>gi|26553482|ref|NP_757416.1| 30S ribosomal protein S7 [Mycoplasma penetrans HF-2] >gi|62287338|sp|Q8EX20|RS7_MYCPE 30S ribosomal protein S7 >gi|26453488|dbj|BAC43820.1| ribosomal protein S7 [Mycoplasma penetrans HF-2] (155 aa)
Score = 671, Expect = 3.7e-69, Identities = 155/155 (100%), Positives = 155/155 (100%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF
  S:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
>gi|31544737|ref|NP_853315.1| 30S ribosomal protein S7 [Mycoplasma gallisepticum R] >gi|62287306|sp|Q7NAV2|RS7_MYCGA 30S ribosomal protein S7 >gi|31541583|gb|AAP56883.1| RpsG [Mycoplasma gallisepticum R] (155 aa)
Score = 518, Expect = 2.1e-51, Identities = 110/154 (71%), Positives = 136/154 (88%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLR 154
           MRKNRA KR++LPDPVYNS LVT+AINAIML+GKKG+AQ+I+Y SFDLI +KT +D +E+F KA+ENIMP LEL+VRR+AG+N+QVPT VS ERK TL LRWL+  +RKR+EK+M++K+A EIIDAS  TGA+ KK+EDTHKMAEANKAFAH+R
  S:     1 MRKNRAEKRKVLPDPVYNSVLVTRAINAIMLDGKKGIAQKILYGSFDLIAQKTQKDPLEIFNKAVENIMPRLELKVRRIAGANYQVPTDVSPERKVTLALRWLVTLSRKRHEKTMLDKIANEIIDASNNTGASVKKREDTHKMAEANKAFAHMR 154
>gi|13358088|ref|NP_078362.1| 30S ribosomal protein S7 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761882|ref|YP_001752609.1| ribosomal protein S7 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920311|ref|ZP_02931658.1| ribosomal protein S7 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171920781|ref|ZP_02931973.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|183508562|ref|ZP_02958080.1| ribosomal protein S7 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|185179029|ref|ZP_02964777.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|186701755|ref|ZP_02971440.1| ribosomal protein S7 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|188024053|ref|ZP_02996804.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039191|ref|ZP_02998003.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 8] >gi|188518358|ref|ZP_03003867.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524288|ref|ZP_03004329.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530648|ref|ZP_03004993.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568898|ref|ZP_03005610.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 2] >gi|188592715|ref|ZP_03006001.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 10] >gi|195867905|ref|ZP_03079903.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|17367767|sp|Q9PPW6|RS7_UREPA 30S ribosomal protein S7 >gi|11276545|pir||H82879 ribosomal protein S7 UU524 [imported] - Ureaplasma urealyticum >gi|6899527|gb|AAF30937.1|AE002151_3 ribosomal protein S7 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827459|gb|ACA32721.1| ribosomal protein S7 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902728|gb|EDT49017.1| ribosomal protein S7 [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171903540|gb|EDT49829.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|182676008|gb|EDT87913.1| ribosomal protein S7 [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|184209123|gb|EDU06166.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|186701028|gb|EDU19310.1| ribosomal protein S7 [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|188019089|gb|EDU57129.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998275|gb|EDU67372.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660181|gb|EDX53561.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660382|gb|EDX53641.1| ribosomal protein S7 [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (155 aa)
Score = 515, Expect = 5.4e-51, Identities = 106/155 (68%), Positives = 130/155 (83%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR++L DPVYNSRLVTK INAIM +GKKGLAQ I+Y +F+++++KT +  +EVF KA++N+MP +EL+VRRV GSNFQVPT V+ ER+QTLGLRW+ L AR R+E +MIEKLA EIIDAS   GAA KKKEDTHKMAEANKAFAHLR+
  S:     1 MRKLKPQKRQVLADPVYNSRLVTKLINAIMYDGKKGLAQSIIYSAFEIVEQKTGKPALEVFNKAIDNVMPIIELKVRRVGGSNFQVPTEVTPERRQTLGLRWITLYARLRHEHTMIEKLAHEIIDASNNVGAAIKKKEDTHKMAEANKAFAHLRW 155
>gi|110003983|emb|CAK98323.1| 30s ribosomal protein s7 [Spiroplasma citri] (155 aa)
Score = 504, Expect = 9.5e-50, Identities = 101/155 (65%), Positives = 132/155 (85%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK++A KR++LPDP+Y+S+LVT+AIN IM++GK+G+AQ I+Y +FD++K+KT  + +E+F KA+ENI P LEL+VRR+ G+N+QVP  V++ERK TLGLRWLI  AR RNEKSMI++LA EIIDAS G G A KKK+DTHKMAEANKAFAH R+
  S:     1 MRKHQAEKRDVLPDPIYSSKLVTRAINKIMIDGKRGVAQTILYGAFDIVKEKTKTEPLEIFNKAIENITPHLELKVRRIGGANYQVPIEVNEERKVTLGLRWLINYARLRNEKSMIDRLANEIIDASNGIGGAVKKKDDTHKMAEANKAFAHYRW 155
>gi|125718895|ref|YP_001036028.1| 30S ribosomal protein S7 [Streptococcus sanguinis SK36] >gi|166228485|sp|A3CQM3|RS7_STRSV 30S ribosomal protein S7 >gi|125498812|gb|ABN45478.1| 30S ribosomal protein S7, putative [Streptococcus sanguinis SK36] (156 aa)
Score = 491, Expect = 2.9e-48, Identities = 97/154 (62%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKN+A KRE+LPDP+YNS+LVT+ IN +ML+GK+G A  IVY +FD IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR+R E +M+++LA EI+DAS  TGAA KK+EDTH+MAEAN+AFAH R+
  S:     3 RKNQAPKREVLPDPLYNSKLVTRLINRVMLDGKRGTAASIVYGAFDQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARQRGEHTMVDRLAKEILDASNNTGAAVKKREDTHRMAEANRAFAHFRW 156
>gi|13507965|ref|NP_109914.1| 30S ribosomal protein S7 [Mycoplasma pneumoniae M129] >gi|2500416|sp|P75545|RS7_MYCPN 30S ribosomal protein S7 >gi|1674307|gb|AAB96253.1| ribosomal protein S7 [Mycoplasma pneumoniae M129] (155 aa)
Score = 490, Expect = 3.8e-48, Identities = 102/155 (65%), Positives = 131/155 (84%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRA KR +LPDPV+N+ LVT+ IN IM +GKKGLAQ+I+Y +FDLI+++T E  + VF++A+ N+MP LELRVRR+AGSN+QVPT V ++RK  L LRW+ + ARKR+EK+M+EK+A EIIDAS  TGAA KKK+DTHKMAEANKAFAH+R+
  S:     1 MRKNRAPKRTVLPDPVFNNTLVTRIINVIMEDGKKGLAQRILYGAFDLIEQRTKEKPLTVFERAVGNVMPRLELRVRRIAGSNYQVPTEVPQDRKIALALRWIAMFARKRHEKTMLEKIANEIIDASNNTGAAIKKKDDTHKMAEANKAFAHMRW 155
>gi|146317809|ref|YP_001197521.1| 30S ribosomal protein S7 [Streptococcus suis 05ZYH33] >gi|146320003|ref|YP_001199714.1| 30S ribosomal protein S7 [Streptococcus suis 98HAH33] >gi|166228484|sp|A4VYX5|RS7_STRS2 30S ribosomal protein S7 >gi|166228486|sp|A4VSN2|RS7_STRSY 30S ribosomal protein S7 >gi|145688615|gb|ABP89121.1| Ribosomal protein S7 [Streptococcus suis 05ZYH33] >gi|145690809|gb|ABP91314.1| Ribosomal protein S7 [Streptococcus suis 98HAH33] (156 aa)
Score = 489, Expect = 4.7e-48, Identities = 98/154 (63%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKN+A KRE+LPDP+YNS+LVT+ IN +ML+GK+G A  IVY +FD IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR R E +MI++LA EI+DA+  TGAA KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNQAPKREVLPDPLYNSKLVTRLINRVMLDGKRGTAASIVYGAFDQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARNRGEHTMIDRLAKEIMDAANNTGAAVKKREDTHKMAEANRAFAHFRW 156
>gi|50365439|ref|YP_053864.1| 30S ribosomal protein S7 [Mesoplasma florum L1] >gi|62287257|sp|Q6F0J3|RS7_MESFL 30S ribosomal protein S7 >gi|50363995|gb|AAT75980.1| 30S ribosomal protein S7 [Mesoplasma florum L1] (155 aa)
Score = 488, Expect = 6.1e-48, Identities = 103/155 (66%), Positives = 125/155 (80%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRA KR++L DP+YNS+LVT+AIN IML+GK+G AQ I+Y +FD+IK+KT E+ IE+F KA+ENI P LEL+VRR+ G+N+QVP  VS ER+ TL LRWLI  AR RNEK M  KLA EIIDAS   G + KK+EDTHKMAEANKAFAH R+
  S:     1 MRKNRAEKRDVLADPIYNSKLVTRAINKIMLDGKRGTAQTIIYDAFDIIKEKTGEEPIEIFNKAIENIKPHLELKVRRIGGANYQVPVEVSDERQVTLALRWLINYARLRNEKVMTVKLANEIIDASNNMGGSVKKREDTHKMAEANKAFAHYRW 155
>gi|160914565|ref|ZP_02076780.1| hypothetical protein EUBDOL_00571 [Eubacterium dolichum DSM 3991] >gi|158433723|gb|EDP12012.1| hypothetical protein EUBDOL_00571 [Eubacterium dolichum DSM 3991] (156 aa)
Score = 484, Expect = 2.1e-47, Identities = 98/154 (63%), Positives = 130/154 (84%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YNS+LVT+ IN IM++GK+G+AQ+I+Y +FD+I+ KTNE  +EVF+KALEN+MP LEL+VRRV G+N+QVP  VS ER+ TLGLRW++  AR RNEK+M ++LAAEI+DA+ G+GA+ KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLVDPIYNSKLVTRLINKIMIDGKRGVAQKILYNAFDIIEVKTNEKPMEVFEKALENVMPLLELKVRRVGGANYQVPVEVSAERRLTLGLRWIVNYARLRNEKTMEQRLAAEIMDAANGSGASVKKREDTHKMAEANKAFAHYRW 156
>gi|83319930|ref|YP_424143.1| 30S ribosomal protein S7 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|188159789|ref|ZP_02998891.1| 30S ribosomal protein S7 [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|109894836|sp|Q2SSX0|RS7_MYCCT 30S ribosomal protein S7 >gi|83283816|gb|ABC01748.1| 30S ribosomal protein S7 [Mycoplasma capricolum subsp. capricolum ATCC 27343] (155 aa)
Score = 484, Expect = 2.1e-47, Identities = 103/155 (66%), Positives = 127/155 (81%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRA KR++L DP+YNS+LVT+AIN IML+GK+G+AQ I+Y +F++IK+KTN++ IEVF KA+ENI P LEL+VRR+ G+N+QVP  VS ER+ TL LRWLI  AR RNEK M  KLA EIIDAS   G + KK+EDTHKMAEANKAFAH R+
  S:     1 MRKNRAEKRDVLADPIYNSKLVTRAINKIMLDGKRGIAQSIIYDAFNIIKEKTNKEPIEVFNKAIENIKPHLELKVRRIGGANYQVPVEVSAERQITLALRWLINYARLRNEKVMTIKLANEIIDASNNIGGSVKKREDTHKMAEANKAFAHYRW 155
>gi|42560710|ref|NP_975161.1| 30S ribosomal protein S7 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|24638202|sp|Q8VMU1|RS7_MYCMS 30S ribosomal protein S7 >gi|18077331|emb|CAC87986.1| ribosomal protein S7 [Mycoplasma mycoides subsp. mycoides] >gi|19171202|emb|CAD21852.1| ribosomal protein S7 [Mycoplasma mycoides subsp. mycoides] >gi|42492206|emb|CAE76803.1| 30S ribosomal protein S7 [Mycoplasma mycoides subsp. mycoides SC str. PG1] (155 aa)
Score = 483, Expect = 2.5e-47, Identities = 103/155 (66%), Positives = 127/155 (81%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRA KR++L DP+YNS+LVT+AIN IML+GK+G+AQ I+Y +F++IK+KTN++ IEVF KA+ENI P LEL+VRR+ G+N+QVP  VS ER+ TL LRWLI  AR RNEK M  KLA EIIDAS   G + KK+EDTHKMAEANKAFAH R+
  S:     1 MRKNRAEKRDVLADPIYNSKLVTRAINKIMLDGKRGIAQSIIYDAFNIIKEKTNKEPIEVFNKAIENIKPHLELKVRRIGGANYQVPIEVSAERQITLALRWLINYARLRNEKVMTIKLANEIIDASNNIGGSVKKREDTHKMAEANKAFAHYRW 155
>gi|192813598|ref|ZP_03042258.1| ribosomal protein S7 [Geobacillus sp. Y412MC10] >gi|192797573|gb|EDV74093.1| ribosomal protein S7 [Geobacillus sp. Y412MC10] (156 aa)
Score = 483, Expect = 2.7e-47, Identities = 97/154 (62%), Positives = 126/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK   TKR++LPDPVYNS+LVT+ IN IML+GK+G+AQ I+Y SF++IK++T  D +EVF+ A++NIMP LE++ RRV G+N+QVP  V  ER+ +LGLRWL+  +R R EK+M E+LAAEIIDAS  TGA+ KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVTKRDVLPDPVYNSKLVTRLINRIMLDGKRGVAQSILYNSFNIIKERTGNDPMEVFEAAIKNIMPVLEVKARRVGGANYQVPIEVKPERRTSLGLRWLVNYSRNRGEKTMEERLAAEIIDASNNTGASVKKREDTHKMAEANKAFAHYRW 156
>gi|12044940|ref|NP_072750.1| 30S ribosomal protein S7 [Mycoplasma genitalium G37] >gi|66880318|ref|ZP_00405300.1| COG0049: Ribosomal protein S7 [Mycoplasma genitalium G-37] >gi|1351006|sp|P47334|RS7_MYCGE 30S ribosomal protein S7 >gi|3844675|gb|AAC71306.1| ribosomal protein S7 [Mycoplasma genitalium G37] >gi|166079060|gb|ABY79678.1| ribosomal protein S7 [synthetic Mycoplasma genitalium JCVI-1.0] (155 aa)
Score = 482, Expect = 3.1e-47, Identities = 97/155 (62%), Positives = 131/155 (84%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRA KR +LPDPV+N+ LVT+ IN IM +GKKGLAQ+I+Y +F++I+K+TN+  + VF+KA++N+MP LEL+VRR+AGSN+QVPT V  +R+  L LRW+++ A KRNEK+M+E++A EIIDA   TGA+ KKK+DTHKMAEANKAFAH+R+
  S:     1 MRKNRALKRTVLPDPVFNNTLVTRIINVIMKDGKKGLAQRILYGAFEIIEKRTNQQPLTVFEKAVDNVMPRLELKVRRIAGSNYQVPTEVPPDRRIALALRWIVIFANKRNEKTMLERVANEIIDAFNNTGASVKKKDDTHKMAEANKAFAHMRW 155
>gi|164686523|ref|ZP_02210551.1| hypothetical protein CLOBAR_00090 [Clostridium bartlettii DSM 16795] >gi|164604392|gb|EDQ97857.1| hypothetical protein CLOBAR_00090 [Clostridium bartlettii DSM 16795] (156 aa)
Score = 481, Expect = 3.9e-47, Identities = 96/154 (62%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVY S++VTK IN +M++GKKG AQ+IVY +FD+I +KT E+ +EVF KA++NIMP LE++ RRV G+N+QVP  V  +R+QTLGLRWL+   R R EK M+EKLA EI+DA+  TGA+ KK+EDTHKMAEANKAFAH RF
  S:     3 RKGNVPKRDVLPDPVYGSKVVTKLINNLMIDGKKGKAQKIVYDAFDIIAEKTGEEALEVFNKAMDNIMPVLEVKARRVGGANYQVPIEVRPDRRQTLGLRWLVTYTRARGEKGMVEKLAREIMDAANNTGASVKKREDTHKMAEANKAFAHYRF 156
>gi|158319539|ref|YP_001512046.1| 30S ribosomal protein S7 [Alkaliphilus oremlandii OhILAs] >gi|167011252|sp|A8MLD6|RS7_ALKOO 30S ribosomal protein S7 >gi|158139738|gb|ABW18050.1| ribosomal protein S7 [Alkaliphilus oremlandii OhILAs] (156 aa)
Score = 480, Expect = 6.1e-47, Identities = 96/154 (62%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+LPDP+Y S++++K IN IML+GKKG+AQ+IVY +  LI ++T ED +EVF+KA+ NIMP LE++ RRV G+N+QVP  V  +R+QTLG+RWL+   R R EK M+EKLA EIIDAS  TGA  KKKEDTHKMAEANKAFAH R+
  S:     3 RKGSVPKREVLPDPIYGSKVISKLINGIMLDGKKGVAQKIVYDALALINERTGEDALEVFEKAMNNIMPVLEVKARRVGGANYQVPVEVRSDRRQTLGIRWLVNYTRARGEKGMVEKLAKEIIDASNSTGATVKKKEDTHKMAEANKAFAHYRW 156
>gi|24378855|ref|NP_720810.1| 30S ribosomal protein S7 [Streptococcus mutans UA159] >gi|62287333|sp|Q8DVV5|RS7_STRMU 30S ribosomal protein S7 >gi|24376733|gb|AAN58116.1|AE014883_2 30S ribosomal protein S7 [Streptococcus mutans UA159] (156 aa)
Score = 478, Expect = 8.3e-47, Identities = 96/154 (62%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKNRA KRE+LPDP+YNS+LVT+ IN IML+GK+G A  IVY +F+ IK+ T  D +EVF++A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DAS  TGA+ KK+EDTH+MAEAN+AFAH R+
  S:     3 RKNRAPKREVLPDPLYNSKLVTRLINRIMLDGKRGTAASIVYGAFEQIKEATGNDALEVFEQAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTASRTRGEHTMKDRLAKEILDASNNTGASVKKREDTHRMAEANRAFAHFRW 156
>gi|169351747|ref|ZP_02868685.1| hypothetical protein CLOSPI_02528 [Clostridium spiroforme DSM 1552] >gi|169291969|gb|EDS74102.1| hypothetical protein CLOSPI_02528 [Clostridium spiroforme DSM 1552] (156 aa)
Score = 478, Expect = 8.4e-47, Identities = 96/154 (62%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK +  KR++LPDPVYNS+ V+K IN IML+GKKG+AQ I+Y +F  +++KT    +EVF +A+ NIMP LEL+VRR+ G+N+QVP  VS ER+ TLGLRWL+  +R RNE +M+E+LA EIIDAS G GA+ KKKEDTHKMAEANKAFAH R+
  S:     3 RKGQVAKRDVLPDPVYNSKTVSKLINNIMLDGKKGVAQNILYDAFKKVEEKTGNSAMEVFDQAINNIMPVLELKVRRIGGANYQVPVEVSGERRMTLGLRWLVNYSRLRNENTMVERLANEIIDASNGAGASVKKKEDTHKMAEANKAFAHFRW 156
>gi|169824188|ref|YP_001691799.1| 30S ribosomal protein S7 [Finegoldia magna ATCC 29328] >gi|167830993|dbj|BAG07909.1| 30S ribosomal protein S7 [Finegoldia magna ATCC 29328] (156 aa)
Score = 478, Expect = 8.6e-47, Identities = 96/154 (62%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE++PDPVY+ + VTK IN IML+GKKG AQ+IVY +FD+IK+ T ED +EVF KA+ NIMP LE++ RR+ G+N+QVP  V  ER+QTLGLRWL    R R EK+M+EKLA EI+DA+  TGA+ KK+ED HKMAEANKAFAH R+
  S:     3 RKGHVQKREVMPDPVYDDKTVTKLINNIMLDGKKGTAQKIVYGAFDIIKETTGEDALEVFYKAMNNIMPILEVKTRRIGGANYQVPIEVRPERRQTLGLRWLTTYTRARGEKTMVEKLAKEIMDAANNTGASVKKREDVHKMAEANKAFAHYRY 156
>gi|167757663|ref|ZP_02429790.1| hypothetical protein CLORAM_03213 [Clostridium ramosum DSM 1402] >gi|167702660|gb|EDS17239.1| hypothetical protein CLORAM_03213 [Clostridium ramosum DSM 1402] (156 aa)
Score = 478, Expect = 9.7e-47, Identities = 95/154 (61%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK +  KR++LPDPVYNS+ V+K IN IML+GKKG+AQ I+Y +F  +++KT    +EVF +A+ NIMP LEL+VRR+ G+N+QVP  VS ER+ TLGLRWL+  +R RNE +M+++LA EIIDAS G GA+ KKKEDTHKMAEANKAFAH R+
  S:     3 RKGQVAKRDVLPDPVYNSKTVSKLINNIMLDGKKGVAQNILYDAFKKVEEKTGNPAMEVFDQAINNIMPVLELKVRRIGGANYQVPVEVSGERRMTLGLRWLVNYSRLRNENTMVDRLANEIIDASNGAGASVKKKEDTHKMAEANKAFAHFRW 156
>gi|15902293|ref|NP_357843.1| 30S ribosomal protein S7 [Streptococcus pneumoniae R6] >gi|111658316|ref|ZP_01409005.1| hypothetical protein SpneT_02000506 [Streptococcus pneumoniae TIGR4] >gi|116516917|ref|YP_815770.1| 30S ribosomal protein S7 [Streptococcus pneumoniae D39] >gi|148983678|ref|ZP_01816997.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP3-BS71] >gi|148988013|ref|ZP_01819476.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP6-BS73] >gi|148994615|ref|ZP_01823757.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP9-BS68] >gi|148996696|ref|ZP_01824414.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP11-BS70] >gi|149006025|ref|ZP_01829754.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP18-BS74] >gi|149011142|ref|ZP_01832447.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP19-BS75] >gi|149017966|ref|ZP_01834425.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP23-BS72] >gi|168484146|ref|ZP_02709098.1| ribosomal protein S7 [Streptococcus pneumoniae CDC1873-00] >gi|168489748|ref|ZP_02713947.1| ribosomal protein S7 [Streptococcus pneumoniae SP195] >gi|168490799|ref|ZP_02714942.1| ribosomal protein S7 [Streptococcus pneumoniae CDC0288-04] >gi|168493967|ref|ZP_02718110.1| ribosomal protein S7 [Streptococcus pneumoniae CDC3059-06] >gi|168576301|ref|ZP_02722184.1| ribosomal protein S7 [Streptococcus pneumoniae MLV-016] >gi|169834242|ref|YP_001693799.1| ribosomal protein S7 [Streptococcus pneumoniae Hungary19A-6] >gi|182683253|ref|YP_001835000.1| 30S ribosomal protein S7 [Streptococcus pneumoniae CGSP14] >gi|194398272|ref|YP_002036970.1| 30S ribosomal protein S7 [Streptococcus pneumoniae G54] >gi|122279344|sp|Q04MH8|RS7_STRP2 30S ribosomal protein S7 >gi|62287332|sp|Q8CWU6|RS7_STRR6 30S ribosomal protein S7 >gi|15457798|gb|AAK99053.1| 30S Ribosomal protein S7 [Streptococcus pneumoniae R6] >gi|116077493|gb|ABJ55213.1| ribosomal protein S7 [Streptococcus pneumoniae D39] >gi|147757271|gb|EDK64310.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP11-BS70] >gi|147762381|gb|EDK69342.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP18-BS74] >gi|147764778|gb|EDK71708.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP19-BS75] >gi|147923825|gb|EDK74937.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP3-BS71] >gi|147926477|gb|EDK77550.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP6-BS73] >gi|147927145|gb|EDK78183.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP9-BS68] >gi|147931530|gb|EDK82508.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP23-BS72] >gi|168996744|gb|ACA37356.1| ribosomal protein S7 [Streptococcus pneumoniae Hungary19A-6] >gi|172042582|gb|EDT50628.1| ribosomal protein S7 [Streptococcus pneumoniae CDC1873-00] >gi|182628587|gb|ACB89535.1| 30S ribosomal protein S7 [Streptococcus pneumoniae CGSP14] >gi|183571774|gb|EDT92302.1| ribosomal protein S7 [Streptococcus pneumoniae SP195] >gi|183575043|gb|EDT95571.1| ribosomal protein S7 [Streptococcus pneumoniae CDC0288-04] >gi|183576124|gb|EDT96652.1| ribosomal protein S7 [Streptococcus pneumoniae CDC3059-06] >gi|183577797|gb|EDT98325.1| ribosomal protein S7 [Streptococcus pneumoniae MLV-016] >gi|194357939|gb|ACF56387.1| 30S ribosomal protein S7 [Streptococcus pneumoniae G54] (156 aa)
Score = 476, Expect = 1.6e-46, Identities = 95/154 (61%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKNRA KR++LPDP+YNS+LVT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR R E +M ++LA EI+DA+  TGAA KK+EDTH+MAEAN+AFAH R+
  S:     3 RKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYGAFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW 156
>gi|168181860|ref|ZP_02616524.1| ribosomal protein S7 [Clostridium botulinum Bf] >gi|182674915|gb|EDT86876.1| ribosomal protein S7 [Clostridium botulinum Bf] (156 aa)
Score = 476, Expect = 1.7e-46, Identities = 92/154 (59%), Positives = 127/154 (82%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS++VTK IN+IML+GKKG+AQ+I Y +F++I +K+ +D +EVF+ A+ NIMP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++++ARKR E+SM E+LA E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPLYNSKVVTKLINSIMLDGKKGVAQKICYDAFEIIAEKSGKDAMEVFETAMNNIMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWMLIAARKRGERSMRERLAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|170755397|ref|YP_001783125.1| ribosomal protein S7 [Clostridium botulinum B1 str. Okra] >gi|169120609|gb|ACA44445.1| ribosomal protein S7 [Clostridium botulinum B1 str. Okra] (156 aa)
Score = 476, Expect = 1.7e-46, Identities = 91/154 (59%), Positives = 127/154 (82%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS++VTK IN+IML+GK+G+AQ+I Y +F++I +K+ +D +EVF+ A+ NIMP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++++ARKR E+SM E+LA E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPLYNSKVVTKLINSIMLDGKRGVAQKICYDAFEIIGEKSGKDAMEVFETAMNNIMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWMLIAARKRGERSMRERLAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|157151622|ref|YP_001449525.1| 30S ribosomal protein S7 [Streptococcus gordonii str. Challis substr. CH1] >gi|189045638|sp|A8AUR5|RS7_STRGC 30S ribosomal protein S7 >gi|157076416|gb|ABV11099.1| ribosomal protein S7 [Streptococcus gordonii str. Challis substr. CH1] (156 aa)
Score = 476, Expect = 1.7e-46, Identities = 96/154 (62%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKNRA KRE+LPDP+YNS+LVT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR R E +M ++LA EI+DA+  TGAA KK+EDTH+MAEAN+AFAH R+
  S:     3 RKNRAPKREVLPDPLYNSKLVTRLINRVMLDGKRGTATSIVYGAFEQIKEATGTDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARLRGEHTMQDRLAKEIMDAANNTGAAVKKREDTHRMAEANRAFAHFRW 156
>gi|169190352|ref|ZP_02850324.1| ribosomal protein S7 [Paenibacillus sp. JDR-2] >gi|169002959|gb|EDS49834.1| ribosomal protein S7 [Paenibacillus sp. JDR-2] (156 aa)
Score = 476, Expect = 1.8e-46, Identities = 95/154 (61%), Positives = 127/154 (82%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK   TKR++LPDPVYNS+LVT+ IN IM++GK+G+AQ ++Y +F LI+++T +D +EVF++AL+NIMP LE++ RRV GSN+QVP  V  ER+ +LGLRWL+  +R R EK+M E+LAAEI+DAS  TGA+ KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVTKRDVLPDPVYNSKLVTRLINRIMIDGKRGVAQTLLYDAFTLIQERTGKDPMEVFEEALKNIMPVLEVKARRVGGSNYQVPIEVKPERRTSLGLRWLVNYSRNRGEKTMEERLAAEIMDASNNTGASVKKREDTHKMAEANKAFAHYRW 156
>gi|15900206|ref|NP_344810.1| 30S ribosomal protein S7 [Streptococcus pneumoniae TIGR4] >gi|17367606|sp|Q97SQ4|RS7_STRPN 30S ribosomal protein S7 >gi|14971743|gb|AAK74450.1| ribosomal protein S7 [Streptococcus pneumoniae TIGR4] (156 aa)
Score = 475, Expect = 2.3e-46, Identities = 95/154 (61%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKNRA KR++LPDP+YNS+LVT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR R E +M ++LA EI+DA+  TGAA KK+EDTH+MAEAN+AFAH R+
  S:     3 RKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYGAFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVKVRPERRTTLGLRWLVTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW 156
>gi|148381425|ref|YP_001255966.1| ribosomal protein S7 [Clostridium botulinum A str. ATCC 3502] >gi|153933324|ref|YP_001385800.1| 30S ribosomal protein S7 [Clostridium botulinum A str. ATCC 19397] >gi|153935931|ref|YP_001389207.1| 30S ribosomal protein S7 [Clostridium botulinum A str. Hall] >gi|153941509|ref|YP_001392838.1| 30S ribosomal protein S7 [Clostridium botulinum F str. Langeland] >gi|168178828|ref|ZP_02613492.1| ribosomal protein S7 [Clostridium botulinum NCTC 2916] >gi|170761456|ref|YP_001788825.1| ribosomal protein S7 [Clostridium botulinum A3 str. Loch Maree] >gi|166227437|sp|A7FZ73|RS7_CLOB1 30S ribosomal protein S7 >gi|166227438|sp|A5I7L0|RS7_CLOBH 30S ribosomal protein S7 >gi|166227439|sp|A7GJ78|RS7_CLOBL 30S ribosomal protein S7 >gi|148290909|emb|CAL85045.1| 30S ribosomal protein S7 [Clostridium botulinum A str. ATCC 3502] >gi|152929368|gb|ABS34868.1| ribosomal protein S7 [Clostridium botulinum A str. ATCC 19397] >gi|152931845|gb|ABS37344.1| ribosomal protein S7 [Clostridium botulinum A str. Hall] >gi|152937405|gb|ABS42903.1| ribosomal protein S7 [Clostridium botulinum F str. Langeland] >gi|169408445|gb|ACA56856.1| ribosomal protein S7 [Clostridium botulinum A3 str. Loch Maree] >gi|182670214|gb|EDT82190.1| ribosomal protein S7 [Clostridium botulinum NCTC 2916] (156 aa)
Score = 474, Expect = 2.6e-46, Identities = 91/154 (59%), Positives = 127/154 (82%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS++VTK IN+IML+GK+G+AQ+I Y +F++I +K+ +D +EVF+ A+ NIMP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++++ARKR E+SM E+LA E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPLYNSKVVTKLINSIMLDGKRGVAQKICYDAFEIIAEKSGKDAMEVFETAMNNIMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWMLIAARKRGERSMRERLAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|171779185|ref|ZP_02920156.1| hypothetical protein STRINF_01033 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|111073864|dbj|BAF02539.1| 30S ribosomal protein S7 [Streptococcus bovis] >gi|171282241|gb|EDT47668.1| hypothetical protein STRINF_01033 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (156 aa)
