G+  +F I KLRY+KIILM DADVDG HIR LLLT LFR+M PL+E G+VY+A PPL+K      G    YAY ++  +E         K++ + +  +QR+KGLGEMNP +LWETTMDP+ R+LL+VT++DA  AD++FS+LMG++V  RR FI++NA+ V+ LDI
  S:    19 YDARSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEVVDNSVDEALAGYATAIEVTLLADGGVRVTDNGRGIPVDPHPVEKKPAVELVLTTLHAGGKFDSKSYAVSGGLHGVGVSVVNALSTRLEVEVRRDGYLWTQSY----EMTKPVTEL--IRREPTDETGTQITFWPDGSIFETTTFNFETLSRRLQEMAFLNKGLSITIRDERPEFVGDSPVTQTYYYEGGLSDFVRHLNATKEPVHSSIIAFEEAGD----------GIAVEIAMQWNQSYTSSVHTFANTINTAEGGTHEEGFRAALTSIVNRYARDQKLLRDKDENLTGDDIREGLTAIVSVKLADPQFEGQTKTKLGNTEAKSFVQKVCHEYLRDWLDRNPGEAKDIVTKATQAARARIAARQARELTRRKTLLESTSLPGKLADCQSTDPERCEVYIVEGDSAGGSAKGGRDPYYQAILPIRGKILNVEKARIDRILKNNEVQAIITALGTGIHDDFDITKLRYHKIILMADADVDGQHIRTLLLTLLFRFMKPLIEAGHVYLAQPPLYKIKWDPRGTDVDYAYSDRERDEKIAAGIAAGKKDPRPRDLVQRFKGLGEMNPSELWETTMDPERRVLLQVTLDDAAQADEMFSVLMGEDVESRRAFIQRNARDVRFLDI 661
>gi|85057535|ref|YP_456451.1| DNA gyrase subunit B [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789640|gb|ABC65372.1| DNA gyrase subunit B [Aster yellows witches'-broom phytoplasma AYWB] (671 aa)
Score = 1559, Expect = 4.7e-171, Identities = 346/632 (54%), Positives = 456/632 (72%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAE-FDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFA--GGIKQWVEELNNEKEPI-VPTIVYDEREESVKAANNKDKYNIRV----------EVAFQYNK------TYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV----GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSS-KYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNA----------DKVFSLLMGDEVAPRREFIEKNA 641
           Y+A +I+ILEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G+A+ IT+ +       V D+GRGIPV+ H KT K  VET+LT LHAGGKFD+ SYKVSGGLHGVGASVVNALS+W  V + +  K+ Y +  + G  V+ L+V     + K GT ++F  D EI +    ++ DT+K R++QL++LNKG+K+   D+R + +  F F    G++ +++ +N   + I    I Y E+E    A     +Y  ++          E+  + +K      T +   F+F NNI T EGG+HEEGFK AL ++I+K+A E  LLK+ DE +  ED +EG+TAI+S+KH +PQ+EGQTK KL N+EVR   S +  E  EKYLLE+P+D+  II KCLL+  AR  +  ARE  R K P +S     KLADC +KD  ISELYIVEGDSAGGSAK GRD  FQAILPL+GK++NVEK+   KI +N+EI +LI AIGAG+    G +F +DK+RY+KII+MTDADVDG+HIR LLLTF FR+   L+E G +Y A PPL+K+  GK + KY YDEKT + F  +NS +K   QRYKGLGEMNP+QLWETTMDP+NR LLK +++DALNA          D+ F++LMG++V PR+ FI + A
  S:     4 YNADSIQILEGLEAVRKRPGMYIGSTAQKGLHHLVWEIVDNSIDEALAGHANNITLEILPGEIISVSDNGRGIPVDIHPKTGKPAVETILTTLHAGGKFDSSSYKVSGGLHGVGASVVNALSNWFTVEI-RLNKQIYFQKYEKGIAVSPLEVIG--GTNKRGTTIQFLSDPEIFQETTIYNFDTLKERMQQLSFLNKGLKLKIADKRYEKETVFNFCHEKGLQDYIDFINTSHKQIPFHEIFYLEKEAQKLAFEIVFEYTTQLRPTKKDEQGNEIEEKEDKDTIPRYTQSQKIFSFVNNIPTHEGGTHEEGFKLALTRVISKYAKEFNLLKK-DEHLLSEDILEGITAIISLKHQDPQFEGQTKAKLANTEVRQITSQLFGEFLEKYLLEHPQDSRKIIDKCLLSANARLAAKRAREVVRNK-PLDSLGFASKLADCRSKDPHISELYIVEGDSAGGSAKQGRDSRFQAILPLRGKVLNVEKSLDAKILTNKEIKSLIQAIGAGINIGKGKDFNVDKIRYHKIIIMTDADVDGAHIRTLLLTFFFRHFRELIEKGYIYFARPPLYKYQKGKGTPKYFYDEKTKQTFANKNS-LKDGFQRYKGLGEMNPNQLWETTMDPENRTLLKASLKDALNALSDEEALMETDQTFNMLMGEKVLPRKNFILEKA 664
>gi|56751624|ref|YP_172325.1| DNA gyrase subunit B [Synechococcus elongatus PCC 6301] >gi|81301300|ref|YP_401508.1| DNA gyrase subunit B [Synechococcus elongatus PCC 7942] >gi|25019687|gb|AAN71773.1| DNA gyrase subunit B [Synechococcus sp. PCC 7942] >gi|56686583|dbj|BAD79805.1| DNA gyrase B subunit [Synechococcus elongatus PCC 6301] >gi|81170181|gb|ABB58521.1| DNA gyrase subunit B [Synechococcus elongatus PCC 7942] (645 aa)
Score = 1558, Expect = 6.7e-171, Identities = 333/631 (52%), Positives = 443/631 (70%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD-------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIE 638
           N Y AS I++LEGLE VRKRPGMYIGST  KGLHH+V+E+VDN++DEA+ G  + I + L ++GS +V D+GRGIP + H +T KS +ETVLT+LHAGGKF    YKVSGGLHGVG SVVNALS +++V V++E K H   F+ G  P+ +L+V  + A  + GT V F PD  I  E  EFD  T+ SRLK+LAYLN G++I+F DER          +ET+ F GGI+++V  +N +K+ +   I++ + E          K  ++VE A Q+    Y+++   F NNI T +GG+H EG K  L + +N  A ++   K+ D  +S E+  EGLTAIVS+K P+P++EGQTK KLGN+EVR  V  +V E   +YL  +P  A++I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   SE++IVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI  LITA+G G+ G EF   +LRY++I++MTDADVDG+HIR LLLTF +RY   LLE G +YIACPPL+K   G++  Y Y+E+ L+E          Y IQR+KGLGEM P QLWETTMDP+ R + +V IEDA  AD++F++LMGD V PRREFIE
  S:     3 NEYGASQIQVLEGLEPVRKRPGMYIGSTGPKGLHHLVYEVVDNAVDEALAGYCNTIDVRLLEDGSCQVTDNGRGIPTDIHPQTGKSALETVLTILHAGGKFGGGGYKVSGGLHGVGVSVVNALSEYVEVTVWREGKTHQQRFEQG-NPIGELQVAPD-ADDRRGTQVRFKPDATIFSETTEFDYGTLASRLKELAYLNAGVRIDFTDERLQLTKNHEPHQETYYFEGGIREYVAYMNTDKQALHSEIIFVQSE----------KDGVQVEAALQWCVDAYSDNILGFANNIRTIDGGTHIEGLKTVLTRTMNTIARKRNKRKDADNNLSGENIREGLTAIVSVKVPDPEFEGQTKTKLGNTEVRGIVDTLVGETLTEYLEFHPSVADLILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPGESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNTEIQALITALGLGIKGEEFDASQLRYHRIVIMTDADVDGAHIRTLLLTFFYRYQRSLLEQGYIYIACPPLYKLERGRNHYYCYNERELQERIATFPENANYTIQRFKGLGEMMPQQLWETTMDPETRTMKRVEIEDAAEADRIFTILMGDRVQPRREFIE 632
>gi|86141195|ref|ZP_01059741.1| DNA gyrase subunit B [Flavobacterium sp. MED217] >gi|85831754|gb|EAQ50209.1| DNA gyrase subunit B [Leeuwenhoekiella blandensis MED217] (646 aa)
Score = 1558, Expect = 6.7e-171, Identities = 331/649 (51%), Positives = 443/649 (68%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK--PVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E  K  YSA +I+ LEG+E VR RP MYIG   ++GLHH+V+E+VDNSIDEAM G+   I + + +  S  V+D+GRGIPV+ H K   S +E V+T + AGGKFD DSYKVSGGLHGVG S VNALS+ LK  VY++ K    E++ G    PV  +  T+++     GT V F PD  I +   E++ DT+ SR+++LAYLNKGIKI+  D+R  D+      ETF    G+K++V  L+  ++PI+  ++  E E          K +I VEVA  YN +Y  +  ++ NNINT EGG+H  GF+  L   + K+A    +L +   +I+ +D  EGLTAI+S+K   PQ+EGQTK KLGN EV   VS  VSE+ E YL E+P+DA  I++K +LA +AR  + +ARE  +RK+      LPGKLADCS  D E  E+++VEGDSAGG+AK+GRDR FQAILPL+GKI+NVEKA   K+F NEEI N+ TA+G  +G E       + KLRY KI++M DADVDGSHI  L+LTF FRYM  L+E G+VYIA PPL+    GK  +YA+ EK  +E+  +       +QRYKGLGEMN +QLW+TTM+P+ R L +VTI++   AD++FS+LMGDEV PRREFIEKNA Y  N+D+
  S:     1 MSEEANKKQYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEAMAGHCDSIKVIINENNSISVKDNGRGIPVDLHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSTHLKATVYRDGKIWEQEYEKGKAMYPVKGIGDTDDR-----GTAVTFLPDPSIFQTTTEYNYDTLASRMRELAYLNKGIKISLTDKRQKDEKGDFVSETFHSEEGLKEFVRFLDGNRQPIIGEVISMEGE----------KNDIPVEVAMIYNDSYAENLHSYVNNINTHEGGTHLAGFRRGLTSSLKKYADASGMLDKLKFEIAGDDFREGLTAIISVKVAEPQFEGQTKTKLGNREVTSAVSQAVSEMVEIYLEEHPDDAKTIVQKVILAAQARHAAKKAREMVQRKTVMSIGGLPGKLADCSETDPEACEVFLVEGDSAGGTAKMGRDRNFQAILPLRGKILNVEKAMQHKVFENEEIKNIFTALGVTIGTEEDSKALNLSKLRYKKIVIMCDADVDGSHIATLILTFFFRYMRELVEGGHVYIATPPLYLLKKGKKMRYAWSEKERDEYNAQMGG-SVSVQRYKGLGEMNAEQLWDTTMNPEFRTLRQVTIDNGTEADRIFSMLMGDEVPPRREFIEKNAVYA-NIDV 646
>gi|119487794|ref|ZP_01621303.1| DNA topoisomerase IV subunit B [Lyngbya sp. PCC 8106] >gi|119455627|gb|EAW36764.1| DNA topoisomerase IV subunit B [Lyngbya sp. PCC 8106] (645 aa)
Score = 1557, Expect = 8.1e-171, Identities = 328/642 (51%), Positives = 450/642 (70%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTD-------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYN-KTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++YSA  I++LEGLEAVRKRPGMYIGST  +GLHH+V+E+VDNSIDEA+ G+ + I +    +GS  V DDGRGIPV+ H+KT KS +ETV+TVLHAGGKF    YKVSGGLHGVG SVVNALS W++V V ++ +  Y +    G PV +L+    +   + GT V+F PD  I     EFD  TI +RL++LAYLN G++I   D R D         E+F + GGI++++  +N EK+P+   ++Y   E +          N+++EVA Q+    Y+++   F NNI T +GG+H EG K  L + +N FA ++  LKE +  +  E+  EGLTA++S+K P+P++EGQTK KLGN+EVR  V ++V E+  +YL  +P  A+ +++K + A +A + +  AR+  RRKS  ES+ LPGKLADCST+    SE+++VEGDSAGGSAK GRDR  QAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G +F   +LRY+KII+MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPL+K   G++  Y Y+++ L+E   E  S   Y IQR+KGLGEM P+QLW TTM+P+ R++ +V +EDA  AD VF++LMGD VAPRREFIE NA  +  +D+