Score = 473, Expect = 3.4e-46, Identities = 94/154 (61%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKNRA KRE+LPDP+YNS+LVT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTH+MAEAN+AFAH R+
  S:     3 RKNRAPKREVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVYDAFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRDRGEHTMKDRLAKEILDAANNTGASVKKREDTHRMAEANRAFAHFRW 156
>gi|195977414|ref|YP_002122658.1| 30S ribosomal protein S7 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974119|gb|ACG61645.1| 30S ribosomal protein S7 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (156 aa)
Score = 473, Expect = 3.4e-46, Identities = 95/154 (61%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKNRA KRE+LPDP+YNS+LVT+ IN IML+GK+G A  IVY +F  IK+ T  D +EVF+ A++NIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNRAPKREVLPDPLYNSKLVTRLINRIMLDGKRGTASSIVYDAFSEIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW 156
>gi|121534755|ref|ZP_01666576.1| ribosomal protein S7 [Thermosinus carboxydivorans Nor1] >gi|121306775|gb|EAX47696.1| ribosomal protein S7 [Thermosinus carboxydivorans Nor1] (156 aa)
Score = 472, Expect = 4.8e-46, Identities = 93/154 (60%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVYNS+L+T+ IN +ML GKKG+A++IVY +FD+I+ KT +D +EVF+ AL+N+MP LE+R RRV G+N+QVP  V  +R+ +LG+RWL+  AR R EK+M E+LAAE++DA+  TG A KKKEDTHKMAEANKAFAH R+
  S:     3 RKGPVPKRDVLPDPVYNSKLITRLINKVMLSGKKGIAEKIVYDAFDIIRAKTGKDPVEVFETALKNVMPVLEVRARRVGGANYQVPVEVRPDRRLSLGIRWLVNYARLRGEKTMRERLAAELMDAANNTGGAVKKKEDTHKMAEANKAFAHYRW 156
>gi|160945274|ref|ZP_02092500.1| hypothetical protein FAEPRAM212_02793 [Faecalibacterium prausnitzii M21/2] >gi|158443005|gb|EDP20010.1| hypothetical protein FAEPRAM212_02793 [Faecalibacterium prausnitzii M21/2] (156 aa)
Score = 470, Expect = 7.9e-46, Identities = 91/154 (59%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++L DP+YNS++VT+ +N++ML+GKKG+AQ+IVY++F +I++KT  D +E F+KA+ENIMPSLE + RRV G+N+QVP  VS  R++TLGLRWL   +R R EK+M ++LAAEI+DA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     3 RRGNIAKRDVLADPIYNSKMVTRLVNSVMLDGKKGVAQKIVYEAFSMIQEKTGNDPLETFEKAMENIMPSLECKTRRVGGANYQVPLEVSPARRETLGLRWLTAYSRTRGEKTMAQRLAAEIMDAANNTGNAVKKREDTHKMAEANKAFAHFRY 156
>gi|187776572|ref|ZP_02993045.1| hypothetical protein CLOSPO_00086 [Clostridium sporogenes ATCC 15579] >gi|187775231|gb|EDU39033.1| hypothetical protein CLOSPO_00086 [Clostridium sporogenes ATCC 15579] (172 aa)
Score = 470, Expect = 8.3e-46, Identities = 91/154 (59%), Positives = 127/154 (82%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS++VTK IN+IML+GK+G+AQ+I Y +F++I +K+ +D +EVF+ A+ NIMP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++++ARKR E+SM E+LA E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:    19 RKGHIAKRDVLPDPLYNSKVVTKLINSIMLDGKRGVAQKICYDAFEIIAEKSGKDAMEVFETAMNNIMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWMLIAARKRGERSMRERLAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 172
>gi|154499818|ref|ZP_02037856.1| hypothetical protein BACCAP_03475 [Bacteroides capillosus ATCC 29799] >gi|150271416|gb|EDM98673.1| hypothetical protein BACCAP_03475 [Bacteroides capillosus ATCC 29799] (162 aa)
Score = 470, Expect = 8.6e-46, Identities = 94/154 (61%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+LPDP+YNS LVTK +N+IML+GKKG+AQ++VY +FD+IK+KT +D ++VF  A+ENIMPSLE++ RRV G+ +QVP  V  ER+QTLGLRWL   +R R+EK+M E+LA EI+DA+   G+A KK+EDTHKMAE+NKAFAH R+
  S:     9 RRGNVPKREVLPDPLYNSVLVTKLVNSIMLDGKKGVAQKVVYGAFDIIKEKTEKDPLDVFTAAIENIMPSLEVKARRVGGATYQVPIEVRPERRQTLGLRWLTTYSRARSEKTMKERLAGEIMDAANNLGSAVKKREDTHKMAESNKAFAHYRW 162
>gi|124524126|ref|ZP_01697842.1| ribosomal protein S7 [Bacillus coagulans 36D1] >gi|124495169|gb|EAY42918.1| ribosomal protein S7 [Bacillus coagulans 36D1] (156 aa)
Score = 470, Expect = 8.9e-46, Identities = 94/154 (61%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GK+G AQ I+Y SFD+I+++T +D +EVF +AL+NIMP LE+R RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEAN+AFAH R+
  S:     3 RKGPVAKRDVLPDPIYNSKLVTRLINKMMIDGKRGKAQTILYSSFDIIRERTGKDPMEVFDQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANRAFAHYRW 156
>gi|52078605|ref|YP_077396.1| 30S ribosomal protein S7 [Bacillus licheniformis ATCC 14580] >gi|52783967|ref|YP_089796.1| 30S ribosomal protein S7 [Bacillus licheniformis ATCC 14580] >gi|81691252|sp|Q65PB1|RS7_BACLD 30S ribosomal protein S7 >gi|52001816|gb|AAU21758.1| ribosomal protein S7 (BS7) [Bacillus licheniformis ATCC 14580] >gi|52346469|gb|AAU39103.1| RpsG [Bacillus licheniformis DSM 13] (156 aa)
Score = 469, Expect = 1.1e-45, Identities = 96/154 (62%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GKKG AQ I+Y+SFD+IK++T  D +EVF++AL+NIMP LE++ RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPLYNSKLVTRLINKMMIDGKKGKAQTILYKSFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|148544700|ref|YP_001272070.1| 30S ribosomal protein S7 [Lactobacillus reuteri F275] >gi|184154052|ref|YP_001842393.1| 30S ribosomal protein S7 [Lactobacillus reuteri F275] >gi|167011258|sp|A5VLK9|RS7_LACRF 30S ribosomal protein S7 >gi|148531734|gb|ABQ83733.1| SSU ribosomal protein S7P [Lactobacillus reuteri F275] >gi|183225396|dbj|BAG25913.1| 30S ribosomal protein S7 [Lactobacillus reuteri F275] (156 aa)
Score = 469, Expect = 1.1e-45, Identities = 90/154 (58%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KREILPDP+YNS+LVT  I+ +M++GK+G A +I+Y +FD IK +T  D +EVF++A+EN+MP LE++ RRV GSN+QVP  V  +R+ TLGLRW++  AR R E +M+E+LA EIIDAS  TGA+ KK+EDTH+MAEAN+AFAH R+
  S:     3 RKGHVQKREILPDPMYNSKLVTSLIDHLMIDGKRGTATKILYAAFDEIKNETGNDPVEVFQQAMENVMPVLEVKARRVGGSNYQVPIEVRPDRRTTLGLRWIVQYARLRGEHTMVERLAREIIDASNNTGASVKKREDTHRMAEANRAFAHYRW 156
>gi|167769918|ref|ZP_02441971.1| hypothetical protein ANACOL_01259 [Anaerotruncus colihominis DSM 17241] >gi|167667909|gb|EDS12039.1| hypothetical protein ANACOL_01259 [Anaerotruncus colihominis DSM 17241] (174 aa)
Score = 468, Expect = 1.2e-45, Identities = 91/154 (59%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ +  KR++LPDP+YNS+LVT+ IN IM +GKKG+AQ+IVY +FD++K+KT +D +E F++++ENIMP LE++ RRV G+ +QVP  V  ER+QTLGLRWL   AR R EK+M E+LA EI+D+   TG A KK+EDTHKMAEAN+AFAH R+
  S:    21 RRGQIAKRDVLPDPLYNSKLVTRLINNIMYDGKKGVAQKIVYGAFDIVKEKTGKDPLEAFQQSMENIMPVLEVKARRVGGATYQVPMEVRPERRQTLGLRWLTTYARNRGEKTMRERLAGEIMDSLNQTGGAVKKREDTHKMAEANRAFAHYRW 174
>gi|15923536|ref|NP_371070.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926224|ref|NP_373757.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus N315] >gi|21282230|ref|NP_645318.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus MW2] >gi|27467228|ref|NP_763865.1| 30S ribosomal protein S7 [Staphylococcus epidermidis ATCC 12228] >gi|49482776|ref|YP_040000.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49485411|ref|YP_042632.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57651422|ref|YP_185478.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus COL] >gi|57866146|ref|YP_187783.1| 30S ribosomal protein S7 [Staphylococcus epidermidis RP62A] >gi|70727460|ref|YP_254376.1| 30S ribosomal protein S7 [Staphylococcus haemolyticus JCSC1435] >gi|88194308|ref|YP_499100.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267006|ref|YP_001245949.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus JH9] >gi|150393053|ref|YP_001315728.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus JH1] >gi|151220720|ref|YP_001331542.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156978875|ref|YP_001441134.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus Mu3] >gi|161508786|ref|YP_001574445.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728928|ref|ZP_02761205.1| ribosomal protein S7 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166228482|sp|A7WYX3|RS7_STAA1 30S ribosomal protein S7 >gi|172048780|sp|A6QEJ8|RS7_STAAE 30S ribosomal protein S7 >gi|189045635|sp|A6TZ23|RS7_STAA2 30S ribosomal protein S7 >gi|189045636|sp|A5IQA0|RS7_STAA9 30S ribosomal protein S7 >gi|189045637|sp|A8YZP4|RS7_STAAT 30S ribosomal protein S7 >gi|54039544|sp|P66616|RS7_STAAN 30S ribosomal protein S7 >gi|54039545|sp|P66617|RS7_STAAW 30S ribosomal protein S7 >gi|54039546|sp|P66618|RS7_STAES 30S ribosomal protein S7 >gi|54041985|sp|P66615|RS7_STAAM 30S ribosomal protein S7 >gi|62287185|sp|Q5HIC9|RS7_STAAC 30S ribosomal protein S7 >gi|62287261|sp|Q6GBU1|RS7_STAAS 30S ribosomal protein S7 >gi|62287262|sp|Q6GJC2|RS7_STAAR 30S ribosomal protein S7 >gi|73919121|sp|Q5HRK6|RS7_STAEQ 30S ribosomal protein S7 >gi|109894852|sp|Q2FJ94|RS7_STAA3 30S ribosomal protein S7 >gi|110282992|sp|P48940|RS7_STAA8 30S ribosomal protein S7 >gi|118585374|sp|Q4L3K7|RS7_STAHJ 30S ribosomal protein S7 >gi|27314771|gb|AAO03907.1|AE016745_6 30S ribosomal protein S7 [Staphylococcus epidermidis ATCC 12228] >gi|13700437|dbj|BAB41735.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus N315] >gi|14246314|dbj|BAB56708.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus Mu50] >gi|21203666|dbj|BAB94366.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus MW2] >gi|49240905|emb|CAG39572.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49243854|emb|CAG42279.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57285608|gb|AAW37702.1| ribosomal protein S7 [Staphylococcus aureus subsp. aureus COL] >gi|57636804|gb|AAW53592.1| ribosomal protein S7 [Staphylococcus epidermidis RP62A] >gi|68448186|dbj|BAE05770.1| 30S ribosomal protein S7 [Staphylococcus haemolyticus JCSC1435] >gi|87201866|gb|ABD29676.1| ribosomal protein S7 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740075|gb|ABQ48373.1| SSU ribosomal protein S7P [Staphylococcus aureus subsp. aureus JH9] >gi|149945505|gb|ABR51441.1| ribosomal protein S7 [Staphylococcus aureus subsp. aureus JH1] >gi|150373520|dbj|BAF66780.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721010|dbj|BAF77427.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus Mu3] >gi|160367595|gb|ABX28566.1| ribosomal protein S7 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (156 aa)
Score = 468, Expect = 1.2e-45, Identities = 92/154 (59%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP++NS+LVTK IN IML+GK+G AQ+I+Y +FDL+++++  D +EVF++A+ NIMP LE++ RRV GSN+QVP  V  ER+ TLGLRWL+  AR R EK+M ++LA EI+DA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     3 RKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW 156
>gi|109647473|ref|ZP_01371376.1| ribosomal protein S7 [Desulfitobacterium hafniense DCB-2] >gi|109640563|gb|EAT50118.1| ribosomal protein S7 [Desulfitobacterium hafniense DCB-2] (156 aa)
Score = 468, Expect = 1.3e-45, Identities = 94/154 (61%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KREILPDP+Y +R++TK IN IML+GKKG A+ I Y +F+LI++KT +D IEVF+ AL+N+MP LE++ RRV G+N+QVP  V  +R+QTLGLRWL+  ARKR+EK+M E++A E++DA+  TG + KKKEDTHKMAEANKAFAH R+
  S:     3 RKGYIAKREILPDPIYKNRVLTKFINQIMLDGKKGTAESICYNAFELIQEKTGKDPIEVFETALKNVMPVLEVKARRVGGANYQVPIEVRTDRRQTLGLRWLVGYARKRSEKTMEERIAGELMDAANNTGGSIKKKEDTHKMAEANKAFAHYRW 156
>gi|118726665|ref|ZP_01575286.1| ribosomal protein S7 [Clostridium cellulolyticum H10] >gi|118663924|gb|EAV70565.1| ribosomal protein S7 [Clostridium cellulolyticum H10] (156 aa)
Score = 468, Expect = 1.3e-45, Identities = 89/154 (57%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK   +KR++LPDP+Y S+ VTK IN +M +GKKG+AQQI Y +FD+IK+KT  D +EVF++A+ NIMP LE++ RRV G+ +QVP  V  +R+Q LGLRWL+  +RKR E++M E+L+ EI+DA    G A+KKKEDTHKMAEAN+AFAH R+
  S:     3 RKGHISKRDVLPDPIYGSKTVTKLINNVMYDGKKGIAQQICYDAFDIIKEKTGRDPLEVFEEAMANIMPVLEVKARRVGGATYQVPMEVRPDRRQALGLRWLVDYSRKRGERTMRERLSGEILDAINNMGGAYKKKEDTHKMAEANRAFAHYRW 156
>gi|160946126|ref|ZP_02093337.1| hypothetical protein PEPMIC_00074 [Peptostreptococcus micros ATCC 33270] >gi|158447649|gb|EDP24644.1| hypothetical protein PEPMIC_00074 [Peptostreptococcus micros ATCC 33270] (156 aa)
Score = 468, Expect = 1.4e-45, Identities = 94/154 (61%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE++PDP+Y   +VTK IN IML+GKKG+AQ IVY +F+++K+KT E+  EVF+KALENIMP LE++ RR+ G+ +QVP  V  ER+QTLGLRWL+  +R R EK+M E+LA EI+DA   TGA+ KK+EDTHKMAEANKAFAH  F
  S:     3 RKGHVPKREVMPDPIYGDVVVTKLINNIMLDGKKGIAQAIVYGAFEIVKEKTGEEPTEVFRKALENIMPVLEIKARRIGGATYQVPIQVRPERRQTLGLRWLVTYSRNRGEKTMKERLAKEILDAVNNTGASVKKREDTHKMAEANKAFAHYGF 156
>gi|71910045|ref|YP_281595.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS5005] >gi|71852827|gb|AAZ50850.1| SSU ribosomal protein S7P [Streptococcus pyogenes MGAS5005] (156 aa)
Score = 468, Expect = 1.5e-45, Identities = 92/154 (59%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKN+A KRE+LPDP+YNS++VT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A++NIMP+LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYDAFNAIKEATGNDALEVFETAMDNIMPALEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW 156
>gi|89893213|ref|YP_516700.1| 30S ribosomal protein S7 [Desulfitobacterium hafniense Y51] >gi|123091862|sp|Q250N6|RS7_DESHY 30S ribosomal protein S7 >gi|89332661|dbj|BAE82256.1| 30S ribosomal protein S7 [Desulfitobacterium hafniense Y51] (156 aa)
Score = 467, Expect = 1.6e-45, Identities = 94/154 (61%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KREILPDP+Y +R++TK IN IML+GKKG A+ I Y +F+LI++KT +D IEVF+ AL+N+MP LE++ RRV G+N+QVP  V  +R+QTLGLRWL+  ARKR+EK+M E++A E++DA+  TG + KKKEDTHKMAEANKAFAH R+
  S:     3 RKGYIAKREILPDPIYKNRVLTKFINQIMLDGKKGTAESICYNAFELIQEKTGKDPIEVFETALKNVMPVLEVKARRVGGANYQVPIEVRADRRQTLGLRWLVGYARKRSEKTMEERIAGELMDAANNTGGSIKKKEDTHKMAEANKAFAHYRW 156
>gi|18311391|ref|NP_563325.1| 30S ribosomal protein S7 [Clostridium perfringens str. 13] >gi|110799966|ref|YP_697098.1| 30S ribosomal protein S7 [Clostridium perfringens ATCC 13124] >gi|110803690|ref|YP_699667.1| 30S ribosomal protein S7 [Clostridium perfringens SM101] >gi|168208045|ref|ZP_02634050.1| ribosomal protein S7 [Clostridium perfringens E str. JGS1987] >gi|168212000|ref|ZP_02637625.1| ribosomal protein S7 [Clostridium perfringens B str. ATCC 3626] >gi|168215385|ref|ZP_02641010.1| ribosomal protein S7 [Clostridium perfringens CPE str. F4969] >gi|168218311|ref|ZP_02643936.1| ribosomal protein S7 [Clostridium perfringens NCTC 8239] >gi|169344028|ref|ZP_02865017.1| ribosomal protein S7 [Clostridium perfringens C str. JGS1495] >gi|123047160|sp|Q0SQE0|RS7_CLOPS 30S ribosomal protein S7 >gi|123344488|sp|Q0TMP2|RS7_CLOP1 30S ribosomal protein S7 >gi|21263968|sp|Q8XHS0|RS7_CLOPE 30S ribosomal protein S7 >gi|18146075|dbj|BAB82115.1| 30S ribosomal protein S7 [Clostridium perfringens str. 13] >gi|110674613|gb|ABG83600.1| ribosomal protein S7 [Clostridium perfringens ATCC 13124] >gi|110684191|gb|ABG87561.1| ribosomal protein S7 [Clostridium perfringens SM101] >gi|169297852|gb|EDS79948.1| ribosomal protein S7 [Clostridium perfringens C str. JGS1495] >gi|170660656|gb|EDT13339.1| ribosomal protein S7 [Clostridium perfringens E str. JGS1987] >gi|170710073|gb|EDT22255.1| ribosomal protein S7 [Clostridium perfringens B str. ATCC 3626] >gi|170713241|gb|EDT25423.1| ribosomal protein S7 [Clostridium perfringens CPE str. F4969] >gi|182379680|gb|EDT77159.1| ribosomal protein S7 [Clostridium perfringens NCTC 8239] (156 aa)
Score = 467, Expect = 1.7e-45, Identities = 93/154 (60%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVYNS++VTK IN +M +GKKG+AQ+I Y +F +I +KT  D +EVF++A+ NIMP LE++ RR+ G+N+QVP  V  ER+QTLGLRWL+ ++RKR EK M E+LA E++DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPVYNSKVVTKLINNVMEDGKKGVAQKICYDAFQIINEKTGRDAMEVFEEAMNNIMPLLEVKARRIGGANYQVPIEVRPERRQTLGLRWLLAASRKRGEKYMRERLAGELMDAANNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|182417385|ref|ZP_02948717.1| ribosomal protein S7 [Clostridium butyricum 5521] >gi|182378764|gb|EDT76288.1| ribosomal protein S7 [Clostridium butyricum 5521] (156 aa)
Score = 467, Expect = 2.0e-45, Identities = 89/154 (57%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVYNS++VTK IN+IM +GKKG+AQ+I Y +F++I +K+ ++ +EVF++A+ N+MP LE++ RR+ G+ +QVP  V  ER+QTLG+RW+++ ARKR EK M E++A E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPVYNSKVVTKFINSIMEDGKKGVAQKICYDAFEIIAQKSGKEALEVFEEAMNNVMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWMLIGARKRGEKLMCERVAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|22537909|ref|NP_688760.1| 30S ribosomal protein S7 [Streptococcus agalactiae 2603V/R] >gi|25011852|ref|NP_736247.1| 30S ribosomal protein S7 [Streptococcus agalactiae NEM316] >gi|76787220|ref|YP_330389.1| 30S ribosomal protein S7 [Streptococcus agalactiae A909] >gi|76798236|ref|ZP_00780485.1| ribosomal protein S7 [Streptococcus agalactiae 18RS21] >gi|77412126|ref|ZP_00788450.1| ribosomal protein S7 [Streptococcus agalactiae CJB111] >gi|62287334|sp|Q8DXS6|RS7_STRA5 30S ribosomal protein S7 >gi|62287335|sp|Q8E3E6|RS7_STRA3 30S ribosomal protein S7 >gi|90120567|sp|Q3JZB4|RS7_STRA1 30S ribosomal protein S7 >gi|22534807|gb|AAN00633.1|AE014272_4 ribosomal protein S7 [Streptococcus agalactiae 2603V/R] >gi|24413393|emb|CAD47472.1| ribosomal protein S7 [Streptococcus agalactiae NEM316] >gi|76562277|gb|ABA44861.1| ribosomal protein S7 [Streptococcus agalactiae A909] >gi|76586389|gb|EAO62898.1| ribosomal protein S7 [Streptococcus agalactiae 18RS21] >gi|77161833|gb|EAO72820.1| ribosomal protein S7 [Streptococcus agalactiae CJB111] (156 aa)
Score = 466, Expect = 2.1e-45, Identities = 93/154 (60%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKN+A KRE+LPDP+YNS++VT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYDAFEAIKEATGTDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW 156
>gi|169331637|ref|ZP_02860830.1| hypothetical protein ANASTE_00021 [Anaerofustis stercorihominis DSM 17244] >gi|169259699|gb|EDS73665.1| hypothetical protein ANASTE_00021 [Anaerofustis stercorihominis DSM 17244] (156 aa)
Score = 466, Expect = 2.2e-45, Identities = 92/154 (59%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+LPDP+YNS LVTK +N +ML+GKKG+AQ+IVY +FD++ +KT +D +E F++AL NIMPSLE++ RRV G+ +QVP  +  ER+QTLGLRWL+   R R EK+M E+LAAEI+DA   +G++ KKKEDTHKMA+ANKAFAH ++
  S:     3 RKGPVPKREVLPDPMYNSVLVTKLLNNVMLDGKKGVAQKIVYGAFDIVAEKTGKDPLEAFEEALNNIMPSLEVKARRVGGATYQVPMDIRPERRQTLGLRWLVTYTRARGEKTMKERLAAEIMDALNNSGSSVKKKEDTHKMADANKAFAHFKW 156
>gi|15674451|ref|NP_268625.1| 30S ribosomal protein S7 [Streptococcus pyogenes M1 GAS] >gi|19745404|ref|NP_606540.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS8232] >gi|54039547|sp|P66620|RS7_STRP8 30S ribosomal protein S7 >gi|54041986|sp|P66619|RS7_STRP1 30S ribosomal protein S7 >gi|13621547|gb|AAK33346.1| 30S ribosomal protein S7 [Streptococcus pyogenes M1 GAS] >gi|19747513|gb|AAL97039.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS8232] (156 aa)
Score = 466, Expect = 2.2e-45, Identities = 92/154 (59%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKN+A KRE+LPDP+YNS++VT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A++NIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYDAFNAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW 156
>gi|73663518|ref|YP_302299.1| 30S ribosomal protein S7 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|110826003|sp|Q49V56|RS7_STAS1 30S ribosomal protein S7 >gi|72496033|dbj|BAE19354.1| 30S ribosomal protein S7 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (156 aa)
Score = 466, Expect = 2.5e-45, Identities = 92/154 (59%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP++NS+LVTK IN IML+GK+G AQ+I+Y +FDL+K+++  + +EVF++A++NIMP LE++ RRV GSN+QVP  V  ER+ TLGLRWL+  +R R EK+M E+LA EI+DA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     3 RKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVKERSGREAVEVFEEAIDNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYSRLRGEKTMEERLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW 156
>gi|187935402|ref|YP_001884469.1| ribosomal protein S7 [Clostridium botulinum B str. Eklund 17B] >gi|188588584|ref|YP_001919668.1| ribosomal protein S7 [Clostridium botulinum E3 str. Alaska E43] >gi|187723555|gb|ACD24776.1| ribosomal protein S7 [Clostridium botulinum B str. Eklund 17B] >gi|188498865|gb|ACD52001.1| ribosomal protein S7 [Clostridium botulinum E3 str. Alaska E43] (156 aa)
Score = 465, Expect = 2.7e-45, Identities = 89/154 (57%), Positives = 127/154 (82%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVYNS++VTK IN+IM +GKKG+AQ+I Y++F+LI +++ ++ +EVF++A+ N+MP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++++ARKR EK M E++A E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPVYNSKVVTKFINSIMEDGKKGVAQKICYEAFELIAQRSGKEALEVFEEAMNNVMPLLEVKARRIGGATYQVPMEVRTERRQTLGIRWMLIAARKRGEKLMCERVAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|94991746|ref|YP_599845.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS2096] >gi|123382346|sp|Q1JDK7|RS7_STRPB 30S ribosomal protein S7 >gi|94545254|gb|ABF35301.1| SSU ribosomal protein S7P [Streptococcus pyogenes MGAS2096] (156 aa)
Score = 465, Expect = 3.2e-45, Identities = 92/154 (59%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKN+A KRE+LPDP+YNS++VT+ IN +ML+GK+G A  IVY +F  IK+ T  D +EVF+ A++NIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYYAFSAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW 156
>gi|21909735|ref|NP_664003.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS315] >gi|28895116|ref|NP_801466.1| 30S ribosomal protein S7 [Streptococcus pyogenes SSI-1] >gi|50913609|ref|YP_059581.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS10394] >gi|71902891|ref|YP_279694.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS6180] >gi|94987864|ref|YP_595965.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS9429] >gi|94989740|ref|YP_597840.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS10270] >gi|94993622|ref|YP_601720.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS10750] >gi|139473089|ref|YP_001127804.1| 30S ribosomal protein S7 [Streptococcus pyogenes str. Manfredo] >gi|123080342|sp|Q1JIM7|RS7_STRPD 30S ribosomal protein S7 >gi|123258232|sp|Q1JNH8|RS7_STRPC 30S ribosomal protein S7 >gi|123382213|sp|Q1J8I5|RS7_STRPF 30S ribosomal protein S7 >gi|166228483|sp|A2RCI1|RS7_STRPG 30S ribosomal protein S7 >gi|24638200|sp|P59062|RS7_STRP3 30S ribosomal protein S7 >gi|62287211|sp|Q5XDW5|RS7_STRP6 30S ribosomal protein S7 >gi|110826004|sp|Q48VB7|RS7_STRPM 30S ribosomal protein S7 >gi|21903919|gb|AAM78806.1| 30S ribosomal protein S7 [Streptococcus pyogenes MGAS315] >gi|28810361|dbj|BAC63299.1| 30S ribosomal protein S7 [Streptococcus pyogenes SSI-1] >gi|50902683|gb|AAT86398.1| SSU ribosomal protein S7P [Streptococcus pyogenes MGAS10394] >gi|71801986|gb|AAX71339.1| SSU ribosomal protein S7P [Streptococcus pyogenes MGAS6180] >gi|94541372|gb|ABF31421.1| SSU ribosomal protein S7P [Streptococcus pyogenes MGAS9429] >gi|94543248|gb|ABF33296.1| SSU ribosomal protein S7P [Streptococcus pyogenes MGAS10270] >gi|94547130|gb|ABF37176.1| SSU ribosomal protein S7P [Streptococcus pyogenes MGAS10750] >gi|134271335|emb|CAM29553.1| 30S ribosomal protein S7 [Streptococcus pyogenes str. Manfredo] (156 aa)
Score = 465, Expect = 3.3e-45, Identities = 92/154 (59%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKN+A KRE+LPDP+YNS++VT+ IN +ML+GK+G A  IVY +F  IK+ T  D +EVF+ A++NIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYDAFSAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW 156
>gi|16077179|ref|NP_387992.1| 30S ribosomal protein S7 [Bacillus subtilis subsp. subtilis str. 168] >gi|2507324|sp|P21469|RS7_BACSU 30S ribosomal protein S7 (BS7) >gi|1644222|dbj|BAA11002.1| ribosomal protein S7 [Bacillus subtilis] >gi|2632378|emb|CAB11887.1| ribosomal protein S7 (BS7) [Bacillus subtilis subsp. subtilis str. 168] (156 aa)
Score = 464, Expect = 3.5e-45, Identities = 94/154 (61%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LV++ IN +M++GKKG  Q I+Y+SFD+IK++T  D +EVF++AL+NIMP LE++ RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKKGKPQTILYKSFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|15674243|ref|NP_268418.1| 30S ribosomal protein S7 [Lactococcus lactis subsp. lactis Il1403] >gi|116513219|ref|YP_812126.1| 30S ribosomal protein S7 [Lactococcus lactis subsp. cremoris SK11] >gi|125625310|ref|YP_001033793.1| 30S ribosomal protein S7 [Lactococcus lactis subsp. cremoris MG1363] >gi|17367641|sp|Q9CDG0|RS7_LACLA 30S ribosomal protein S7 >gi|12725332|gb|AAK06359.1|AE006455_5 30S ribosomal protein S7 [Lactococcus lactis subsp. lactis Il1403] >gi|116108873|gb|ABJ74013.1| SSU ribosomal protein S7P [Lactococcus lactis subsp. cremoris SK11] >gi|124494118|emb|CAL99119.1| 30S ribosomal protein S7 [Lactococcus lactis subsp. cremoris MG1363] (155 aa)
Score = 464, Expect = 3.5e-45, Identities = 95/155 (61%), Positives = 122/155 (78%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRA KRE+L DP+YNS +VT+ IN +ML+GK+G+A QIVY +F  I++ T  + +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR R E +M ++LA EI+DA+  TGAA KK+EDTHKMAEAN+AFAH R+
  S:     1 MRKNRAPKREVLADPMYNSIVVTRLINRVMLDGKRGVAAQIVYGAFKQIEEATGNNPLEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARNRGEHTMQDRLAKEILDAANNTGAAVKKREDTHKMAEANRAFAHFRW 155
>gi|167039516|ref|YP_001662501.1| 30S ribosomal protein S7 [Thermoanaerobacter sp. X514] >gi|166853756|gb|ABY92165.1| ribosomal protein S7 [Thermoanaerobacter sp. X514] (156 aa)
Score = 464, Expect = 3.7e-45, Identities = 94/154 (61%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +RE+LPDPVYNS+ V+K IN +M +GKK LAQ+I Y +FD+I++KT  D +EVF++AL N+MP LE+R RRV G+ +QVP  V  ER+ +LG+RWL+  AR+R+ KSM+EKLAAEIIDA+  TG + KKKEDTHKMAEANKAFAH R+
  S:     3 RKGHVERREVLPDPVYNSKKVSKLINKVMWDGKKSLAQKICYGAFDIIREKTGRDPLEVFEEALNNVMPVLEVRPRRVGGATYQVPMEVRPERRLSLGIRWLVEYARQRSGKSMMEKLAAEIIDAANNTGGSVKKKEDTHKMAEANKAFAHYRW 156
>gi|125975210|ref|YP_001039120.1| 30S ribosomal protein S7 [Clostridium thermocellum ATCC 27405] >gi|196253511|ref|ZP_03152135.1| ribosomal protein S7 [Clostridium thermocellum DSM 4150] >gi|166227441|sp|A3DIZ8|RS7_CLOTH 30S ribosomal protein S7 >gi|125715435|gb|ABN53927.1| SSU ribosomal protein S7P [Clostridium thermocellum ATCC 27405] >gi|196197052|gb|EDX91925.1| ribosomal protein S7 [Clostridium thermocellum DSM 4150] (156 aa)
Score = 464, Expect = 4.1e-45, Identities = 90/154 (58%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YN ++V K IN IM++GKK +AQ+I Y +FD+I++KT +D +EVF++AL N+MP LE++ RRV G+ +QVP  V  ER+Q L LRWL++ AR+R+E++M E+LAAEIIDA+   G A+KKKEDTHKMAEANKAFAH R+
  S:     3 RKGNVPKRDVLPDPIYNDKVVAKLINNIMIDGKKSIAQKICYGAFDIIREKTGKDPLEVFEQALNNVMPVLEVKPRRVGGATYQVPVEVRPERRQALALRWLVVYARERSERTMKERLAAEIIDATNNMGGAYKKKEDTHKMAEANKAFAHYRW 156
>gi|154684629|ref|YP_001419790.1| 30S ribosomal protein S7 [Bacillus amyloliquefaciens FZB42] >gi|166227416|sp|A7Z0N3|RS7_BACA2 30S ribosomal protein S7 >gi|154350480|gb|ABS72559.1| RpsG [Bacillus amyloliquefaciens FZB42] (156 aa)
Score = 463, Expect = 4.6e-45, Identities = 94/154 (61%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LV++ IN +M++GKKG +Q I+Y+SFD+IK++T  D +EVF++AL+NIMP LE++ RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPLYNSKLVSRLINKMMIDGKKGKSQTILYKSFDIIKERTGNDAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|29374845|ref|NP_813998.1| 30S ribosomal protein S7 [Enterococcus faecalis V583] >gi|62287323|sp|Q839H0|RS7_ENTFA 30S ribosomal protein S7 >gi|29342303|gb|AAO80069.1| ribosomal protein S7 [Enterococcus faecalis V583] (156 aa)
Score = 463, Expect = 5.5e-45, Identities = 88/154 (57%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GK+G+A  I+Y SFD+IK+ T  D +EVF++A++N+MP LE++ RRV GSN+QVP  V  ER+ TLGLRW++  AR R E +M E+LA EI+DA+  TGA+ KK+EDTHKMA+AN+AFAH R+
  S:     3 RKGPVAKRDVLPDPIYNSKLVTRLINRVMVDGKRGIAANIIYNSFDIIKESTGNDPLEVFEQAMKNVMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWVVNYARLRGEHTMEERLAKEIMDAANNTGASVKKREDTHKMADANRAFAHYRW 156
>gi|150015039|ref|YP_001307293.1| 30S ribosomal protein S7 [Clostridium beijerinckii NCIMB 8052] >gi|189045604|sp|A6LPQ7|RS7_CLOB8 30S ribosomal protein S7 >gi|149901504|gb|ABR32337.1| ribosomal protein S7 [Clostridium beijerinckii NCIMB 8052] (156 aa)
Score = 463, Expect = 5.5e-45, Identities = 90/154 (58%), Positives = 126/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVYNS++VTK IN+IM +GKKG+AQ+I Y++F LI K++ ++ +EVF++A+ N+MP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++++ARKR EK M E++A E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPVYNSKVVTKFINSIMEDGKKGVAQKICYEAFGLIAKRSGKEALEVFEEAMNNVMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWMLIAARKRGEKLMSERVAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|82750254|ref|YP_415995.1| 30S ribosomal protein S7 [Staphylococcus aureus RF122] >gi|90120563|sp|Q2YSB5|RS7_STAAB 30S ribosomal protein S7 >gi|82655785|emb|CAI80185.1| 30S ribosomal protein S7 [Staphylococcus aureus RF122] (156 aa)
Score = 463, Expect = 5.6e-45, Identities = 91/154 (59%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP++NS+LVTK IN IML+GK+G AQ+I+Y +F+L+++++  D +EVF++A+ NIMP LE++ RRV GSN+QVP  V  ER+ TLGLRWL+  AR R EK+M ++LA EI+DA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     3 RKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFNLVEQRSGRDALEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW 156
>gi|56961928|ref|YP_173650.1| 30S ribosomal protein S7 [Bacillus clausii KSM-K16] >gi|62287208|sp|Q5WLR6|RS7_BACSK 30S ribosomal protein S7 >gi|56908162|dbj|BAD62689.1| 30S ribosomal protein S7 [Bacillus clausii KSM-K16] (156 aa)
Score = 462, Expect = 6.6e-45, Identities = 92/154 (59%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R++LPDP+YNS+LVT+ IN IM++GK+G AQ I+Y +F+L+K+++  D +EVF +AL+NIMP LE++ RRV GSN+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+   GAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVARRDVLPDPIYNSKLVTRLINRIMVDGKRGTAQTILYNAFELVKERSGNDPMEVFDQALKNIMPVLEVKARRVGGSNYQVPIEVKPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNAGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|167036797|ref|YP_001664375.1| 30S ribosomal protein S7 [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855631|gb|ABY94039.1| ribosomal protein S7 [Thermoanaerobacter pseudethanolicus ATCC 33223] (156 aa)
Score = 462, Expect = 6.7e-45, Identities = 93/154 (60%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +RE+LPDPVYNS+ V+K IN +M +GKK LAQ+I Y +FD+I++KT  D +EVF++AL N+MP LE+R RRV G+ +QVP  V  ER+ +LG+RWL+  AR+R+ KSM+EKLAAEI+DA+  TG + KKKEDTHKMAEANKAFAH R+
  S:     3 RKGHVERREVLPDPVYNSKKVSKLINKVMWDGKKSLAQKICYGAFDIIREKTGRDPLEVFEEALNNVMPVLEVRPRRVGGATYQVPVEVRPERRLSLGIRWLVEYARQRSGKSMMEKLAAEIMDAANNTGGSVKKKEDTHKMAEANKAFAHYRW 156
>gi|148377856|ref|YP_001256732.1| 30S ribosomal protein S7 [Mycoplasma agalactiae PG2] >gi|148291902|emb|CAL59293.1| 30S ribosomal protein S7 [Mycoplasma agalactiae PG2] (156 aa)
Score = 462, Expect = 7.5e-45, Identities = 97/154 (62%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK+ A  R++L DPV+NS LVTK INAIML+GKK LAQ I+Y +F+L+K+KT +D +EVF+ A++N+ P LE+R RR+ G+N+QVPT VS  RKQTL LRWL+  AR RNEK+M  +LA EIIDAS  TG A KK+EDTHKMAEAN+AFAH R+
  S:     3 RKHSAPIRKVLADPVFNSVLVTKLINAIMLDGKKSLAQDILYSAFNLVKEKTQKDPMEVFQAAIDNVTPQLEVRTRRIGGTNYQVPTEVSARRKQTLALRWLVQYARLRNEKTMDVRLANEIIDASNKTGGAIKKREDTHKMAEANRAFAHFRW 156
>gi|78043518|ref|YP_361123.1| 30S ribosomal protein S7 [Carboxydothermus hydrogenoformans Z-2901] >gi|90120405|sp|Q3A9R1|RS7_CARHZ 30S ribosomal protein S7 >gi|77995633|gb|ABB14532.1| ribosomal protein S7 [Carboxydothermus hydrogenoformans Z-2901] (156 aa)
Score = 461, Expect = 8.0e-45, Identities = 91/154 (59%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+Y S+LVTK IN  M++GKK LA++I Y++FD+I++KT  D +EVF++A++N+MP LE+R RRV G+N+QVP  V  ER+Q+L +RW++  AR+RN +SM EKLAAEI+DA+ G G A KKKEDTHKMAEANKAFAH R+
  S:     3 RRGPVPKRDVLPDPIYGSKLVTKLINKTMVDGKKSLAEKICYRAFDIIREKTGRDPLEVFEEAMKNVMPVLEVRPRRVGGANYQVPVEVRPERRQSLAIRWIVNYARERNGRSMEEKLAAEIMDAANGVGGAVKKKEDTHKMAEANKAFAHYRW 156
>gi|116334273|ref|YP_795800.1| 30S ribosomal protein S7 [Lactobacillus brevis ATCC 367] >gi|122269045|sp|Q03PV3|RS7_LACBA 30S ribosomal protein S7 >gi|116099620|gb|ABJ64769.1| SSU ribosomal protein S7P [Lactobacillus brevis ATCC 367] (156 aa)
Score = 461, Expect = 8.1e-45, Identities = 86/154 (55%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+LPDP+YNS+LVT+ IN +M++GK+G + +I+Y +FD+IK +T  D +E F++A++NIMP LE++ RRV GSN+QVP  V  +R+ TLGLRWL+  +R R E +M+E+LA EI+DA+  TGAA KK+EDTH+MA+AN+AFAH R+
  S:     3 RKGNVQKREVLPDPIYNSKLVTRLINHMMMDGKRGTSTKIIYGAFDIIKNETGNDPVETFEEAMKNIMPVLEVKARRVGGSNYQVPIEVRPDRRTTLGLRWLVQYSRLRGEHTMVERLAREIMDAANNTGAAVKKREDTHRMADANRAFAHYRW 156
>gi|153952857|ref|YP_001393622.1| 30S ribosomal protein S7 [Clostridium kluyveri DSM 555] >gi|189045605|sp|A5N4P3|RS7_CLOK5 30S ribosomal protein S7 >gi|146345738|gb|EDK32274.1| RpsG [Clostridium kluyveri DSM 555] (156 aa)
Score = 461, Expect = 9.0e-45, Identities = 92/154 (59%), Positives = 127/154 (82%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVYNS++VTK IN IM +GKKG+AQ+I Y +FD+I++KT+++ +EVF++A+ NIMP LE++ RR+ G+ +QVP  V  ER+QTLG+RWL++++RKR EK M E+LAAE++DA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIGKRDVLPDPVYNSKVVTKLINNIMKDGKKGVAQKICYGAFDIIEQKTSKEPMEVFEEAMNNIMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWLLVASRKRGEKYMRERLAAELMDAANNTGTAVKKREDTHKMAEANKAFAHYRY 156
>gi|15612693|ref|NP_240996.1| 30S ribosomal protein S7 [Bacillus halodurans C-125] >gi|7388223|sp|Q9Z9L8|RS7_BACHD 30S ribosomal protein S7 >gi|4512400|dbj|BAA75267.1| rpsG homologue (identity of 84% to B. subtilis ) [Bacillus halodurans] >gi|10172742|dbj|BAB03849.1| 30S ribosomal protein S7 [Bacillus halodurans C-125] (156 aa)
Score = 461, Expect = 9.3e-45, Identities = 90/154 (58%), Positives = 126/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R++LPDP+YNS+LVT+ IN IM++GK+G+AQ+I+Y +F+L+++++ +D +EVF +AL+NIMP LE++ RRV G+N+QVP  V  ER+ TLGLRWL+  +R R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVARRDVLPDPIYNSKLVTRLINRIMVDGKRGIAQKILYNAFELVRERSGKDPMEVFDQALKNIMPVLEVKARRVGGANYQVPVEVKPERRTTLGLRWLVNYSRLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|126697636|ref|YP_001086533.1| 30S ribosomal protein S7 [Clostridium difficile 630] >gi|145956381|ref|ZP_01805377.1| hypothetical protein CdifQ_04000077 [Clostridium difficile QCD-32g58] >gi|168696865|ref|ZP_02729142.1| 30S ribosomal protein S7 [Clostridium difficile QCD-37x79] >gi|168715547|ref|ZP_02747824.1| 30S ribosomal protein S7 [Clostridium difficile QCD-63q42] >gi|168726735|ref|ZP_02759012.1| 30S ribosomal protein S7 [Clostridium difficile QCD-76w55] >gi|168730435|ref|ZP_02762712.1| 30S ribosomal protein S7 [Clostridium difficile QCD-97b34] >gi|196127770|ref|ZP_03119519.1| 30S ribosomal protein S7 [Clostridium difficile ATCC 43255] >gi|196160581|ref|ZP_03121142.1| 30S ribosomal protein S7 [Clostridium difficile CIP 107932] >gi|196165506|ref|ZP_03126037.1| 30S ribosomal protein S7 [Clostridium difficile QCD-23m63] >gi|122974214|sp|Q18CF5|RS7_CLOD6 30S ribosomal protein S7 >gi|115249073|emb|CAJ66884.1| 30S ribosomal protein S7 [Clostridium difficile 630] (156 aa)
Score = 460, Expect = 1.0e-44, Identities = 94/154 (61%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+LPDP+Y S++VTK IN +M++GKKG +Q+IVY +F ++ +KT E+ +EVF KA++NIMP LE++ RRV G+N+QVP  V  ER+QTLGLRWL+   R R EK M+EKLA EI+DA+  TGA+ KKKEDTHKMAEANKAFAH R+
  S:     3 RKGNIPKREVLPDPMYGSKVVTKLINNLMVDGKKGKSQRIVYDAFAIVAEKTGEEALEVFNKAMDNIMPVLEVKARRVGGANYQVPIEVRPERRQTLGLRWLVKYTRARGEKGMVEKLAKEIMDAANNTGASVKKKEDTHKMAEANKAFAHYRW 156
>gi|55821762|ref|YP_140204.1| 30S ribosomal protein S7 [Streptococcus thermophilus LMG 18311] >gi|55823681|ref|YP_142122.1| 30S ribosomal protein S7 [Streptococcus thermophilus CNRZ1066] >gi|116628479|ref|YP_821098.1| 30S ribosomal protein S7 [Streptococcus thermophilus LMD-9] >gi|122266926|sp|Q03IS0|RS7_STRTD 30S ribosomal protein S7 >gi|81676507|sp|Q5LY20|RS7_STRT1 30S ribosomal protein S7 >gi|81676660|sp|Q5M2M5|RS7_STRT2 30S ribosomal protein S7 >gi|55737747|gb|AAV61389.1| 30S ribosomal protein S7 [Streptococcus thermophilus LMG 18311] >gi|55739666|gb|AAV63307.1| 30S ribosomal protein S7 [Streptococcus thermophilus CNRZ1066] >gi|116101756|gb|ABJ66902.1| SSU ribosomal protein S7P [Streptococcus thermophilus LMD-9] (156 aa)
Score = 460, Expect = 1.2e-44, Identities = 94/154 (61%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RKNRA KRE+L DP+YNS++VT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A++NIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M E+LA EI+DA+  TGAA KK+EDTHKMAEAN+AFAH R+
  S:     3 RKNRAPKREVLADPLYNSKIVTRLINRVMLDGKRGTAATIVYDAFEQIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRITLGLRWLVNASRARGEHTMKERLAKEIMDAANNTGAAVKKREDTHKMAEANRAFAHFRW 156
>gi|3041716|sp|P22744|RS7_BACST 30S ribosomal protein S7 (BS7) (156 aa)
Score = 460, Expect = 1.3e-44, Identities = 92/154 (59%), Positives = 126/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+YNS+LVT+ IN IM++GKK  AQ+I+Y +FD+I+++T +D +EVF++AL+N+MP LE+R RRV G+N+QVP  V  +R+ +LGLRWL+  AR RNEK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYTAFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWLVQYARLRNEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|90961183|ref|YP_535099.1| 30S ribosomal protein S7 [Lactobacillus salivarius UCC118] >gi|123270008|sp|Q1WVA1|RS7_LACS1 30S ribosomal protein S7 >gi|90820377|gb|ABD99016.1| SSU ribosomal protein S7P [Lactobacillus salivarius UCC118] (156 aa)
Score = 459, Expect = 1.5e-44, Identities = 89/154 (57%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+LPDP+YNS+LVT+ IN +ML+GK+G A +I+YQ+FD+IK++T  + ++VF++A++NIMP LE++ RRV GSN+QVP  V  +R+ TLGLRWL+  +R R E +M E+LA EI+DA+  TGAA KK+EDTHKMA+AN+AFAH R+
  S:     3 RKGAVAKREVLPDPIYNSKLVTRLINRLMLDGKRGTASKILYQAFDIIKEQTGNEPLDVFEEAMKNIMPVLEVKARRVGGSNYQVPIEVRPDRRTTLGLRWLVQYSRLRGEHTMSERLAKEIMDAANNTGAAVKKREDTHKMADANRAFAHYRW 156
>gi|20808664|ref|NP_623835.1| 30S ribosomal protein S7 [Thermoanaerobacter tengcongensis MB4] >gi|22096133|sp|Q8R7V0|RS7_THETN 30S ribosomal protein S7 >gi|20517299|gb|AAM25439.1| Ribosomal protein S7 [Thermoanaerobacter tengcongensis MB4] (156 aa)
Score = 459, Expect = 1.5e-44, Identities = 93/154 (60%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+LPDPVYNS  V K IN +M +GKK LAQ+I Y +FD+I++KT  D +EVF++AL N+MP LE+R RRV G+ +QVP  V  ER+ +LG+RW++  AR+R+ KSM+EKLAAEIIDA+  TG + KKKEDTH+MAEANKAFAH R+
  S:     3 RKGPVPKREVLPDPVYNSVKVAKLINKVMWDGKKSLAQKICYGAFDIIREKTGRDPLEVFEEALNNVMPVLEVRPRRVGGATYQVPMEVRPERRLSLGIRWIVEYARQRSGKSMMEKLAAEIIDAANNTGGSVKKKEDTHRMAEANKAFAHYRW 156
>gi|77406278|ref|ZP_00783345.1| ribosomal protein S7 [Streptococcus agalactiae H36B] >gi|77175131|gb|EAO77933.1| ribosomal protein S7 [Streptococcus agalactiae H36B] (154 aa)
Score = 459, Expect = 1.6e-44, Identities = 92/152 (60%), Positives = 121/152 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHL 153
           RKN+A KRE+LPDP+YNS++VT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+ ++R R E +M ++LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH 
  S:     3 RKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYDAFEAIKEATGTDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHF 154
>gi|116617321|ref|YP_817692.1| 30S ribosomal protein S7 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122272478|sp|Q03ZQ3|RS7_LEUMM 30S ribosomal protein S7 >gi|116096168|gb|ABJ61319.1| SSU ribosomal protein S7P [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (156 aa)
Score = 458, Expect = 1.8e-44, Identities = 90/154 (58%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    ++EILPDP+YNS+LV++ IN +ML+GK+G A  I+Y +FD IK+ T  D +EVF++A+ENIMP LE++ RRV GSN+QVP  V  +R+ TLGLRWL+  +R RNE +M E+LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKGYTKRQEILPDPIYNSKLVSRLINKLMLDGKRGTASTILYDAFDRIKEATGNDPLEVFEQAMENIMPVLEVKARRVGGSNYQVPIEVRPDRRSTLGLRWLVNYSRLRNEHTMDERLAKEIMDAANDTGASVKKREDTHKMAEANRAFAHYRW 156
>gi|56418637|ref|YP_145955.1| 30S ribosomal protein S7 [Geobacillus kaustophilus HTA426] >gi|62287187|sp|Q5L401|RS7_GEOKA 30S ribosomal protein S7 >gi|56378479|dbj|BAD74387.1| 30S ribosomal protein S7 (BS7) [Geobacillus kaustophilus HTA426] (156 aa)
Score = 458, Expect = 2.0e-44, Identities = 91/154 (59%), Positives = 126/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+YNS+LVT+ IN IM++GKK  AQ+I+Y +FD+I+++T +D +EVF++AL+N+MP LE+R RRV G+N+QVP  V  +R+ +LGLRWL+  AR RNEK+M E+LA EI+DA+  TGAA KK+EDTHKMAEAN+AFAH R+
  S:     3 RRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYTAFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWLVQYARLRNEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANRAFAHYRW 156
>gi|150392164|ref|YP_001322213.1| 30S ribosomal protein S7 [Alkaliphilus metalliredigens QYMF] >gi|167011251|sp|A6TWI6|RS7_ALKMQ 30S ribosomal protein S7 >gi|149952026|gb|ABR50554.1| ribosomal protein S7 [Alkaliphilus metalliredigens QYMF] (156 aa)
Score = 458, Expect = 2.2e-44, Identities = 94/154 (61%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+L DP++ S +V K IN++ML+GKKG AQ IVY +FD+IK++  E+ +EVF+KA+ NIMP LE++ RRV G+N+QVP  V  ER+QTLGLRWL+   R R EK MIEKLA EI+DA+  TG++ KKKEDTHKMAEANKAFAH R+
  S:     3 RKGNVPKREVLADPIHGSMVVAKLINSVMLDGKKGTAQNIVYGAFDIIKERAEENPVEVFEKAMNNIMPVLEVKARRVGGANYQVPIEVRPERRQTLGLRWLVKYTRARGEKGMIEKLAKEIMDAANNTGSSVKKKEDTHKMAEANKAFAHYRW 156
>gi|28212178|ref|NP_783122.1| 30S ribosomal protein S7 [Clostridium tetani E88] >gi|62287329|sp|Q890N7|RS7_CLOTE 30S ribosomal protein S7 >gi|28204622|gb|AAO37059.1| SSU ribosomal protein S7P [Clostridium tetani E88] (156 aa)
Score = 457, Expect = 2.3e-44, Identities = 87/154 (56%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+++TK IN++M +GKKGLAQ+I Y +FD+I+ KT ++ +EVF++A+ N+MP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++++ARKR EK M E+LA E++DA+   GAA KK+E+THKMAEANKAFAH R+
  S:     3 RKGYIGKRDVLPDPMYNSKVLTKLINSLMYDGKKGLAQKICYDAFDVIQNKTGKEPMEVFEEAMNNVMPLLEVKARRIGGATYQVPLEVRPERRQTLGIRWILIAARKRGEKYMSERLAGELMDAANNLGAAVKKREETHKMAEANKAFAHYRY 156
>gi|157690895|ref|YP_001485357.1| 30S ribosomal protein S7 [Bacillus pumilus SAFR-032] >gi|194017413|ref|ZP_03056024.1| ribosomal protein S7 [Bacillus pumilus ATCC 7061] >gi|167011254|sp|A8F980|RS7_BACP2 30S ribosomal protein S7 >gi|157679653|gb|ABV60797.1| ribosomal protein S7 [Bacillus pumilus SAFR-032] >gi|194010685|gb|EDW20256.1| ribosomal protein S7 [Bacillus pumilus ATCC 7061] (156 aa)
Score = 456, Expect = 3.3e-44, Identities = 91/154 (59%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LV++ IN +M++GK+G +Q I+Y+SFD+IK++T  + +EVF++AL+NIMP LE++ RRV G+N+QVP  V  +R+ TLGLRWL+  AR R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKRGKSQTILYKSFDIIKERTGNEAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPDRRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|160935069|ref|ZP_02082455.1| hypothetical protein CLOLEP_03945 [Clostridium leptum DSM 753] >gi|156866522|gb|EDO59894.1| hypothetical protein CLOLEP_03945 [Clostridium leptum DSM 753] (162 aa)
Score = 455, Expect = 4.1e-44, Identities = 90/154 (58%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+YNS+LVT+ IN +M++GKKG++Q+IVY +F++I++KT +D +E F++A+ENIMP LE++ RRV G+ +QVP  V  ER+QTLGLRWL   AR R+EK+M E+LA EI+DA  G G A KK++DTHKMAEANKAFAH R+
  S:     9 RRGSIAKRDVLPDPLYNSKLVTRLINNVMVDGKKGVSQKIVYGAFEIIQEKTGKDPLETFEQAMENIMPLLEVKARRVGGATYQVPMEVRPERRQTLGLRWLTNYARLRSEKTMKERLAGEILDAINGVGGAAKKRDDTHKMAEANKAFAHYRW 162
>gi|184155994|ref|YP_001844334.1| 30S ribosomal protein S7 [Lactobacillus fermentum IFO 3956] >gi|183227338|dbj|BAG27854.1| 30S ribosomal protein S7 [Lactobacillus fermentum IFO 3956] (156 aa)
Score = 455, Expect = 4.2e-44, Identities = 89/154 (57%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    K E+LPDP+YNS+LVT  IN +ML+GK+G A +I+YQ+ D IK++T  D IEVF++A+ENI P+LE++ RR+ GSN+QVP  V  +R++TL LRWL+  AR R E +M+E+L+ EIIDAS  TGA+ KKKEDT +MAEAN+AFAH R+
  S:     3 RKGHVAKPEVLPDPIYNSKLVTSLINHLMLDGKRGTASKILYQALDQIKEQTGNDPIEVFEQAMENIKPALEVKARRIGGSNYQVPIEVRPDRQRTLALRWLVQYARLRGEHTMVERLSGEIIDASNNTGASIKKKEDTLRMAEANRAFAHYRW 156
>gi|152973952|ref|YP_001373469.1| 30S ribosomal protein S7 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189045597|sp|A7GK16|RS7_BACCN 30S ribosomal protein S7 >gi|152022704|gb|ABS20474.1| ribosomal protein S7 [Bacillus cereus subsp. cytotoxis NVH 391-98] (156 aa)
Score = 455, Expect = 4.8e-44, Identities = 91/154 (59%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GKKG +Q I+Y +FD+++++T ++ +EVF++AL+NIMP LE+R RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+  TGA+ KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYNAFDIVRERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNTGASVKKREDTHKMAEANKAFAHYRW 156
>gi|58336627|ref|YP_193212.1| 30S ribosomal protein S7 [Lactobacillus acidophilus NCFM] >gi|75507663|sp|Q5FM93|RS7_LACAC 30S ribosomal protein S7 >gi|58253944|gb|AAV42181.1| 30s ribosomal protein S7 [Lactobacillus acidophilus NCFM] (156 aa)
Score = 453, Expect = 6.6e-44, Identities = 87/154 (56%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK   TKR++L DPVYNS+LVTK IN +M++GK+  A  I+Y +F++++ KT ++ ++VF++A+ N+MP LE+R RR+ GSN+Q+P  V  ER+ TLGLRWL+  AR RNE +M E+LA EIIDAS  TG+A KK+ED H+MAEAN+AFAH RF
  S:     3 RKGHVTKRDVLADPVYNSKLVTKLINHLMIDGKRAKASSILYDAFNIVQDKTGKEPLDVFEEAMNNVMPVLEVRARRIGGSNYQIPVEVRPERRTTLGLRWLVSYARLRNEHTMDERLANEIIDASNNTGSAVKKREDVHRMAEANRAFAHYRF 156
>gi|116495953|ref|YP_807687.1| 30S ribosomal protein S7 [Lactobacillus casei ATCC 334] >gi|191639434|ref|YP_001988600.1| 30S ribosomal protein S7 [Lactobacillus casei] >gi|122262647|sp|Q034X7|RS7_LACC3 30S ribosomal protein S7 >gi|116106103|gb|ABJ71245.1| SSU ribosomal protein S7P [Lactobacillus casei ATCC 334] >gi|190713736|emb|CAQ67742.1| 30S ribosomal protein S7 [Lactobacillus casei BL23] (156 aa)
Score = 453, Expect = 6.7e-44, Identities = 85/154 (55%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDPVYNS+LVT+ IN +M++GK+G A  I+Y +FD+IKK+T  + ++VF++A++N+MP LE++ RR+ GSN+QVP  V  +R+ TLGLRW++  +R+R E +M E+LA EI+DA+  TGAA KK+EDTHKMA+AN+AFAH R+
  S:     3 RKGSVAKRDVLPDPVYNSKLVTRLINHLMIDGKRGKASTILYDAFDMIKKQTGNEPLDVFEEAMKNVMPVLEVKARRIGGSNYQVPIEVRPDRRTTLGLRWIVQYSRQRGEHTMDERLAKEIMDAANNTGAAVKKREDTHKMADANRAFAHYRW 156
>gi|138893781|ref|YP_001124234.1| 30S ribosomal protein S7 [Geobacillus thermodenitrificans NG80-2] >gi|196251028|ref|ZP_03149710.1| ribosomal protein S7 [Geobacillus sp. G11MC16] >gi|166227449|sp|A4IJI5|RS7_GEOTN 30S ribosomal protein S7 >gi|134265294|gb|ABO65489.1| SSU ribosomal protein S7P [Geobacillus thermodenitrificans NG80-2] >gi|196209500|gb|EDY04277.1| ribosomal protein S7 [Geobacillus sp. G11MC16] (156 aa)
Score = 453, Expect = 7.2e-44, Identities = 90/154 (58%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+YNS+LVT+ IN IM++GKK  AQ+I+Y +FD+I+++T +D +EVF++AL+N+MP LE+R RRV G+N+QVP  V  +R+ +LGLRWL+  +R R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RRGPVAKRDVLPDPIYNSKLVTRLINKIMIDGKKSKAQKILYTAFDIIRERTGKDPMEVFEQALKNVMPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWLVQYSRLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|116493166|ref|YP_804901.1| 30S ribosomal protein S7 [Pediococcus pentosaceus ATCC 25745] >gi|122265370|sp|Q03EB3|RS7_PEDPA 30S ribosomal protein S7 >gi|116103316|gb|ABJ68459.1| SSU ribosomal protein S7P [Pediococcus pentosaceus ATCC 25745] (156 aa)
Score = 453, Expect = 7.5e-44, Identities = 90/154 (58%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KRE+LPDP+YNS+LVT+ IN +ML+GK+G A +I+Y +FD+I+K+T  +   VF++A+ NIMP LE++ RRV GSN+QVP  V  +R+ TLGLRWL+  AR R E +M E+LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKREVLPDPIYNSKLVTRLINRLMLDGKRGKASKILYNAFDIIEKETGSEPTGVFEEAMNNIMPVLEVKARRVGGSNYQVPIEVRPDRRTTLGLRWLVNYARLRGEHTMPERLAREIMDAANNTGASVKKREDTHKMAEANRAFAHYRW 156
>gi|154484488|ref|ZP_02026936.1| hypothetical protein EUBVEN_02202 [Eubacterium ventriosum ATCC 27560] >gi|149734336|gb|EDM50253.1| hypothetical protein EUBVEN_02202 [Eubacterium ventriosum ATCC 27560] (188 aa)
Score = 452, Expect = 9.5e-44, Identities = 91/154 (59%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+L DP+YNS +VTK IN IML+GKKG+AQ+IVY +FD I  +T +D IEVF++A+ N+MP+LE++ RR+ G+ +QVP  V  ER+Q LGLRW+ L +R+R+EK+M E+LA EI+DA+  TG++ KK+ED HKMAEANKAFAH RF
  S:    35 RKGHTQKREVLADPMYNSVVVTKLINNIMLDGKKGVAQKIVYGAFDKIANQTGKDAIEVFEEAMNNVMPALEVKARRIGGATYQVPIEVRPERRQALGLRWITLYSRQRSEKTMEERLANEIMDAANNTGSSVKKREDMHKMAEANKAFAHYRF 188
>gi|81429381|ref|YP_396382.1| 30S ribosomal protein S7 [Lactobacillus sakei subsp. sakei 23K] >gi|90120483|sp|Q38UQ8|RS7_LACSS 30S ribosomal protein S7 >gi|78611024|emb|CAI56077.1| 30S ribosomal protein S7 [Lactobacillus sakei subsp. sakei 23K] (156 aa)
Score = 452, Expect = 1.0e-43, Identities = 86/154 (55%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LV++ IN +M++GK+G A  I+Y +FD+IK++T  + +EVF++A+ NIMP LE++ RR+ GSN+QVP  V  ER+ TLGLRWL+  AR R E +M ++LA EI+DA+  TGAA KK+EDTHKMA+AN+AFAH R+
  S:     3 RKGYVAKRDVLPDPMYNSKLVSRLINRLMIDGKRGTASTILYDAFDIIKEETGNEPLEVFEEAMNNIMPVLEVKARRIGGSNYQVPIEVRPERRTTLGLRWLVSYARLRGEHTMDQRLAREIMDAANNTGAAVKKREDTHKMADANRAFAHYRW 156