  S:     3 SSYSADQIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEVVDNSIDEALAGHCTHIEVDFNADGSVTVTDDGRGIPVDVHSKTGKSALETVMTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSEWVEVQVLRD-ETQYTQRYQRGVPVDELQSKPSQGK-QTGTSVQFLPDTTIFTTGIEFDYATIANRLRELAYLNAGVRITLTDNRLDLIQLEEAKTESFCYEGGIREYIAYMNREKQPLHEDVIYVSGERN----------NVQIEVALQWCVDAYSDNILGFANNIRTIDGGTHLEGLKAVLTRTMNNFARKRNKLKENESNLGGENVREGLTAVISVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGEVLTEYLDFHPHIADAVLEKAIQAFKAAEAARRARDLVRRKSVLESSPLPGKLADCSTRIPAESEIFLVEGDSAGGSAKQGRDRRTQAILPLRGKILNIEKTDDSKIYKNNEIQSLITALGLGIRGEDFDSSQLRYHKIIIMTDADVDGAHIRTLLLTFFYRYQRELVEQGFIYIACPPLYKVERGRNHYYCYNDRELQERLAEFPSNANYNIQRFKGLGEMMPEQLWNTTMNPETRMIKQVEVEDAAQADNVFTVLMGDRVAPRREFIETNAPRLNLVDL 643
>gi|21309845|gb|AAM46064.1|AF263924_3 DNA gyrase beta subunit [Peanut witches'-broom phytoplasma] (648 aa)
Score = 1556, Expect = 1.1e-170, Identities = 342/649 (52%), Positives = 458/649 (70%)
  Q:     1 MNKETKKNT-----YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDN----DSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPD---FEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+K  KKN      YSAS+I+ILEGLEAVRK+PGMYI S  +KG +H++WEI+DNSIDEA+ G A+EI + +  +    V D+GRGIPV+ H KTKKS VET+LT LHAGGKF N     +Y  SGG HGVGASVVNALS+W  V +    K +Y +++ G  P   L++     + K GT ++F PD   F+ ++   +  D +K R++QLA+LNK +K+   D R +  +   F   GGI+++++ LN  K+ ++    Y E  E+          NI +E+AFQYN+ Y ++ ++F NNI T EGG+HEEGFK AL +I++K+A +K LLK+ D     ED +EG+TAI+++KH +P +EGQTK +LGN ++R FVS       E YLLENP++A  II KCLLA +AR  + +ARE TR+KSP ++ S   KLADC TKD  ++ELYIVEGDSAGGSAK GRD  FQAILPL+GKIINVEKA+ +KI  N EII+LI + G G   EF I K RY+KII+MTDADVDG+HIR LLLTF FR   PL+EN  +Y A PPL+K    K   Y Y E+ L+ F  ++N+  K  +QRYKGLGEMN +QLWETTMDP  R LL+V +EDA+ AD++F++LMG+EV+ R+ FI++NA Y  ++DI
  S:     1 MSKNDKKNKENLGEYSASSIEILEGLEAVRKKPGMYIDSVTMKGAYHLIWEIIDNSIDEALAGYATEIILKIFPDNVVSVSDNGRGIPVDIHPKTKKSAVETILTTLHAGGKFKNAPNSKNYSYSGGQHGVGASVVNALSTWFTVEICLNGKIYYQKYEKG-VPTTSLQIIGN--TNKRGTNIKFLPDETIFQDIKNTPYSLDVLKKRVQQLAFLNKNVKLIIEDLRLEPPQIINFYSKGGIQEYLQYLNENKK-VLNQPFYQESSEN----------NIFLEIAFQYNENYISNIYSFVNNIPTHEGGTHEEGFKMALNRILSKYAKDKNLLKK-DLSFIGEDTLEGITAIIALKHYDPLFEGQTKARLGNYDMRQFVSKHFGIALESYLLENPQEAKKIIDKCLLAAKARVAAKKAREITRKKSPLDTLSFASKLADCRTKDPSLAELYIVEGDSAGGSAKQGRDSSFQAILPLRGKIINVEKARLNKILVNNEIISLIQSFGTGFDKEFNISKARYHKIIIMTDADVDGAHIRTLLLTFFFRQFRPLIENNYIYFAQPPLYKVQNNKKISYFYTEQDLKNFMSRKNNSQKIVVQRYKGLGEMNAEQLWETTMDPATRTLLQVKLEDAVEADRIFTMLMGEEVSNRKIFIQENATYA-DIDI 648
>gi|187934052|ref|YP_001884271.1| DNA gyrase, B subunit [Clostridium botulinum B str. Eklund 17B] >gi|187722205|gb|ACD23426.1| DNA gyrase, B subunit [Clostridium botulinum B str. Eklund 17B] (635 aa)
Score = 1556, Expect = 1.1e-170, Identities = 351/646 (54%), Positives = 445/646 (68%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLK-VTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE--FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           E     Y  + I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G    I + + K+ S    DDGRG+PV  H K  KS VE ++T+LHAGGKF    YKVSGGLHGVGASVVNALS    V V +E   +K+ Y +    GK + DLK + N + S   GT + F PD EI +   FD DT+  RL++LA+LNKGI I  ID R D +E + + GGIK +V  LN  K P+ P  +Y E          KDK  + VE+  QYN  Y  + F+F NNI+T EGG+H  GFK AL +  N +A     +KE D+  S +D  EGLTA++S+K  +PQ+EGQTK KLGNSEV+  V ++VSE    +L ENP  + +II K L+A  AR+ + +ARE TR KS  E  +LPGKLADCS+KD    E+YIVEGDSAGGSAK GRDR FQAILPL+GKI+NVEK + DKI ++E I +++TA G G+G +F I+K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+E G+VYIA PPLF+   GK   YAY +  L++             IQRYKGLGEMN  QLW+TTMDP  R+LLK  IEDA+ AD++F++LMG++V PRREFIE+NAK V NLDI
  S:     2 EQNNQKYDENQIQVLEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNSIDEALAGYCKNIEVKINKDNSITSSDDGRGMPVGMHPKMHKSAVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEQCIVTVKREGHIWKQEYSK----GKVLYDLKQIGNTEES---GTTIYFKPDAEIFDEVLFDFDTLSQRLRELAFLNKGINIKLIDSRNDREENYYYEGGIKSFVSYLNRNKTPLHPEPIYVE--------GIKDK--VTVELGLQYNDGYTENLFSFANNIDTIEGGTHLVGFKTALTRAFNDYAKRFGFIKENDKNFSGDDIREGLTAVISVKIEDPQFEGQTKTKLGNSEVKGIVDSIVSEYIGIFLEENPGISKIIIDKALMAARAREAARKARELTR-KSVLERTTLPGKLADCSSKDPRECEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKIMNVEKQRLDKILNSETIRSMVTAFGGGIGKDFDIEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMRELVEQGHVYIAQPPLFRVGKGKKEVYAYSDSELDQVLLDMGGKDTSVDIQRYKGLGEMNATQLWDTTMDPAKRILLKAEIEDAMAADEIFTILMGEKVEPRREFIEQNAKNVVNLDI 635
>gi|167043616|gb|ABZ08310.1| putative DNA gyrase B [uncultured marine microorganism HF4000_APKG2M17] (655 aa)
Score = 1556, Expect = 1.2e-170, Identities = 325/643 (50%), Positives = 447/643 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGP---EFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE---NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKY 643
           M +    N Y ASNI++LEGLEAVRKRP MYIG    +GLHH+V E+VDNSIDEA+ G+   I + + ++GS  ++D+GRGIPV+ H   K+S +E V+T LHAGGKFD D+YKVSGGLHGVG S VNALS  L+  ++++       F+ G    A  KV + K     GT+V F+PD  I +  EF  D +  RL+++AYLN+ + I+  D R  +  ++ + F GGI ++VE L+  + PI    +Y   E++           + VE+A +YN  Y  +  +F NNINT EGG+H  GF+ AL + +  +A +  LLK     +S +D  EG+T I+SIK   PQ+EGQTK KLGNSEV+  V ++V     ++L ++P+++  I++K ++A EAR  + +ARE  +RK+ F S  LPGKLADCS+K+ E  E+Y+VEGDSAGGSAK  RDR FQAILPL+GKI+NVEKA+ D+I +NEEI N++TA+G G+G    +F  +KLRY+KII+MTDADVDG+HIR LLLTFL+R+M+ L+E G +YIA PPL+K   GK  +Y + +K L+E  +    +S  K  IQRYKGLGEMNPDQLW+TTM+P+ RLL ++TI+DA  AD++FS LMGD V PRR+FIE+NAKY
  S:    10 MAENEASNQYGASNIQVLEGLEAVRKRPAMYIGDIGPRGLHHLVNEVVDNSIDEALAGHCDAIDVIIHEDGSISIKDNGRGIPVDMHPIEKRSALEVVMTTLHAGGKFDKDTYKVSGGLHGVGVSCVNALSEKLEASIWRDGALWKQTFEYGDPVGAVAKVRDMKDGESTGTLVRFWPDGGIFQTTEFRFDRLADRLREMAYLNRHVYISIEDLREAEGLRDEYHFEGGIIEFVEYLDEARTPIHDETIYIADEDA----------EVPVEMAMRYNSGYTENVLSFVNNINTHEGGTHVSGFRRALTRTLKSYADKNNLLKNVKVDLSGDDFREGITVILSIKVAEPQFEGQTKTKLGNSEVQGAVESLVFLKLGEWLDDHPKESKRIVEKVIIAAEARAAARKARELVQRKNAFSSGGLPGKLADCSSKNAEECEIYLVEGDSAGGSAKQARDRHFQAILPLRGKILNVEKARLDRILANEEIRNIVTALGTGLGAGEDDFDPEKLRYHKIIVMTDADVDGAHIRTLLLTFLYRHMHALVEAGYIYIAQPPLYKAKKGKQEEYCWTDKQLKEVIERIGGDSPEKVTIQRYKGLGEMNPDQLWDTTMNPETRLLQRITIDDAAAADRIFSTLMGDAVEPRRKFIERNAKY 650
>gi|88805959|ref|ZP_01121477.1| DNA gyrase subunit B [Robiginitalea biformata HTCC2501] >gi|88783568|gb|EAR14739.1| DNA gyrase subunit B [Robiginitalea biformata HTCC2501] (648 aa)
Score = 1554, Expect = 1.8e-170, Identities = 331/649 (51%), Positives = 449/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK-----ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M++E K  +YSA +I+ LEG+E VR RP MYIG   ++GLHH+V+E+VDNSIDEAM G+   I++T+ ++ S  V+D+GRGIPV+ H K   S +E V+T + AGGKFD DSYKVSGGLHGVG SVVNALS  LK  VY+E K    E+ + G+ +  +K T    S  NGTIV F+PD EI ++  EF  DT+ +R+++LAYLNKG+ I   D R  +K     E F    G+K+++  L+  +EP++  ++  E E          K +I VEVA  YN +Y  +  ++ NNINT EGG+H  GF+  L   + K+A    +L +   +++ +D  EGLTAIVS+K   PQ+EGQTK KLGN EV   VS  VSE+   YL E+P+DA  +++K +LA +AR  + +ARE  +RK+P     LPGKLADCS +D E  E+++VEGDSAGG+AK+GRDR  QAILPL+GKI+NVEKA   K+F NEEI N+ TA+G  +G E       +DKLRY+K+I+M DADVDGSHI  L+LTF FRYM  L+E G+VYIA PPL+    G   +YA+++K  +   +E   S     IQRYKGLGEMN +QLW+TTM+P+ R L +VTI++A  +D++FS+LMGDEV PRREFIE+NA Y  N+D+
  S:     1 MSEEVKGKSYSADSIQALEGIEHVRMRPSMYIGDIGVRGLHHLVYEVVDNSIDEAMGGHCDTISVTINEDNSITVEDNGRGIPVDLHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSVVNALSKHLKATVYREGKIWEQEY-ERGRTLYPVKSTG--TSDLNGTIVTFHPDPEIFQQTIEFSYDTLSNRMRELAYLNKGVAITITDRRVKEKGEYLSERFYSEEGLKEFIRFLDGNREPLIADVISMEGE----------KNDIPVEVAMVYNTSYTENLHSYVNNINTHEGGTHLSGFRRGLTTTLKKYADASGMLDKLKFEVAGDDFREGLTAIVSVKVAEPQFEGQTKTKLGNREVSAAVSQAVSEMLTNYLEEHPDDAKTVVQKVILAAQARHAAAKAREMVQRKNPMSGGGLPGKLADCSDQDPERCEIFLVEGDSAGGTAKMGRDRNTQAILPLRGKILNVEKAMQHKVFENEEIKNIYTALGVTIGTEEDSKALNLDKLRYHKVIIMCDADVDGSHIETLILTFFFRYMRELIEGGHVYIATPPLYLVKKGSKKRYAWNDKERDAIVEELSTSSGSPGIQRYKGLGEMNAEQLWDTTMNPEFRTLRQVTIDNATESDRIFSMLMGDEVPPRREFIERNAVYA-NIDV 648
>gi|189462935|ref|ZP_03011720.1| hypothetical protein BACCOP_03637 [Bacteroides coprocola DSM 17136] >gi|189430362|gb|EDU99346.1| hypothetical protein BACCOP_03637 [Bacteroides coprocola DSM 17136] (654 aa)