>gi|15828900|ref|NP_326260.1| 30S ribosomal protein S7 [Mycoplasma pulmonis UAB CTIP] >gi|17367623|sp|Q98QD7|RS7_MYCPU 30S ribosomal protein S7 >gi|14089843|emb|CAC13602.1| 30S RIBOSOMAL PROTEIN S7 [Mycoplasma pulmonis] (156 aa)
Score = 451, Expect = 1.1e-43, Identities = 96/154 (62%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK++A  R +L DPV+N  +VTK +N IML+GKK +AQ IVY +FD+IK+KT  +  EVF++AL NI P LE+R RR+ GSN+QVPT VSK R+QTL LRWL   AR RNEK+M  +LA EIIDAS  TG A KK+EDTHKMAEAN+AFAH R+
  S:     3 RKHKAPIRTVLADPVFNMVVVTKLVNTIMLDGKKSIAQNIVYSAFDIIKEKTGREPYEVFQEALNNITPLLEIRTRRIGGSNYQVPTEVSKRRQQTLSLRWLTNYARLRNEKTMDLRLANEIIDASNKTGGAIKKREDTHKMAEANRAFAHFRW 156
>gi|170017951|ref|YP_001728870.1| ribosomal protein S7 [Leuconostoc citreum KM20] >gi|169804808|gb|ACA83426.1| Ribosomal protein S7 [Leuconostoc citreum KM20] (156 aa)
Score = 451, Expect = 1.3e-43, Identities = 88/154 (57%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    ++E+LPDP+YNS+LV++ IN +ML+GK+G A  I+Y +FD IK+ T  + +EVF++A+ENIMP LE++ RRV GSN+QVP  V  +R+ TLGLRWL+  +R RNE +M E+LA EI+DA+  TGA+ KK+EDTHKMAEAN+AFAH R+
  S:     3 RKGYTKRQEVLPDPIYNSKLVSRLINKLMLDGKRGTASTILYDAFDRIKEATGNEPLEVFEQAMENIMPVLEVKARRVGGSNYQVPIEVRPDRRTTLGLRWLVNYSRLRNEHTMDERLAKEIMDAANDTGASVKKREDTHKMAEANRAFAHYRW 156
>gi|83591280|ref|YP_431289.1| 30S ribosomal protein S7 [Moorella thermoacetica ATCC 39073] >gi|109894835|sp|Q2RFP3|RS7_MOOTA 30S ribosomal protein S7 >gi|83574194|gb|ABC20746.1| SSU ribosomal protein S7P [Moorella thermoacetica ATCC 39073] (156 aa)
Score = 451, Expect = 1.4e-43, Identities = 92/154 (59%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  +R +L DP+Y +  VTK IN +ML+GKK LAQ+I Y +F++IK KT +D +EVF++AL+N+MP LE++ RRV G+N+QVP  V  ER+QTLG+RWL+  AR R+ KSM EKLAAE+IDA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     3 RRGRVPRRAVLADPLYGNTKVTKLINQVMLDGKKSLAQRICYDAFEIIKNKTGKDPVEVFEQALKNVMPVLEVKARRVGGANYQVPVEVRPERRQTLGIRWLVNYARARSGKSMQEKLAAELIDAANNTGGAVKKREDTHKMAEANKAFAHYRW 156
>gi|134298089|ref|YP_001111585.1| 30S ribosomal protein S7 [Desulfotomaculum reducens MI-1] >gi|172044216|sp|A4J107|RS7_DESRM 30S ribosomal protein S7 >gi|134050789|gb|ABO48760.1| SSU ribosomal protein S7P [Desulfotomaculum reducens MI-1] (156 aa)
Score = 450, Expect = 1.5e-43, Identities = 88/154 (57%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+Y S++ TK +N +ML+GK+G+A++I+Y +F++IK+KT +  +EVF  A++N+MP LE++ RRV G+N+QVP  V  ER+QTLG+RW++L  RKR  KSM EKLAAEI+DA+  TGA  KK+EDTHKMAEANKAFAH R+
  S:     3 RRGGIPKRDVLPDPIYGSKIATKLVNQMMLDGKRGVAEKIIYDAFEIIKEKTGKSPLEVFDAAMKNVMPVLEVKARRVGGANYQVPVEVRAERRQTLGIRWMVLFTRKRAGKSMAEKLAAEIMDAANNTGATVKKREDTHKMAEANKAFAHYRW 156
>gi|163764746|ref|ZP_02171800.1| Ribosomal protein S7-like protein [Bacillus selenitireducens MLS10] >gi|160354772|gb|EDP81431.1| Ribosomal protein S7-like protein [Bacillus selenitireducens MLS10] (156 aa)
Score = 450, Expect = 1.6e-43, Identities = 91/154 (59%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R++L DP+YNS+LVT+ IN IM+ GK+G AQ I+Y +FDL++++T  D  EVF++AL+NIMP LE++ RRV G+N+QVP  V  +R+ TLGLRWL+  AR R EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVARRDVLADPIYNSKLVTRLINRIMVHGKRGKAQTILYNAFDLVRERTGNDPQEVFEQALKNIMPVLEVKARRVGGANYQVPIEVKPDRRTTLGLRWLVSYARLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|71894072|ref|YP_278180.1| 30S ribosomal protein S7 [Mycoplasma synoviae 53] >gi|115305711|sp|Q4A702|RS7_MYCS5 30S ribosomal protein S7 >gi|71850860|gb|AAZ43469.1| 30S ribosomal protein S7 [Mycoplasma synoviae 53] (156 aa)
Score = 450, Expect = 1.7e-43, Identities = 96/154 (62%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A  RE+L DP++NS +VTK IN IML+GKK +AQ I+Y +FDL+K+KT +D ++VF +A+ENI P LE+R RR+ G+N+QVPT VSK RKQ L LRWL+  AR RN+KSM  +LA EIIDA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     3 RKKSAKVREVLADPIFNSVVVTKLINTIMLDGKKSIAQDILYSAFDLVKEKTKKDPMQVFTQAVENITPQLEIRTRRIGGTNYQVPTEVSKRRKQALSLRWLVQYARLRNDKSMDLRLANEIIDAANKTGGAIKKREDTHKMAEANKAFAHFRW 156
>gi|161506870|ref|YP_001576824.1| 30S ribosomal protein S7 [Lactobacillus helveticus DPC 4571] >gi|172048364|sp|A8YXK2|RS7_LACH4 30S ribosomal protein S7 >gi|160347859|gb|ABX26533.1| 30S ribosomal protein [Lactobacillus helveticus DPC 4571] (156 aa)
Score = 450, Expect = 1.7e-43, Identities = 87/154 (56%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK   TKR +L DPVYNS+LVTK IN +M++GK+  A  I+Y +F++++ KT ++ ++VF++A+ N+MP LE+R RR+ GSN+Q+P  V  ER+ TLGLRWL+  AR RNE +M E+LA EIIDAS  TG+A KK+ED H+MAEAN+AFAH RF
  S:     3 RKGHVTKRAVLADPVYNSKLVTKLINHLMIDGKRAKASSILYDAFNIVQDKTGKEPLDVFEEAMNNVMPVLEVRARRIGGSNYQIPVEVRPERRTTLGLRWLVSYARLRNEHTMDERLANEIIDASNNTGSAVKKREDVHRMAEANRAFAHYRF 156
>gi|116491308|ref|YP_810852.1| 30S ribosomal protein S7 [Oenococcus oeni PSU-1] >gi|118586590|ref|ZP_01544031.1| ribosomal protein S7, BS7 [Oenococcus oeni ATCC BAA-1163] >gi|122276510|sp|Q04ED5|RS7_OENOB 30S ribosomal protein S7 >gi|116092033|gb|ABJ57187.1| SSU ribosomal protein S7P [Oenococcus oeni PSU-1] >gi|118432969|gb|EAV39694.1| ribosomal protein S7, BS7 [Oenococcus oeni ATCC BAA-1163] (156 aa)
Score = 450, Expect = 1.7e-43, Identities = 86/154 (55%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    ++E+LPDP+YNS+LV++ IN +ML+GK+G A  I+Y++FD I+ +T  D +EVF++A+EN+MP LE++ RRV GSN+QVP  V  ER+ TLGLRW++  AR R+E++M E+L+ EI+DA+ GTGA+ KK++DTHKMAEAN+AFAH R+
  S:     3 RKAYTKQQEVLPDPIYNSKLVSRLINKLMLDGKRGTASSILYKAFDRIQSETGNDPVEVFQQAMENVMPVLEVKARRVGGSNYQVPIEVRPERRTTLGLRWIVQYARLRSERTMEERLSKEIMDAANGTGASVKKRDDTHKMAEANRAFAHYRW 156
>gi|167749853|ref|ZP_02421980.1| hypothetical protein EUBSIR_00821 [Eubacterium siraeum DSM 15702] >gi|167657165|gb|EDS01295.1| hypothetical protein EUBSIR_00821 [Eubacterium siraeum DSM 15702] (162 aa)
Score = 449, Expect = 2.1e-43, Identities = 86/154 (55%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+Y S LVT+ +N IML+GKKG+AQ+IVY +FD++ +K+ +  +E F++A+ENIMP LE++ RRV G+ +QVP  V  ER++TLGLRW+ L AR+RNEK+M E+LA EI+DA  G G A KK++DTH+MAEAN+AFAH ++
  S:     9 RRGNVPKRDVLPDPMYGSELVTRLVNNIMLDGKKGVAQKIVYGAFDIVAEKSGKGALEAFEEAMENIMPQLEVKARRVGGATYQVPMEVRPERRRTLGLRWITLYARQRNEKTMKERLANEILDAMNGQGGACKKRDDTHRMAEANRAFAHYKW 162
>gi|30018376|ref|NP_830007.1| 30S ribosomal protein S7 [Bacillus cereus ATCC 14579] >gi|62287319|sp|Q81J44|RS7_BACCR 30S ribosomal protein S7 >gi|29893916|gb|AAP07208.1| SSU ribosomal protein S7P [Bacillus cereus ATCC 14579] (156 aa)
Score = 449, Expect = 2.2e-43, Identities = 90/154 (58%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GKKG +Q I+Y +FD++ ++T ++ +EVF++AL+NIMP LE+R RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+   GA+ KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYNAFDIVNERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW 156
>gi|30260297|ref|NP_842674.1| 30S ribosomal protein S7 [Bacillus anthracis str. Ames] >gi|42779187|ref|NP_976434.1| 30S ribosomal protein S7 [Bacillus cereus ATCC 10987] >gi|47525362|ref|YP_016711.1| 30S ribosomal protein S7 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183140|ref|YP_026392.1| 30S ribosomal protein S7 [Bacillus anthracis str. Sterne] >gi|49479282|ref|YP_034458.1| 30S ribosomal protein S7 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52145113|ref|YP_081717.1| 30S ribosomal protein S7 [Bacillus cereus E33L] >gi|118475875|ref|YP_893026.1| 30S ribosomal protein S7 [Bacillus thuringiensis str. Al Hakam] >gi|166227417|sp|A0R8H6|RS7_BACAH 30S ribosomal protein S7 >gi|62287217|sp|Q63H94|RS7_BACCZ 30S ribosomal protein S7 >gi|62287270|sp|Q6HPR2|RS7_BACHK 30S ribosomal protein S7 >gi|62287295|sp|Q73FA0|RS7_BACC1 30S ribosomal protein S7 >gi|62287320|sp|Q81VT4|RS7_BACAN 30S ribosomal protein S7 >gi|30253618|gb|AAP24160.1| ribosomal protein S7 [Bacillus anthracis str. Ames] >gi|42735102|gb|AAS39042.1| ribosomal protein S7 [Bacillus cereus ATCC 10987] >gi|47500510|gb|AAT29186.1| ribosomal protein S7 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177067|gb|AAT52443.1| ribosomal protein S7 [Bacillus anthracis str. Sterne] >gi|49330838|gb|AAT61484.1| ribosomal protein S7 (30S ribosomal protein S7) [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51978582|gb|AAU20132.1| ribosomal protein S7 (30S ribosomal protein S7) [Bacillus cereus E33L] >gi|118415100|gb|ABK83519.1| SSU ribosomal protein S7P [Bacillus thuringiensis str. Al Hakam] (156 aa)
Score = 449, Expect = 2.2e-43, Identities = 90/154 (58%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GKKG +Q I+Y +FD++ ++T ++ +EVF++AL+NIMP LE+R RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+   GA+ KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYNAFDIVSERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW 156
>gi|167629463|ref|YP_001679962.1| 30S ribosomal protein S7 [Heliobacterium modesticaldum Ice1] >gi|167592203|gb|ABZ83951.1| 30S ribosomal protein s7 [Heliobacterium modesticaldum Ice1] (156 aa)
Score = 448, Expect = 2.4e-43, Identities = 91/154 (59%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +RE+LPDP+YNS++VTK  N IML+GKK  A+ I+Y + D+IK+KTN++ +EV + AL+N+MP LE++ RRV G+N+QVP  V  ER+QTLGLRWL+  +R+R+ K+MI+KLA EI+DA+  TG A KKKEDTHKMAEANKAFAH R+
  S:     3 RRGSVARREVLPDPIYNSKVVTKLANQIMLDGKKSTAEAILYGALDVIKEKTNKNPMEVLEAALKNVMPLLEVKARRVGGANYQVPVEVRPERRQTLGLRWLVKYSRERSGKTMIDKLAGEIMDAANNTGGAVKKKEDTHKMAEANKAFAHYRW 156
>gi|163938114|ref|YP_001642998.1| 30S ribosomal protein S7 [Bacillus weihenstephanensis KBAB4] >gi|163860311|gb|ABY41370.1| ribosomal protein S7 [Bacillus weihenstephanensis KBAB4] (156 aa)
Score = 448, Expect = 2.4e-43, Identities = 90/154 (58%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GKKG +Q I+Y +F++++++++++ +EVF++AL+NIMP LE+R RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DAS   GAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYNAFEIVRERSDKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLAYEILDASNNAGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|15896388|ref|NP_349737.1| 30S ribosomal protein S7 [Clostridium acetobutylicum ATCC 824] >gi|17367597|sp|Q97EH3|RS7_CLOAB 30S ribosomal protein S7 >gi|15026205|gb|AAK81077.1|AE007809_3 Ribosomal protein S7 [Clostridium acetobutylicum ATCC 824] (156 aa)
Score = 448, Expect = 2.8e-43, Identities = 89/154 (57%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS++VTK IN IM +GKKG+AQ+I Y +F+ +K+KT ++ +EVF+ A+ N+MP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++ +A KR EK M  KLA E++DAS  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLPDPLYNSKVVTKLINNIMEDGKKGVAQKICYNAFEYLKEKTGKEPMEVFEAAMNNVMPLLEVKARRIGGATYQVPIEVRPERRQTLGIRWMLAAADKRGEKYMHLKLAGELLDASNNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|28377829|ref|NP_784721.1| 30S ribosomal protein S7 [Lactobacillus plantarum WCFS1] >gi|38258339|sp|Q88XY9|RS7_LACPL 30S ribosomal protein S7 >gi|28270662|emb|CAD63568.1| ribosomal protein S7 [Lactobacillus plantarum WCFS1] (156 aa)
Score = 448, Expect = 2.9e-43, Identities = 87/154 (56%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE+L DP+YNS+LVT+ IN +ML+GK+G A  I+Y +FD IK++T  D +EVF++A++N+MP LE++ RRV GSN+QVP  V  +RK TLGLRW++  AR R E +M ++LA EI+DA+  TGA+ KK+EDTH+MAEAN+AFAH R+
  S:     3 RKGAPAKREVLADPMYNSKLVTRLINHLMLDGKRGTASTILYDAFDQIKEQTGNDPLEVFEEAMKNVMPVLEVKARRVGGSNYQVPIEVRPDRKTTLGLRWIVQYARSRGEHTMSDRLAREIMDAANNTGASVKKREDTHRMAEANRAFAHYRW 156
>gi|118443371|ref|YP_877194.1| 30S ribosomal protein S7 [Clostridium novyi NT] >gi|166227440|sp|A0PXU2|RS7_CLONN 30S ribosomal protein S7 >gi|118133827|gb|ABK60871.1| ribosomal protein S7 [Clostridium novyi NT] (156 aa)
Score = 446, Expect = 4.2e-43, Identities = 85/154 (55%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YN+++V K IN+IML+GKKG+AQ+I Y +F ++ +KT ++ +EVF++A+ N+MP LE++ RR+ G+ +QVP  V  +R+QTLG+RW++ ++RKR EK M E+LA E++DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGNTPKRDVLPDPLYNNKVVAKLINSIMLDGKKGVAQKICYDAFAIMGEKTGKEPLEVFEEAMNNVMPLLEVKARRIGGATYQVPIEVRADRRQTLGIRWIVDASRKRGEKYMRERLAGELLDAANNTGAAVKKREDTHKMAEANKAFAHYRY 156
>gi|193216664|ref|YP_001999906.1| ribosomal protein S7 [Mycoplasma arthritidis 158L3-1] >gi|193001987|gb|ACF07202.1| ribosomal protein S7 [Mycoplasma arthritidis 158L3-1] (156 aa)
Score = 446, Expect = 5.4e-43, Identities = 96/154 (62%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK +   R++L DPV+NS+++TK IN IML+GKK +A+ I+Y +F +IK KTN++ IEVF  A+ENI P LE+R RRV GSN+QVP  VS +RKQTL LRWLI  AR RNEK+M EKLA EIIDAS   G A KK+EDT+KMAE+NKAFAH R+
  S:     3 RKRKTPTRDVLADPVFNSKIITKLINTIMLDGKKSVAESILYNAFAIIKNKTNKEPIEVFTVAIENISPQLEVRSRRVGGSNYQVPCEVSAKRKQTLALRWLIQYARLRNEKTMEEKLAGEIIDASNKMGGAIKKREDTYKMAESNKAFAHFRW 156
>gi|168187818|ref|ZP_02622453.1| ribosomal protein S7 [Clostridium botulinum C str. Eklund] >gi|169294351|gb|EDS76484.1| ribosomal protein S7 [Clostridium botulinum C str. Eklund] (156 aa)
Score = 445, Expect = 5.8e-43, Identities = 85/154 (55%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YN+++V K IN+IML+GKKG+AQ+I Y +F ++ +K+ ++ +EVF++A+ N+MP LE++ RR+ G+ +QVP  V  ER+QTLG+RW++ ++RKR EK M E+LA E++DAS  TG+A KK+EDTHKMAEANKAFAH R+
  S:     3 RKGNTPKRDVLPDPLYNNKVVAKLINSIMLDGKKGVAQKICYDAFAIMGEKSGKEPLEVFEEAMNNVMPLLEVKARRIGGATYQVPIEVRAERRQTLGIRWIVDASRKRGEKYMRERLAGELLDASNNTGSAVKKREDTHKMAEANKAFAHYRY 156
>gi|149001612|ref|ZP_01826585.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP14-BS69] >gi|147760070|gb|EDK67059.1| 30S ribosomal protein S7 [Streptococcus pneumoniae SP14-BS69] (144 aa)
Score = 445, Expect = 6.1e-43, Identities = 87/144 (60%), Positives = 113/144 (78%)
  Q:    12 LPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           +PDP+YNS+LVT+ IN +ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR R E +M ++LA EI+DA+  TGAA KK+EDTH+MAEAN+AFAH R+
  S:     1 MPDPLYNSQLVTRLINRVMLDGKRGTAASIVYGAFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW 144
>gi|89100354|ref|ZP_01173219.1| 30S ribosomal protein S7 [Bacillus sp. NRRL B-14911] >gi|89084975|gb|EAR64111.1| 30S ribosomal protein S7 [Bacillus sp. NRRL B-14911] (156 aa)
Score = 443, Expect = 1.0e-42, Identities = 86/154 (55%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LV++ IN +M++GK+G +Q I+Y +FD+I +++ ++ +EVF +AL+NIMP LE+R RRV G+N+QVP  V  +R+ TLGLRWL+  +R R EK+M E+LA EI+DA+  TG++ KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVAKRDVLPDPIYNSKLVSRLINKMMVDGKRGKSQAILYSAFDIISERSGKEPMEVFDQALKNIMPVLEVRARRVGGANYQVPVEVRPDRRTTLGLRWLVNYSRLRGEKTMEERLANEILDAANNTGSSVKKREDTHKMAEANKAFAHYRW 156
>gi|162447056|ref|YP_001620188.1| small subunit ribosomal protein S7 [Acholeplasma laidlawii PG-8A] >gi|189045596|sp|A9NEN2|RS7_ACHLI 30S ribosomal protein S7 >gi|161985163|gb|ABX80812.1| small subunit ribosomal protein S7 [Acholeplasma laidlawii PG-8A] (156 aa)
Score = 443, Expect = 1.2e-42, Identities = 90/154 (58%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+L+T+ +N IM +GKKG AQ I+Y + + IK +T  + I+VF +AL NI P LE+R RR+ G N+QVP  V  ER+Q L LRWL+  A+KRNEK+M E+LA EI+DAS+GTGAA KK+E+ HKMAEANKAFAH R+
  S:     3 RKGHIVKRDVLPDPIYNSKLITRIVNTIMEDGKKGTAQGILYGALNRIKDQTGREAIDVFNEALNNISPILEVRARRIGGQNYQVPVEVRPERRQALALRWLVQYAKKRNEKTMEERLAKEILDASQGTGAAVKKREEVHKMAEANKAFAHYRW 156
>gi|188584832|ref|YP_001916377.1| SSU ribosomal protein S7P [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349519|gb|ACB83789.1| SSU ribosomal protein S7P [Natranaerobius thermophilus JW/NM-WN-LF] (156 aa)
Score = 442, Expect = 1.3e-42, Identities = 87/154 (56%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR++ PDP+YNS++VTK IN +ML+GKKGL+Q+I Y++ +L+ ++TNE+ +EVF+ A++N+MP LE++ RRV G+ +QVP  V   RKQ L +RW++  AR+R E++M E+LA E+IDA   TG A KKKEDTHKMAEANKAFAH R+
  S:     3 RKGPAPKRDVNPDPIYNSKMVTKFINKLMLDGKKGLSQRIFYKALELVGERTNEEPLEVFETAVKNVMPVLEVKARRVGGATYQVPVEVEPNRKQVLAIRWIVNYARERGERAMSERLAGELIDAYNNTGGAIKKKEDTHKMAEANKAFAHYRW 156
>gi|47459203|ref|YP_016065.1| 30S ribosomal protein S7 [Mycoplasma mobile 163K] >gi|62287277|sp|Q6KHS4|RS7_MYCMO 30S ribosomal protein S7 >gi|47458532|gb|AAT27854.1| 30S ribosomal protein s7 [Mycoplasma mobile 163K] (156 aa)
Score = 441, Expect = 1.7e-42, Identities = 92/154 (59%), Positives = 125/154 (81%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ +A  R++L DP++NS+ +TK IN IML+GKK +A++I+YQ+F++IK KTN+D +EVF+ AL+NI P LE++ RRV G+N+QVP  V+K RK+TL LRWLI  +R R+EK+M E LA EIIDAS  TG++ KK+EDTHKMAEANKAFAH R+
  S:     3 RRKKAPIRQVLSDPIFNSKTITKLINTIMLDGKKSIAERILYQAFEIIKTKTNKDPMEVFQLALDNITPQLEVKTRRVGGTNYQVPMEVTKRRKETLSLRWLIHYSRLRSEKTMQECLANEIIDASNKTGSSIKKREDTHKMAEANKAFAHFRW 156
>gi|116628960|ref|YP_814132.1| 30S ribosomal protein S7 [Lactobacillus gasseri ATCC 33323] >gi|122274042|sp|Q046C8|RS7_LACGA 30S ribosomal protein S7 >gi|116094542|gb|ABJ59694.1| SSU ribosomal protein S7P [Lactobacillus gasseri ATCC 33323] (156 aa)
Score = 441, Expect = 2.0e-42, Identities = 86/154 (55%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DPVYNS+LVTK IN +M++GKK  A  I+Y +F +I+ KT ++ +EVF++A+ N+MP LE++ RR+ GSN+Q+P  V  ER+ TLGLRWL+  AR RNE +M E+LA EI+DA+  TG+A KK+ED H+MAEAN+AFAH RF
  S:     3 RKGNVAKRDVLADPVYNSKLVTKLINHLMIDGKKAKASSILYDAFGIIQDKTGKEPVEVFEEAMNNVMPVLEVKARRIGGSNYQIPVEVRPERRTTLGLRWLVSYARLRNEHTMDERLANEIMDAANNTGSAVKKREDVHRMAEANRAFAHYRF 156
>gi|114567845|ref|YP_754999.1| 30S ribosomal protein S7 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122317281|sp|Q0AUH6|RS7_SYNWW 30S ribosomal protein S7 >gi|114338780|gb|ABI69628.1| SSU ribosomal protein S7P [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (156 aa)
Score = 440, Expect = 2.5e-42, Identities = 86/154 (55%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS++ TK +N +M +GKK LA++I Y +F +++ KT  + +EVF++A++NI P +E+R RRV G+N+QVP  V  +R+QTL +RWL+  ARKR EK+M E+LA EI+DA+  TGAA KK+EDTHKMAEANKAFAH R+
  S:     3 RKGPVPKRDVLPDPIYNSKIFTKLVNQLMWDGKKSLAEKICYGAFAIVQSKTRREPLEVFEEAMKNITPIVEVRARRVGGANYQVPVEVRSDRRQTLAIRWLVGYARKRGEKTMAERLAGEIMDAANHTGAAVKKREDTHKMAEANKAFAHYRW 156
>gi|54020329|ref|YP_115598.1| 30S ribosomal protein S7 [Mycoplasma hyopneumoniae 232] >gi|71893431|ref|YP_278877.1| 30S ribosomal protein S7 [Mycoplasma hyopneumoniae J] >gi|72080418|ref|YP_287476.1| 30S ribosomal protein S7 [Mycoplasma hyopneumoniae 7448] >gi|62287214|sp|Q601W7|RS7_MYCH2 30S ribosomal protein S7 >gi|115305709|sp|Q4A8T6|RS7_MYCH7 30S ribosomal protein S7 >gi|115305710|sp|Q4AAQ5|RS7_MYCHJ 30S ribosomal protein S7 >gi|53987502|gb|AAV27703.1| 30s ribosomal protein S7 [Mycoplasma hyopneumoniae 232] >gi|71851558|gb|AAZ44166.1| 30S ribosomal protein S7 [Mycoplasma hyopneumoniae J] >gi|71913542|gb|AAZ53453.1| 30S ribosomal protein S7 [Mycoplasma hyopneumoniae 7448] (156 aa)
Score = 440, Expect = 2.6e-42, Identities = 94/154 (61%), Positives = 122/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK +A  R +L DPV+NS+L+TKAIN  MLEGKK  AQ I+Y +F L+++K  +D +EVF++A++N+ P  E+R RR+ G+N+QVP  V ++R+QTL LRWLIL ARKRNEK+MI KLA EIIDA   TG AFKKKEDTHKMAEAN+AFAH ++
  S:     3 RKKQAPVRNVLADPVFNSKLITKAINCTMLEGKKTTAQNILYSAFKLVEEKLQKDALEVFRQAVKNVTPLTEVRSRRIGGTNYQVPMEVRQKRQQTLALRWLILFARKRNEKTMIVKLANEIIDAYNKTGGAFKKKEDTHKMAEANRAFAHFKW 156
>gi|42518426|ref|NP_964356.1| 30S ribosomal protein S7 [Lactobacillus johnsonii NCC 533] >gi|62287300|sp|Q74L91|RS7_LACJO 30S ribosomal protein S7 >gi|41582711|gb|AAS08322.1| 30S ribosomal protein S7 [Lactobacillus johnsonii NCC 533] (156 aa)
Score = 440, Expect = 2.7e-42, Identities = 86/154 (55%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DPVYNS+LVTK IN +M++GKK  A  I+Y +F +I+ KT ++ +EVF++A+ N+MP LE++ RR+ GSN+Q+P  V  ER+ TLGLRWL+  AR RNE +M E+LA EI+DA+  TG+A KK+ED H+MAEAN+AFAH RF
  S:     3 RKGNIAKRDVLADPVYNSKLVTKLINHLMIDGKKAKASSILYDAFGIIQDKTGKEPVEVFEEAMNNVMPVLEVKARRIGGSNYQIPVEVRPERRTTLGLRWLVSYARLRNEHTMDERLANEIMDAANNTGSAVKKREDVHRMAEANRAFAHYRF 156
>gi|160894093|ref|ZP_02074871.1| hypothetical protein CLOL250_01647 [Clostridium sp. L2-50] >gi|156864126|gb|EDO57557.1| hypothetical protein CLOL250_01647 [Clostridium sp. L2-50] (170 aa)
Score = 439, Expect = 3.2e-42, Identities = 89/154 (57%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK IN +ML+GKKG+AQ+IVY +FD I  +T +D IEVF++A+ NIMP LE++ RR+ G+ +QVP  V  +R+Q LGLRWL   +R R+EK+M E+LA EI+DA+  TGA+ K+KED HKMAEANKAFAH RF
  S:    17 RKGHIAKRDVLADPIYNNKVVTKLINNVMLDGKKGVAQKIVYGAFDRIATETGKDAIEVFEEAMNNIMPLLEVKARRIGGATYQVPIDVRPDRRQALGLRWLTTFSRARSEKTMEERLAREIMDAANNTGASVKRKEDMHKMAEANKAFAHYRF 170
>gi|85057738|ref|YP_456654.1| 30S ribosomal protein S7 [Aster yellows witches'-broom phytoplasma AYWB] >gi|109894824|sp|Q2NJ18|RS7_AYWBP 30S ribosomal protein S7 >gi|84789843|gb|ABC65575.1| SSU ribosomal protein S7P [Aster yellows witches'-broom phytoplasma AYWB] (156 aa)
Score = 439, Expect = 3.4e-42, Identities = 92/154 (59%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++ PDP+YNS+LVTK IN IM +GKKG AQ I YQ+   +K  TN D IEVF +AL NIMP LE+R RRV G N+QVP+ V  ER+ +LGLRWL+   ++RNEK+M E+LA EI+DAS G G + KK+E+TH+MAEANKAFAH R+
  S:     3 RKGHIKKRDVQPDPIYNSKLVTKTINTIMEDGKKGKAQTIFYQALKQVKTITNRDPIEVFHEALNNIMPVLEVRTRRVGGQNYQVPSEVRPERRHSLGLRWLVKYTKERNEKTMEERLAKEIVDASLGNGVSVKKREETHRMAEANKAFAHYRW 156
>gi|147676651|ref|YP_001210866.1| 30S ribosomal protein S7 [Pelotomaculum thermopropionicum SI] >gi|189045619|sp|A5D5I6|RS7_PELTS 30S ribosomal protein S7 >gi|146272748|dbj|BAF58497.1| ribosomal protein S7 [Pelotomaculum thermopropionicum SI] (156 aa)
Score = 438, Expect = 3.7e-42, Identities = 92/154 (59%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+LPDPVY S+++TK IN +ML+GKK LA+ IVY + D+IK+KT ++ +EVF+ A++N+MP LE++ RRV G+N+QVP  V  +R+QTL +RWL   AR+R  KSM EKLA EI+DA+ GTG A KKKEDTHKMAEANKAFAH R+
  S:     3 RRGAVPKREVLPDPVYQSKVLTKLINQVMLKGKKSLAESIVYGAMDIIKEKTGKNPLEVFETAMKNVMPVLEVKARRVGGANYQVPVEVRHDRRQTLAIRWLTNYARERAGKSMKEKLANEIMDAAAGTGGAVKKKEDTHKMAEANKAFAHYRW 156
>gi|187605180|ref|ZP_02991381.1| ribosomal protein S7 [Exiguobacterium sp. AT1b] >gi|187482749|gb|EDU20752.1| ribosomal protein S7 [Exiguobacterium sp. AT1b] (155 aa)
Score = 438, Expect = 3.8e-42, Identities = 88/155 (56%), Positives = 125/155 (80%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKNRA +R+++ DP+YNS+LVT+ IN +ML+GKKG AQ I+Y +F +I +++ ++ +EVF++A+ NIMP LE++ RRV G+N+QVP  V  ER+ TLGLR+L+  AR RNEK+M +++A EI+DA+  TGA+ KK+ED HKMAEANKAFAH R+
  S:     1 MRKNRAERRDVIADPIYNSKLVTRLINRVMLDGKKGTAQTIIYNAFGIIAERSGKEPMEVFEEAMNNIMPVLEVKARRVGGANYQVPVEVRPERRTTLGLRYLVNYARLRNEKTMEQRIANEIMDAANNTGASVKKREDMHKMAEANKAFAHYRW 155
>gi|167748166|ref|ZP_02420293.1| hypothetical protein ANACAC_02910 [Anaerostipes caccae DSM 14662] >gi|167652158|gb|EDR96287.1| hypothetical protein ANACAC_02910 [Anaerostipes caccae DSM 14662] (175 aa)
Score = 437, Expect = 4.8e-42, Identities = 90/154 (58%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK IN IML+GKKG+AQ+IVY +F+ I++K  +  +EVF++A+ NIMP LE++ RR+ G+ +QVP  V  +R+Q L LRWL L +RKR EK+M E+LA EI DAS  TGA+ KKKED HKMAEANKAFAH RF
  S:    22 RKGHIAKRDVLADPIYNNKVVTKLINNIMLDGKKGVAQKIVYGAFNRIEEKAGKPALEVFEEAMNNIMPVLEVKARRIGGATYQVPIDVRPDRRQALALRWLTLYSRKRGEKTMEERLANEIFDASNNTGASVKKKEDMHKMAEANKAFAHYRF 175
>gi|16801865|ref|NP_472133.1| 30S ribosomal protein S7 [Listeria innocua Clip11262] >gi|16804692|ref|NP_466177.1| 30S ribosomal protein S7 [Listeria monocytogenes EGD-e] >gi|46908833|ref|YP_015222.1| 30S ribosomal protein S7 [Listeria monocytogenes str. 4b F2365] >gi|47092276|ref|ZP_00230067.1| ribosomal protein S7 [Listeria monocytogenes str. 4b H7858] >gi|47095458|ref|ZP_00233067.1| ribosomal protein S7 [Listeria monocytogenes str. 1/2a F6854] >gi|116874020|ref|YP_850801.1| 30S ribosomal protein S7 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153168818|ref|ZP_01928579.1| ribosomal protein S7 [Listeria monocytogenes FSL N1-017] >gi|153175962|ref|ZP_01931221.1| ribosomal protein S7 [Listeria monocytogenes FSL N3-165] >gi|153180819|ref|ZP_01933815.1| ribosomal protein S7 [Listeria monocytogenes F6900] >gi|153185586|ref|ZP_01936136.1| ribosomal protein S7 [Listeria monocytogenes J0161] >gi|153192413|ref|ZP_01939405.1| ribosomal protein S7 [Listeria monocytogenes J2818] >gi|153197684|ref|ZP_01941911.1| ribosomal protein S7 [Listeria monocytogenes 10403S] >gi|153204303|ref|ZP_01945100.1| ribosomal protein S7 [Listeria monocytogenes HPB2262] >gi|167015747|ref|ZP_02278280.1| 30S ribosomal protein S7 [Listeria monocytogenes FSL J1-194] >gi|167058725|ref|ZP_02280982.1| 30S ribosomal protein S7 [Listeria monocytogenes FSL F2-515] >gi|167215316|ref|ZP_02285623.1| 30S ribosomal protein S7 [Listeria monocytogenes FSL R2-503] >gi|167218442|ref|ZP_02288078.1| 30S ribosomal protein S7 [Listeria monocytogenes FSL J1-175] >gi|167405457|ref|ZP_02310213.1| 30S ribosomal protein S7 [Listeria monocytogenes FSL J2-003] >gi|168266866|ref|ZP_02688831.1| 30S ribosomal protein S7 [Listeria monocytogenes FSL J2-071] >gi|123466658|sp|A0ALZ0|RS7_LISW6 30S ribosomal protein S7 >gi|54039542|sp|P66612|RS7_LISIN 30S ribosomal protein S7 >gi|54041983|sp|P66611|RS7_LISMO 30S ribosomal protein S7 >gi|62287292|sp|Q71WB7|RS7_LISMF 30S ribosomal protein S7 >gi|16412155|emb|CAD00868.1| ribosomal protein S7 [Listeria monocytogenes] >gi|16415340|emb|CAC98030.1| ribosomal protein S7 [Listeria innocua] >gi|46882106|gb|AAT05399.1| ribosomal protein S7 [Listeria monocytogenes str. 4b F2365] >gi|47016068|gb|EAL06992.1| ribosomal protein S7 [Listeria monocytogenes str. 1/2a F6854] >gi|47019255|gb|EAL09997.1| ribosomal protein S7 [Listeria monocytogenes str. 4b H7858] >gi|116742898|emb|CAK22022.1| rpsG [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126941722|gb|EBA19601.1| ribosomal protein S7 [Listeria monocytogenes J0161] >gi|127632857|gb|EBA22291.1| ribosomal protein S7 [Listeria monocytogenes 10403S] >gi|127763917|gb|EBA24735.1| ribosomal protein S7 [Listeria monocytogenes J2818] >gi|133726052|gb|EBA27750.1| ribosomal protein S7 [Listeria monocytogenes FSL N1-017] >gi|133728675|gb|EBA30373.1| ribosomal protein S7 [Listeria monocytogenes FSL N3-165] >gi|133731766|gb|EBA33464.1| ribosomal protein S7 [Listeria monocytogenes F6900] >gi|133734083|gb|EBA35781.1| ribosomal protein S7 [Listeria monocytogenes HPB2262] (156 aa)