Score = 1553, Expect = 2.2e-170, Identities = 325/641 (50%), Positives = 443/641 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-------PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKK---ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           N YSAS+I++LEGLEAVRKRP MYIG    KGLHH+V+E+VDNSIDEA+ G  + I +T+ ++ S  VQD+GRGIPV+ H K KKS +E V+TVLHAGGKFD  SYKVSGGLHGVG S VNALS+ +   V++  K H  E+   GKP+  +K      +   GT   F+PD  I    E+  + +++R+++LAYLNKGI I   D+R  +      +E F    G+K++V  LN+   P++  ++Y           N +K  I +E A  YN  +  +  ++ NNINT EGG+HE GF+ AL +++ K+A E K L++   +IS ED  EGL A++S+K   PQ+EGQTK KLGN+EV   V+  V E    YL E+P++A  I+ K +LA  AR  + +ARE+ +RKSP     LPGKLADCS++  E  EL++VEGDSAGGSAK GR R FQAILPL+GKI+NVEKA   K F ++E+ N+I A+G   G        +  IDKLRY+K+I+MTDADVDGSHI  L++T  +RYM  +++ G++YIA PPL+K S GK S+Y Y ++  + F +   + ++     QRYKGLGEMNP+QLWETTM+P+ R+L +V+IE+A  AD +FS+LMGD+VAPRREFIEK+A Y  N+D
  S:    11 NNYSASSIQVLEGLEAVRKRPAMYIGDISEKGLHHLVYEVVDNSIDEALAGYCTHIEVTINEDNSITVQDNGRGIPVDFHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTNVFRNGKIHQQEYA-CGKPLYAVKEVG--TTDITGTRQTFWPDGSIFTTTEYKYNILQARMRELAYLNKGITITLTDKREKEEDGSFKQEIFHSEEGVKEFVRFLNSTNTPLIDDVIY----------LNTEKQGIPIECAIMYNTGFRENLHSYVNNINTIEGGTHEAGFRTALTRVLKKYAEESKALEKAKVEISGEDFREGLIAVISVKVAEPQFEGQTKTKLGNNEVSGAVNQAVGEALTYYLEEHPKEAKTIVDKVVLAATARIAARKARESVQRKSPMGGGGLPGKLADCSSRTAEECELFLVEGDSAGGSAKQGRSRQFQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGVRFGVDGTEDSKKANIDKLRYHKVIIMTDADVDGSHIDTLIMTLFYRYMPEVIQGGHLYIANPPLYKCSKGKISEYCYTDEERQAFMQKYGDGTETGIHTQRYKGLGEMNPEQLWETTMNPETRILKQVSIENAAEADYIFSMLMGDDVAPRREFIEKHATYA-NID 653
>gi|164510805|emb|CAK18885.1| topoisomerase II subunit B [Staphylococcus pseudintermedius] (611 aa)
Score = 1553, Expect = 2.4e-170, Identities = 327/619 (52%), Positives = 445/619 (71%)
  Q:    30 MYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           MYIGST  +GLHH+VWEIVDNSIDEA+ G A  I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V+++ + H+  +  G  P  DLK   +  + + GT++ F  D  I  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE +N  KEP+         +E +     +D  +I VE+A QYN  +  +  T+ NNI+T EGG+HE+GFK AL +++N +  + KL+KE  +++S ED  EGLTA+VSIKH +PQ+EGQTK KLGNSEVR  V  V SE+FE++L E+P+ A +I++K ++A  AR  + +ARE TRRKS  + +SLPGKLADCS+KD   SE+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ DKI +N EI  ++TA G G+G EF I K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y ++++ L++ K K N   K+ I RYKGLGEMN DQLWETTM+P+NR +L+VT++DA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:     1 MYIGSTSERGLHHLVWEIVDNSIDEALAGYADNIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSDTLEVYVHRDGRIHHQAYHKG-VPAFDLKQVGD--TDQTGTVIRFKADGTIFQETTVYNYETLQKRIRELAFLNKGIRITLTDERDEENVREDSYHYEGGIKSYVELINENKEPL--------HDEPIYVHQTRD--DIEVEIALQYNSGFATNLLTYANNIHTYEGGTHEDGFKRALTRVLNNYGTQSKLIKEDKDRLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQIVDRVFSELFERFLYEHPQVARIIVEKGIMASRARIAAKKAREVTRRKSALDISSLPGKLADCSSKDPSESEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDKILNNNEIRQMVTAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVFNDRELDKLKEKLNPTPKWSIARYKGLGEMNADQLWETTMNPENRAMLQVTLDDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 610
>gi|164510802|emb|CAK18883.1| topoisomerase II subunit B [Staphylococcus pseudintermedius] (611 aa)
Score = 1553, Expect = 2.8e-170, Identities = 327/619 (52%), Positives = 445/619 (71%)
  Q:    30 MYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFK-KENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           MYIGST  +GLHH+VWEIVDNSIDEA+ G A  I + + K+   KV D+GRGIPV+   K  +  VE +LTVLHAGGKF    YKVSGGLHGVG+SVVNALS  L+V+V+++ + H+  +  G  P  DLK   +  + + GT++ F  D  I  E   ++ +T++ R+++LA+LNKGI+I   DER ++   ++++ + GGIK +VE +N  KEP+         +E +     +D  +I VE+A QYN  +  +  T+ NNI+T EGG+HE+GFK AL +++N +  + KL+KE  +++S ED  EGLTA+VSIKH +PQ+EGQTK KLGNSEVR  V  V SE+FE++L E+P+ A +I++K ++A  AR  + +ARE TRRKS  + +SLPGKLADCS+KD   SE+++VEGDSAGGS K GRD   QAILPL+GKI+NVEKA+ DKI +N EI  ++TA G G+G EF I K RY+KI++MTDADVDG+HIR LLLTF +R+M PL+E G VYIA PPL+K + GK   Y ++++ L++ K K N   K+ I RYKGLGEMN DQLWETTM+P+NR +L+VT++DA+ AD+ F +LMGD V  RR+FIE NA Y  NLD
  S:     1 MYIGSTSERGLHHLVWEIVDNSIDEALAGYADNIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSETLEVYVHRDGRIHHQAYHKG-VPAFDLKQVGD--TDQTGTVIRFKADGTIFQETTVYNYETLQKRIRELAFLNKGIRITLTDERDEENVREDSYHYEGGIKSYVELINENKEPL--------HDEPIYVHQTRD--DIEVEIALQYNSGFATNLLTYANNIHTYEGGTHEDGFKRALTRVLNNYGTQSKLIKEDKDRLSGEDTREGLTAVVSIKHGDPQFEGQTKTKLGNSEVRQIVDRVFSELFERFLYEHPQVARIIVEKGIMASRARIAAKKAREVTRRKSALDISSLPGKLADCSSKDPSESEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDKILNNNEIRQMVTAFGTGIGGEFDISKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVFNDRELDKLKEKLNPTPKWSIARYKGLGEMNADQLWETTMNPENRAMLQVTLDDAIEADQTFEMLMGDVVENRRQFIEDNAVYA-NLD 610
>gi|160932418|ref|ZP_02079808.1| hypothetical protein CLOLEP_01253 [Clostridium leptum DSM 753] >gi|156868377|gb|EDO61749.1| hypothetical protein CLOLEP_01253 [Clostridium leptum DSM 753] (646 aa)
Score = 1552, Expect = 3.0e-170, Identities = 348/648 (53%), Positives = 464/648 (71%)
  Q:     2 NKETKKNT-YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD---KETFLFAGGIKQWVEELNNEK--EPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N+ T+ N  Y AS+I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDN+IDEA+ G   +I + +       V+D+GRGIPV    K     V  V TVLHAGGKF    YKVSGGLHGVGASVVNALS+WL+V V  +    Y +  + GK + DL++  +  + K GT V F  D EI  E   ++ +T+++RL++ A+LN GI I  +DER  +   ++ FL+ GGI  +VE L+  K  E I P I++      VK A      +   EVA QYN++YN    +F NNI+TT+GG+HEEGFK AL +I+N +A +  +LK+ D+ +S ED  EGLTAI+S+K    Q+EGQTK KLGN+E+R  V N++SE    YL ENP  A  I +K + A  AR+ + +ARE  RRKS  ES +LPGKLADC +++ E +E+YIVEGDSAGGSAK GRDR FQAILPL GK++NVEKA+ DK++ N++++ +ITA+G G+G EF + KLRY K+I+M DADVDGSHIR LLLTF FR+M PL+E G++YIA PPL++ + GK+  YAY +K  ++  KE + V   IQRYKGLGEM+ +QLWETTM+P+ R++LKV +EDA  AD+ F++LMGD+V PRREFIEKNAKYV+NLD+
  S:     4 NEITQTNEEYGASDIQVLEGLEAVRKRPGMYIGSTGPRGLHHLVYEIVDNAIDEALAGYCDKIDVRILPGDIIVVEDNGRGIPVGIQPKMGIPAVTVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTWLEVEV-SDGAHIYRQRFERGKTITDLEMIGD--TTKTGTKVTFQADPEIFSESTVYEYETLETRLREQAFLNAGIHIELVDERDPENRVQKNFLYEGGISSFVEFLHKRKSLEVIHPDIIH------VKGALTDG--SAEAEVAMQYNESYNELLISFANNIHTTDGGTHEEGFKRALTRIMNDYARKYNILKDGDKNLSGEDVREGLTAIISVKLKEAQFEGQTKAKLGNTEIRTLVDNLISEKLSAYLEENPATARAIFEKAMAASRAREAARKARELVRRKSALESAALPGKLADCQSRNPEETEIYIVEGDSAGGSAKGGRDRKFQAILPLWGKMLNVEKARLDKVYGNDKLMPVITALGCGIGDEFDLAKLRYGKVIIMADADVDGSHIRTLLLTFFFRFMKPLIEEGHIYIAQPPLYRLTKGKNHYYAYSDKERDQMLKEMT-VTAPIQRYKGLGEMDSEQLWETTMNPETRIMLKVELEDAAAADETFTILMGDKVEPRREFIEKNAKYVQNLDV 646
>gi|153894827|ref|ZP_02015410.1| DNA gyrase, B subunit [Halorubrum lacusprofundi ATCC 49239] >gi|151586050|gb|EDN49474.1| DNA gyrase, B subunit [Halorubrum lacusprofundi ATCC 49239] (645 aa)
Score = 1551, Expect = 3.9e-170, Identities = 334/645 (51%), Positives = 444/645 (68%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEF------KDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD-------DKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVK-YQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++++ Y A  I++LEGL+AVRKRP MYIGSTD +GLHH+V+E+VDNSIDEA+ G   +IT+T+  + S  V DDGRGIPV+ H K  +  +E ++T+LHAGGKFD+ SY+VSGGLHGVG SVVNALS  L+V V ++   +  EF      +DG + V DL    E      GT + F+PD EI E   F+  T+ SRL++LA+LN G+ +  IDER +       D+ETF + GGI+++V  LN  + PI   ++Y E E+           +I VEVA Q  +    S   F NNINT EGG+H  GFK AL + +N +A    L+ + +  +  ED  EGLTA++S+KHP+PQ+EGQTK KLGNSEVR  V +   +    +  ENP+ A  ++ K   A  ARK + +A E TRRKS  ES +LPGKLADC T+D E +EL++VEGDSAGGSAK GR+R  QAILPLKGKI+NVEK + D+I  N+EI  LITAIGAG+G EF ID +RYNKII+MTDADVDG+HIR LLLT L+R+M PLLE G VY A PPL++      +  A  E   +    E       Q+QR+KGLGEMNPDQLW+TTMDP+NR L ++ I+DA  AD++F++LMGD V PR++FI+++A   + +DI
  S:     2 SEQSEYGAGQIQVLEGLQAVRKRPAMYIGSTDGRGLHHLVYEVVDNSIDEALAGYCDDITVTIHDDNSVSVSDDGRGIPVDIHEKYDRPALEVIMTILHAGGKFDSKSYQVSGGLHGVGVSVVNALSERLEVEVKRDGGVYRHEFARGEPAEDGFERVRDLNDDEE-----TGTYIRFWPDEEIFETTAFEFSTLASRLRELAFLNSGVAVTLIDERDEEGVDDAGDEETFRYEGGIREFVGYLNEARTPIHDEVIYFEDEDD----------DIHVEVAMQATEELQGSVHAFANNINTREGGTHLTGFKTALTRTVNDYANTHGLVDDLEANLKGEDVREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESATHDKLGTFFEENPDTARKVVHKAAEAARARKAAKKAEELTRRKSALESTALPGKLADCQTRDPEEAELFVVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKHRLDRILENDEIRALITAIGAGIGEEFDIDDVRYNKIIIMTDADVDGAHIRTLLLTLLYRHMKPLLEAGYVYAAQPPLYRVRYRGETYDAMTEAERDRIVAEECDGNPAQVQRFKGLGEMNPDQLWDTTMDPENRRLKRINIDDAAAADRMFNVLMGDAVEPRKQFIKEHATEAEWVDI 645
>gi|78185902|ref|YP_373945.1| DNA gyrase, B subunit [Pelodictyon luteolum DSM 273] >gi|78165804|gb|ABB22902.1| DNA gyrase subunit B [Pelodictyon luteolum DSM 273] (644 aa)
Score = 1551, Expect = 4.4e-170, Identities = 332/646 (51%), Positives = 438/646 (67%)
  Q:     4 ETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWV-----EELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           +T ++ Y A+NI++L+G+  VR RP MYIG    +GLHH+++EIVDNSIDE + G    I ++L  +GS  V D GRGIPV+ H   KKS +E V+T++ AGGKFD  +YKVSGGLHGVGASVVNALS W +V VY++ K  +  +  G  P AD+K           T   F PD EI +  EF  D I  R+++LA+LN  +KI  + +   ++ETF F GG+K++V       LN  KEPI    +Y E++ ++            VE+A +YN +Y  + F++ NNINT EGG+H  GF+ AL + +N +A +  LLK     ++ +D  EGLTA++S+K   PQ+EGQTK KLGNSE +  V +V++E   ++   NP    +II+K   A  +R+ + +A+E TRRKS  ES+ LPGKLADCS  D E  ELYIVEGDSAGGSAK GRDR FQAILPLKGKI+NVEKA+  K+  NEEI  +I A+G   G  EF  +KLRY KII+MTDADVDG+HIR LLLTF FR+M  L+E G VYIA PPL+    GK  +YA+D+           K +  K    IQRYKGLGEMNP+QLW TTMDP++R LL+V++E+A+ ADKVFS LMGD+V PRREFIEKNA+YV+ LD+
  S:     7 QTPQSNYGATNIQVLDGIAHVRMRPAMYIGDIHSRGLHHLIYEIVDNSIDETLGGYNDYIFVSLNPDGSVTVIDHGRGIPVDIHPDKKKSALELVMTLIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVYRDGKAWFQRYHRG-VPEADVKEIGTTTERG--TKTTFMPDSEIFKVTEFRKDIIIDRMRELAFLNSNLKI-VVQDIEGEQETFHFEGGLKEFVLFTDENRLNLIKEPIY---IYGEKDGTI------------VEIALEYNDSYQENVFSYVNNINTHEGGTHVTGFRKALTRTLNAYAQKNDLLKNLKLALTGDDFKEGLTAVISVKVAEPQFEGQTKTKLGNSETQSIVESVLNEQLAEFAESNPNVIKMIIEKVKGAAMSREAARKAKELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKGKILNVEKARLHKMLENEEIKTIILALGTNFGEEEFSAEKLRYGKIIIMTDADVDGAHIRTLLLTFFFRHMRSLIEAGKVYIAQPPLYLVKSGKEQQYAWDDDERNSISDSMKKMQKGKANVHIQRYKGLGEMNPEQLWGTTMDPEHRSLLQVSVENAMEADKVFSTLMGDKVEPRREFIEKNARYVRRLDV 644
>gi|154503045|ref|ZP_02040105.1| hypothetical protein RUMGNA_00867 [Ruminococcus gnavus ATCC 29149] >gi|153796286|gb|EDN78706.1| hypothetical protein RUMGNA_00867 [Ruminococcus gnavus ATCC 29149] (645 aa)
Score = 1550, Expect = 5.0e-170, Identities = 349/640 (54%), Positives = 449/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSK-VKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNA--DKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A  I+ILEGLEAVRKRPGMYIGST  +GLHH+V+EIVDN++DEA+ G    I +++  + S  V D+GRGIPV  + K     VE V T+LHAGGKF    YKVSGGLHGVGASVVNALS WL+V +Y E   YK+ Y    + GK +  LKV  E    K GT V F PD EI E   F+ D +K RL+++A+L KG+KI   D R ++  + TF + GGIK++V  LN  K P+   I+Y E E          K  + VE+A Q+N +Y+++T+ F NNI T EGG+H EGF+ AL K  N++A + KLLK+ +  +S +D  EGLTAIVS+K   PQ+EGQTK+KLGNSE R  V N+VS   E +L +NP  A   ++K L+A  AR+ + +AR+ TRRKS  E  SLPGKLADCS K+ E  E+YIVEGDSAGGSAK  R R  QAILPL+GKI+NVEKA+ DKI++N EI  +ITA G G+  +F I KLRY+KII+MTDADVDG+HI  LLLTFL+R+M  L+  G VY+A PPL+K    K   YAY ++ L E   E  +    +IQRYKGLGEM+ DQLWETTMDP++R+LL+VT++D  ++  D  F+ LMGD+V PRREFIE+NA++VKNLDI
  S:    12 YGADQIQILEGLEAVRKRPGMYIGSTSARGLHHLVYEIVDNAVDEALAGYCDTINVSINPDNSVTVVDNGRGIPVGLNHKAGIPAVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSVWLEVEIYNEGKIYKQRY----ERGKTMYSLKVVGECDPDKTGTKVTFLPDGEIFEETVFEYDVLKQRLREMAFLTKGLKIILQDLREEEIREHTFHYEGGIKEFVTYLNKSKTPLYDQIIYCEGE----------KDGVVVEMAMQHNDSYSDNTYGFVNNITTPEGGTHIEGFRKALTKTFNEYARKNKLLKDNEPNLSGDDIREGLTAIVSVKIGEPQFEGQTKQKLGNSEARGAVDNIVSTQLEIFLEQNPSVAKQTVEKSLMAQRAREAARKARDLTRRKSALEGMSLPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARQRATQAILPLRGKILNVEKARLDKIYANAEIKAMITAFGTGIHEDFDISKLRYHKIIIMTDADVDGAHISTLLLTFLYRFMPDLIREGYVYLAQPPLYKLEKNKKVWYAYSDEELNEILTEVGRDSNNKIQRYKGLGEMDADQLWETTMDPEHRVLLRVTMDDETSSELDLTFTTLMGDKVEPRREFIEENARFVKNLDI 645
>gi|28209863|ref|NP_780807.1| DNA gyrase subunit B [Clostridium tetani E88] >gi|28202298|gb|AAO34744.1| DNA gyrase subunit B [Clostridium tetani E88] (637 aa)
Score = 1550, Expect = 6.2e-170, Identities = 347/647 (53%), Positives = 457/647 (70%)
  Q:     3 KETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE--NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           ++ KK  Y  S I++LEGLEAVRKRPGMYIGST  +GLHH+V+EIVDNSIDEA+ G   +I I + ++ S  ++D+GRG+PV  H K  K TVE ++T+LHAGGKF    YKVSGGLHGVGASVVNALSS  +V V ++   +++ Y    + G  V  L+   E +  ++GT   F PD  I +  EF+ D +  RL+++A+LNKGI I   D+R D KE F + GGIK +V  LN  KE +    +Y E          KD++   VE++ QYN  Y  + F+F NNI+T EGG+H  GFK A+ +  N +A     LKE D+ ++ ED  EG+TAI+S+K  +PQ+EGQTK KLGNSEVR  V  +V E    +L ENP+ A  II K L+A  AR+ + +AR+ TRRKS  ES SLPGKLADCS+KD +  E+YIVEGDSAGGSAK GR+R FQAILPL+GKI+NVEK + DKI +++ I ++ITA GAG+G +F ++K+RYN+II+MTDADVDG+HIR LLLTF +RYM  L+ENG+VYIA PPL+K S  +   Y Y ++ LEE   E      K QIQRYKGLGEMN +QLW+TTM+P  R+LL+ TIEDA+ AD++F++LMGD+V  RREFI++NAK V NLD+
  S:     2 EQDKKQKYDESQIQVLEGLEAVRKRPGMYIGSTGARGLHHLVYEIVDNSIDEALAGYCDKIDIYINEDNSITIEDNGRGMPVGLHPKMNKPTVEVIMTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSECRVEVKRDGYVWRQVY----EKGIAVTGLEKIGETS--QHGTKTYFKPDPTIFDELEFEYDVLVQRLREMAFLNKGINITIEDKRVDKKEDFHYEGGIKSFVLYLNRTKEVLHKEPIYIE--------GMKDEH--MVEISIQYNDGYAENIFSFANNISTIEGGTHLAGFKSAVTRAFNDYARRYGFLKENDKNLAGEDIREGITAIISVKLIDPQFEGQTKTKLGNSEVRGIVDTIVGEGVGNFLEENPQIAKSIIDKTLMAARAREAARKARDLTRRKSVLESTSLPGKLADCSSKDPKECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQRLDKILNSDTIKSMITAFGAGIGKDFDVEKIRYNRIIIMTDADVDGAHIRTLLLTFFYRYMKELVENGHVYIAQPPLYKVSKDRKEHYVYTDRELEEILDEIGGRDNKTQIQRYKGLGEMNAEQLWDTTMNPDKRILLRATIEDAMAADEIFTILMGDKVDLRREFIQENAKTVVNLDV 637
>gi|160935172|ref|ZP_02082555.1| hypothetical protein CLOBOL_00067 [Clostridium bolteae ATCC BAA-613] >gi|158441903|gb|EDP19600.1| hypothetical protein CLOBOL_00067 [Clostridium bolteae ATCC BAA-613] (657 aa)
Score = 1549, Expect = 7.9e-170, Identities = 320/640 (50%), Positives = 427/640 (66%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD-----------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEE-FKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDA---LNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A+ I+ILEGLEAVRKRP MYIGST  +GLHHMV+EIVDN++DEA+ G+ + I + L K+GS  V+D+GRGIP     KT  S ++ V TVLHAGGKFD+ +YKVSGGLHGVGASVVNALSS L V V ++   Y + Y    + G P A +K     +   +GT V F PD +I     +D + ++ RL++ A+L +G++I+  D R D              TF F  G+K +V  L  + EP+   I+    E         DK  ++ E A  +N +Y+    +F NNI+T EGG+H  GF+ AL + +N +A   KLLK+TD  +S+++  EGLTA++S++  + Q+EGQTK+KLG+S VRP V  +V      +L +NP  A  I  K +LA +AR  +  ARE  RRK+     SLPGKLADCS+K+    EL+IVEGDSAGGSAKL R R  QA+LPL+GKI+NVEKA  D+I +N EI  +I+A G G+   F ++ LRYNKIILMTDADVDG+HI  LLLTFLFR+M  L+E G+V++A PPL++   GK   YAY +  LE+          Y+IQRYKGLGEM+  QLWETTMDP  R LL++TI D        + FS+LMGDEV PR+ FI ++A+Y+  LDI
  S:    14 YGAAQIQILEGLEAVRKRPSMYIGSTSSQGLHHMVYEIVDNAVDEALAGHCTLIQVYLNKDGSVTVRDNGRGIPAGIQTKTGLSAIQVVFTVLHAGGKFDDSNYKVSGGLHGVGASVVNALSSHLHVQVDQDGFSYAQSY----ERGIPAAPVKQLGPCSQGTHGTTVTFMPDQDIFPSIAWDRNILEERLRETAFLTQGLEISLYDLRRDPAGEATCPVTAWSRTFCFQNGLKDFVSWLEQDGEPLYTGIISGRHE--------TDK--VQAEFALVHNSSYSEQLLSFANNISTPEGGTHVTGFRQALSRAVNDYARNAKLLKDTDSSLSRDELSEGLTAVLSVRLQDAQFEGQTKQKLGSSHVRPVVEQMVYTRLTLFLEQNPAAAKAICDKAMLARKARTAARTAREMARRKTALSGLSLPGKLADCSSKNPGECELFIVEGDSAGGSAKLARSRENQAVLPLRGKILNVEKASLDRISANAEIKAMISAFGTGILDTFSLENLRYNKIILMTDADVDGAHITTLLLTFLFRFMPKLIEEGHVFLAQPPLYRVEKGKKLWYAYSDSELEQTINAIGRDGTYKIQRYKGLGEMDAGQLWETTMDPSRRTLLRITINDMEMYHETCQTFSILMGDEVEPRKNFILEHAQYISMLDI 657
>gi|149278877|ref|ZP_01885012.1| DNA topoisomerase (ATP-hydrolyzing), subunit B (DNA gyrase) [Pedobacter sp. BAL39] >gi|149230496|gb|EDM35880.1| DNA topoisomerase (ATP-hydrolyzing), subunit B (DNA gyrase) [Pedobacter sp. BAL39] (652 aa)
Score = 1548, Expect = 8.2e-170, Identities = 332/639 (51%), Positives = 443/639 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-PE----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK----TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVK 645