Score = 436, Expect = 6.0e-42, Identities = 85/154 (55%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+YNS+LVT+ IN +M++GK+G +Q I+Y +FD+I ++T +D +EVF++A++NIMP LE++ RRV G+N+QVP  V  +R+ TLGLRWL+  AR R EK+M  ++A EI+DA+  TGA+ KK+EDTHKMA+AN+AFAH R+
  S:     3 RKGPVAKRDVLPDPIYNSKLVTRLINKMMVDGKRGKSQAILYSAFDIIAQETGKDPMEVFEQAMKNIMPLLEVKARRVGGANYQVPIEVRADRRSTLGLRWLVNYARLRGEKTMEVRVAREIMDAANNTGASVKKREDTHKMADANRAFAHYRW 156
>gi|168333598|ref|ZP_02691863.1| 30S ribosomal protein S7 [Epulopiscium sp. 'N.t. morphotype B'] (156 aa)
Score = 435, Expect = 8.1e-42, Identities = 96/154 (62%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DPVYNS+LVTK IN +ML+GK+G AQ+IVY +FD++K KT  D IEVF++ALENIMP LE++ RRV G+ +QVP  V  ER+QTLGLRWLI   RKR E++  + LAAE++DA    G A KKKEDTHKMAEANKAFAH R+
  S:     3 RKGHIAKRDVLADPVYNSKLVTKLINTLMLDGKRGTAQKIVYGAFDIVKDKTGRDSIEVFEEALENIMPVLEVKARRVGGATYQVPMEVRPERRQTLGLRWLITYMRKRGERTSTQALAAELLDALNNGGGAVKKKEDTHKMAEANKAFAHYRW 156
>gi|166031394|ref|ZP_02234223.1| hypothetical protein DORFOR_01083 [Dorea formicigenerans ATCC 27755] >gi|166028799|gb|EDR47556.1| hypothetical protein DORFOR_01083 [Dorea formicigenerans ATCC 27755] (163 aa)
Score = 434, Expect = 1.0e-41, Identities = 91/154 (59%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YNS++VTK IN IML+GKKG+AQ+IVY +F+ I  K+ +  IEVF++A+ NIMP LE++ RR+ G+N+QVP  V  +R+QTL LRWL   +R+R EK+M E+LA EI+DA+  TGA+ KKKED HKMAEANKAFAH RF
  S:    10 RKGHTQKRDVLADPMYNSKVVTKLINNIMLDGKKGVAQKIVYGAFERIADKSEKPAIEVFEEAMNNIMPVLEVKARRIGGANYQVPIEVRADRRQTLALRWLTTYSRQRGEKTMEERLANEILDAANNTGASVKKKEDMHKMAEANKAFAHYRF 163
>gi|153852624|ref|ZP_01994061.1| hypothetical protein DORLON_00034 [Dorea longicatena DSM 13814] >gi|149754266|gb|EDM64197.1| hypothetical protein DORLON_00034 [Dorea longicatena DSM 13814] (163 aa)
Score = 434, Expect = 1.2e-41, Identities = 90/154 (58%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DPVYN+++VTK +N IML+GKKG+AQ+IVY +F+ ++ K  +  IEVF++A+ NIMP LE++ RR+ G+N+QVP  V  ER+QTL LRWL + +R R EK+M E+LA EI+DA+  TGA+ KKKED HKMAEANKAFAH RF
  S:    10 RKGHTQKRDVLADPVYNNKVVTKLVNNIMLDGKKGVAQKIVYGAFERVEAKAEKPAIEVFEEAMNNIMPVLEVKARRIGGANYQVPIEVRPERRQTLALRWLTVYSRARGEKTMEERLANEILDAANNTGASVKKKEDMHKMAEANKAFAHYRF 163
>gi|160878394|ref|YP_001557362.1| 30S ribosomal protein S7 [Clostridium phytofermentans ISDg] >gi|189045606|sp|A9KRZ2|RS7_CLOPH 30S ribosomal protein S7 >gi|160427060|gb|ABX40623.1| ribosomal protein S7 [Clostridium phytofermentans ISDg] (156 aa)
Score = 433, Expect = 1.5e-41, Identities = 84/154 (54%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN++ VTK IN IML+GKKG AQ+IVY +F+ + +K+ +D  EVF++A+ N+MP LE++ RR+ G+ +QVP  V  +R+Q LGLRWL + +RKR EK+M+++LA EI+DA+  TG+A K+KED HKMA+ANKAFAH R+
  S:     3 RKGHIQKRDVLADPIYNNKTVTKLINNIMLDGKKGTAQKIVYGAFEKVAEKSGKDATEVFEEAMNNVMPVLEVKARRIGGATYQVPIEVRPDRRQALGLRWLTMFSRKRGEKTMVDRLAGEILDAAANTGSAVKRKEDMHKMADANKAFAHYRW 156
>gi|23097570|ref|NP_691036.1| 30S ribosomal protein S7 [Oceanobacillus iheyensis HTE831] >gi|62287337|sp|Q8ETY6|RS7_OCEIH 30S ribosomal protein S7 >gi|22775793|dbj|BAC12071.1| 30S ribosomal protein S7 [Oceanobacillus iheyensis HTE831] (156 aa)
Score = 433, Expect = 1.6e-41, Identities = 86/154 (55%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPDP+Y S+LVT+ IN IM++GK+G AQ+I+Y +F+L+ +++ ++ +EVF++A++N+MP LE+R RRV GSN+QVP  V  ER+Q LGLR+++  +R R EK+M E+LA EI+DAS  TGAA K++ED HKMAEANKAFAH R+
  S:     3 RKGPVPKRDVLPDPLYKSKLVTRLINQIMVDGKRGKAQKILYNAFELVAERSGQNAMEVFEQAMKNVMPVLEVRARRVGGSNYQVPVEVRPERRQALGLRYIVNYSRLRGEKTMEERLANEILDASNNTGAAVKRREDMHKMAEANKAFAHYRW 156
>gi|163813879|ref|ZP_02205273.1| hypothetical protein COPEUT_00032 [Coprococcus eutactus ATCC 27759] >gi|158450749|gb|EDP27744.1| hypothetical protein COPEUT_00032 [Coprococcus eutactus ATCC 27759] (156 aa)
Score = 433, Expect = 1.6e-41, Identities = 88/154 (57%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK IN IML+GKKG+AQ+IVY +FD I ++T +  +EVF++A+ NIMP LE++ RR+ G+ +QVP  V  +R+Q LGLRWL   +R R+EK+M E+LA EI+DA+  TGA+ K+KED HKMAEANKAFAH RF
  S:     3 RKGHIAKRDVLADPIYNNKVVTKLINNIMLDGKKGVAQKIVYGAFDRIAEETGKPALEVFEEAMNNIMPLLEVKARRIGGATYQVPIDVRPDRRQALGLRWLTAFSRARSEKTMEERLAKEIMDAANNTGASVKRKEDMHKMAEANKAFAHYRF 156
>gi|160937575|ref|ZP_02084936.1| hypothetical protein CLOBOL_02466 [Clostridium bolteae ATCC BAA-613] >gi|158439644|gb|EDP17394.1| hypothetical protein CLOBOL_02466 [Clostridium bolteae ATCC BAA-613] (156 aa)
Score = 432, Expect = 1.8e-41, Identities = 87/154 (56%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK IN IML+GKKG+AQ+IVY +FD + + T +D +EVF++A+ NIMP LE++ +R+ G+ +QVP  V  ER+QTL LRW+ L +RKR EK+  ++LA EI+DA+  TGA+ KKKED HKMAEANKAF+H RF
  S:     3 RKGHTQKRDVLADPIYNNKVVTKLINNIMLDGKKGVAQKIVYGAFDRVAETTGKDAMEVFEEAMNNIMPVLEVKAKRIGGATYQVPIEVRPERRQTLALRWITLYSRKRGEKTQKDRLANEIMDAANNTGASVKKKEDMHKMAEANKAFSHFRF 156
>gi|146295990|ref|YP_001179761.1| 30S ribosomal protein S7 [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166227428|sp|A4XI35|RS7_CALS8 30S ribosomal protein S7 >gi|145409566|gb|ABP66570.1| SSU ribosomal protein S7P [Caldicellulosiruptor saccharolyticus DSM 8903] (157 aa)
Score = 432, Expect = 2.1e-41, Identities = 89/154 (57%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEK-SMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KREILPDPVYN ++V K IN +M +GKK +AQ+IVY +FD++++KT +D +EV + AL N+MP LE+R RRV G+ +Q+P  VS +R+ +LG+RWL+  AR+R +K +M EKLAAEI+DA+  TG A KKKEDTH+MAEAN+AFAH R+
  S:     3 RKGPVKKREILPDPVYNDKVVAKLINKVMYDGKKSIAQKIVYGAFDIVREKTGKDPLEVLEAALNNVMPVLEVRPRRVGGATYQIPIEVSPDRRLSLGIRWLVEYARERKDKRTMKEKLAAEIMDAANNTGGAVKKKEDTHRMAEANRAFAHYRW 157
>gi|65317562|ref|ZP_00390521.1| COG0049: Ribosomal protein S7 [Bacillus anthracis str. A2012] (145 aa)
Score = 431, Expect = 2.4e-41, Identities = 86/145 (59%), Positives = 118/145 (81%)
  Q:    11 ILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           +LPDP+YNS+LVT+ IN +M++GKKG +Q I+Y +FD++ ++T ++ +EVF++AL+NIMP LE+R RRV G+N+QVP  V  ER+ TLGLRWL+  AR R EK+M E+LA EI+DA+   GA+ KK+EDTHKMAEANKAFAH R+
  S:     1 MLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYNAFDIVSERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW 145
>gi|149195225|ref|ZP_01872315.1| 30S ribosomal protein S7 [Caminibacter mediatlanticus TB-2] >gi|149134658|gb|EDM23144.1| 30S ribosomal protein S7 [Caminibacter mediatlanticus TB-2] (155 aa)
Score = 431, Expect = 2.4e-41, Identities = 88/155 (56%), Positives = 121/155 (78%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ RA KR ++PDPVYNS +VTK IN +M +GKK LA++IVY + + + +K  E GI++F KA+EN+ P LE+R RRV G+ +QVP  V  ER+QTL +RW++ +AR RNE++M+E+LA E+ DA+   GAAFKK+EDTH+MAEANKAFAH R+
  S:     1 MRRRRAPKRPVMPDPVYNSEVVTKFINKVMWDGKKTLAERIVYGAIEKLNEKGEEKGIDIFFKAIENVKPLLEVRSRRVGGATYQVPMEVRPERQQTLSIRWIVDAARNRNERTMVERLANELWDAANERGAAFKKREDTHRMAEANKAFAHYRW 155
>gi|157831399|pdb|1HUS|A Chain A, Ribosomal Protein S7 (155 aa)
Score = 430, Expect = 3.3e-41, Identities = 88/154 (57%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP+YNS+LVT+ IN I ++GKK  AQ+I+Y +FD+I+++T +D  EVF++AL+N+ P LE+R RRV G+N+QVP  V  +R+ +LGLRWL+  AR RNEK+  E+LA EI DA+  TGAA KK+EDTHK AEANKAFAH R+
  S:     2 RRGPVAKRDVLPDPIYNSKLVTRLINKIXIDGKKSKAQKILYTAFDIIRERTGKDPXEVFEQALKNVXPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWLVQYARLRNEKTXEERLANEIXDAANNTGAAVKKREDTHKXAEANKAFAHYRW 155
>gi|77918311|ref|YP_356126.1| 30S ribosomal protein S7 [Pelobacter carbinolicus DSM 2380] >gi|90120523|sp|Q3A6Q1|RS7_PELCD 30S ribosomal protein S7 >gi|77544394|gb|ABA87956.1| SSU ribosomal protein S7P [Pelobacter carbinolicus DSM 2380] (156 aa)
Score = 429, Expect = 4.0e-41, Identities = 90/154 (58%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP YN R V K INAIML GKK  A+ IVY +FDLI +++ E+ ++VFKKA+ENI P LE++ RRV GS +QVP  V  +R+  L +RWLIL AR R EK+M+E+LA E++DA+   GAA KK+EDTH+MAEANKAFAH R+
  S:     3 RRREVAKRVILPDPKYNDRTVAKFINAIMLMGKKSTAEGIVYGAFDLIAERSGEEALDVFKKAVENIRPMLEVKSRRVGGSTYQVPVEVRADRRNALAIRWLILYARGRGEKTMVERLAGELLDAAANRGAAVKKREDTHRMAEANKAFAHYRW 156
>gi|104773539|ref|YP_618519.1| 30S ribosomal protein S7 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513536|ref|YP_812442.1| 30S ribosomal protein S7 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275694|sp|Q04C18|RS7_LACDB 30S ribosomal protein S7 >gi|123077336|sp|Q1GBM1|RS7_LACDA 30S ribosomal protein S7 >gi|103422620|emb|CAI97228.1| 30S ribosomal protein S7 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116092851|gb|ABJ58004.1| SSU ribosomal protein S7P [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (156 aa)
Score = 429, Expect = 4.8e-41, Identities = 85/154 (55%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK   +KR++L DPVYNS+LVTK IN +M +GK+  A  I+Y +FD+IK KT  + ++VF++A+ N+ P LE++ RR+ GSN+QVP  V  ER+ TL LRWL+  +R RNE +M E+LA E+IDAS  TG+A KK+ED H+MAEAN+AFAH RF
  S:     3 RKGHVSKRDVLADPVYNSKLVTKLINHLMKDGKRAQASSILYDAFDIIKDKTGREPMDVFEEAMNNVKPVLEVKARRIGGSNYQVPVEVRPERQTTLALRWLVSYSRLRNEHTMDERLANELIDASNNTGSAVKKREDVHRMAEANRAFAHYRF 156
>gi|169830042|ref|YP_001700200.1| 30S ribosomal protein S7 [Lysinibacillus sphaericus C3-41] >gi|168994530|gb|ACA42070.1| 30S ribosomal protein S7 [Lysinibacillus sphaericus C3-41] (145 aa)
Score = 428, Expect = 5.6e-41, Identities = 85/145 (58%), Positives = 118/145 (81%)
  Q:    11 ILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           +LPDP+Y+S+LVT+ IN +M++GK+G +Q+I+Y +F+++K+++ E+ IEVF+ AL N+MP LE+R RRV GSN+QVP  V  ER+ TLGLR+L+  AR R EK+M E+LA EI+DAS  TGA+ KK+ED HKMAEANKAFAH R+
  S:     1 MLPDPIYSSKLVTRLINKMMVDGKRGTSQKILYGAFEIVKERSGENPIEVFEAALNNVMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRYLVNYARLRGEKTMEERLANEILDASNNTGASVKKREDMHKMAEANKAFAHYRW 145
>gi|167758489|ref|ZP_02430616.1| hypothetical protein CLOSCI_00829 [Clostridium scindens ATCC 35704] >gi|167663685|gb|EDS07815.1| hypothetical protein CLOSCI_00829 [Clostridium scindens ATCC 35704] (163 aa)
Score = 428, Expect = 6.2e-41, Identities = 88/154 (57%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK +N IML+GKKG+AQ+IVY +FD +  K+++  IEVF++A+ NIMP LE++ RR+ G+ +QVP  V  +R+Q L LRWL   +RKR EK+M E+LA EI+DA+  TGA+ KKKED HKMAEANKAFAH RF
  S:    10 RKGHTQKRDVLADPLYNNKVVTKLVNNIMLDGKKGVAQKIVYGAFDRVAAKSDKPAIEVFEEAMNNIMPVLEVKARRIGGATYQVPIEVRADRRQALALRWLTSYSRKRGEKTMEERLANEILDAANNTGASVKKKEDMHKMAEANKAFAHYRF 163
>gi|149279671|ref|ZP_01885800.1| 30S ribosomal protein S7 [Pedobacter sp. BAL39] >gi|149229707|gb|EDM35097.1| 30S ribosomal protein S7 [Pedobacter sp. BAL39] (155 aa)
Score = 426, Expect = 1.0e-40, Identities = 91/155 (58%), Positives = 119/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK++  KR ILPDP +N   VT+ +N +M +GKK +A  I Y + +L +KK  E+G+EV+K+AL N+MP++E++ RRV G+NFQVPT V  +RK  LG++WLI  ARKR EK+M EKLA EI+ A+KG GAA KKKEDTHKMAEANKAF+H RF
  S:     1 MRKSKPKKRIILPDPKFNDVQVTRFVNNMMYDGKKSIAYDIFYDAVELAEKKAGENGLEVWKRALTNVMPAVEVKSRRVGGANFQVPTEVRPDRKIALGMKWLISYARKRGEKTMKEKLAGEIVSAAKGEGAAVKKKEDTHKMAEANKAFSHFRF 155
>gi|126646985|ref|ZP_01719495.1| 30S ribosomal protein S7 [Algoriphagus sp. PR1] >gi|126577033|gb|EAZ81281.1| 30S ribosomal protein S7 [Algoriphagus sp. PR1] (155 aa)
Score = 425, Expect = 1.2e-40, Identities = 86/155 (55%), Positives = 119/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR ILPDP +N  LVTK +N +M++GKK +A +I Y + + +++K  E+G+EV+KKAL NI PS+E++ RRV G+ FQVP  V  ERK +LG++W+I  AR+R EK+M+++LA EII  +KG GAA KKK+DTH+MAEANKAF+H RF
  S:     1 MRKAKPKKRYILPDPKFNDTLVTKFVNCLMVDGKKSIAYRIFYDAVEKVEEKVGENGLEVWKKALNNIAPSVEVKSRRVGGATFQVPMEVRPERKMSLGIKWMITYARRRGEKTMMDRLAGEIIAGAKGEGAAVKKKDDTHRMAEANKAFSHFRF 155
>gi|117924151|ref|YP_864768.1| 30S ribosomal protein S7 [Magnetococcus sp. MC-1] >gi|166227457|sp|A0L5W9|RS7_MAGSM 30S ribosomal protein S7 >gi|117607907|gb|ABK43362.1| SSU ribosomal protein S7P [Magnetococcus sp. MC-1] (156 aa)
Score = 424, Expect = 1.9e-40, Identities = 85/154 (55%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE++PD  YN +LV K +N +M++GKK LA+++ Y +FDLI+++T ED I+VFK+A++N+ P+LE+R RRV G+N+QVP  V   R+QTL +RWLI  AR R EK+M E+LAAE+I+AS+G GA  KK++DTH+MAEANK FAH R+
  S:     3 RRREVPKREVIPDARYNDKLVAKFMNCLMVDGKKSLAERVFYGAFDLIEQRTKEDPIKVFKEAVDNVRPTLEVRSRRVGGANYQVPVEVRPVRRQTLAIRWLIGYARSRGEKTMRERLAAELIEASQGRGATIKKRDDTHRMAEANKVFAHYRW 156
>gi|110639538|ref|YP_679747.1| 30S ribosomal protein S7 [Cytophaga hutchinsonii ATCC 33406] >gi|110282219|gb|ABG60405.1| SSU ribosomal protein S7P [Cytophaga hutchinsonii ATCC 33406] (155 aa)
Score = 423, Expect = 2.0e-40, Identities = 88/155 (56%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR +LPDP ++  +VTK +N++M +GKK  A  I Y +  L++KKT+E G+EV+KKAL N+ P +E+R RRV GS FQVPT V  +RK  LG++WLI  AR R EK+M +KLA EII ASKG GAA KK++D H+MAEANKAF+H RF
  S:     1 MRKAKPKKRYLLPDPKFSDTMVTKFVNSLMYDGKKSTAYSIFYDAVALVEKKTSESGLEVWKKALNNVSPQVEVRSRRVGGSTFQVPTEVRPDRKMALGMKWLINYARSRGEKTMTDKLAGEIISASKGEGAAVKKRDDVHRMAEANKAFSHFRF 155
>gi|124003867|ref|ZP_01688715.1| ribosomal protein S7 [Microscilla marina ATCC 23134] >gi|123990922|gb|EAY30389.1| ribosomal protein S7 [Microscilla marina ATCC 23134] (155 aa)
Score = 423, Expect = 2.1e-40, Identities = 87/155 (56%), Positives = 116/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR +LPDP +   LVTK +N +M +GKK LA  I Y + DL+++KT + G+E++KKAL N+MP +E+R RRV G+ FQVPT V  ERK +LG++W+I  ARKR EK+M E+LAAEII  +K  G A KKK+DTH+MAEAN+AF+H RF
  S:     1 MRKRKPKKRYLLPDPKFQDVLVTKFVNYLMEDGKKSLAYSIFYGALDLVQEKTGDSGLEMWKKALNNVMPGVEVRSRRVGGATFQVPTEVRPERKVSLGIKWMISFARKRGEKTMHERLAAEIIAGAKNEGGAVKKKDDTHRMAEANRAFSHFRF 155
>gi|152991730|ref|YP_001357451.1| 30S ribosomal protein S7 [Sulfurovum sp. NBC37-1] >gi|166228487|sp|A6Q6I5|RS7_SULNB 30S ribosomal protein S7 >gi|151423591|dbj|BAF71094.1| 30S ribosomal protein S7 [Sulfurovum sp. NBC37-1] (155 aa)
Score = 423, Expect = 2.5e-40, Identities = 86/155 (55%), Positives = 124/155 (80%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  R +LPDPVY S+++TK INA+ML+GKK  AQ+++Y + + I+ KT E GIEVF KA++NI P +E++ RRV G+ +QVP  V   R+Q+LG+RW++ +ARKRNE++M+E+L+ E++DA+   G+AFKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKAPVRPVLPDPVYGSKVLTKFINAVMLDGKKSTAQKVMYSALERIESKTGEKGIEVFNKAMDNIKPVMEVKSRRVGGATYQVPIEVRPARQQSLGIRWIVEAARKRNERTMMERLSNELMDAATEKGSAFKKKEDTYKMAEANKAFAHYRW 155
>gi|118591188|ref|ZP_01548587.1| 30S ribosomal protein S7 [Stappia aggregata IAM 12614] >gi|118436264|gb|EAV42906.1| 30S ribosomal protein S7 [Stappia aggregata IAM 12614] (156 aa)
Score = 422, Expect = 2.6e-40, Identities = 81/154 (52%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   +VTK +N+IM +GKK  A++IVY +FD+++ KT E+ IEVF  ALEN+MP +E+R RRV G+ +QVP  V  +R+Q L +RWLI +AR RNE +M+++L+ E++DA+   G A KK+EDTH+MA+AN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDTVVTKFMNSIMYDGKKSTAERIVYGAFDVVENKTRENPIEVFHAALENVMPQVEVRSRRVGGATYQVPVEVRTDRRQALAIRWLITAARNRNETTMVDRLSGELLDAANNRGTAVKKREDTHRMADANRAFSHYRW 156
>gi|154503767|ref|ZP_02040827.1| hypothetical protein RUMGNA_01591 [Ruminococcus gnavus ATCC 29149] >gi|153795867|gb|EDN78287.1| hypothetical protein RUMGNA_01591 [Ruminococcus gnavus ATCC 29149] (163 aa)
Score = 422, Expect = 2.7e-40, Identities = 87/154 (56%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK IN IML+GKKG+AQ+IVY +F+ ++ K  +  IEVF++A+ NIMP LE++ RR+ G+ +QVP  V  +R+Q L LRW+ L +R+R EK+M E+LA EI+DA+  TGA+ KKKED HKMAEANKAFAH RF
  S:    10 RKGHTQKRDVLADPIYNNKVVTKLINNIMLDGKKGVAQKIVYGAFERVEAKAEKSAIEVFEEAMNNIMPVLEVKARRIGGATYQVPIEVRADRRQALALRWITLYSRQRGEKTMEERLANEILDAANNTGASVKKKEDMHKMAEANKAFAHYRF 163
>gi|39936317|ref|NP_948593.1| 30S ribosomal protein S7 [Rhodopseudomonas palustris CGA009] >gi|167365715|ref|ZP_02299859.1| ribosomal protein S7 [Rhodopseudomonas palustris TIE-1] >gi|192292041|ref|YP_001992646.1| ribosomal protein S7 [Rhodopseudomonas palustris TIE-1] >gi|62287282|sp|Q6N4T3|RS7_RHOPA 30S ribosomal protein S7 (RRP-S7) >gi|39650172|emb|CAE28695.1| 30S ribosomal protein S7 [Rhodopseudomonas palustris CGA009] >gi|192285790|gb|ACF02171.1| ribosomal protein S7 [Rhodopseudomonas palustris TIE-1] (156 aa)
Score = 422, Expect = 3.0e-40, Identities = 83/154 (53%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + +VTK +N++M  GKK +A+ IVY +FDLI+ KT +  + VF++AL+N+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHAAEKREVLPDPKFGNIIVTKFMNSVMYAGKKSVAESIVYGAFDLIEAKTKQPPLGVFEQALDNVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLITAARGRNEKTMTERLSAELLDASNNRGNAVKKREDVHKMAEANRAFSHYRW 156
>gi|32265858|ref|NP_859890.1| 30S ribosomal protein S7 [Helicobacter hepaticus ATCC 51449] >gi|62287314|sp|Q7VJ84|RS7_HELHP 30S ribosomal protein S7 >gi|32261907|gb|AAP76956.1| ribosomal protein S7 [Helicobacter hepaticus ATCC 51449] (155 aa)
Score = 421, Expect = 3.7e-40, Identities = 88/155 (56%), Positives = 125/155 (80%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+L DP+YN+++VTK IN +ML+GKK ++++I+Y +FD I++K+ E GIEVF+KALE + P +E+R RRV G+ +QVP  V   R+Q+L +RWL+ + RKRNE++MIE+LA+E++DA+   GAAFKKKED HKMAEANKAFAH R+
  S:     1 MRRRKAPVREVLGDPIYNNKVVTKFINKMMLDGKKSVSEKIIYAAFDKIEEKSGEKGIEVFEKALERVKPLVEVRSRRVGGATYQVPVEVRPARQQSLSIRWLLEATRKRNERTMIERLASELVDAANERGAAFKKKEDVHKMAEANKAFAHYRW 155
>gi|75675552|ref|YP_317973.1| 30S ribosomal protein S7 [Nitrobacter winogradskyi Nb-255] >gi|90120518|sp|Q3SSX0|RS7_NITWN 30S ribosomal protein S7 >gi|74420422|gb|ABA04621.1| SSU ribosomal protein S7P [Nitrobacter winogradskyi Nb-255] (156 aa)
Score = 421, Expect = 4.2e-40, Identities = 83/154 (53%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + ++TK +N+IM  GKK +A+ IVY + DLI+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G+A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHSAEKREVLPDPKFGNVVITKFMNSIMYAGKKSVAESIVYGALDLIEAKTKQGPLTVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLITAARGRNEKTMTERLSAELLDASNNRGSAVKKREDVHKMAEANRAFSHYRW 156
>gi|172056136|ref|YP_001812596.1| ribosomal protein S7 [Exiguobacterium sibiricum 255-15] >gi|171988657|gb|ACB59579.1| ribosomal protein S7 [Exiguobacterium sibiricum 255-15] (156 aa)
Score = 420, Expect = 4.7e-40, Identities = 85/154 (55%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK +  +R+++ DP+YNS+LVT+ IN +ML+GKKG AQQI+Y++F+ I +++  D +EVF++A+ NIMP LE++ RRV G+N+QVP  V  ER+ TL LR+L+  +R RNEK+M  +LA EI+DA+  TGA+ KK+ED HKMAEANKAFAH R+
  S:     3 RKGQVERRDVMADPIYNSKLVTRLINRLMLDGKKGTAQQILYKAFEAIAERSGRDAMEVFEEAMNNIMPVLEVKARRVGGANYQVPVEVRPERRTTLALRYLVNYSRLRNEKTMDARLANEIMDAANNTGASVKKREDMHKMAEANKAFAHYRW 156
>gi|169198841|ref|ZP_02858150.1| ribosomal protein S7 [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169087970|gb|EDS67685.1| ribosomal protein S7 [Rhizobium leguminosarum bv. trifolii WSM2304] (156 aa)
Score = 420, Expect = 5.4e-40, Identities = 81/154 (52%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A KREI PDP +   +VTK +NAIML+GKK +A+ IVY +FD+++ K+ ++ + VF  AL+NI P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +ARKRNE +M+++L+ E++DAS   G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHKAEKREINPDPKFGDLVVTKFMNAIMLDGKKSVAENIVYGAFDVVQGKSKQEPLTVFHSALDNIAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIAAARKRNETTMVDRLSGELLDASNNRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|116251536|ref|YP_767374.1| 30S ribosomal protein S7 [Rhizobium leguminosarum bv. viciae 3841] >gi|167358142|ref|ZP_02292801.1| ribosomal protein S7 [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|123384823|sp|Q1MIE5|RS7_RHIL3 30S ribosomal protein S7 >gi|115256184|emb|CAK07265.1| putative 30S ribosomal protein S7 [Rhizobium leguminosarum bv. viciae 3841] >gi|167074976|gb|EDR78793.1| ribosomal protein S7 [Rhizobium leguminosarum bv. trifolii WSM1325] (156 aa)
Score = 419, Expect = 6.4e-40, Identities = 82/154 (53%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A KREI PDP +   +VTK +NAIML+GKK +A+ IVY +FD+++ K  ++ + VF  ALENI P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +ARKRNE +M+++L+ E++DAS   G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHKAEKREINPDPKFGDLVVTKFMNAIMLDGKKSVAENIVYGAFDVVQGKAKQEPLTVFHSALENIAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIAAARKRNETTMVDRLSGELLDASNNRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|92117094|ref|YP_576823.1| 30S ribosomal protein S7 [Nitrobacter hamburgensis X14] >gi|123265326|sp|Q1QN34|RS7_NITHX 30S ribosomal protein S7 >gi|91799988|gb|ABE62363.1| SSU ribosomal protein S7P [Nitrobacter hamburgensis X14] (156 aa)
Score = 419, Expect = 6.6e-40, Identities = 82/154 (53%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + ++TK +N++M  GKK +A+ IVY + DLI+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G+A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHSAEKREVLPDPKFGNVVITKFMNSVMYAGKKSVAEGIVYGALDLIEAKTRQGPLTVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLIAAARGRNEKTMTERLSAELLDASNNRGSAVKKREDVHKMAEANRAFSHYRW 156
>gi|153816275|ref|ZP_01968943.1| hypothetical protein RUMTOR_02524 [Ruminococcus torques ATCC 27756] >gi|145846458|gb|EDK23376.1| hypothetical protein RUMTOR_02524 [Ruminococcus torques ATCC 27756] (163 aa)
Score = 419, Expect = 6.7e-40, Identities = 85/154 (55%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK IN IML+GKKG+AQ+IVY +F+ ++ K  +  IEVF++A+ N+MP LE++ RR+ G+ +QVP  V  +R+Q L LRWL + +R+R EK+M E+LA EI+DA+  TG A K+KED HKMAEANKAFAH RF
  S:    10 RKGHTQKRDVLADPIYNNKVVTKLINNIMLDGKKGVAQKIVYGAFERVEAKAEKPAIEVFEEAMNNMMPVLEVKARRIGGATYQVPIEVRADRRQALALRWLTMYSRQRGEKTMEERLANEILDAANNTGGAVKRKEDMHKMAEANKAFAHYRF 163
>gi|86357301|ref|YP_469193.1| 30S ribosomal protein S7 [Rhizobium etli CFN 42] >gi|190891351|ref|YP_001977893.1| 30S ribosomal protein S7 [Rhizobium etli CIAT 652] >gi|109894843|sp|Q2K9M0|RS7_RHIEC 30S ribosomal protein S7 >gi|86281403|gb|ABC90466.1| 30S ribosomal protein S7 [Rhizobium etli CFN 42] >gi|190696630|gb|ACE90715.1| 30S ribosomal protein S7 [Rhizobium etli CIAT 652] (156 aa)
Score = 419, Expect = 7.0e-40, Identities = 82/154 (53%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A KREI PDP +   +VTK +NAIML+GKK +A+ IVY +FD ++ K+ ++ + VF  AL+NI P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +ARKRNE +MI++L+ E++DAS   G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHKAEKREINPDPKFGDLVVTKFMNAIMLDGKKSVAENIVYGAFDAVQGKSKQEPLSVFHSALDNIAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIAAARKRNETTMIDRLSGELLDASNNRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|170738707|ref|YP_001767362.1| ribosomal protein S7 [Methylobacterium sp. 4-46] >gi|168192981|gb|ACA14928.1| ribosomal protein S7 [Methylobacterium sp. 4-46] (156 aa)
Score = 418, Expect = 7.6e-40, Identities = 80/154 (51%), Positives = 120/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI+PDP Y   ++TK +N++M EGKK +A+ IVY +FD+I+ +   + IEVF+ AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RN+++M+E+L+AE++DA+   GAA KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKREIIPDPKYGDVVLTKFMNSVMYEGKKSVAESIVYGAFDIIESRARANPIEVFRAALDNVAPAIEVRSRRVGGATYQVPVEVRHERRQALAIRWLIQAARSRNDRTMVERLSAELLDAANNRGAAVKKREDTHRMAEANRAFSHYRW 156
>gi|85715135|ref|ZP_01046119.1| 30S ribosomal protein S7 [Nitrobacter sp. Nb-311A] >gi|85698050|gb|EAQ35923.1| 30S ribosomal protein S7 [Nitrobacter sp. Nb-311A] (156 aa)