           K+ YSA NI++LEGLEAVRKRP MYIG T IKGLHH+V+E+VDNSIDEA+ G+A  I + + ++ S +V+D+GRGIP   + K  KS +E V+TVLHAGGKFD D+YKVSGGLHGVG S VNALS+ LK  V++E  + +++  + GKP+ D+K+  E  + K GTIV F PD  I  +  E+  DT+ +RL++L++LNKGIK+   DER  D       E F   GG+K++V+ L+  +  ++   +Y E            K  I VE+A QYN +Y  +  ++ NNINT EGG+H  GF+  L + +  +A +  LLK    +I+ +D  EGLTA+VS+K   PQ+EGQTK KLGNSEV   V   V E    YL ENP +A +I+ K +LA  AR  + +ARE  +RKS    + LPGKLADCS  D E  E+Y+VEGDSAGG+AK GRDR FQAILPLKGKI+NVEKA   KI+ N+EI N+ TA+G  +G PE      + KLRY+K+++MTDAD+DGSHI  L+LTF FRYM  L+E G VYIA PPL++   GK  +Y ++++     ++  K    +    IQRYKGLGEMN +QLW+TT++P+ R LL+ TIE+A   D  FS+LMGDEV PRR+FIE+NAKY K
  S:     8 KSNYSADNIQVLEGLEAVRKRPSMYIGDTGIKGLHHLVYEVVDNSIDEALAGHADTIYVNILEDNSIRVEDNGRGIPTGINKKENKSALEIVMTVLHAGGKFDKDTYKVSGGLHGVGVSCVNALSTHLKAEVHRE-GQIWMQEYNIGKPLYDVKLVGE--TDKRGTIVTFSPDPTIFTQTTEYRYDTLAARLRELSFLNKGIKLTLTDERETDADGNFITELFHSEGGLKEFVQFLDGGRPSLIAEPIYVE----------GIKNGIPVELALQYNDSYAENVHSYVNNINTHEGGTHIAGFRRGLTRTLKAYADKSGLLKNVKFEITGDDFREGLTAVVSVKVQEPQFEGQTKTKLGNSEVMGAVDVAVGEALNNYLEENPREAKLIVNKVILAATARAAARKAREMVQRKSVMGGSGLPGKLADCSDSDPEKCEIYLVEGDSAGGTAKQGRDRNFQAILPLKGKILNVEKAMEHKIYENDEIKNMFTALGVSIGTPEDDKALNLTKLRYHKVVIMTDADIDGSHITTLILTFFFRYMKALIEAGYVYIAAPPLYQVKKGKEHEYCWNDQQRDAAVQRLKGAGKEESVHIQRYKGLGEMNAEQLWDTTLNPQTRTLLQATIENAAECDHTFSMLMGDEVGPRRDFIERNAKYAK 649
>gi|68535067|ref|YP_249772.1| DNA gyrase subunit B [Corynebacterium jeikeium K411] >gi|68262666|emb|CAI36154.1| DNA gyrase subunit B [Corynebacterium jeikeium K411] (674 aa)
Score = 1548, Expect = 9.0e-170, Identities = 334/649 (51%), Positives = 451/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK---------------------------------ETFLFAGGIKQWVEELNNEKEPIVPTIV-YDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSK-YAYDEK----TLEEFKKENSKVKYQ--IQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M +  K++ Y AS+I ILEGLEAVRKRPGMYIGST  +GLHH+VWE+VDNS+DEAM G A E+++TL  +G  +V DDGRGIPVE H  T   TV+ V+T LHAGGKFD+DSY VSGGLHGVG SVVNALS+ ++  +    ++ Y+  ++  + V + ++   K +   GT   F+PD EI E  EF+ DT+  RL+++A+LNKG+ I  +DER + +                                   F +  G+K +V  +N ++  I PTI+ +D  EE           +  VEVA Q+N  ++ S  TF N INT EGG+HEEGF+ AL  ++N++A + KLLK  D K+S +D  EGL A++S++  +PQ+EGQTK KLGN+E++ FV   V+E    +L  NP +A  I+ K + +  AR  + +AR+  RRKS  +   LPGKLADC ++D ++SELYIVEGDSAGGSAK GRD ++QAILPL+GKI+NVEKA+ DK+  N E+  +ITA+G G+  EF I KLRY+KI+LM DADVDG HI  LLLT LFR+M PL+E G VY+A PPL+K    K    +A+ ++     LEE   +  K+     IQRYKGLGEMN  +LWETTMDP  R L +V +EDA  AD++FS+LMGD+V  RR FI KNA+ V+ LD+
  S:     1 MAEPQKQSDYGASSITILEGLEAVRKRPGMYIGSTGERGLHHLVWEVVDNSVDEAMAGYAKEVSVTLLADGGVEVIDDGRGIPVEDHP-TGPPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRMETEI---KRDGYLWRQNFNEAVPE-ELQQVKKARGTGTKQRFWPDPEIFETVEFNFDTVAKRLQEMAFLNKGLTIKLVDERENLEDDEELEAAAEDAAAPKSTEEKAAEAEKKKGPRTRVFHYPEGLKDYVAYINRKRTAIHPTIISFDVAEE-----------DHEVEVALQWNSGFSQSVHTFANTINTFEGGTHEEGFRAALTSLMNRYARDHKLLKAKDPKLSGDDVREGLAAVISVRVGDPQFEGQTKTKLGNTEIKGFVQRAVNEHLADWLDANPAEAKAIVDKAVASAHARDAARKARDMVRRKSASDIGGLPGKLADCRSRDPKLSELYIVEGDSAGGSAKSGRDSMYQAILPLRGKILNVEKARMDKVLKNNEVQAIITALGTGIHDEFDIKKLRYHKIVLMADADVDGQHIATLLLTLLFRFMRPLVEEGYVYLAQPPLYKLKWAKGEPGFAFSDRERDEQLEEGLAKGRKINKDDGIQRYKGLGEMNAKELWETTMDPTVRTLRRVDLEDAAAADEIFSVLMGDDVVARRSFITKNARDVRFLDV 674
>gi|13878524|sp|O29720|GYRB_ARCFU DNA gyrase subunit B (632 aa)
Score = 1548, Expect = 9.7e-170, Identities = 329/649 (50%), Positives = 446/649 (68%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK-PVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKV-KYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M+ +     Y+A +I++L+ LEAVRKRPGMYIG   ++GLHH++WE+VDN++DEA+ G    I ++L K+GSA V+D+GRGIP E H +  KS +E V+T LHAGGKF    Y+VSGGLHGVG SVVNALS WL+VWV +  K +Y +++ G + P A  +      + ++GT V F PD EI E  EF  + +  RLK+LAYLN+G+KI   DER   +ETF F  GI   V  LN  ++P+          E +     KD   + VEVA Q+  +   +   F NNINT+EGGSH  GF+  L + +N++   KK LK+  E ++  D  EGLTA++S+K P PQ+EGQTK KL NS+V+  V + V     ++L ENP  A  ++ K +L  +AR+ +  A+E  +RK+   + +LPGKLADCS+K+ E  EL+IVEG+SAGGSAK  RDR FQAILP+KGKIINVEKA   ++  N+EI  +I+AIGAG+G +F I K RY +II+MTDADVDG+HIR LLLTF +RYM PL+E+G +YIA PPL++   GK S YAY +   EE K+   +V   ++QRYKGLGEMNP QLWETTM+P+NR+L++VT+EDA  AD++FS+LMG++V  RR FI  ++K VKNLDI
  S:     1 MSPDQTAVEYTAKDIEVLDDLEAVRKRPGMYIGGVGVRGLHHLLWEVVDNAVDEALAGYCDTIKVSLHKDGSASVEDNGRGIPTEMH-ELGKSALEIVMTKLHAGGKFSKKVYRVSGGLHGVGVSVVNALSEWLEVWVKRNGKIYYQKYQRGSRSPEAGHRTEVLGETKEHGTTVRFKPDREIFETTEFKYEIVAQRLKELAYLNRGLKIILFDEREGKEETFHFEDGIIGLVRSLNRNRKPL---------HEPIYIETTKD--GVSVEVAIQFTDSDVENIQAFANNINTSEGGSHVVGFRAGLTRAVNEYG--KKHLKKF-EPVTGVDIREGLTAVISVKVPEPQFEGQTKTKLTNSDVKTVVESAVYSGVLRWLEENPAQAETLLNKFILNKKAREAAKRAKELVKRKNELIT-TLPGKLADCSSKNPEERELFIVEGESAGGSAKQARDRRFQAILPIKGKIINVEKAGMARVLKNDEIKAIISAIGAGIGKDFDITKARYRRIIIMTDADVDGAHIRTLLLTFFYRYMRPLIESGYLYIAQPPLYQIKKGKKSYYAYSD---EELKRTLEQVGGGEVQRYKGLGEMNPQQLWETTMNPENRILIQVTLEDAKRADELFSILMGEDVESRRNFIMAHSKEVKNLDI 632
>gi|73697709|gb|AAZ81471.1| DNA gyrase subunit B [Acholeplasma palmae] (588 aa)
Score = 1547, Expect = 1.4e-169, Identities = 327/600 (54%), Positives = 421/600 (70%)
  Q:    24 VRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLF--AGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFS 623
           VRKRPGMYIGST  +GLHH+VWEIVDNSIDEA+ G A  IT+ + K+   +V D+GRGIPV  H KT K  VET+LT LHAGGKFD  SYKVSGGLHGVGASVVNALSS+  V V+   K H   F+ G  PV  L +  +  +   GT++ F  D ++  E   +D +T++SR++QLA+LN+ IKI   D+R ++  +F +   GG+ ++++ L   K  I     Y E+E             I +EVA QY  +Y  + ++F NNI T EGG HE+GFK AL +++ K+A +  LLK+ DE    +D  EGLTAI+S+KHP+PQ+EGQTK KLGN EVR   S VV E FE+YLLENP DA  II K LLA  AR  + +AREATRRKSP ++     KLADC +K+  ISELYIVEGDSAGGSAK GR+  +QAILPL+GK++NVEKA+ DK+ SN EI++LI AIG G+G EF  +K RY+KI++MTDADVDG+HIR LLLTF FRY  PL++ G +Y A PPL+K   GK  +Y YD++ L +   E    K  +QRYKGLGEMNP+QLWETTMDP+ R LL+VT++DA+ AD+VF+
  S:     1 VRKRPGMYIGSTGERGLHHLVWEIVDNSIDEALAGYADTITVEVLKDNIIRVTDNGRGIPVGIHHKTGKPAVETILTTLHAGGKFDGSSYKVSGGLHGVGASVVNALSSYFIVEVHVNGKIHKQRFEKG-FPVTGLDIIGD--TTHQGTVITFLADPDVFKETTIYDFETLRSRVQQLAFLNRNIKITITDDRKEEPVSFTYHYEGGLLEYIDFLTGTKTKINANKFYAEKEVD----------GITLEVALQYTDSYATNLYSFTNNIPTHEGGMHEDGFKMALNRVLAKYAKDNNLLKK-DEPFISDDTREGLTAIISVKHPDPQFEGQTKTKLGNVEVRQIASQVVGETFERYLLENPTDAKAIIDKSLLAARARIAARKAREATRRKSPLDALGFASKLADCRSKNPAISELYIVEGDSAGGSAKQGRESEYQAILPLRGKVLNVEKARIDKVLSNNEILSLIQAIGTGIGEEFNPEKARYHKIVIMTDADVDGAHIRTLLLTFFFRYFKPLIDLGYIYFAQPPLYKLQFGKKVEYVYDDEALPK-ALEQLGGKPSMQRYKGLGEMNPEQLWETTMDPETRTLLQVTMKDAIEADQVFN 588
>gi|150020566|ref|YP_001305920.1| DNA gyrase, B subunit [Thermosipho melanesiensis BI429] >gi|149793087|gb|ABR30535.1| DNA gyrase, B subunit [Thermosipho melanesiensis BI429] (627 aa)
Score = 1545, Expect = 2.0e-169, Identities = 336/640 (52%), Positives = 449/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLFAGGIKQWVEELN----NEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSI-KHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y+A NIK+L+GLE VR+RPGMYIGST   GLHH+V+EIVDNS+DEA+ G   +I +T+ K+GS +++D+GRGIPV+ H +T KS +E V+T LHAGGKF  DSYKVSGGLHGVGASVVNALS WL+V V+++ K +Y +++ G  P+ ++++  E  +   GTIV F PD EI    EFD+DTI  RL++LA+LN  I + F DER + ++TF F GG+K++V  L+    +  EPI+ +  Y+               +I+V+V FQY  +     ++F NNI T +GG+H  GFK A  +++N+   +   LK+  + +  ED  EG+ AIVS+     P++EGQTK KLGN EV+  V+ VV E   +Y   N     +II+K L A +AR+ +  ARE  +RKS F S+SLPGKLADC TK  E SEL+IVEGDSAGGSAK  RDR FQAILPL+GKI+NVEK+   K+  NE+I ++ITA+G G+G +F I KLRY KII+MTDADVDG+HIR LLLT  +RYM  L++ G +YIA PPL+K +V K   Y Y ++ LEEFK+     K++IQRYKGLGEMNP QLWETTMDP+ R LLKV IEDA  AD++F +LMG +   R+EFI ++A  VK +DI
  S:     3 YNAQNIKVLKGLEPVRQRPGMYIGSTGKAGLHHLVYEIVDNSVDEALQGYCDKIYVTIFKDGSVEIKDNGRGIPVDIHPETGKSALEVVMTTLHAGGKFSKDSYKVSGGLHGVGASVVNALSEWLEVEVHRDGKIYYQKYQRG-TPLTEVRIIGE--TDYRGTIVRFKPDTEIFSTVEFDSDTILIRLRELAFLNPNITVVFKDERENIEKTFHFTGGLKEFVVHLSKGTRSLHEPILVSGEYN---------------SIKVDVCFQYTASDFEKIYSFVNNIRTVDGGTHVTGFKTAFTRVVNELGKKTGQLKK--DTLRGEDIREGIVAIVSVLMSKTPEFEGQTKSKLGNEEVQEAVAKVVREKLLEYFESNENTLKIIIQKALEAKKAREAAKHAREMIKRKSVFGSSSLPGKLADCITKKMEESELFIVEGDSAGGSAKQARDRNFQAILPLRGKILNVEKSSWLKLLKNEQIRDIITALGTGIGDDFDISKLRYGKIIIMTDADVDGAHIRTLLLTLFYRYMKELIDEGRIYIAQPPLYKVNVNKKIYYFYSDEELEEFKENLKDKKFEIQRYKGLGEMNPQQLWETTMDPEKRKLLKVEIEDAEEADELFEMLMGSDTESRKEFIFRHALQVKEIDI 627
>gi|150024625|ref|YP_001295451.1| DNA gyrase B subunit [Flavobacterium psychrophilum JIP02/86] >gi|149771166|emb|CAL42633.1| DNA gyrase B subunit [Flavobacterium psychrophilum JIP02/86] (647 aa)
Score = 1545, Expect = 2.1e-169, Identities = 322/648 (49%), Positives = 440/648 (67%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERA-EFDADTIKSRLKQLAYLNKGIKINFIDERTDDK------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG-----PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M+ E KK+ YSA +I+ LEG+E VR RP MYIG   ++GLHH+V+E+VDNSIDEAM G+   I + + ++GS  V+D+GRGIPV  H K   S +E V+T + AGGKFD DSYKVSGGLHGVG SVVNALS+ L+  V+    + Y +  + GK +  +K   E  + K GTIV FYPD  I  +  E+  DT+ +R+++L++LNKGI I F D+R  DK      E F    G+K+++  L+  +EPI+  ++          + + DK  I VEVA  YN +Y  + F++ NNINT EGG+H +GF+  L + + K+A    +L +   +IS +D  EGLTAI+S+K   PQ+EGQTK KLGN EV   VS  V ++ E YL ENP DA +I++K +LA +AR  + +ARE  +RK+      LPGKL+DCS +D    E+++VEGDSAGG+AK GRDR FQAILPL+GKI+NVEKA   K+F NEEI N+ TA+G  +G         ++KLRY+K+++M DAD+DGSHI  L+LTF FR+M  L+E G++YIA PPL+    G   +YA++E   ++   E       IQRYKGLGEMN +QLW+TT++P+ R L +V I+    AD+VFS+LMGDEV PRREFIEKNA Y  N+D
  S:     1 MSDEIKKDNYSADSIQALEGMEHVRMRPSMYIGDVGVRGLHHLVYEVVDNSIDEAMGGHCDTIRVDINEDGSISVEDNGRGIPVGIHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSVVNALSNHLRATVHSSDGKIYEQEYEKGKALYPVKQIGE--TTKRGTIVTFYPDPSIFTQTIEYSYDTLSARMRELSFLNKGITITFTDKREKDKDGNFVSEIFHSTEGLKEYIRYLDGNREPIIAHVI----------SMDNDKGEIPVEVALIYNTSYTENIFSYVNNINTHEGGTHLQGFRTGLTRSLKKYADSSGMLDKLKFEISGDDFREGLTAIISVKVAEPQFEGQTKTKLGNREVVSPVSQAVGDMIENYLEENPNDARIIVQKVILAAQARHAAKKAREMVQRKTVMGGGGLPGKLSDCSEQDPAKCEVFLVEGDSAGGTAKQGRDRAFQAILPLRGKILNVEKAMHHKVFENEEIRNIFTALGVTIGTAEDSKALNLEKLRYHKVVIMCDADIDGSHISTLILTFFFRFMKELIEQGHIYIATPPLYLVKKGNKKEYAWNEVQRDQ-ANERMGGSATIQRYKGLGEMNAEQLWDTTLNPEFRTLRQVNIDSLAEADRVFSMLMGDEVPPRREFIEKNAVYA-NID 646
>gi|168335262|ref|ZP_02693363.1| DNA gyrase subunit B [Epulopiscium sp. 'N.t. morphotype B'] (635 aa)
Score = 1545, Expect = 2.2e-169, Identities = 341/642 (53%), Positives = 443/642 (69%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGG--KPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKY-QIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           N Y  S I+ILEGLEAVRKRP MYIGST  KGLHH+V+EIVDN++DEA+ G   ++T+T+ K+ S  V D+GRGIPV  H     S  E V T+LHAGGKF    YKVSGGLHGVGASVVNALSSWL   VY+  K +  +FK G   + +  +  T++      GT V F PD  I E   +D   +K R ++ A+L KG+KI  IDER + K  + F + GG+ ++V  LN  K PI   I Y E E          K ++ +EVAF +N  YN + F+F NNINT EGG+H  GFK AL K +N +A + K+LK+ D+ +S ED  EG+T ++SIK   P++EGQTK KL N+ VR  V N+VSE F  +L +NP  A +II+K  +A  AR  + +AR+ TRRK+  E+++LPGKLADCS +D +  E+YIVEGDSAGGSAK  R R  QAILPL+GKI+NVEKA+ DK+ ++EEI N+ITA GAG+  +  I+KLRY+KIILMTDADVDG+HIR LLLTF +R+   L+  G +YIA PPL+     K   YAY+++ LE    E  +    ++QRYKGLGEMNPDQLW+TTM+P  R L+KV IEDA+ AD++F+ LMGD+V PRREFI++ AK VKNLDI
  S:     4 NIYDESQIQILEGLEAVRKRPDMYIGSTSAKGLHHLVYEIVDNAVDEALAGFCDKVTVTIHKDNSISVLDNGRGIPVGIHKDKGISAAEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSSWLISRVYQHGKIYEQKFKKGHVVESLHPIGTTDQ-----TGTFVHFLPDETIFEETVYDFAILKKRFQETAFLTKGLKIKLIDERVEPKLEKIFHYEGGVSEFVLFLNKNKTPIYENIFYCEGE----------KDDVSIEVAFCHNDGYNENIFSFANNINTIEGGTHLSGFKNALTKTVNDYAKKMKILKDNDKSLSGEDIREGITGVISIKISEPKFEGQTKTKLVNTNVRTIVDNIVSEKFMIFLEQNPTIAKIIIQKATMASHARDAARKARDLTRRKNVLENSTLPGKLADCSERDPKKCEIYIVEGDSAGGSAKSARSRQNQAILPLRGKILNVEKARLDKMLASEEIRNMITAFGAGINEDLNIEKLRYHKIILMTDADVDGAHIRTLLLTFFYRFYRELITGGFIYIAQPPLYLVEKNKKKHYAYNDRELELILTEIGRNGITRMQRYKGLGEMNPDQLWDTTMNPATRTLVKVNIEDAVEADEIFTALMGDKVEPRREFIKEYAKLVKNLDI 635
>gi|167766860|ref|ZP_02438913.1| hypothetical protein CLOSS21_01377 [Clostridium sp. SS2/1] >gi|167711408|gb|EDS21987.1| hypothetical protein CLOSS21_01377 [Clostridium sp. SS2/1] (640 aa)
Score = 1543, Expect = 3.3e-169, Identities = 347/645 (53%), Positives = 459/645 (71%)
  Q:     5 TKKN-TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK--ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEK----TLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIED--ALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           T+KN  Y A  I+ILEGLEAVRKRPGMYIGST  KGLHH+V+EIVDN++DE++ G    I +TL K+GS  V+D+GRGIPV  + K   S+VE V T+LHAGGKF    YKVSGGLHGVG+SVVNALS WL+V V KE   H   + + GK    LKV  +  + K GT V FYPD  I E  +FD +T+K RL++ A+L K +KI   D+R +++  ETF + GGIK++V  LN  KE + P ++Y E E          K  + VEVAFQ+N +YN ++ +F NNI T EGG+H  GFK AL    N +A +  LLKE ++ +S ED  EGLT+++SIK   PQ+EGQTK+KLGNSE R  V++++SE  + +L +NP+ A +I +K +LA  AR  + +AR+ TRRK+  +  SLPGKLADCS K+ E  E+YIVEGDSAGGSAK  R R  QAILPL+GKI+NVEKA+ DK+  N+EI  +ITA G G+  +F I+KLRY+KII+MTDADVDG+HI  LLLTF++R+M  L++ G VY+A PPL++    K   YAY ++     L+E  ++N+    +IQRYKGLGEM+ +QLW+TTMDP+ R+LL+V +++  A   D  F+ LMGD+V PRREFIE NAKYV+NLDI
  S:     3 TQKNGEYGADQIQILEGLEAVRKRPGMYIGSTSEKGLHHLVYEIVDNAVDESLAGFCDTIIVTLNKDGSVTVEDNGRGIPVGINKKKGVSSVEVVFTILHAGGKFGGGGYKVSGGLHGVGSSVVNALSDWLEVTVCKEGHIHKQRY-ERGKVCYPLKVLGD--TDKTGTTVTFYPDATIFETIDFDYNTLKRRLRETAFLTKNLKIVLTDDRGEEQVSETFHYEGGIKEFVTYLNKGKEALYPDVIYCEGE----------KDGVYVEVAFQHNDSYNETSLSFVNNIITPEGGTHLSGFKMALTSTFNDYARKNNLLKEKEDNLSGEDIREGLTSVISIKIGEPQFEGQTKQKLGNSEARGAVNSILSEQLKYFLEQNPQVAKIICEKAVLAQRARDAARKARDLTRRKTALDGMSLPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDKVLVNKEIQAMITAFGTGIHEDFDIEKLRYHKIIIMTDADVDGAHIATLLLTFIYRFMPELIKKGYVYLAQPPLYRVEKNKKFWYAYSDEELNNILQEIGRDNNN---KIQRYKGLGEMDAEQLWDTTMDPEKRILLRVNLDEDSASEIDLTFTTLMGDQVEPRREFIEANAKYVQNLDI 640
>gi|42525521|ref|NP_970619.1| DNA gyrase, B subunit [Treponema denticola ATCC 35405] >gi|4033400|sp|O87545|GYRB_TREDE DNA gyrase subunit B >gi|3676691|gb|AAC62070.1| DNA gyrase subunit B; GyrB [Treponema denticola] >gi|41815532|gb|AAS10500.1| DNA gyrase, B subunit [Treponema denticola ATCC 35405] (638 aa)
Score = 1543, Expect = 3.6e-169, Identities = 338/643 (52%), Positives = 444/643 (69%)
  Q:     7 KNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGG--KPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDER--TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVE-KKLLKETD--EKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYD----EKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           K+ YSA+NI +L+GLEAVRKRPGMYIGST   GLHH+V+E+VDN IDEAM G   +I + L      +V+D+GRGIPV+ H   K S +E VLT LHAGGKFD  SYKVSGGLHGVG SVVNALS W++  VYK+  EHY +F+ G   +PV  +  T      K+GT++ +  D  I  E   ++ + + +RL++LA+LN  I I   DER  T  + TF F GGI Q+V  LN  K+    + V+ E E          K +I  EVA QYN  YN +  +F N+INT EGG+H EGFK AL +++N F  +  KL+K+ D  EK++ ED   GLTAIVS+K P PQ+EGQTK KLGNS+VR  V + V+E    +  +NP +   +++KC+    AR  +  A+EATRRKS  +S  LPGKLADCS KD E  E+YIVEGDSAGGSAK GRD   QAILPL GK++NVEK + DK+ +NE++  +I  +G G+G +F I+KLRY+K+I+M DADVDGSHIR LLLTF FRYM  ++E G+VY+A PPL+K S  K   Y Y+    +  L++  + N+     +QRYKGLGEM+  QLWETTMDP  R +++VT+ DA+ AD++FS LMG+EV PRR+FIE+NA Y  NLD+
  S:     3 KSNYSANNITVLKGLEAVRKRPGMYIGSTGPDGLHHLVYEVVDNCIDEAMAGFCDKILVVLEPNDIVRVEDNGRGIPVDIHPTEKISALELVLTRLHAGGKFDKGSYKVSGGLHGVGVSVVNALSVWMEAKVYKDGFEHYAKFEKGSILEPVKKIGETE-----KSGTVIRWAVDPSIFTETTVYNFEVLATRLRELAFLNSKISITMRDERLSTPKEVTFAFEGGISQFVSYLNESKQVFPKSPVFIEGE----------KNDILCEVAIQYNDGYNENLLSFVNDINTREGGTHLEGFKTALTRVMNDFLKKYPKLVKKMDKEEKLTGEDVRAGLTAIVSVKVPEPQFEGQTKTKLGNSDVRGIVDSFVNEKLTLFFEQNPNEVEKVLEKCVAEAAARIAARRAKEATRRKSGLDSFGLPGKLADCSLKDPESCEVYIVEGDSAGGSAKKGRDSKTQAILPLWGKMLNVEKTRLDKVVNNEKLQPIIATLGTGIGKDFNIEKLRYHKVIIMADADVDGSHIRTLLLTFFFRYMPQVIEKGHVYLAMPPLYKISHNKKEWYVYNDDERDSVLDQIGRGNNAA---VQRYKGLGEMDGTQLWETTMDPARRKMMRVTLPDAVEADRIFSTLMGEEVEPRRKFIEENAVYA-NLDV 638
>gi|196240539|ref|ZP_03139307.1| DNA gyrase, B subunit [Cyanothece sp. PCC 7425] >gi|196215388|gb|EDY10039.1| DNA gyrase, B subunit [Cyanothece sp. PCC 7425] (645 aa)
Score = 1542, Expect = 4.6e-169, Identities = 333/629 (52%), Positives = 443/629 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIM-ERAEFDADTIKSRLKQLAYLNKGIKINFIDERTD----DK---ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKK---ENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIE 638