Score = 418, Expect = 7.9e-40, Identities = 83/154 (53%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + ++TK +N+IM  GKK  A+ IVY + DLI+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M+E+L+AE++DAS   G+A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHSAEKREVLPDPKFGNVVITKFMNSIMYAGKKSAAESIVYGALDLIEAKTKQGPLTVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLIAAARGRNEKTMMERLSAELLDASNNRGSAVKKREDVHKMAEANRAFSHYRW 156
>gi|167768224|ref|ZP_02440277.1| hypothetical protein CLOSS21_02780 [Clostridium sp. SS2/1] >gi|167709748|gb|EDS20327.1| hypothetical protein CLOSS21_02780 [Clostridium sp. SS2/1] (170 aa)
Score = 418, Expect = 8.4e-40, Identities = 85/154 (55%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++L DP+YN+++VTK IN IML+GKKG+AQ+IVY +F  I+++  +  +EVF++A+ NIMP LE++ RR+ G+ +QVP  V  +R+Q L LRW+   +RKR E++M E+LA E++DAS  TGA+ KKKED HKMAEANKAFAH RF
  S:    17 RKGHIAKRDVLADPIYNNKVVTKLINNIMLDGKKGVAQKIVYGAFARIEEEAGKPALEVFEEAMNNIMPVLEVKARRIGGATYQVPIDVRPDRRQALALRWITTFSRKRGERTMEERLAKELLDASNNTGASVKKKEDMHKMAEANKAFAHYRF 170
>gi|39938749|ref|NP_950515.1| 30S ribosomal protein S7 [Onion yellows phytoplasma OY-M] >gi|62287284|sp|Q6YQW0|RS7_ONYPE 30S ribosomal protein S7 >gi|39721858|dbj|BAD04348.1| ribosomal protein S7 [Onion yellows phytoplasma OY-M] (156 aa)
Score = 417, Expect = 9.8e-40, Identities = 89/154 (57%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++ PDPVYNS+LVTK IN IM +GKKG AQ I YQ+   +K  TN + I+VF +AL NIMP LE+R RR+ G N+QVP+ V  ER+Q+LGLRW++   ++ NEK+M E+LA EI+DAS G G   KK+E+TH+MAEANKAFAH R+
  S:     3 RKGHIKKRDVQPDPVYNSKLVTKIINIIMEDGKKGKAQTIFYQALKQVKTITNREPIKVFHEALNNIMPVLEVRTRRMGGQNYQVPSEVRPERRQSLGLRWIVKYTKESNEKTMEERLAKEIVDASLGNGVLVKKREETHRMAEANKAFAHYRW 156
>gi|110634034|ref|YP_674242.1| 30S ribosomal protein S7 [Mesorhizobium sp. BNC1] >gi|123353636|sp|Q11HP8|RS7_MESSB 30S ribosomal protein S7 >gi|110285018|gb|ABG63077.1| SSU ribosomal protein S7P [Mesorhizobium sp. BNC1] (156 aa)
Score = 417, Expect = 1.1e-39, Identities = 83/154 (53%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   +VTK +NAIM EGKK +A++IVY + D +++KT ++ + VF +AL+N+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNEK+M+E+L+ E++DAS   G A KK+EDTHKMAEAN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDTVVTKFMNAIMFEGKKSVAERIVYGALDQVQEKTKQEPVAVFHQALDNVAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLISAARGRNEKTMVERLSGELLDASSNRGTAVKKREDTHKMAEANRAFSHYRW 156
>gi|150396203|ref|YP_001326670.1| 30S ribosomal protein S7 [Sinorhizobium medicae WSM419] >gi|166228480|sp|A6U855|RS7_SINMW 30S ribosomal protein S7 >gi|150027718|gb|ABR59835.1| ribosomal protein S7 [Sinorhizobium medicae WSM419] (156 aa)
Score = 417, Expect = 1.1e-39, Identities = 81/154 (52%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   +VTK +NAIML GKK +A+ IVY +FD ++ K  ++ + VF  AL+NI P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +ARKRNE +M+++L  E++DA+   G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDLVVTKFMNAIMLHGKKSVAESIVYGAFDAVQSKLKQEPVTVFHSALDNIAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIAAARKRNETTMVDRLCGELMDAANNRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|15889245|ref|NP_354926.1| 30S ribosomal protein S7 [Agrobacterium tumefaciens str. C58] >gi|22096099|sp|Q8UE14|RS7_AGRT5 30S ribosomal protein S7 >gi|15157074|gb|AAK87711.1| 30S ribosomal protein S7 [Agrobacterium tumefaciens str. C58] (156 aa)
Score = 417, Expect = 1.2e-39, Identities = 80/154 (51%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI PDP +   +VTK +NAIML GKK +A+ IVY +FD+++ KT ++ + VF  AL+N+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +ARKRNE +M+++L+ E++DA+   G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHSAEKREINPDPKFGDLVVTKFMNAIMLHGKKSVAESIVYGAFDVVQGKTKQEPLGVFHSALDNVAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLITAARKRNETTMVDRLSGELMDAANNRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|169830432|ref|YP_001716414.1| ribosomal protein S7 [Candidatus Desulforudis audaxviator MP104C] >gi|169637276|gb|ACA58782.1| ribosomal protein S7 [Candidatus Desulforudis audaxviator MP104C] (156 aa)
Score = 416, Expect = 1.3e-39, Identities = 83/154 (53%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE + DPVY S+++TK IN +ML+GK+ +A+ I Y + D++++KT  + +EV ++A++N+MP +E R RRV G+N+QVP  V  +R+QTLG+RW+   AR+R  KSM EKLAAEI+DA+ G G A KKKEDTH+MAEANKAFAH R+
  S:     3 RRGAVPKREAVADPVYGSKMLTKLINQVMLDGKRSVAEAICYGALDIVRRKTGREPLEVLEQAMKNVMPIVETRPRRVGGANYQVPVEVRADRRQTLGVRWITSFARQRPGKSMKEKLAAEIMDAANGVGGAVKKKEDTHRMAEANKAFAHYRW 156
>gi|34556894|ref|NP_906709.1| 30S ribosomal protein S7 [Wolinella succinogenes DSM 1740] >gi|62287302|sp|Q7MA54|RS7_WOLSU 30S ribosomal protein S7 >gi|34482609|emb|CAE09609.1| PUTATIVE 30S RIBOSOMAL PROTEIN S7 [Wolinella succinogenes] (155 aa)
Score = 416, Expect = 1.4e-39, Identities = 86/155 (55%), Positives = 123/155 (79%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+L DP+Y +++VTK +N +M +GKK +A++I+Y +FD I++KT E GIEVF+KALE + P +E+R RRV G+ +QVP  V   R+Q+L +RWL+ +ARKRNE++M+++LA E+IDA+   G+AFKKKED HKMAEANKAFAH R+
  S:     1 MRRRKAPVREVLGDPIYGNKVVTKFVNKMMYDGKKSVAEKIIYATFDRIEEKTKEKGIEVFEKALERVRPMVEVRSRRVGGATYQVPVEVRATRQQSLSIRWLLEAARKRNERTMVDRLANELIDAANDRGSAFKKKEDVHKMAEANKAFAHYRW 155
>gi|15965105|ref|NP_385458.1| 30S ribosomal protein S7 [Sinorhizobium meliloti 1021] >gi|21263977|sp|Q92QH3|RS7_RHIME 30S ribosomal protein S7 >gi|15074285|emb|CAC45931.1| Probable 30S ribosomal protein S7 [Sinorhizobium meliloti 1021] (156 aa)
Score = 416, Expect = 1.5e-39, Identities = 81/154 (52%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   +VTK +NAIML GKK +A+ IVY +FD ++ K  ++ + VF  AL+NI P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +ARKRNE +M+++L  E++DA+   G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDLVVTKFMNAIMLHGKKSVAESIVYGAFDAVQSKLKQEPVAVFHSALDNIAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIAAARKRNETTMVDRLCGELMDAANNRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|51894214|ref|YP_076905.1| 30S ribosomal protein S7 [Symbiobacterium thermophilum IAM 14863] >gi|62287230|sp|Q67JT9|RS7_SYMTH 30S ribosomal protein S7 >gi|51857903|dbj|BAD42061.1| 30S ribosomal protein S7 [Symbiobacterium thermophilum IAM 14863] (156 aa)
Score = 415, Expect = 1.7e-39, Identities = 85/154 (55%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+ PDPVYNS LVT+ IN IML+GKK LAQ+I Y++ D    K  ++ +EV + AL+NIMP +E R RRV G+ +QVP  V  ER+Q LG+RWL+  AR R E++M+E+LAAE++DA   TG A KKKE+ H+MAEANK FAH R+
  S:     3 RRGHVPKREVQPDPVYNSELVTRVINKIMLDGKKALAQRIFYEAIDKASAKLGKEPMEVLEGALKNIMPVVETRSRRVGGATYQVPMEVRPERRQALGIRWLVQFARARGERTMVERLAAELVDAFNNTGGAVKKKEEVHRMAEANKPFAHYRW 156
>gi|46579710|ref|YP_010518.1| 30S ribosomal protein S7 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602813|ref|YP_967213.1| 30S ribosomal protein S7 [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166227442|sp|A1VEC0|RS7_DESVV 30S ribosomal protein S7 >gi|62287293|sp|Q72CI4|RS7_DESVH 30S ribosomal protein S7 >gi|46449125|gb|AAS95777.1| ribosomal protein S7 [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120563042|gb|ABM28786.1| SSU ribosomal protein S7P [Desulfovibrio vulgaris subsp. vulgaris DP4] (156 aa)
Score = 415, Expect = 1.8e-39, Identities = 83/154 (53%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +REILPDP+YNSRLV + IN +M +GKKG A++I Y + D + +KT E+ ++ F+KA+EN+ P LE++ RRV G+ +QVP  V  +R+ +L LRWLI  +R R EK M+ KL+AE++DA    G A KKKEDTH+MAEANKAFAH R+
  S:     3 RKGPVPRREILPDPLYNSRLVARFINRLMYDGKKGAAEKIFYSALDTLAQKTGEEPLKAFEKAIENVKPHLEVKARRVGGATYQVPMEVRPDRQVSLSLRWLIAYSRSRGEKGMVSKLSAELLDAFNNRGGAVKKKEDTHRMAEANKAFAHYRW 156
>gi|154245619|ref|YP_001416577.1| 30S ribosomal protein S7 [Xanthobacter autotrophicus Py2] >gi|154159704|gb|ABS66920.1| ribosomal protein S7 [Xanthobacter autotrophicus Py2] (156 aa)
Score = 415, Expect = 2.1e-39, Identities = 79/154 (51%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A +RE++PDP Y S  +++ +N++M +GKK +A+ IVY + D+++ K   D ++VF +ALEN+ P++E+R RRV G+ +QVP  V  ER+QTL +RWLI SAR RNEK+M+E+L+AE++DA+   GAA KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHKAERREVIPDPKYGSTTLSRFMNSVMRDGKKSVAEGIVYGALDVVETKAKHDPVDVFIQALENVAPAVEVRSRRVGGATYQVPVEVRNERRQTLAIRWLIASARARNEKTMVERLSAELLDAANNRGAAVKKREDTHRMAEANRAFSHYRW 156
>gi|115314168|ref|YP_762891.1| 30S ribosomal protein S7 [Francisella tularensis subsp. holarctica OSU18] >gi|122325789|sp|Q0BNT0|RS7_FRATO 30S ribosomal protein S7 >gi|115129067|gb|ABI82254.1| ribosomal protein S7 [Francisella tularensis subsp. holarctica OSU18] (157 aa)
Score = 414, Expect = 2.4e-39, Identities = 91/154 (59%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK-TNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+NRA KR+ILPDP Y S++V K +N IML GKK +A++IVY +FD IK K  + + +EVF+KALE++ P +E++ RRV G+ +QVP  V  ER+QTLG+RW+I +ARKR E +M ++LAAEI++A +G GAA KK+EDTHKMAEANKAFAH R+
  S:     3 RRNRAPKRDILPDPKYKSQVVAKFVNHIMLSGKKSIAEKIVYGAFDKIKAKDASANEVEVFEKALESVSPMVEVKSRRVGGATYQVPVEVRPERRQTLGMRWIIDAARKRKENTMGDRLAAEILEAVEGRGAAVKKREDTHKMAEANKAFAHFRW 157
>gi|119025549|ref|YP_909394.1| 30S ribosomal protein S7 [Bifidobacterium adolescentis ATCC 15703] >gi|154487004|ref|ZP_02028411.1| hypothetical protein BIFADO_00842 [Bifidobacterium adolescentis L2-32] >gi|166227418|sp|A1A0S9|RS7_BIFAA 30S ribosomal protein S7 >gi|118765133|dbj|BAF39312.1| 30S ribosomal protein S7 [Bifidobacterium adolescentis ATCC 15703] >gi|154084867|gb|EDN83912.1| hypothetical protein BIFADO_00842 [Bifidobacterium adolescentis L2-32] (156 aa)
Score = 414, Expect = 2.5e-39, Identities = 84/154 (54%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  + K ++LPDP+Y S +V + IN I+L+GKK +A+ IVY + D++K+KT+++ + V K+AL+NI PSLE+R RRV G+ +QVP  V   R  TL LRWL   +R R EK+M E+LA EI+DAS G GA+ K++EDTHKMAEANKAFAH R+
  S:     3 RKGPSKKHQLLPDPIYGSTVVAQLINKILLDGKKSIAEDIVYSALDMVKEKTDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPGRANTLSLRWLTDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW 156
>gi|90417767|ref|ZP_01225679.1| ribosomal protein S7 [Aurantimonas sp. SI85-9A1] >gi|90337439|gb|EAS51090.1| ribosomal protein S7 [Aurantimonas sp. SI85-9A1] (156 aa)
Score = 414, Expect = 2.6e-39, Identities = 78/154 (50%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   +V+K +NA+M +GKK +A++IVY +FD + +K+ +D + +F +ALENI P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +M+++L+ E++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDLIVSKFMNAVMYDGKKSVAERIVYGAFDAVHEKSRQDAVAIFHQALENISPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLITAARNRNETTMVDRLSGELMDAANNRGTAVKKREDTHRMAEANRAFSHYRW 156
>gi|148256396|ref|YP_001240981.1| 30S ribosomal protein S7 [Bradyrhizobium sp. BTAi1] >gi|166227419|sp|A5ELN1|RS7_BRASB 30S ribosomal protein S7 >gi|146408569|gb|ABQ37075.1| SSU ribosomal protein S7P [Bradyrhizobium sp. BTAi1] (156 aa)
Score = 414, Expect = 2.8e-39, Identities = 80/154 (51%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + +VTK +N++M  GKK +A+ IVY +F +I+ KT ++ + VF++AL+N+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHSAEKREVLPDPKFGNIIVTKFMNSVMYAGKKSVAESIVYGAFGIIESKTKQNPLTVFEQALDNVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLISAARDRNEKTMTERLSAELLDASNNRGNAVKKREDVHRMAEANRAFSHYRW 156
>gi|91977656|ref|YP_570315.1| 30S ribosomal protein S7 [Rhodopseudomonas palustris BisB5] >gi|123762620|sp|Q134S5|RS7_RHOPS 30S ribosomal protein S7 >gi|91684112|gb|ABE40414.1| SSU ribosomal protein S7P [Rhodopseudomonas palustris BisB5] (156 aa)
Score = 413, Expect = 2.9e-39, Identities = 82/154 (53%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + +VTK +N++M  GKK +A++IVY + DLI+ KT +  + VF++AL+N+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHAAEKREVLPDPKFGNIVVTKFMNSVMYAGKKSVAERIVYGALDLIEAKTKQPPLGVFEQALDNVMPAIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLITAARGRNEKTMTERLSAELLDASNNRGNAVKKREDVHKMAEANRAFSHYRW 156
>gi|183602585|ref|ZP_02963950.1| 30S ribosomal protein S7 [Bifidobacterium animalis subsp. lactis HN019] >gi|183218226|gb|EDT88872.1| 30S ribosomal protein S7 [Bifidobacterium animalis subsp. lactis HN019] (156 aa)
Score = 413, Expect = 3.3e-39, Identities = 84/154 (54%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  + K ++LPDP+Y S +V + IN I+L+GKK +A+ IVY + D++K KT+++ + V K+AL+NI PSLE+R RRV G+ +QVP  V   R  TL LRWL   +R R EK+M E+LA EI+DAS G GA+ K++EDTHKMAEANKAFAH R+
  S:     3 RKGPSKKHQVLPDPIYGSIVVAQLINKILLDGKKSIAEDIVYSALDMVKDKTDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPARANTLSLRWLTDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW 156
>gi|86749411|ref|YP_485907.1| 30S ribosomal protein S7 [Rhodopseudomonas palustris HaA2] >gi|109894845|sp|Q2IXR4|RS7_RHOP2 30S ribosomal protein S7 >gi|86572439|gb|ABD06996.1| SSU ribosomal protein S7P [Rhodopseudomonas palustris HaA2] (156 aa)
Score = 413, Expect = 3.3e-39, Identities = 83/154 (53%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + +VTK +N++M  GKK +A+ IVY + DLI+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHAAEKREVLPDPKFGNIVVTKFMNSVMYAGKKSVAESIVYGALDLIEAKTKQAPLTVFEQALENVMPAIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLITAARGRNEKTMTERLSAELLDASNNRGNAVKKREDVHKMAEANRAFSHYRW 156
>gi|115525589|ref|YP_782500.1| 30S ribosomal protein S7 [Rhodopseudomonas palustris BisA53] >gi|122295405|sp|Q07KL4|RS7_RHOP5 30S ribosomal protein S7 >gi|115519536|gb|ABJ07520.1| SSU ribosomal protein S7P [Rhodopseudomonas palustris BisA53] (156 aa)
Score = 413, Expect = 3.3e-39, Identities = 81/154 (52%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + ++TK +N++M  GKK +A+ IVY +  LI+ KT +D + VF +AL+N+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHAAEKREVLPDPKFGNIVITKFMNSVMYAGKKSVAETIVYGALGLIEGKTKQDPLSVFVQALDNVMPTIEVRSRRVGGATYQVPVEVRSARRQALGIRWLITAARGRNEKTMTERLSAELLDASNNRGNAVKKREDVHKMAEANRAFSHYRW 156
>gi|171854023|emb|CAM11996.1| 30S ribosomal protein S7 [Candidatus Phytoplasma australiense] (156 aa)
Score = 413, Expect = 3.5e-39, Identities = 86/154 (55%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++ PDP+YNS+LVTK IN IM +GKKG AQ I YQ+   ++  T  + +EVF+ AL NIMP LE+R RRV G N+QVP+ +  ER+Q+LGL+WL+   ++ NEK+M +KLA EI+DAS G G + KK+E+TH+MAEANKAFAH R+
  S:     3 RKGHIKKRDVNPDPIYNSKLVTKVINVIMQDGKKGKAQTIFYQALKKVQLMTKREPLEVFRDALNNIMPVLEVRTRRVGGQNYQVPSEIRPERRQSLGLKWLVKFTKQCNEKTMKDKLAKEIVDASLGHGVSVKKREETHRMAEANKAFAHYRW 156
>gi|50955573|ref|YP_062861.1| 30S ribosomal protein S7 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|62287235|sp|Q6ACY8|RS7_LEIXX 30S ribosomal protein S7 >gi|50952055|gb|AAT89756.1| 30S ribosomal protein S7 [Leifsonia xyli subsp. xyli str. CTCB07] (156 aa)
Score = 413, Expect = 3.6e-39, Identities = 84/154 (54%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S +V++ +N I+L+GKKGLA++IVY + + +  K+  D +   KKAL+NI P+LE+R RRV GS +QVP  V   R  TL LRWL   A+ R EK+M E+LA EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVVADPVYGSPVVSQLVNKILLDGKKGLAERIVYDALEGVSSKSGNDAVATLKKALDNIRPTLEVRSRRVGGSTYQVPVEVKPHRANTLALRWLTSYAKGRREKTMTERLANEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|161353767|ref|YP_001205101.2| 30S ribosomal protein S7 [Bradyrhizobium sp. ORS278] (156 aa)
Score = 413, Expect = 3.6e-39, Identities = 81/154 (52%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + +VTK +N++M  GKK +A+ IVY +F +I+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHSAEKREVLPDPKFGNIIVTKFMNSVMYAGKKSVAEGIVYGAFGIIEAKTKQSPLTVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLISAARDRNEKTMTERLSAELLDASNNRGNAVKKREDVHRMAEANRAFSHYRW 156
>gi|28493643|ref|NP_787804.1| 30S ribosomal protein S7 [Tropheryma whipplei str. Twist] >gi|28572836|ref|NP_789616.1| 30S ribosomal protein S7 [Tropheryma whipplei TW08/27] >gi|62287325|sp|Q83FP0|RS7_TROWT 30S ribosomal protein S7 >gi|62287326|sp|Q83HC8|RS7_TROW8 30S ribosomal protein S7 >gi|28410969|emb|CAD67354.1| 30S ribosomal protein S7 [Tropheryma whipplei TW08/27] >gi|28476685|gb|AAO44773.1| 30S ribosomal protein S7 [Tropheryma whipplei str. Twist] (156 aa)
Score = 412, Expect = 3.8e-39, Identities = 82/154 (53%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +REI  DPVY+SR+V++ I  ++L GKK LAQ+IVY + D +  K +ED + V +KAL+N+ PSLE+R RRV GS +QVP  V   R   L +RWL + +R R EKSM+++LA+EI+DAS G GA  K KEDTH+MAE+N+AFAH R+
  S:     3 RKGPVVRREIPEDPVYSSRVVSQLIGRVLLSGKKSLAQRIVYSALDKVSMKASEDPVSVLRKALDNVRPSLEVRSRRVGGSTYQVPVPVRSHRADALAIRWLTVYSRARREKSMVDRLASEILDASNGVGATVKCKEDTHRMAESNRAFAHYRW 156
>gi|182678333|ref|YP_001832479.1| ribosomal protein S7 [Beijerinckia indica subsp. indica ATCC 9039] >gi|182634216|gb|ACB94990.1| ribosomal protein S7 [Beijerinckia indica subsp. indica ATCC 9039] (156 aa)
Score = 412, Expect = 4.7e-39, Identities = 78/154 (50%), Positives = 121/154 (78%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE++PD  Y   ++TK +N+IM +GKK +A+ IVY +FD+I++K++ + + VFK+AL+N+ PS+E+R RRV G+ +QVP  V  ER+Q L +RW+I +AR RN+K+MI++L+AE++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKREVIPDAKYGDIILTKFMNSIMYDGKKSIAEAIVYGAFDIIEQKSHNEPLSVFKQALDNVAPSIEVRSRRVGGATYQVPVEVRSERRQALAIRWIITAARGRNDKTMIDRLSAELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|56707475|ref|YP_169371.1| 30S ribosomal protein S7 [Francisella tularensis subsp. tularensis SCHU S4] >gi|89255667|ref|YP_513028.1| 30S ribosomal protein S7 [Francisella tularensis subsp. holarctica] >gi|110669946|ref|YP_666503.1| 30S ribosomal protein S7 [Francisella tularensis subsp. tularensis FSC198] >gi|118496849|ref|YP_897899.1| 30S ribosomal protein S7 [Francisella tularensis subsp. novicida U112] >gi|134302588|ref|YP_001122559.1| 30S ribosomal protein S7 [Francisella tularensis subsp. tularensis WY96-3418] >gi|156501617|ref|YP_001427682.1| 30S ribosomal protein S7 [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009892|ref|ZP_02274823.1| 30S ribosomal protein S7 [Francisella tularensis subsp. holarctica FSC200] >gi|187932146|ref|YP_001892131.1| 30S ribosomal protein S7 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194324467|ref|ZP_03058239.1| ribosomal protein S7 [Francisella tularensis subsp. novicida FTE] >gi|123359603|sp|Q14JC3|RS7_FRAT1 30S ribosomal protein S7 >gi|166227446|sp|A7N9S3|RS7_FRATF 30S ribosomal protein S7 >gi|166227447|sp|A0Q4I0|RS7_FRATN 30S ribosomal protein S7 >gi|166227448|sp|A4IZT7|RS7_FRATW 30S ribosomal protein S7 >gi|62287191|sp|Q5NHX1|RS7_FRATT 30S ribosomal protein S7 >gi|109894830|sp|Q2A5H3|RS7_FRATH 30S ribosomal protein S7 >gi|54113309|gb|AAV29288.1| NT02FT0095 [synthetic construct] >gi|56603967|emb|CAG44955.1| 30S ribosomal protein S7 [Francisella tularensis subsp. tularensis SCHU S4] >gi|89143498|emb|CAJ78674.1| 30S ribosomal protein S7 [Francisella tularensis subsp. holarctica LVS] >gi|110320279|emb|CAL08338.1| 30S ribosomal protein S7 [Francisella tularensis subsp. tularensis FSC 198] >gi|118422755|gb|ABK89145.1| 30S ribosomal protein S7 [Francisella tularensis subsp. novicida U112] >gi|134050365|gb|ABO47436.1| ribosomal protein S7 [Francisella tularensis subsp. tularensis WY96-3418] >gi|151569074|gb|EDN34728.1| 30S ribosomal protein S7 [Francisella tularensis subsp. tularensis FSC033] >gi|156252220|gb|ABU60726.1| ribosomal protein S7 [Francisella tularensis subsp. holarctica FTNF002-00] >gi|187713055|gb|ACD31352.1| 30S ribosomal protein S7 [Francisella tularensis subsp. mediasiatica FSC147] >gi|194321302|gb|EDX18788.1| ribosomal protein S7 [Francisella tularensis subsp. novicida FTE] (157 aa)
Score = 411, Expect = 5.1e-39, Identities = 90/154 (58%), Positives = 123/154 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK-TNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+NRA KR+ILPDP Y S++V K +N IML GKK +A++IVY +FD IK K  + + +EVF+KALE++ P +E++ RRV G+ +QVP  V  ER+QTLG+RW+I +ARKR E +M +++AAEI++A +G GAA KK+EDTHKMAEANKAFAH R+
  S:     3 RRNRAPKRDILPDPKYKSQVVAKFVNHIMLSGKKSIAEKIVYGAFDKIKAKDASANEVEVFEKALESVSPMVEVKSRRVGGATYQVPVEVRPERRQTLGMRWIIDAARKRKENTMGDRVAAEILEAVEGRGAAVKKREDTHKMAEANKAFAHFRW 157
>gi|83815057|ref|YP_445163.1| 30S ribosomal protein S7 [Salinibacter ruber DSM 13855] >gi|109894850|sp|Q2S3R8|RS7_SALRD 30S ribosomal protein S7 >gi|83756451|gb|ABC44564.1| ribosomal protein S7 [Salinibacter ruber DSM 13855] (157 aa)
Score = 411, Expect = 5.7e-39, Identities = 86/155 (55%), Positives = 120/155 (77%)
  Q:     1 MRKNRA-TKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKT-NEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           M +N A  +R   PDPVY   +V++ +NAIM +GKK LA++IVY +FD+I+++T  E+G+EVFKKA+ N  P +E+R RRV G+ +QVPT V  ER+ TL  RW+I  AR RNEKSM+ +LA+E++DA++G G A KKK+DTH+MAE+NKAFAH +F
  S:     1 MSRNEAPEQRTTQPDPVYRDDMVSRFVNAIMRDGKKSLARRIVYDTFDVIEERTGEEEGLEVFKKAVNNAAPLVEVRSRRVGGATYQVPTEVRPERRITLAFRWIIQYARARNEKSMVNRLASELVDAARGEGGAVKKKDDTHRMAESNKAFAHFQF 157
>gi|171740953|ref|ZP_02916760.1| hypothetical protein BIFDEN_00014 [Bifidobacterium dentium ATCC 27678] >gi|171276567|gb|EDT44228.1| hypothetical protein BIFDEN_00014 [Bifidobacterium dentium ATCC 27678] (156 aa)
Score = 410, Expect = 7.3e-39, Identities = 84/154 (54%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  + K ++LPDP+Y S +V + IN I+L+GKK +A+ IVY + D++K+KT ++ + V K+AL+NI PSLE+R RRV G+ +QVP  V   R  TL LRWL   +R R EK+M E+LA EI+DAS G GA+ K++EDTHKMAEANKAFAH R+
  S:     3 RKGPSKKHQLLPDPIYGSTVVAQLINKILLDGKKSIAEDIVYSALDMVKEKTEQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPARANTLSLRWLTDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW 156
>gi|154249821|ref|YP_001410646.1| 30S ribosomal protein S7 [Fervidobacterium nodosum Rt17-B1] >gi|171769380|sp|A7HM56|RS7_FERNB 30S ribosomal protein S7 >gi|154153757|gb|ABS60989.1| ribosomal protein S7 [Fervidobacterium nodosum Rt17-B1] (155 aa)
Score = 409, Expect = 8.6e-39, Identities = 83/155 (53%), Positives = 114/155 (73%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ RA  R + PDPVY   LVT+ +N IM +GKK +AQ+IVY + D++ +KT +DGIEVFK+A+EN+ P +E+R RR+ G+ +QVP  V + RK TL +RW++  AR +  K M EKLA E+++A   TGAA KK+ED HKMAEAN+AFAH R+
  S:     1 MRRRRAEPRVVSPDPVYGEVLVTRMVNKIMWDGKKSIAQKIVYGAIDILSQKTGKDGIEVFKQAIENVKPIVEVRPRRIGGATYQVPVEVQEPRKTTLAIRWIVDIARSKKGKPMQEKLAEELLNAYNNTGAAIKKREDVHKMAEANRAFAHFRW 155
>gi|23335707|ref|ZP_00120940.1| COG0049: Ribosomal protein S7 [Bifidobacterium longum DJO10A] >gi|23465668|ref|NP_696271.1| 30S ribosomal protein S7 [Bifidobacterium longum NCC2705] >gi|189439717|ref|YP_001954798.1| Ribosomal protein S7 [Bifidobacterium longum DJO10A] >gi|62287341|sp|Q8G5B5|RS7_BIFLO 30S ribosomal protein S7 >gi|23326344|gb|AAN24907.1| 30S ribosomal protein S7 [Bifidobacterium longum NCC2705] >gi|189428152|gb|ACD98300.1| Ribosomal protein S7 [Bifidobacterium longum DJO10A] (156 aa)
Score = 409, Expect = 9.5e-39, Identities = 83/154 (53%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  + K  +LPDP+Y S +V + IN I+L+GKK +A+ IVY + D++K+K++++ + V K+AL+NI PSLE+R RRV G+ +QVP  V   R  TL LRWL   +R R EK+M E+LA EI+DAS G GA+ K++EDTHKMAEANKAFAH R+
  S:     3 RKGPSKKHVVLPDPIYGSTVVAQLINKILLDGKKSIAEDIVYSALDMVKEKSDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPNRANTLSLRWLTDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW 156
>gi|167626809|ref|YP_001677309.1| 30S ribosomal protein S7 [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189045610|sp|B0U0Z2|RS7_FRAP2 30S ribosomal protein S7 >gi|167596810|gb|ABZ86808.1| 30S ribosomal protein S7 [Francisella philomiragia subsp. philomiragia ATCC 25017] (157 aa)
Score = 408, Expect = 1.1e-38, Identities = 88/154 (57%), Positives = 124/154 (80%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIK-KKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+NRA KR+ILPDP + S++V K +N IML+GKK +A++IVY +FD IK K  + + +EVF+KAL+++ P +E++ RRV G+ +QVP  V  ER+QTLG+RW+I +ARKR E +M +++AAEI++A +G GAA KK+EDTHKMAEANKAFAH R+
  S:     3 RRNRAPKRDILPDPKFKSQVVAKFVNHIMLDGKKSIAEKIVYGAFDKIKAKDASANEVEVFEKALDSVSPMVEVKSRRVGGATYQVPVEVRPERRQTLGMRWIIDAARKRKESTMGDRVAAEILEAIEGRGAAVKKREDTHKMAEANKAFAHFRW 157
>gi|183981033|ref|YP_001849324.1| 30S ribosomal protein S7, RpsG [Mycobacterium marinum M] >gi|183174359|gb|ACC39469.1| 30S ribosomal protein S7, RpsG [Mycobacterium marinum M] (156 aa)
Score = 408, Expect = 1.2e-38, Identities = 82/154 (53%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R+R EK+MIE+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLQGKKSLAERIVYGALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|170748632|ref|YP_001754892.1| ribosomal protein S7 [Methylobacterium radiotolerans JCM 2831] >gi|170655154|gb|ACB24209.1| ribosomal protein S7 [Methylobacterium radiotolerans JCM 2831] (156 aa)
Score = 408, Expect = 1.3e-38, Identities = 79/154 (51%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI+PDP Y   ++TK +N+IM EGKK  A++IVY +FD+++ +   + IEVF+ AL+N+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RN+++M+E+L+AE++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKREIIPDPKYGDVVLTKFMNSIMYEGKKSTAERIVYGAFDIVENRARANPIEVFRAALDNVAPMIEVRSRRVGGATYQVPVEVRTERRQALAIRWLIQAARSRNDRTMVERLSAELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|148322299|gb|EDK87549.1| ribosomal protein S7 [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (156 aa)
Score = 407, Expect = 1.4e-38, Identities = 85/153 (55%), Positives = 114/153 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLR 154
           R+  A KR++LPD  Y+ ++VTK IN+IML+GKK +A+ I Y + DLIK+KT ++G +VFK+AL+NI P +E+R RR+ G+ +QVP  V  +R+QTL +RWL    R R E  MIEKLAAE+I A+   GA  KKKEDT+KMAEAN+AFAH R
  S:     3 RRRAAVKRDVLPDSRYSDKVVTKVINSIMLDGKKSIAEGIFYSAMDLIKEKTGQEGYDVFKQALDNIKPQIEVRSRRIGGATYQVPVEVKADRQQTLAIRWLTTYTRARKEYGMIEKLAAELIAAANNEGATIKKKEDTYKMAEANRAFAHYR 155
>gi|19704889|ref|NP_602384.1| 30S ribosomal protein S7 [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|34762377|ref|ZP_00143379.1| SSU ribosomal protein S7P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|22096136|sp|Q8RIM0|RS7_FUSNN 30S ribosomal protein S7 >gi|19712780|gb|AAL93683.1| SSU ribosomal protein S7P [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|27887959|gb|EAA25025.1| SSU ribosomal protein S7P [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (156 aa)
Score = 407, Expect = 1.6e-38, Identities = 85/153 (55%), Positives = 114/153 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLR 154
           R+  A KR++LPD  Y+ ++VTK IN+IML+GKK +A+ I Y + DLIK+KT ++G ++FK+ALENI P +E+R RR+ G+ +QVP  V  +R+QTL +RWL    R R E  MIEKLAAE+I A+   GA  KKKEDT+KMAEAN+AFAH R
  S:     3 RRRAAVKRDVLPDSRYSDKVVTKVINSIMLDGKKSIAEGIFYSAMDLIKEKTGQEGYDIFKQALENIKPQIEVRSRRIGGATYQVPVEVKADRQQTLAIRWLTTYTRARKEYGMIEKLAAELIAAANNEGATIKKKEDTYKMAEANRAFAHYR 155
>gi|134252884|gb|EBA51978.1| 30S ribosomal protein S7 [Francisella tularensis subsp. holarctica 257] (156 aa)
Score = 407, Expect = 1.7e-38, Identities = 90/153 (58%), Positives = 122/153 (79%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIK-KKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLR 154
           R+NRA KR+ILPDP Y S++V K +N IML GKK +A++IVY +FD IK K  + + +EVF+KALE++ P +E++ RRV G+ +QVP  V  ER+QTLG+RW+I +ARKR E +M +++AAEI++A +G GAA KK+EDTHKMAEANKAFAH R
  S:     3 RRNRAPKRDILPDPKYKSQVVAKFVNHIMLSGKKSIAEKIVYGAFDKIKAKDASANEVEVFEKALESVSPMVEVKSRRVGGATYQVPVEVRPERRQTLGMRWIIDAARKRKENTMGDRVAAEILEAVEGRGAAVKKREDTHKMAEANKAFAHFR 156
>gi|15840086|ref|NP_335123.1| 30S ribosomal protein S7 [Mycobacterium tuberculosis CDC1551] >gi|13880235|gb|AAK44937.1| ribosomal protein S7 [Mycobacterium tuberculosis CDC1551] (156 aa)
Score = 407, Expect = 1.7e-38, Identities = 83/154 (53%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWLI  +R+R EK+MIE+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLIGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|154148658|ref|YP_001407178.1| 30S ribosomal protein S7 [Campylobacter hominis ATCC BAA-381] >gi|166227432|sp|A7I3T7|RS7_CAMHC 30S ribosomal protein S7 >gi|153804667|gb|ABS51674.1| ribosomal protein S7 [Campylobacter hominis ATCC BAA-381] (156 aa)
Score = 407, Expect = 1.8e-38, Identities = 84/155 (54%), Positives = 120/155 (77%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED-GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+LPDP+Y ++++TK IN++M +GKK +A +I+Y + +LI +K  E  GIEVF  A+EN+ P LE++ RRV G+ +QVP  V   R+Q L +RW+I  ARKR+E++MIEKLA E++DA+   G++FKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKALVREVLPDPIYGNKVITKFINSLMYDGKKSIATKIMYGAINLIDQKGGEKKGIEVFNDAIENVKPVLEVKSRRVGGATYQVPIEVRPARQQALAIRWIIAFARKRSERTMIEKLAYELLDAANSKGSSFKKKEDTYKMAEANKAFAHYRW 156
>gi|15828006|ref|NP_302269.1| 30S ribosomal protein S7 [Mycobacterium leprae TN] >gi|13093559|emb|CAC30833.1| 30S ribosomal protein S7 [Mycobacterium leprae] (156 aa)
Score = 407, Expect = 1.8e-38, Identities = 83/154 (53%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N I+L+GKK LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R+R EK+MIE+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|118472053|ref|YP_885785.1| 30S ribosomal protein S7 [Mycobacterium smegmatis str. MC2 155] >gi|166227465|sp|A0QS97|RS7_MYCS2 30S ribosomal protein S7 >gi|730669|sp|P41193|RS7_MYCSM 30S ribosomal protein S7 >gi|511652|gb|AAA62391.1| ribosomal protein S7 >gi|118173340|gb|ABK74236.1| ribosomal protein S7 [Mycobacterium smegmatis str. MC2 155] (156 aa)
Score = 406, Expect = 1.8e-38, Identities = 82/154 (53%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++LEGKK LA++IVY + +  ++KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R+R EK+M+E+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLEGKKSLAERIVYGALEQAREKTGTDPVVTLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVNFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|13470548|ref|NP_102116.1| 30S ribosomal protein S7 [Mesorhizobium loti MAFF303099] >gi|17367617|sp|Q98N60|RS7_RHILO 30S ribosomal protein S7 >gi|14021289|dbj|BAB47902.1| 30S ribosomal protein S7 [Mesorhizobium loti MAFF303099] (156 aa)
Score = 406, Expect = 1.9e-38, Identities = 79/154 (51%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI PDP +   +VTK +NA+M +GKK +A+ IVY + D ++ KT ++ + VF +AL+N+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +MI++L+ E++DA+   G A KK+EDTHKMAEAN+AFAH R+
  S:     3 RRHSAEKREINPDPKFGDLIVTKFMNAVMYDGKKSVAETIVYGALDQVQSKTKQEPVTVFHQALDNVAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIAAARNRNETTMIDRLSGELMDAANNRGTAVKKREDTHKMAEANRAFAHYRW 156
>gi|27380515|ref|NP_772044.1| 30S ribosomal protein S7 [Bradyrhizobium japonicum USDA 110] >gi|62287330|sp|Q89J80|RS7_BRAJA 30S ribosomal protein S7 >gi|27353679|dbj|BAC50669.1| 30S ribosomal protein S7 [Bradyrhizobium japonicum USDA 110] (156 aa)
Score = 406, Expect = 2.0e-38, Identities = 79/154 (51%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP + + ++TK +N++M  GKK +A+ IVY +  +I+ KT ++ + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR+RNEK+M E+L+AE++DAS   G A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHSAEKREVLPDPKFGNIVITKFMNSVMYAGKKSVAEGIVYGALGIIETKTKQNPLGVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLISAARERNEKTMTERLSAELLDASNNRGNAVKKREDVHRMAEANRAFSHYRW 156
>gi|78357305|ref|YP_388754.1| 30S ribosomal protein S7 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|90120417|sp|Q30Z37|RS7_DESDG 30S ribosomal protein S7 >gi|78219710|gb|ABB39059.1| SSU ribosomal protein S7P [Desulfovibrio desulfuricans G20] (156 aa)
Score = 406, Expect = 2.1e-38, Identities = 78/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +RE+LPDPVYNSRL  + +N +M++GKKG A++I Y+S +++++KT ED I+ F+KA++N+ P +E++ RRV G+ +QVP  V  +R+ +L +RWLI  AR R EK M+ +L+ E++DA    G A KKK+DTH+MAEANKAFAH R+
  S:     3 RKGPIPRREVLPDPVYNSRLAARFVNRMMVDGKKGAAEKIFYKSLEVLQEKTGEDAIKAFEKAVDNVKPFVEVKSRRVGGATYQVPVEVRSDRQVSLAIRWLITYARARGEKGMVGRLSGELLDAFNNRGGAVKKKDDTHRMAEANKAFAHFRW 156
>gi|157363438|ref|YP_001470205.1| 30S ribosomal protein S7 [Thermotoga lettingae TMO] >gi|167012603|sp|A8F4Q7|RS7_THELT 30S ribosomal protein S7 >gi|157314042|gb|ABV33141.1| ribosomal protein S7 [Thermotoga lettingae TMO] (155 aa)
Score = 406, Expect = 2.3e-38, Identities = 85/155 (54%), Positives = 117/155 (75%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ RA  R+I PDPVY+  LV K +N IM +GKK +AQ+IVY+SF+ I++K+ +D +EVF+KA+EN+ P LE+R RRV G+ +QVP  V + RK +L LRW++ +AR +  K M  +LA EI+ + +GTG A KKKED HKMAEAN+AFAHLR+
  S:     1 MRRRRAEVRKIAPDPVYSDILVAKLVNRIMWDGKKAVAQKIVYRSFEYIQEKSGKDPLEVFQKAIENVRPVLEVRPRRVGGATYQVPVEVQEPRKTSLALRWIVAAARAKKGKPMYVRLAEEILASYQGTGTAMKKKEDVHKMAEANRAFAHLRW 155
>gi|163705861|ref|ZP_02123852.1| ribosomal protein S7 [Methylobacterium nodulans ORS 2060] >gi|162428721|gb|EDQ39365.1| ribosomal protein S7 [Methylobacterium nodulans ORS 2060] (156 aa)
Score = 406, Expect = 2.3e-38, Identities = 78/154 (50%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KR+I+PD  Y   ++TK +N++M EGKK +A+ IVY +FD+I+ +   + IEVF+ AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RN+++M+E+L+AE++DA+   GAA KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKRQIIPDAKYGDVVLTKFMNSVMYEGKKSVAESIVYGAFDIIESRARVNPIEVFRAALDNVAPAIEVRSRRVGGATYQVPVEVRHERRQALAIRWLIQAARSRNDRTMVERLSAELLDAANNRGAAVKKREDTHRMAEANRAFSHYRW 156
>gi|57240980|ref|ZP_00368928.1| ribosomal protein S7 [Campylobacter lari RM2100] >gi|57018599|gb|EAL55373.1| ribosomal protein S7 [Campylobacter lari RM2100] (156 aa)
Score = 406, Expect = 2.3e-38, Identities = 86/155 (55%), Positives = 118/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED-GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+LPDP+Y ++++TK IN++M +GKK  A  I+Y + + I KK  E  GIE+F  A+ENI P LE++ RRV G+ +QVP  V   R+Q L +RW+I  ARKR+E++MIEKLAAE++DA+   GA+FKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKAPVREVLPDPIYGNKVITKFINSLMYDGKKSTATTIMYGALEAIDKKGGEKKGIEIFNDAIENIKPLLEVKSRRVGGATYQVPVEVRPARQQALAIRWIISFARKRSERTMIEKLAAELLDAANSKGASFKKKEDTYKMAEANKAFAHYRW 156
>gi|114704480|ref|ZP_01437388.1| 30S ribosomal protein S7 [Fulvimarina pelagi HTCC2506] >gi|114539265|gb|EAU42385.1| 30S ribosomal protein S7 [Fulvimarina pelagi HTCC2506] (156 aa)
Score = 405, Expect = 2.4e-38, Identities = 76/154 (49%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI PDP +   +V+K +NA+M +GKK +A++IVY +FD +++KT ++ + +F +ALENI P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +M+++L+ E++DA+   G A KK+EDTH+MA+AN+AF+H R+
  S:     3 RRHSAEKREINPDPKFGDLVVSKFMNAVMYDGKKSVAERIVYGAFDTVQEKTRQEPVAIFHQALENIAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLITAARNRNETTMVDRLSGELMDAANNRGTAVKKREDTHRMADANRAFSHYRW 156
>gi|15607823|ref|NP_215197.1| 30S ribosomal protein S7 [Mycobacterium tuberculosis H37Rv] >gi|31791867|ref|NP_854360.1| 30S ribosomal protein S7 [Mycobacterium bovis AF2122/97] >gi|121636604|ref|YP_976827.1| 30S ribosomal protein S7 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148660458|ref|YP_001281981.1| 30S ribosomal protein S7 [Mycobacterium tuberculosis H37Ra] >gi|148821888|ref|YP_001286642.1| 30S ribosomal protein S7 [Mycobacterium tuberculosis F11] >gi|167967584|ref|ZP_02549861.1| 30S ribosomal protein S7 [Mycobacterium tuberculosis H37Ra] >gi|194543056|ref|YP_002078085.1| 30S ribosomal protein S7 rpsG [Mycobacterium tuberculosis C] >gi|166227464|sp|A1KGG3|RS7_MYCBP 30S ribosomal protein S7 >gi|166227468|sp|A5U069|RS7_MYCTA 30S ribosomal protein S7 >gi|6094192|sp|P41194|RS7_MYCTU 30S ribosomal protein S7 >gi|38605695|sp|Q53539|RS7_MYCBO 30S ribosomal protein S7 >gi|2909656|emb|CAA17466.1| PROBABLE 30S RIBOSOMAL PROTEIN S7 RPSG [Mycobacterium tuberculosis H37Rv] >gi|31617454|emb|CAD93564.1| PROBABLE 30S RIBOSOMAL PROTEIN S7 RPSG [Mycobacterium bovis AF2122/97] >gi|121492251|emb|CAL70718.1| Probable 30S ribosomal protein S7 rpsG [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600063|gb|EAY59073.1| 30S ribosomal protein S7 rpsG [Mycobacterium tuberculosis C] >gi|134149146|gb|EBA41191.1| 30S ribosomal protein S7 rpsG [Mycobacterium tuberculosis str. Haarlem] >gi|148504610|gb|ABQ72419.1| 30S ribosomal protein S7 [Mycobacterium tuberculosis H37Ra] >gi|148720415|gb|ABR05040.1| 30S ribosomal protein S7 rpsG [Mycobacterium tuberculosis F11] (156 aa)
Score = 405, Expect = 2.5e-38, Identities = 82/154 (53%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R+R EK+MIE+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|57242430|ref|ZP_00370368.1| ribosomal protein S7 [Campylobacter upsaliensis RM3195] >gi|57016715|gb|EAL53498.1| ribosomal protein S7 [Campylobacter upsaliensis RM3195] (156 aa)
Score = 405, Expect = 2.8e-38, Identities = 85/155 (54%), Positives = 117/155 (75%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED-GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  REILPDP+Y ++++TK IN++M +GKK  A  I+Y + + I KK  E  GI++F  A+ENI P LE++ RRV G+ +QVP  V   R+Q L +RW+I  ARKR+E++MIEKLA E++DA+   GA+FKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKAPIREILPDPIYGNKIITKFINSLMYDGKKSTATTILYGALETIDKKGGEKKGIDIFNDAIENIKPLLEVKSRRVGGATYQVPVEVRPARQQALAIRWIISFARKRSERTMIEKLAGELMDAANSKGASFKKKEDTYKMAEANKAFAHYRW 156
>gi|159039838|ref|YP_001539091.1| 30S ribosomal protein S7 [Salinispora arenicola CNS-205] >gi|189045626|sp|A8M533|RS7_SALAI 30S ribosomal protein S7 >gi|157918673|gb|ABW00101.1| ribosomal protein S7 [Salinispora arenicola CNS-205] (156 aa)
Score = 405, Expect = 2.8e-38, Identities = 80/154 (51%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A +R ++ DPVYNS LVT+ +N I+L GK+ LA+ IVY++ +  ++K+  D +   K+A++N+ P+LE+R RRV G+ +QVP  V   R  TLGLRWL+  AR R EK+M+E+L  E++DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPRRPLVADPVYNSPLVTQLVNKILLRGKRQLAETIVYEALEGCREKSGTDPVVTLKRAMDNVKPTLEVRSRRVGGATYQVPVEVRPARATTLGLRWLVTYARARREKTMVERLMNELLDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|194246785|ref|YP_002004424.1| 30S ribosomal protein S7 [Candidatus Phytoplasma mali] >gi|193807142|emb|CAP18580.1| 30S ribosomal protein S7 [Candidatus Phytoplasma mali] (156 aa)
Score = 405, Expect = 2.8e-38, Identities = 88/154 (57%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KR++LPD  YNS+LVTK IN IM +GKK  AQ I+Y +F+ +K+ T  + I VF +AL+NIMP LE+R RR+ G  +Q+P+ V  ERKQ+LGLRWL+  A+KRNEK+M +KLA EIIDA+ G G A KK+E+ H+MAEANK+FAH R+
  S:     3 RKKSINKRDVLPDVFYNSKLVTKTINTIMKDGKKATAQAILYGAFNKVKEITQREPIIVFDEALKNIMPELEVRSRRIGGQKYQIPSEVRPERKQSLGLRWLVQFAQKRNEKTMQQKLAKEIIDAASGNGLAVKKREEIHRMAEANKSFAHYRW 156
>gi|23011449|ref|ZP_00051804.1| COG0049: Ribosomal protein S7 [Magnetospirillum magnetotacticum MS-1] (156 aa)
Score = 405, Expect = 2.8e-38, Identities = 79/154 (51%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI+PD  Y   ++TK +N+IM EGKK  A++IVY +FD+++ + + + IEVF+ AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RN+++MIE+L+AE++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKREIIPDAKYGDVVLTKFMNSIMYEGKKSTAERIVYGAFDIVESRAHANPIEVFRAALDNVAPAIEVRSRRVGGATYQVPVEVRTERRQALAIRWLIQAARARNDRTMIERLSAELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|90424941|ref|YP_533311.1| 30S ribosomal protein S7 [Rhodopseudomonas palustris BisB18] >gi|109894846|sp|Q211E4|RS7_RHOPB 30S ribosomal protein S7 >gi|90106955|gb|ABD88992.1| SSU ribosomal protein S7P [Rhodopseudomonas palustris BisB18] (156 aa)
Score = 404, Expect = 3.1e-38, Identities = 79/154 (51%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+ PDP + + ++TK +N++M  GKK +A+ IVY + ++I+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS G G A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHSAEKREVNPDPKFGNVILTKFMNSVMYAGKKSVAEGIVYGALEIIEAKTKQGPLPVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSVRRQALGIRWLISAARDRNEKTMTERLSAELLDASNGRGNAVKKREDVHRMAEANRAFSHYRW 156
>gi|15612184|ref|NP_223836.1| 30S ribosomal protein S7 [Helicobacter pylori J99] >gi|15645810|ref|NP_207987.1| 30S ribosomal protein S7 [Helicobacter pylori 26695] >gi|108563560|ref|YP_627876.1| 30S ribosomal protein S7 [Helicobacter pylori HPAG1] >gi|109948059|ref|YP_665287.1| 30S ribosomal protein S7 [Helicobacter acinonychis str. Sheeba] >gi|123066106|sp|Q17VN8|RS7_HELAH 30S ribosomal protein S7 >gi|123073738|sp|Q1CS70|RS7_HELPH 30S ribosomal protein S7 >gi|54039541|sp|P66610|RS7_HELPJ 30S ribosomal protein S7 >gi|54041982|sp|P66609|RS7_HELPY 30S ribosomal protein S7 >gi|2314355|gb|AAD08240.1| ribosomal protein S7 (rps7) [Helicobacter pylori 26695] >gi|4155708|gb|AAD06690.1| 30S RIBOSOMAL PROTEIN S7 [Helicobacter pylori J99] >gi|107837333|gb|ABF85202.1| ribosomal protein S7 [Helicobacter pylori HPAG1] >gi|109715280|emb|CAK00288.1| 30S ribosomal protein S7 [Helicobacter acinonychis str. Sheeba] (155 aa)
Score = 404, Expect = 3.2e-38, Identities = 84/155 (54%), Positives = 122/155 (78%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+L DPVY +++VTK IN +M +GKK +A++I+Y++F+ I++K+ E GIEVF+KALE + P +E+R RRV G+ +QVP  V   R+Q+L +RW++ + RKRNE+ M+++LA E++DA+   GAAFKKKED HKMAEANKAFAH R+
  S:     1 MRRRKAPVREVLGDPVYGNKVVTKFINKMMFDGKKSVAEKIIYKAFNKIEEKSGEKGIEVFEKALERVRPLVEVRSRRVGGATYQVPVEVRASRQQSLSIRWILEATRKRNERMMVDRLANELMDAASDKGAAFKKKEDVHKMAEANKAFAHYRW 155
>gi|145225653|ref|YP_001136331.1| 30S ribosomal protein S7 [Mycobacterium gilvum PYR-GCK] >gi|189045617|sp|A4T1R4|RS7_MYCGI 30S ribosomal protein S7 >gi|145218139|gb|ABP47543.1| SSU ribosomal protein S7P [Mycobacterium gilvum PYR-GCK] (156 aa)
Score = 404, Expect = 3.5e-38, Identities = 82/154 (53%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  ++KT  D +   K+A++N+ PSLE+R RRV G+ +QVP  V  +R  TL LRWL+  ++ R EK+MIE+LA EI+DAS G GAA K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLDGKKSLAERIVYGALEQAREKTGTDPVVTLKRAMDNVKPSLEVRSRRVGGATYQVPVEVRPDRSVTLALRWLVSFSKARREKTMIERLANEILDASNGLGAAVKRREDTHKMAEANRAFAHYRW 156
>gi|88854691|ref|ZP_01129357.1| 30S ribosomal protein S7 [marine actinobacterium PHSC20C1] >gi|88815852|gb|EAR25708.1| 30S ribosomal protein S7 [marine actinobacterium PHSC20C1] (156 aa)
Score = 404, Expect = 3.6e-38, Identities = 81/154 (52%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY + +V++ +N I+L+GKKGLA++IVY + + + +KT +D +   KKAL+N+ P+LE++ RRV GS +QVP  V   R  TL LRWL   A+ R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVVADPVYGAPIVSQLVNKILLDGKKGLAERIVYGALEGVTEKTGQDAVVTLKKALDNVRPTLEVKSRRVGGSTYQVPVEVKSHRANTLALRWLTSYAKGRREKTMTERLTNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|188527982|ref|YP_001910669.1| 30S ribosomal protein S7 [Helicobacter pylori Shi470] >gi|188144222|gb|ACD48639.1| 30S ribosomal protein S7 [Helicobacter pylori Shi470] (155 aa)
Score = 404, Expect = 4.0e-38, Identities = 84/155 (54%), Positives = 122/155 (78%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+L DPVY +++VTK IN +M +GKK +A++I+Y++F+ I++K+ E GIEVF+KALE + P +E+R RRV G+ +QVP  V   R+Q+L +RW++ + RKRNE+ M+++LA E++DA+   GAAFKKKED HKMAEANKAFAH R+
  S:     1 MRRRKAPVREVLGDPVYGNKVVTKFINKMMYDGKKSVAEKIIYKAFNKIEEKSGEKGIEVFEKALERVRPLVEVRSRRVGGATYQVPVEVRASRQQSLSIRWILEATRKRNERMMVDRLANELMDAASDKGAAFKKKEDVHKMAEANKAFAHYRW 155
>gi|111018920|ref|YP_701892.1| 30S ribosomal protein S7 [Rhodococcus sp. RHA1] >gi|123340777|sp|Q0SFF2|RS7_RHOSR 30S ribosomal protein S7 >gi|110818450|gb|ABG93734.1| 30S ribosomal protein S7 [Rhodococcus sp. RHA1] (156 aa)
Score = 404, Expect = 4.0e-38, Identities = 82/154 (53%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT+ +N I+L+GKK  A++IVY++ +  ++KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V   R  TL LRWL+  +R+R EK+M+E+LA E++DAS G GAA K++EDTHKMAEANKAFAH R+
  S:     3 RKGPAPKRPLINDPVYGSPLVTQLVNKILLDGKKSTAERIVYEALEQAREKTGTDPVVTLKRALDNVKPALEVRSRRVGGATYQVPVEVRPGRSTTLALRWLVTFSRQRREKTMVERLANELLDASNGLGAAVKRREDTHKMAEANKAFAHYRW 156
>gi|118616548|ref|YP_904880.1| 30S ribosomal protein S7 [Mycobacterium ulcerans Agy99] >gi|166227469|sp|A0PM40|RS7_MYCUA 30S ribosomal protein S7 >gi|118568658|gb|ABL03409.1| 30S ribosomal protein S7, RpsG [Mycobacterium ulcerans Agy99] (156 aa)
Score = 403, Expect = 4.3e-38, Identities = 81/154 (52%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  +  T  D +   K+AL+N+ P LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R+R EK+MIE+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLQGKKSLAERIVYGALEQARDNTGTDPVITLKRALDNVKPVLEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|163868654|ref|YP_001609863.1| 30S ribosomal protein S7 [Bartonella tribocorum CIP 105476] >gi|189045598|sp|A9IW33|RS7_BART1 30S ribosomal protein S7 >gi|161018310|emb|CAK01868.1| 30S ribosomal protein S7 [Bartonella tribocorum CIP 105476] (156 aa)
Score = 403, Expect = 4.5e-38, Identities = 77/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   ++TK +NAIM +GKK +A++IVY + D ++KK   D +++F +ALEN+ P +E+R RRV G+ +QVP  V  +R+Q L +RWLI +A  RNE +MIE+L+ E++DA+   G+A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDLVITKFMNAIMFDGKKSVAERIVYGALDSVEKKVKADPVDLFHRALENVAPHIEVRSRRVGGATYQVPIDVRPDRRQALAIRWLISAACGRNETTMIERLSGELMDAANNRGSAVKKREDVHRMAEANRAFSHYRW 156
>gi|188581371|ref|YP_001924816.1| ribosomal protein S7 [Methylobacterium populi BJ001] >gi|179344869|gb|ACB80281.1| ribosomal protein S7 [Methylobacterium populi BJ001] (156 aa)
Score = 403, Expect = 4.5e-38, Identities = 79/154 (51%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI+PD  Y   ++TK +N+IM EGKK  A++IVY +FDL++ +   + IEVF+ AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RN+++M+E+L+AE++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKREIIPDAKYGDVVLTKFMNSIMYEGKKSTAERIVYGAFDLVESRARANPIEVFRAALDNVAPAIEVRSRRVGGATYQVPVEVRTERRQALAIRWLIQAARGRNDRTMVERLSAELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|157738196|ref|YP_001490880.1| 30S ribosomal protein S7 [Arcobacter butzleri RM4018] >gi|167011253|sp|A8EW87|RS7_ARCB4 30S ribosomal protein S7 >gi|157700050|gb|ABV68210.1| 30S ribosomal protein S7 [Arcobacter butzleri RM4018] (155 aa)
Score = 403, Expect = 4.6e-38, Identities = 82/155 (52%), Positives = 120/155 (77%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  REI+ DP+YNS+++TK +NAIML+GKK +A++I+Y +   +  +  E G ++F++A+EN+ P LE+R RRV G+ +QVP  V   R+QTL LRWLI ++RKRNE++M+E+LA E+ +A+   GA+FKKKED H+MAEANKAFAH R+
  S:     1 MRRRKAPVREIMADPIYNSKVITKFVNAIMLDGKKSVAEKILYGAIANLDARGEEKGFDLFERAIENVKPLLEVRSRRVGGATYQVPVEVRAVRRQTLALRWLIDASRKRNERTMVERLANELFEAANERGASFKKKEDVHRMAEANKAFAHYRW 155
>gi|154174218|ref|YP_001408637.1| 30S ribosomal protein S7 [Campylobacter curvus 525.92] >gi|166227430|sp|A7GZJ5|RS7_CAMC5 30S ribosomal protein S7 >gi|112803902|gb|EAU01246.1| ribosomal protein S7 [Campylobacter curvus 525.92] (156 aa)
Score = 403, Expect = 4.7e-38, Identities = 83/155 (53%), Positives = 119/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNE-DGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+LPDP+Y ++++TK IN++M +GKK +A +I+Y +   I+KK  +  GI+VF  A+EN+ P LE++ RRV G+ +QVP  V   R+Q L +RWLI  ARKR+E++MI+KLA E++DA+   GA+FKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKAPVREVLPDPIYGNKVITKFINSLMYDGKKSVATEIMYGALKAIEKKGGDVKGIDVFNDAIENVKPILEVKSRRVGGATYQVPVEVRPVRQQALAIRWLITYARKRSERTMIDKLANELLDAANSKGASFKKKEDTYKMAEANKAFAHYRW 156
>gi|15791856|ref|NP_281679.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|57237544|ref|YP_178558.1| 30S ribosomal protein S7 [Campylobacter jejuni RM1221] >gi|57504743|ref|ZP_00370797.1| ribosomal protein S7 [Campylobacter coli RM2228] >gi|86149064|ref|ZP_01067296.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|86151830|ref|ZP_01070044.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153686|ref|ZP_01071889.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|88596968|ref|ZP_01100204.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612104|ref|YP_001000188.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 81-176] >gi|148925868|ref|ZP_01809555.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. jejuni CG8486] >gi|153951518|ref|YP_001398476.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. doylei 269.97] >gi|157414774|ref|YP_001482030.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 81116] >gi|166227433|sp|A7H4P6|RS7_CAMJD 30S ribosomal protein S7 >gi|166227434|sp|A1VYJ7|RS7_CAMJJ 30S ribosomal protein S7 >gi|172047077|sp|A8FKR6|RS7_CAMJ8 30S ribosomal protein S7 >gi|17367764|sp|Q9PI17|RS7_CAMJE 30S ribosomal protein S7 >gi|81675615|sp|Q5HVX7|RS7_CAMJR 30S ribosomal protein S7 >gi|57019399|gb|EAL56097.1| ribosomal protein S7 [Campylobacter coli RM2228] >gi|57166348|gb|AAW35127.1| ribosomal protein S7 [Campylobacter jejuni RM1221] >gi|85840422|gb|EAQ57679.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85841459|gb|EAQ58707.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 260.94] >gi|85842647|gb|EAQ59859.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni HB93-13] >gi|87250066|gb|EAQ73024.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190657|gb|EAQ94630.1| ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359853|emb|CAL34640.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|145844854|gb|EDK21958.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. jejuni CG8486] >gi|152938964|gb|ABS43705.1| ribosomal protein S7 [Campylobacter jejuni subsp. doylei 269.97] >gi|157385738|gb|ABV52053.1| 30S ribosomal protein S7 [Campylobacter jejuni subsp. jejuni 81116] (156 aa)
Score = 403, Expect = 4.7e-38, Identities = 84/155 (54%), Positives = 118/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED-GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+LPDP+Y ++++TK IN++M +GKK  A  I+Y + + I KK  E  GI++F  A+ENI P LE++ RRV G+ +QVP  V   R+Q L +RW+I  ARKR+E++MI+KLAAE++DA+   GA+FKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKAPVREVLPDPIYGNKVITKFINSLMYDGKKSTATTIMYGALEAIDKKGGEKKGIDIFNDAIENIKPLLEVKSRRVGGATYQVPVEVRPARQQALAIRWIISFARKRSERTMIDKLAAELLDAANSKGASFKKKEDTYKMAEANKAFAHYRW 156