           YSA  I++LEGLE VRKRPGMYIGST  +GLHH+V+E+VDNS+DEA+ G    I + L  +GS  V DDGRGIP +  +KT KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALSSWL+  V+++ K     F + G P  DLK      + + GT ++F PD EI  E  EFD  T+  RL++LAYLN G+KI F D R D    D+   ET+ + GGIK++V  +N +KEP+   I+Y + E +          +++VEVA Q+    Y ++   F NNI T +GG+H EG K  L + +N FA ++  LKE D  ++ E+  EG+TA++S+K P P++EGQTK KLGN+EVR  V ++V E+  +YL   P   + I++K + A  A + +  ARE  RRKS  ES++LPGKLADCS++D   +E++IVEGDSAGGSAK GRDR FQAILPL+GKI+N+EK    KI+ N EI +LITA+G G+ G EF    LRY+KII MTDADVDG+HIR LLLTF +RY   L++ G +Y+ACPPL+K   G++  Y Y+++  ++      EN+  +Y+IQR+KGLGEM P QLW+TTM+P+ R L +VTIEDA  AD++F++LMGD VAPRREFIE
  S:     5 YSADQIQVLEGLEPVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCKNILVELNPDGSVTVTDDGRGIPTDIVSKTGKSALETVLTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSSWLEAKVWRDGKVFTQRF-ERGLPATDLKAQPSGGN-RTGTAIQFMPDAEIFTETIEFDYKTLSGRLRELAYLNAGVKIEFRDGRLDLLKRDEPLLETYFYEGGIKEYVSYMNVDKEPLHQEIIYVQGERN----------DVQVEVALQWCTDAYTDNLLGFANNIRTIDGGTHLEGLKAVLTRTLNNFARKRNKLKEGDPNLAGENVREGMTAVISVKVPEPEFEGQTKTKLGNTEVRGIVDSLVGEVLTEYLDFRPAVVDSILEKAIQAFNAAEAARRARELVRRKSVLESSTLPGKLADCSSRDPREAEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIEKTDDAKIYKNNEIQSLITALGLGIKGEEFDASNLRYHKIIAMTDADVDGAHIRTLLLTFFYRYQRQLVDQGYIYVACPPLYKIERGRNHYYCYNDRERDQIIAGLGENA--RYEIQRFKGLGEMMPQQLWDTTMNPETRTLKQVTIEDAAEADRIFNILMGDRVAPRREFIE 632
>gi|167764147|ref|ZP_02436274.1| hypothetical protein BACSTE_02530 [Bacteroides stercoris ATCC 43183] >gi|167698263|gb|EDS14842.1| hypothetical protein BACSTE_02530 [Bacteroides stercoris ATCC 43183] (653 aa)
Score = 1540, Expect = 7.1e-169, Identities = 325/648 (50%), Positives = 442/648 (68%)
  Q:     1 MNKETKKN---TYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG------PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE---NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           M +E K N    YSASNI++LEGLEAVRKRP MYIG    KGLHH+V+E+VDNSIDEA+ G    I +T+ ++ S  VQD+GRGIPV+ H K +KS +E V+TVLHAGGKFD  SYKVSGGLHGVG S VNALS+ +   V++  K +  E+ + G P+  +K     A    GT  +F+PD  I     +  D + +R+++LAYLN GIKI   D R  +      +E F    G+K++V  +++ +E +V  ++Y           N +K    VEVA  YN +YN +  ++ NNINT EGG+H  GF+ AL + + K+A + K+L++   +IS +D  EGLTA++SIK   PQ+EGQTK KLGN+EV   V   V E    YL E+P++A +I+ K +LA +AR  + +ARE+ +RKSP     +PGKLADCS+KD E  EL++VEGDSAGGSAK GR+R FQAILPL+GKI+NVEKA   K F ++E+ N+I A+G   G       E  IDKLRY K+I+MTDADVDGSHI  L++T  FRY   +++ G +YIA PPL+  + GK  +Y + ++  ++F       S+     QRYKGLGEMNP+QLWETTM+P+NR+L +V +E+A  AD  FS+LMG++V PRR+FIEKNA Y  N+D
  S:     1 MTEEEKINGESNYSASNIQVLEGLEAVRKRPAMYIGDISSKGLHHLVYEVVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEQKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTQVFRNGKIYQQEY-ECGHPLYSVKEVGTTAI--TGTRQQFWPDATIFTETVYSYDILATRMRELAYLNAGIKITLTDLRVKEEDGSYKQEVFYSVEGLKEFVRYIDSSREHLVNDVIYI----------NTEKQGTPVEVAIMYNTSYNENIHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDNKMLEKAKVEISGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVMGAVDQAVGEALSYYLEEHPKEAKMIVDKVILAAQARVAARKARESVQRKSPMSGGGMPGKLADCSSKDPEECELFLVEGDSAGGSAKQGRNRTFQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGVDGEDSKEANIDKLRYKKVIIMTDADVDGSHIDTLIMTLFFRYFPQVIQQGYLYIATPPLYLCTKGKVKEYCWTDQQRQKFIDTYGGGSENAVHTQRYKGLGEMNPEQLWETTMNPENRMLKQVHLENAAEADYTFSMLMGEDVGPRRDFIEKNATYA-NID 652
>gi|53711588|ref|YP_097580.1| DNA gyrase B subunit [Bacteroides fragilis YCH46] >gi|60679839|ref|YP_209983.1| DNA gyrase subunit B [Bacteroides fragilis NCTC 9343] >gi|52214453|dbj|BAD47046.1| DNA gyrase B subunit [Bacteroides fragilis YCH46] >gi|60491273|emb|CAH06021.1| DNA gyrase subunit B [Bacteroides fragilis NCTC 9343] (652 aa)
Score = 1539, Expect = 9.2e-169, Identities = 320/644 (49%), Positives = 439/644 (68%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGK--PVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDK------ETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPE-----FKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE---NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           T   +YSA +I++LEGLEAVRKRP MYIG   +KGLHH+V+EIVDNSIDEA+ G    I +T+ ++ S  VQD+GRGIPV+ H K +KS +E  +TVLHAGGKFD  SYKVSGGLHGVG S VNALS+ +   V++  K +  E++ G    PV ++ + +       GT  +F+PD  I     +D   + SRL++LAYLN G++I+  D R  ++      ETF    G++++V  + + +E ++  ++Y           N +K NI +EVA  YN  ++ +  ++ NNINT EGG+H  GF+ AL + + K+A + K+L++   +IS +D  EGLTA++S+K   PQ+EGQTK KLGN+EV   V   V E+   YL E+P++A  I+ K +LA  AR  + +ARE  +RKSP     LPGKLADCS KD +  EL++VEGDSAGG+AK GR+R FQAILPL+GKI+NVEKA   K   +EEI N+ TA+G  +G E       IDKLRY+KII+MTDADVDGSHI  L++TF FRYM  +++NG +YIA PPL+    GK  +Y + +   ++F       S+     QRYKGLGEMN  QLWETTMDP+NR+L +V I++A  AD +FS+LMG++V PRREFIE+NA Y  N+D
  S:     8 TNNGSYSADSIQVLEGLEAVRKRPAMYIGDISVKGLHHLVYEIVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDFHEKEQKSALEVAMTVLHAGGKFDKGSYKVSGGLHGVGMSCVNALSTHMTTQVFRNGKIYQQEYEIGKPLYPVKEVGIADH-----TGTKQQFWPDDSIFTETIYDYKILASRLRELAYLNAGLRISLTDRRVVNEDGSFKHETFYSEEGLREFVRFIESSREHLINDVIY----------LNTEKQNIPIEVAIMYNTGFSENIHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDSKMLEKVKVEISGDDFREGLTAVISVKVAEPQFEGQTKTKLGNNEVMGAVDQAVGEVLNYYLEEHPKEAKAIVDKVILAATARHAARKAREMVQRKSPMSGGGLPGKLADCSDKDPQKCELFLVEGDSAGGTAKQGRNRAFQAILPLRGKILNVEKAMYHKALESEEIRNIYTALGVTIGTEEDSKAANIDKLRYHKIIIMTDADVDGSHIDTLIMTFFFRYMPQIIQNGYLYIATPPLYLCKKGKIEEYCWTDAQRQKFIDTYGGGSENAIHTQRYKGLGEMNAQQLWETTMDPENRMLKQVNIDNAAEADYIFSMLMGEDVGPRREFIEENATYA-NID 651
>gi|171853665|emb|CAM11548.1| DNA gyrase beta subunit [Candidatus Phytoplasma australiense] (662 aa)
Score = 1538, Expect = 1.3e-168, Identities = 339/632 (53%), Positives = 449/632 (71%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAE-FDADTIKSRLKQLAYLNKGIKINFIDERTDDKETFLF--AGGIKQWVEELNNE--KEPIVPTIVYDEREESVK-------AANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG----PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALN----------ADKVFSLLMGDEVAPRREFIEKNA 641
           Y+A +I+ILEGLEAVRKRPGMYIGST  KGLHH+VWEIVDNSIDEA+ G+A+EIT+ +       V D+GRGIPV  H KT K  VET+LT LHAGGKFD+ SYK+SGGLHGVGASVVNALSSW  V ++ + K HY +++  G PVA L+V  +  + + GT+++F  D  I +    +DA  +K R++QL++LNKG+K+N ID+R +   +F F    G++ ++  +N    ++P     V ++  +++          N+ +K   + E     N T     ++F NNI+T EGG+HEEGFK AL +  +K+A +  LLK+ +E +  ED +EG+TAI+S+KH +PQ+EGQTK KLGN EVR  VS    E   ++LLENP DA  II+KCLL+  AR  +  ARE  R K P ++     KLADC +KD +ISELYIVEGDSAGGSAK GRD  FQAILPLKGK++NVEK +S KI +N+EI +LI AIG GV         +DKLRY+KII+MTDADVDG+HIR LLLTF FR +  L+E G +Y A PPL+K+  GK+  Y Y+EK   +F  + + +K   QRYKGLGEMNPDQLWETTM+P+ R LL+ +++DALN          A+  F++LMG EV PR+EFI  NA
  S:     4 YNADSIQILEGLEAVRKRPGMYIGSTAAKGLHHLVWEIVDNSIDEALAGHANEITLEILPGDIISVTDNGRGIPVGIHHKTGKPAVETILTTLHAGGKFDSSSYKISGGLHGVGASVVNALSSWFSVEIHLDKKIHYQKYEK-GVPVAPLEVIGK--TDRKGTVIKFLADPSIFQETTIYDAKILKERIQQLSFLNKGLKLNLIDQRQEKPVSFNFYHEKGLQDYLTFINQTYMQKPFHNLFVLEKELDNLALEIVFEYTVNDDEKSKQQEEEQAIKNYTQTQKIYSFVNNIHTHEGGTHEEGFKLALSRNFSKYAKDYNLLKK-NESLLSEDILEGITAIISLKHQDPQFEGQTKAKLGNVEVRQIVSQYFGEALGRFLLENPGDAKKIIEKCLLSANARLAAKRAREIVRNK-PLDTLGFAAKLADCRSKDPKISELYIVEGDSAGGSAKQGRDSHFQAILPLKGKVLNVEKTQSSKILTNKEIKSLIQAIGIGVDINKQKNLNLDKLRYHKIIIMTDADVDGAHIRTLLLTFFFRNLRILIEKGYIYFARPPLYKYQKGKNITYFYEEKEKIDFSLKKN-IKDGFQRYKGLGEMNPDQLWETTMNPEKRTLLQASLKDALNALSDEEAIKEANSTFNILMGKEVFPRKEFILNNA 655
>gi|119512311|ref|ZP_01631397.1| DNA topoisomerase IV subunit B [Nodularia spumigena CCY9414] >gi|119463024|gb|EAW43975.1| DNA topoisomerase IV subunit B [Nodularia spumigena CCY9414] (645 aa)
Score = 1538, Expect = 1.5e-168, Identities = 330/631 (52%), Positives = 447/631 (70%)
  Q:     8 NTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEI-MERAEFDADTIKSRLKQLAYLNKGIKINFIDER-------TDDKETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQY-NKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGV-GPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE-NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIE 638
           ++YSA  I++LEGLEAVRKRPGMYIG+T  +GLHH+V+E+VDNSIDEA+ G+ + I + +  +GS  V DDGRGIP + H++T KS +ETVLTVLHAGGKF    YKVSGGLHGVG SVVNALS  L+V V+++ K H ++  + G PV +L+   +K   K GT + F PD +I +   EFD  TI  RL++LAYLN G+KI F D R       T   ET+ + GGIK+++  +N +K+P+   I+Y   E +          N++VEV+ Q+    Y ++   F NNI T +GG+H EG K  L + +N  A ++  +KE +  +S E   EGLTA++S+K P+P++EGQTK KLGN+EVR  V ++V E+  +YL  +P  A+ I+ K + A +A + +  ARE  RRKS  ES+ LPGKLADCS++D   SE++IVEGDSAGGSAK GRDR  QAILPL+GKI+N+EK    KI+ N E+ +LITA+G GV G EF   +LRY++I++MTDADVDG+HIR LLLTF +RY   L+E G +YIACPPLFK   GK+ +Y Y E+ L+++     S   Y IQR+KGLGEM P QLW+TTM+P++R + +V IEDA  AD++F++LMGD VAPRREFIE
  S:     3 SSYSADQIQVLEGLEAVRKRPGMYIGTTGPRGLHHLVYEVVDNSIDEALAGHCTHIEVDINADGSVTVTDDGRGIPTDTHSRTGKSALETVLTVLHAGGKFGGGGYKVSGGLHGVGLSVVNALSDVLEVTVWRDNKVH-VQRYERGVPVTELQAKPDKEG-KTGTSINFKPDSQIFINSVEFDYITIAGRLRELAYLNAGVKIIFGDHRLELLKSDTPRIETYEYKGGIKEYIAYMNRDKQPLHEEIIYVHGERN----------NVQVEVSLQWCTDAYTDNVLGFANNIRTIDGGTHLEGLKAVLTRTLNAIARKRNKIKENESNLSGEHVREGLTAVISVKVPDPEFEGQTKTKLGNTEVRGIVDSLVGEVLSEYLEFHPGIADSILDKAIQAFKAAEAARHARELVRRKSVLESSPLPGKLADCSSRDPSESEIFIVEGDSAGGSAKQGRDRRTQAILPLRGKILNIEKTDDAKIYKNNEVQSLITALGLGVKGDEFDSTQLRYHRIVIMTDADVDGAHIRTLLLTFFYRYQRALIEQGFIYIACPPLFKVERGKNHEYCYSERELQQYLGTLPSNANYNIQRFKGLGEMMPQQLWDTTMNPESRKMKQVEIEDAAEADRIFTILMGDRVAPRREFIE 632
>gi|166032886|ref|ZP_02235715.1| hypothetical protein DORFOR_02607 [Dorea formicigenerans ATCC 27755] >gi|166027243|gb|EDR46000.1| hypothetical protein DORFOR_02607 [Dorea formicigenerans ATCC 27755] (643 aa)
Score = 1537, Expect = 2.0e-168, Identities = 344/649 (53%), Positives = 453/649 (69%)
  Q:     1 MNKETKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKE---YKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD--KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKENSK-VKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIED--ALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           M  E  ++ Y A  I+ILEGLEAVRKRPGMYIGST  +GLHH+V+EIVDN++DEA+ G    I +T+  + S  V D+GRGIPV  + K+    VE V TVLHAGGKF    YKVSGGLHGVGASVVNALS WL+V +  E   Y++ Y    + GK    L+V  E    K GT V F PD EI E   FD   ++ R +++A+L KG+KI   DER  +  ++TF + GGIK++VE LN    P+   I+Y E   +          N+ VEVA Q+N +YN +++ F NNI T EGG+H  GF+ AL K  N +A + KLLK+ +  ++ ED  EGLTAI+S+K  +PQ+EGQTK+KLGNSE R  V NVVSE  + +L +NP+ A V ++K ++A  AR+ + +AR+ TRRKS  +  SLPGKLADCS K+ E  E+YIVEGDSAGGSAK  RDR  QAILPL+GKI+NVEKA+ D+I+ N EI  +ITA G G+  +F I KLRY+KII+MTDADVDG+HI  LLLTF++R+M  L++ G VY+A PPL+K    K   YAY ++ L+   +E  +    +IQRYKGLGEM+ +QLW+TTMDP++R+LL+VT++D  A   D  F+ LMGD+V PRREFIE+NA+YV+NLDI
  S:     1 MATEKVQHEYGADEIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGFCDTIHVTINPDNSVTVTDNGRGIPVGINHKSGLPAVEVVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSVWLEVEICHEGKVYRQRY----ERGKVAKKLEVIGECEPGKTGTKVTFLPDGEIFETTIFDYSILQQRFREMAFLTKGLKIVLRDERPQEPIEKTFHYEGGIKEFVEYLNRSTTPLYEQIIYCEGIVN----------NVSVEVAMQHNDSYNENSYGFVNNITTPEGGTHIVGFRNALTKTFNDYARKNKLLKDNEPNLTGEDIREGLTAIISVKIEDPQFEGQTKQKLGNSEARGAVDNVVSEQLQIFLEQNPQVAKVTVEKSVMAQRAREAARKARDLTRRKSALDGMSLPGKLADCSDKNPEKCEIYIVEGDSAGGSAKTARDRATQAILPLRGKILNVEKARLDRIYGNAEIKAMITAFGTGIHEDFDISKLRYHKIIIMTDADVDGAHISTLLLTFMYRFMPDLIKEGYVYLAQPPLYKLERNKKVWYAYSDEELDSILQEVGRDNNNKIQRYKGLGEMDAEQLWDTTMDPEHRVLLRVTMDDETASELDLTFTTLMGDKVEPRREFIEENAQYVQNLDI 643
>gi|160891431|ref|ZP_02072434.1| hypothetical protein BACUNI_03882 [Bacteroides uniformis ATCC 8492] >gi|156858838|gb|EDO52269.1| hypothetical protein BACUNI_03882 [Bacteroides uniformis ATCC 8492] (653 aa)
Score = 1537, Expect = 2.0e-168, Identities = 321/644 (49%), Positives = 440/644 (68%)
  Q:     5 TKKNTYSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVYKEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDD------KETFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVG------PEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEFKKE---NSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTIEDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLD 648
           +   +YSA NI++LEGLEAVRKRP MYIG    KGLHH+V+E+VDNSIDEA+ G    I +T+ ++ S  VQD+GRGIPV+ H K KKS +E V+TVLHAGGKFD  SYKVSGGLHGVG S VNALS+ +   V++  K +  E+   G P+  +K      +   GT  +F+PD  I     ++ D + +R+++LAYLN GIKI+  D R  D      KE F    G+K++V  +++ +E  +  ++Y           N +K    VEVA  YN +YN +  ++ NNINT EGG+H  GF+ AL + + K+A + K+L++   +I+ +D  EGLTA++SIK   PQ+EGQTK KLGN+EV   V   V E    YL E+P++A +I+ K +LA +AR  + +ARE+ +RKSP     +PGKLADCS+KD E  EL++VEGDSAGGSAK GR+R FQAILPL+GKI+NVEKA   K F ++E+ N+I A+G   G       E  IDKLRY KII+MTDADVDGSHI  L++T  FRY   +++ G +YIA PPL+  + GK+ +Y + ++  ++F       S+     QRYKGLGEMNP+QLWETTM+P+NR+L +V +E+A  AD +FS+LMG++V PRR+FIEKNA Y  N+D
  S:     8 SNNGSYSAENIQVLEGLEAVRKRPAMYIGDISSKGLHHLVYEVVDNSIDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDYHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTQVFRNGKIYQQEYS-CGHPLYSVKEVG--TTDITGTRQQFWPDDTIFTETVYNYDILATRMRELAYLNAGIKISLTDLRVKDEEGNAKKEIFYSEEGLKEFVRYVDSSREHFMNDVIYI----------NTEKQGTPVEVAIMYNTSYNENVHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDNKMLEKAKVEIAGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVMGAVDQAVGEALTYYLEEHPKEAKLIVDKVILAAQARIAARKARESVQRKSPMSGGGMPGKLADCSSKDPEECELFLVEGDSAGGSAKQGRNRAFQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGVDGEDSKEANIDKLRYKKIIIMTDADVDGSHIDTLIMTLFFRYFPQVIQQGCLYIATPPLYLCTKGKAKEYCWTDQQRQKFIDTYGGGSENAVHTQRYKGLGEMNPEQLWETTMNPENRMLKQVHLENAAEADYIFSMLMGEDVGPRRDFIEKNATYA-NID 652
>gi|160878167|ref|YP_001557135.1| DNA gyrase, B subunit [Clostridium phytofermentans ISDg] >gi|160426833|gb|ABX40396.1| DNA gyrase, B subunit [Clostridium phytofermentans ISDg] (642 aa)
Score = 1536, Expect = 2.2e-168, Identities = 351/640 (54%), Positives = 448/640 (70%)
  Q:    10 YSASNIKILEGLEAVRKRPGMYIGSTDIKGLHHMVWEIVDNSIDEAMTGNASEITITLTKEGSAKVQDDGRGIPVEKHAKTKKSTVETVLTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSWLKVWVY---KEYKEHYIEFKDGGKPVADLKVTNEKASIKNGTIVEFYPDFEIMERAEFDADTIKSRLKQLAYLNKGIKINFIDERTDDKE--------TFLFAGGIKQWVEELNNEKEPIVPTIVYDEREESVKAANNKDKYNIRVEVAFQYNKTYNNSTFTFCNNINTTEGGSHEEGFKFALQKIINKFAVEKKLLKETDEKISKEDAIEGLTAIVSIKHPNPQYEGQTKRKLGNSEVRPFVSNVVSEIFEKYLLENPEDANVIIKKCLLAMEARKKSFEAREATRRKSPFESNSLPGKLADCSTKDKEISELYIVEGDSAGGSAKLGRDRIFQAILPLKGKIINVEKAKSDKIFSNEEIINLITAIGAGVGPEFKIDKLRYNKIILMTDADVDGSHIRILLLTFLFRYMYPLLENGNVYIACPPLFKFSVGKSSKYAYDEKTLEEF-----KKENSKVKYQIQRYKGLGEMNPDQLWETTMDPKNRLLLKVTI--EDALNADKVFSLLMGDEVAPRREFIEKNAKYVKNLDI 649
           Y A  I+ILEGLEAVRKRPGMYIGST  +GLHH+V+EIVDN++DEA+ G  + I +++  + S  V D+GRGIPVE + K   STVE V T+LHAGGKF    YKVSGGLHGVGASVVNALS WL+V V    K YK+ Y    + GK +  L+V  E  S + GT V F PD  I E   +D D +K RL+++A+L KG+KI   D RT ++E         F + GGIK++V+ LN  K  + P I+Y E          +D  ++ VEVA Q+N +Y+ S ++F NNI T EGG+H  GFK A+ K  N FA + K LK+ +  +S ED  EGLTAI+SIK P+PQ+EGQTK+KLGNSE R  V +VVSE    +L +NP  A +I++K +LA  AR  + +AR+ TRRK+  E  SLPGKLADCS KD +  E+YIVEGDSAGGSAK  R R  QAILPL+GKI+NVEK++ DKI  N EI  +ITA G G+  +F I KLRY+KII+MTDADVDG+HI  LLLTFL+R+M  L+ +G VY+A PPL+K    K   YAY ++ L        + +N+K    IQRYKGLGEM+ +QLWETTMDP+ R+LL+V +  E++   D  F+ LMGD V PRREFIE NAKYVKNLDI
  S:     5 YGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDNAVDEALAGYCNTIDVSINPDNSITVIDNGRGIPVETNKKKGISTVEVVFTILHAGGKFGGGGYKVSGGLHGVGASVVNALSEWLEVTVELEGKMYKQRY----ECGKVIEPLRVVGE--SDRTGTTVSFLPDRSIFEETVYDYDILKQRLREMAFLTKGLKIILRDLRTSEEEGNTEPNVKEFHYEGGIKEYVQYLNKHKSNLYPEIIYCE--------GTRD--SVYVEVAMQHNDSYSESCYSFVNNITTPEGGTHYTGFKNAITKTFNDFARQMKFLKDNETNLSGEDIREGLTAIISIKLPDPQFEGQTKQKLGNSEARAAVDSVVSEQLTYFLEQNPSVAKIILEKAVLAQRARDAARKARDLTRRKTALEGMSLPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKSRLDKILVNNEIKAMITAFGTGISDDFDISKLRYHKIIIMTDADVDGAHISTLLLTFLYRFMPELIRDGYVYLAQPPLYKVEKSKQVWYAYSDEDLNNILLQIGRDQNNK----IQRYKGLGEMDAEQLWETTMDPERRVLLRVKMDEENSSEIDLTFTTLMGDNVEPRREFIEANAKYVKNLDI 642
>gi|167759582|ref|ZP_02431709.1| hypothetical protein CLOSCI_01939 [Clostridium scindens ATCC 35704] >gi|167662809|gb|EDS06939.1| hypothetical protein CLOSCI_01939 [Clostridium scindens ATCC 35704]