>gi|94987385|ref|YP_595318.1| 30S ribosomal protein S7 [Lawsonia intracellularis PHE/MN1-00] >gi|123082136|sp|Q1MPT0|RS7_LAWIP 30S ribosomal protein S7 >gi|94731634|emb|CAJ54997.1| ribosomal protein S7 [Lawsonia intracellularis PHE/MN1-00] (156 aa)
Score = 403, Expect = 4.8e-38, Identities = 78/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +RE+LPDP+YNSRL ++ +N +M +GKKG+A++I Y + + + +KT E+ +  F++AL+N+ P  E++ RRV G+ +QVP  V  +R+ +L +RWLI  AR R EK M+ KLAAE +DA    G A KKKEDTH+MAEANKAFAH R+
  S:     3 RKGPVPRREVLPDPIYNSRLASRFVNRLMYDGKKGVAEKIFYGALENLSEKTGEEPLRAFERALDNVKPQFEVKARRVGGATYQVPMEVRSDRQISLSIRWLITYARSRGEKGMVNKLAAEFLDAFNNRGGAVKKKEDTHRMAEANKAFAHYRW 156
>gi|15644252|ref|NP_229304.1| 30S ribosomal protein S7 [Thermotoga maritima MSB8] >gi|6226701|sp|P38526|RS7_THEMA 30S ribosomal protein S7 >gi|4982070|gb|AAD36571.1|AE001799_3 ribosomal protein S7 [Thermotoga maritima MSB8] (155 aa)
Score = 403, Expect = 4.9e-38, Identities = 85/155 (54%), Positives = 116/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ RA KR+I PDPV+   LV K IN +M +GKK +AQ+IVY +FD+I++KT +D +EVF++A+EN+ P LE+R RRV G+ +QVP  V + R+ +L LRW++ +AR +  + M EKLA EII A   TG A KKKEDTH+MAEAN+AFAH R+
  S:     1 MRRRRAEKRQIPPDPVFGDVLVAKLINRVMWDGKKTIAQKIVYGAFDIIREKTKKDPLEVFRQAVENVKPVLEVRPRRVGGATYQVPIEVQEPRRTSLALRWIVEAARAKKGRPMKEKLAEEIIAAYNNTGTAIKKKEDTHRMAEANRAFAHYRW 155
>gi|120402291|ref|YP_952120.1| 30S ribosomal protein S7 [Mycobacterium vanbaalenii PYR-1] >gi|166227470|sp|A1T4L4|RS7_MYCVP 30S ribosomal protein S7 >gi|119955109|gb|ABM12114.1| SSU ribosomal protein S7P [Mycobacterium vanbaalenii PYR-1] (156 aa)
Score = 403, Expect = 5.0e-38, Identities = 81/154 (52%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  ++KT  D +   K+A++N+ PSLE+R RRV G+ +QVP  V  +R  TL LRWL+  ++ R EK+M+E+LA EI+DAS G GAA K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLDGKKSLAERIVYGALEQAREKTGTDPVVTLKRAMDNVKPSLEVRSRRVGGATYQVPVEVRPDRSVTLALRWLVSFSKARREKTMVERLANEILDASNGLGAAVKRREDTHKMAEANRAFAHYRW 156
>gi|38233080|ref|NP_938847.1| 30S ribosomal protein S7 [Corynebacterium diphtheriae NCTC 13129] >gi|62287283|sp|Q6NJD7|RS7_CORDI 30S ribosomal protein S7 >gi|38199339|emb|CAE48972.1| 30S ribosomal protein S7 [Corynebacterium diphtheriae] (155 aa)
Score = 403, Expect = 5.0e-38, Identities = 84/155 (54%), Positives = 111/155 (71%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRKN A KR I+ DPVY S +VT+ +N ++L+GKK  A++IVY + D  K+KT  D +   +KAL NI P LE+R RRV G+ +QVP  V   R  TL LRWL+   R+R E +MIE+LA EI+DA+ G GA+ K++EDTHKMAEAN+AFAH R+
  S:     1 MRKNAAPKRPIVKDPVYGSEVVTQLVNKVLLDGKKSTAERIVYGALDKCKEKTGIDPVLTLEKALGNIKPDLEVRSRRVGGATYQVPVEVRPARANTLALRWLVTFTRQRRENTMIERLANEILDAANGLGASVKRREDTHKMAEANRAFAHYRW 155
>gi|148270418|ref|YP_001244878.1| 30S ribosomal protein S7 [Thermotoga petrophila RKU-1] >gi|170289187|ref|YP_001739425.1| ribosomal protein S7 [Thermotoga sp. RQ2] >gi|166228492|sp|A5IM79|RS7_THEP1 30S ribosomal protein S7 >gi|147735962|gb|ABQ47302.1| SSU ribosomal protein S7P [Thermotoga petrophila RKU-1] >gi|170176690|gb|ACB09742.1| ribosomal protein S7 [Thermotoga sp. RQ2] (155 aa)
Score = 403, Expect = 5.2e-38, Identities = 85/155 (54%), Positives = 114/155 (73%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ RA  R++ PDPVY   LV K IN +M +GKK  AQ+IVY +FD+I++KT +D +EVF++A+EN+ P LE+R RRV G+ +QVP  V + R+ +L LRW++ +AR R  + M EKLA EII A   TG A KKKEDTH+MAEAN+AFAH R+
  S:     1 MRRRRAEIRQVPPDPVYGDVLVAKLINKVMWDGKKTTAQKIVYGAFDIIREKTKKDPLEVFRQAVENVKPVLEVRPRRVGGATYQVPIEVQEPRRTSLALRWIVEAARARKGRPMKEKLAEEIIAAYNNTGTAIKKKEDTHRMAEANRAFAHYRW 155
>gi|108797958|ref|YP_638155.1| 30S ribosomal protein S7 [Mycobacterium sp. MCS] >gi|119867055|ref|YP_937007.1| 30S ribosomal protein S7 [Mycobacterium sp. KMS] >gi|126433621|ref|YP_001069312.1| 30S ribosomal protein S7 [Mycobacterium sp. JLS] >gi|123369688|sp|Q1BDD5|RS7_MYCSS 30S ribosomal protein S7 >gi|166227466|sp|A3PV94|RS7_MYCSJ 30S ribosomal protein S7 >gi|166227467|sp|A1UBK9|RS7_MYCSK 30S ribosomal protein S7 >gi|108768377|gb|ABG07099.1| SSU ribosomal protein S7P [Mycobacterium sp. MCS] >gi|119693144|gb|ABL90217.1| SSU ribosomal protein S7P [Mycobacterium sp. KMS] >gi|126233421|gb|ABN96821.1| SSU ribosomal protein S7P [Mycobacterium sp. JLS] (156 aa)
Score = 402, Expect = 5.3e-38, Identities = 81/154 (52%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  ++ R EK+M+E+LA EI+DAS G GAA K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLDGKKSLAERIVYGALEQARDKTGTDPVVTLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSVTLALRWLVSFSKARREKTMVERLANEILDASNGLGAAVKRREDTHKMAEANRAFAHYRW 156
>gi|156451186|ref|ZP_02057563.1| ribosomal protein S7 [Methylobacterium chloromethanicum CM4] >gi|163851581|ref|YP_001639624.1| 30S ribosomal protein S7 [Methylobacterium extorquens PA1] >gi|156189949|gb|EDO22141.1| ribosomal protein S7 [Methylobacterium chloromethanicum CM4] >gi|163663186|gb|ABY30553.1| ribosomal protein S7 [Methylobacterium extorquens PA1] (156 aa)
Score = 402, Expect = 5.5e-38, Identities = 79/154 (51%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI+PD  Y   ++TK +N+IM EGKK  A++IVY +FD+++ +   + IEVF+ AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RN+++MIE+L+AE++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKREIIPDAKYGDVVLTKFMNSIMYEGKKSTAERIVYGAFDIVENRARANPIEVFRAALDNVAPAIEVRSRRVGGATYQVPVEVRTERRQALAIRWLIQAARGRNDRTMIERLSAELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|170788993|gb|EDT30037.1| ribosomal protein S7 [Oligotropha carboxidovorans OM5] (156 aa)
Score = 402, Expect = 5.9e-38, Identities = 79/154 (51%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+ PDP + + +++K +N+IM +GKK +A+ IVY + D I+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RW+I +AR RNEK+M E+L+AE++DAS   G A KK+ED HKMAEAN+AF+H R+
  S:     3 RRHSAEKREVNPDPKFGNIVISKFMNSIMYDGKKSVAENIVYGALDTIEAKTKQSPLSVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWIIAAARGRNEKTMTERLSAELLDASNNRGNAVKKREDVHKMAEANRAFSHYRW 156
>gi|78776557|ref|YP_392872.1| 30S ribosomal protein S7 [Sulfurimonas denitrificans DSM 1251] >gi|109894860|sp|Q30TP4|RS7_THIDN 30S ribosomal protein S7 >gi|78497097|gb|ABB43637.1| SSU ribosomal protein S7P [Sulfurimonas denitrificans DSM 1251] (155 aa)
Score = 402, Expect = 6.7e-38, Identities = 81/155 (52%), Positives = 117/155 (75%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  REI+PDPVY S+++TK IN IM +GKK  A++I+Y + D+I  +  + GI+ F +A+ENI P +E++ RRV G+ +QVP  V   R+ +L +RWL+ ++RKRNE++M E+LA E++DAS   G AFKKKEDT++MAEANKAFAH R+
  S:     1 MRRRKAPVREIMPDPVYGSKVLTKFINKIMFDGKKSTAEKIIYSAMDIISSRGEKTGIDTFNEAIENIKPIIEVKSRRVGGATYQVPVEVRPVRQLSLAIRWLVDASRKRNERTMAERLANELMDASSDKGNAFKKKEDTYRMAEANKAFAHYRW 155
>gi|121601921|ref|YP_988963.1| 30S ribosomal protein S7 [Bartonella bacilliformis KC583] >gi|121602421|ref|YP_988993.1| 30S ribosomal protein S7 [Bartonella bacilliformis KC583] >gi|120614098|gb|ABM44699.1| ribosomal protein S7 [Bartonella bacilliformis KC583] >gi|120614598|gb|ABM45199.1| ribosomal protein S7 [Bartonella bacilliformis KC583] (156 aa)
Score = 401, Expect = 7.3e-38, Identities = 76/154 (49%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   ++TK +NAIM +GKK +A++IVY + D+++ K   D + +F +ALEN+ P +E+R RRV G+ +QVP  V  +R+Q L +RWLI +AR RNE +MI++L+ E++DA+   G A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDVVITKFMNAIMFDGKKSVAERIVYGALDVVEGKVKTDPVALFHQALENVAPHIEVRSRRVGGATYQVPVDVRPDRRQALAIRWLIKAARGRNETAMIDRLSGELVDAANNRGTAVKKREDVHRMAEANRAFSHYRW 156
>gi|41410239|ref|NP_963075.1| 30S ribosomal protein S7 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118467289|ref|YP_883625.1| 30S ribosomal protein S7 [Mycobacterium avium 104] >gi|166227463|sp|A0QL37|RS7_MYCA1 30S ribosomal protein S7 >gi|62287298|sp|Q73SD3|RS7_MYCPA 30S ribosomal protein S7 >gi|41399073|gb|AAS06691.1| RpsG [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118168576|gb|ABK69473.1| ribosomal protein S7 [Mycobacterium avium 104] (156 aa)
Score = 401, Expect = 8.0e-38, Identities = 81/154 (52%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S+LVT+ +N ++L+GKK LA++IVY + +  ++KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R+R EK+M+E+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALENAREKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVSFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|167729444|emb|CAO80355.1| 30S ribosomal subunit protein S7 [Candidatus Cloacamonas acidaminovorans] (156 aa)
Score = 401, Expect = 8.3e-38, Identities = 85/154 (55%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK+RA  RE+LPDP YN   VTK +N +M++GKK +A++IVY +FD+I  KT ED + VFK AL+N+ P +++  RRV G+ +Q+P  V+++  + L  RW+I +AR R+EK+M EKLAAE+I A K  GA+ KK+EDTHKMAEANKAFAHLR+
  S:     3 RKHRAVVREVLPDPKYNDITVTKFMNCLMVKGKKSIAEKIVYGAFDIIAAKTKEDPLVVFKSALDNVRPLVKVVSRRVGGATYQIPIEVNEKNGKALAFRWIIANARARSEKTMTEKLAAELIAAHKKEGASIKKREDTHKMAEANKAFAHLRW 156
>gi|196184715|gb|EDX79691.1| ribosomal protein S7 [Brevundimonas sp. BAL3] (157 aa)
Score = 400, Expect = 9.2e-38, Identities = 81/154 (52%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLI-KKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KRE+LPDP +   +VTK +N +M EGKK +A+ IVY +FD++  KK +++ +  F  AL+N+ PS+E+R RRV G+ +QVP  V  +R++ L +RWL+ +ARKR E +M EKLAAE++DAS   G A KK+EDTHKMAEAN+AF+H R+
  S:     3 RRHRAQKREVLPDPKFGDLIVTKFMNYVMYEGKKAVAENIVYGAFDILADKKKDQEPVATFHAALDNVAPSVEVRSRRVGGATYQVPVEVRPDRRRALAIRWLVNAARKRGENTMTEKLAAELLDASNNRGTAVKKREDTHKMAEANRAFSHYRW 157
>gi|145596438|ref|YP_001160735.1| 30S ribosomal protein S7 [Salinispora tropica CNB-440] >gi|189045629|sp|A4XBQ0|RS7_SALTO 30S ribosomal protein S7 >gi|145305775|gb|ABP56357.1| SSU ribosomal protein S7P [Salinispora tropica CNB-440] (156 aa)
Score = 400, Expect = 9.5e-38, Identities = 79/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A +R ++ DPVYNS LVT+ +N I+L GK+ LA+ +VY + +  ++K+  D +   K+A++N+ P+LE+R RRV G+ +QVP  V   R  TLGLRWL+  AR R EK+M+E+L  E++DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPRRPLVADPVYNSPLVTQLVNKILLRGKRQLAETLVYAALEGCREKSGTDPVVTLKRAMDNVKPTLEVRSRRVGGATYQVPVEVRPARATTLGLRWLVTYARARREKTMVERLMNELLDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|170780728|ref|YP_001709060.1| 30S ribosomal protein S7 [Clavibacter michiganensis subsp. sepedonicus] >gi|189045603|sp|B0RB34|RS7_CLAMS 30S ribosomal protein S7 >gi|169155296|emb|CAQ00399.1| 30S ribosomal protein S7 [Clavibacter michiganensis subsp. sepedonicus] (156 aa)
Score = 400, Expect = 1.0e-37, Identities = 81/154 (52%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY + +V++ +N I+L+GKKGLA++IVY +   +  K  +D +   KKAL+N+ P+LE+R RRV GS +QVP  V   R  TL LRWL   A+ R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVVADPVYGAPIVSQLVNKILLDGKKGLAERIVYDALAGVAAKNGQDAVVTLKKALDNVRPALEVRSRRVGGSTYQVPIEVKPHRANTLALRWLTTYAKSRREKTMTERLTNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|148273806|ref|YP_001223367.1| 30S ribosomal protein S7 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|166227436|sp|A5CUB8|RS7_CLAM3 30S ribosomal protein S7 >gi|147831736|emb|CAN02705.1| 30S ribosomal protein S7 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (156 aa)
Score = 400, Expect = 1.1e-37, Identities = 81/154 (52%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY + +V++ +N I+L+GKKGLA++IVY +   +  K  +D +   KKAL+N+ P+LE+R RRV GS +QVP  V   R  TL LRWL   A+ R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVVADPVYGAPIVSQLVNKILLDGKKGLAEKIVYDALAGVAAKNGQDAVVTLKKALDNVRPALEVRSRRVGGSTYQVPIEVKPHRANTLALRWLTTYAKSRREKTMTERLTNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|169630929|ref|YP_001704578.1| 30S ribosomal protein S7 [Mycobacterium abscessus] >gi|169242896|emb|CAM63924.1| 30S ribosomal protein S7 [Mycobacterium abscessus] (156 aa)
Score = 400, Expect = 1.1e-37, Identities = 78/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A  R ++ DPVY S+LVT+ +N ++L+GKK +A++IVY + +  + KT  D +   K+A++N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R R EK+M+E+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPSRPLVNDPVYGSQLVTQLVNKVLLDGKKSIAERIVYGALEQARDKTGTDPVVTLKRAMDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVTFSRARREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|19551737|ref|NP_599739.1| 30S ribosomal protein S7 [Corynebacterium glutamicum ATCC 13032] >gi|62389392|ref|YP_224794.1| 30S ribosomal protein S7 [Corynebacterium glutamicum ATCC 13032] >gi|145294646|ref|YP_001137467.1| 30S ribosomal protein S7 [Corynebacterium glutamicum R] >gi|23822113|sp|Q8NT20|RS7_CORGL 30S ribosomal protein S7 >gi|21323259|dbj|BAB97887.1| Ribosomal protein S7 [Corynebacterium glutamicum ATCC 13032] >gi|41324726|emb|CAF19208.1| 30S RIBOSOMAL PROTEIN S7 [Corynebacterium glutamicum ATCC 13032] >gi|140844566|dbj|BAF53565.1| hypothetical protein [Corynebacterium glutamicum R] (155 aa)
Score = 399, Expect = 1.2e-37, Identities = 80/155 (51%), Positives = 112/155 (72%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK+ A KR ++ DPVY S LVT+ +N I++ GKK  A++IVY + ++ ++KT  D +   +KAL N+ P LE+R RRV G+ +QVP  V  ER  TL LRWL+   R+R E +MIE+LA E++DA+ G GA+ K++EDTHKMAEAN+AFAH R+
  S:     1 MRKSAAPKRPVVQDPVYKSELVTQLVNKILIGGKKSTAERIVYGALEICREKTGTDPVGTLEKALGNVRPDLEVRSRRVGGATYQVPVDVRPERANTLALRWLVTFTRQRRENTMIERLANELLDAANGLGASVKRREDTHKMAEANRAFAHYRW 155
>gi|157164182|ref|YP_001466549.1| 30S ribosomal protein S7 [Campylobacter concisus 13826] >gi|166227429|sp|A7ZCP1|RS7_CAMC1 30S ribosomal protein S7 >gi|112800032|gb|EAT97376.1| ribosomal protein S7 [Campylobacter concisus 13826] (156 aa)
Score = 399, Expect = 1.2e-37, Identities = 83/155 (53%), Positives = 119/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNE-DGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE+LPDP+Y ++++TK IN++M +GKK +A +I+Y +   I+KK  E  GI+VF  A+EN+ P LE++ RRV G+ +QVP  V   R+Q L +RWLI  ARKR+E++M++KLA E++DA+   GA+FKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKAPVREVLPDPIYGNKIITKFINSLMYDGKKSVATEIMYGAIKAIEKKNAEVKGIDVFNDAIENVKPILEVKSRRVGGATYQVPVEVRPARQQALAIRWLITFARKRSERTMVDKLANELLDAANSKGASFKKKEDTYKMAEANKAFAHYRW 156
>gi|49475798|ref|YP_033839.1| 30S ribosomal protein S7 [Bartonella henselae str. Houston-1] >gi|62287260|sp|Q6G2W1|RS7_BARHE 30S ribosomal protein S7 >gi|49238605|emb|CAF27846.1| 30S ribosomal protein s7 [Bartonella henselae str. Houston-1] (156 aa)
Score = 399, Expect = 1.4e-37, Identities = 75/154 (48%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A KREI PDP +   ++TK +NAIM +GKK +A++IVY + D+++ K   D + +F +ALEN+ P +E+R RRV G+ +QVP  V  +R+Q L +RWLI +AR RNE +MI++L+ E++DA+   G+A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHKAEKREINPDPKFGDLVITKFMNAIMFDGKKSVAERIVYGALDVVESKVKSDPVALFHRALENVAPHIEVRSRRVGGATYQVPIDVRPDRRQALAIRWLISAARGRNEATMIDRLSGELMDAANNRGSAVKKREDVHRMAEANRAFSHYRW 156
>gi|49474408|ref|YP_032450.1| 30S ribosomal protein S7 [Bartonella quintana str. Toulouse] >gi|62287259|sp|Q6FZB8|RS7_BARQU 30S ribosomal protein S7 >gi|49239912|emb|CAF26310.1| 30s ribosomal protein s7 [Bartonella quintana str. Toulouse] (156 aa)
Score = 399, Expect = 1.4e-37, Identities = 76/154 (49%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +   ++TK +NAIM +GKK +A++IVY + D+++ K   D + +F +ALEN+ P +E+R RRV G+ +QVP  V  +R++ L +RWLI +AR RNE +MI +LA E++DA+   G+A KK+ED H+MAEAN+AF+H R+
  S:     3 RRHRAEKREINPDPKFGDLVITKFMNAIMFDGKKSVAERIVYGALDVVESKVKSDPVVLFHQALENVAPHIEVRSRRVGGATYQVPVDVRPDRRRALAVRWLITAARGRNETTMINRLAGELMDAANNRGSAVKKREDVHRMAEANRAFSHYRW 156
>gi|401047|sp|P30764|RS7_MYCLE 30S ribosomal protein S7 >gi|44389|emb|CAA78672.1| ribosomal protein S12 [Mycobacterium leprae] (156 aa)
Score = 399, Expect = 1.4e-37, Identities = 82/154 (53%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++  PVY S+LVT+ +N I+L+GKK LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  TL LRWL+  +R+R EK+MIE+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVKHPVYGSQLVTQLVNKILLKGKKSLAERIVYGALEHARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGFSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|163759414|ref|ZP_02166500.1| 30S ribosomal protein S7 [Hoeflea phototrophica DFL-43] >gi|162283818|gb|EDQ34103.1| 30S ribosomal protein S7 [Hoeflea phototrophica DFL-43] (156 aa)
Score = 399, Expect = 1.4e-37, Identities = 77/154 (50%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI PDP +   +++K +NAIM+ GKK +A+QIVY + D ++++  ++ + +F +ALEN+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +ARKRNE +MIE+L+ E++DA+   G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHSAEKREINPDPKFGDLVLSKFMNAIMMHGKKSVAEQIVYGALDQVEQRAKQEPVPMFHQALENVAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIAAARKRNETTMIERLSGELMDAANNRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|153009282|ref|YP_001370497.1| 30S ribosomal protein S7 [Ochrobactrum anthropi ATCC 49188] >gi|166227474|sp|A6X0B4|RS7_OCHA4 30S ribosomal protein S7 >gi|151561170|gb|ABS14668.1| ribosomal protein S7 [Ochrobactrum anthropi ATCC 49188] (156 aa)
Score = 399, Expect = 1.4e-37, Identities = 76/154 (49%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A KREI PDP +   ++TK +NA+ML GKK +A+ IVY + D+I+ K   + + +F +AL+N+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +MI++L+ E++DA+   G+A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHKAEKREINPDPKFGDLVITKFMNAVMLHGKKSVAESIVYGALDVIEAKAKSEPVALFHQALDNVAPHIEVRSRRVGGATYQVPVDVRPERRQALAIRWLINAARGRNETTMIDRLSGELLDAANNRGSAVKKREDTHRMAEANRAFSHYRW 156
>gi|83594024|ref|YP_427776.1| 30S ribosomal protein S7 [Rhodospirillum rubrum ATCC 11170] >gi|109894847|sp|Q2RQV6|RS7_RHORT 30S ribosomal protein S7 >gi|83576938|gb|ABC23489.1| SSU ribosomal protein S7P [Rhodospirillum rubrum ATCC 11170] (156 aa)
Score = 398, Expect = 1.6e-37, Identities = 78/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KRE+LPD  +   ++ K IN++ML+GKK +A++IVY +F+ I+ KT +D ++VF  AL+N+ PS+E+R RRV G+ +QVP  V  +R+Q LGLRWLI  ARKR+E +M+++L  E +DA+   G A KK+EDTH+MA+ANKAF+H R+
  S:     3 RRRAAEKREVLPDAKFGDLVLAKFINSVMLQGKKAVAEKIVYGAFERIQSKTGQDPVKVFHDALDNVKPSVEVRSRRVGGATYQVPVEVRPDRRQALGLRWLIDFARKRSETTMVDRLTGEFLDAASNRGGAVKKREDTHRMADANKAFSHYRW 156
>gi|167644768|ref|YP_001682431.1| 30S ribosomal protein S7 [Caulobacter sp. K31] >gi|189045601|sp|B0SUQ5|RS7_CAUSK 30S ribosomal protein S7 >gi|167347198|gb|ABZ69933.1| ribosomal protein S7 [Caulobacter sp. K31] (157 aa)
Score = 397, Expect = 2.0e-37, Identities = 78/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDG-IEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ RA KR++LPDP +   +VTK +N +M EGKK +A+ I+Y +FD+++ K  + G +E F  AL+N+ P++E+R RRV G+ +QVP  V  +R++ L +RWL+ +ARKR E +M EKLA E++DAS   G A KK+EDTHKMAEAN+AF+H R+
  S:     3 RRRRAEKRQVLPDPKFGDLIVTKFMNYVMYEGKKAVAENIIYGAFDILENKRKDQGPLETFHSALDNVAPAIEVRSRRVGGATYQVPVEVRPDRRRALAIRWLVTAARKRGENTMTEKLAGELLDASNNRGTAVKKREDTHKMAEANRAFSHYRW 157
>gi|152964652|ref|YP_001360436.1| 30S ribosomal protein S7 [Kineococcus radiotolerans SRS30216] >gi|189045614|sp|A6W5T3|RS7_KINRD 30S ribosomal protein S7 >gi|151359169|gb|ABS02172.1| ribosomal protein S7 [Kineococcus radiotolerans SRS30216] (156 aa)
Score = 397, Expect = 2.2e-37, Identities = 81/154 (52%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT+ +N I+L+GKK +A+ IVY + +  + KT  D + V K+AL+N+ P++E++ RRV GS +QVP  V   R  TL LRWL+  AR+R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+N+AFAH R+
  S:     3 RKGPAPKRPLVVDPVYQSPLVTQLVNKILLDGKKSVAESIVYGALEGARDKTGGDPVVVLKRALDNVKPAIEVKSRRVGGSTYQVPIEVRPTRSTTLALRWLVGYARQRREKTMTERLLNEILDASNGLGAAVKRREDTHKMAESNRAFAHYRW 156
>gi|177676397|ref|ZP_02946811.1| ribosomal protein S7 [Methylocella silvestris BL2] >gi|172068964|gb|EDT55074.1| ribosomal protein S7 [Methylocella silvestris BL2] (156 aa)
Score = 397, Expect = 2.3e-37, Identities = 76/154 (49%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE++PD  +   ++TK +N+IM +GKK +A+ IVY +FD+I++K   + + VFK+ALEN+ P++E+R RRV G+ +QVP  V  ER+Q L +RW+I +AR RN+K+M+++L+AE++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHSAEKREVIPDAKFGDVILTKFMNSIMYDGKKSVAEAIVYDAFDIIEQKARTEPLGVFKQALENVAPAIEVRSRRVGGATYQVPVEVRMERRQALAIRWIITAARGRNDKTMVDRLSAELMDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|57547703|gb|AAW52542.1| RpsG [Micromonospora sp. ATCC 39149] (156 aa)
Score = 397, Expect = 2.4e-37, Identities = 78/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A ++ ++ DPVYNS LVT+ +N I+L GK+ LA++IVY + +  ++K+  D +   K+A++N+ P+LE+R RRV G+ +QVP  V   R  TLGLRWL+  +R R EK+M+E+L  E++DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPRKPLVADPVYNSPLVTQLVNKILLRGKRQLAERIVYAALEGCREKSGTDPVVTLKRAMDNVKPTLEVRSRRVGGATYQVPVEVRPSRATTLGLRWLVTYSRARREKTMVERLMNELLDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|16127431|ref|NP_421995.1| 30S ribosomal protein S7 [Caulobacter crescentus CB15] >gi|17367632|sp|Q9A3K3|RS7_CAUCR 30S ribosomal protein S7 >gi|13424879|gb|AAK25163.1| ribosomal protein S7 [Caulobacter crescentus CB15] (157 aa)
Score = 396, Expect = 3.0e-37, Identities = 78/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDG-IEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ RA KR++LPDP +   +VTK +N +M EGKK +A+ I+Y +FD+++ K  + G +E F  AL+N+ P++E+R RRV G+ +QVP  V  +R++ L +RWL+ +ARKR E +M EKLA E++DAS   G A KK+EDTHKMAEAN+AF+H R+
  S:     3 RRRRAEKRQVLPDPKFGDLVVTKFMNYVMYEGKKAVAENIIYGAFDILEAKRKDQGPLETFHSALDNVAPAIEVRSRRVGGATYQVPVEVRPDRRRALAIRWLVTAARKRGENTMTEKLAGELLDASNNRGTAVKKREDTHKMAEANRAFSHYRW 157
>gi|124514447|gb|EAY55960.1| Ribosomal protein S7 [Leptospirillum sp. Group II UBA] (157 aa)
Score = 395, Expect = 4.1e-37, Identities = 82/154 (53%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R  R  +RE+ PD  +NSRLV+K IN IM +GKK +A+QI+Y S D+I  KT  D +++FK A++N+ P++E++ RRV G+++QVP  +   RK +L LRW++ SA KR   SM EKLA E++DAS  TG A KK+EDTH+MAEANKAFAH R+
  S:     4 RAGRVDRREVAPDAKFNSRLVSKIINVIMKKGKKSVAEQILYDSLDIIAAKTGGDSLKLFKLAIDNVKPAMEVKSRRVGGASYQVPVEIRPNRKISLALRWIVDSAYKRAGHSMEEKLAGELLDASNNTGGAVKKREDTHRMAEANKAFAHYRW 157
>gi|196478111|gb|ACG77639.1| 30S ribosomal protein S7 [Phenylobacterium zucineum HLK1] (157 aa)
Score = 395, Expect = 4.2e-37, Identities = 79/154 (51%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDG-IEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ RA KRE+LPDP +   +VTK +N +M EGKK +A+ IVY +FD+++ +  + G +E F  AL+N+ P++E+R RRV G+ +QVP  V  ER++ L +RWL+ +AR R E +M EKLA E++DAS   G+A KK+EDTHKMAEAN+AF+H R+
  S:     3 RRRRADKREVLPDPKFGDLVVTKFMNYVMYEGKKAVAENIVYGAFDILEARRKDMGPLETFHAALDNVAPAIEVRSRRVGGATYQVPVEVRPERRRALAIRWLVNAARSRGENTMTEKLAGELLDASSNRGSAVKKREDTHKMAEANRAFSHYRW 157
>gi|134103268|ref|YP_001108929.1| 30S ribosomal protein S7 [Saccharopolyspora erythraea NRRL 2338] >gi|166228473|sp|A4FPM9|RS7_SACEN 30S ribosomal protein S7 >gi|133915891|emb|CAM06004.1| 30S ribosomal protein S7 [Saccharopolyspora erythraea NRRL 2338] (156 aa)
Score = 395, Expect = 4.3e-37, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR +  DPVY+S LVT+ +N ++++GK+ LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V   R  TL LRWL+  +R+R EK+M+E+L  E++DAS G GA+ KK+EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPLHADPVYSSPLVTQLVNKVLVDGKRSLAERIVYAALEGCRDKTGTDPVVTLKRALDNVKPTLEVRSRRVGGATYQVPIEVRAGRSTTLALRWLVTYSRQRREKTMVERLMNELLDASNGLGASVKKREDTHKMAESNKAFAHYRW 156
>gi|152990020|ref|YP_001355742.1| 30S ribosomal protein S7 [Nitratiruptor sp. SB155-2] >gi|166227472|sp|A6Q1M6|RS7_NITSB 30S ribosomal protein S7 >gi|151421881|dbj|BAF69385.1| 30S ribosomal protein S7 [Nitratiruptor sp. SB155-2] (156 aa)
Score = 394, Expect = 4.5e-37, Identities = 83/155 (53%), Positives = 119/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNE-DGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ RA  RE++PDP+Y S++VTK IN +M +GKK  AQ+I Y +  LI++K  E  GI++F +A+EN+ P LE++ RRV G+ +QVP  V   R+Q+L +RW++ +AR RNE++M E+LA E++DA+   GAA+KKKEDT+KMAEANKAFAH R+
  S:     1 MRRRRAPIREVMPDPIYGSKVVTKFINKLMWDGKKSTAQKIFYNALKLIEEKDKEAKGIDIFNEAIENVKPLLEVKSRRVGGATYQVPVEVRPVRQQSLAIRWIVDAARNRNERTMAERLANELLDAANKRGAAYKKKEDTYKMAEANKAFAHYRW 156
>gi|72163049|ref|YP_290706.1| 30S ribosomal protein S7 [Thermobifida fusca YX] >gi|118585375|sp|Q47LI9|RS7_THEFY 30S ribosomal protein S7 >gi|71916781|gb|AAZ56683.1| SSU ribosomal protein S7P [Thermobifida fusca YX] (156 aa)
Score = 394, Expect = 4.6e-37, Identities = 80/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR+++ DPVY S LVT  IN ++ +GK+ LAQ IVY + +  ++KT +D + + K+A++N+ P+LE+R RRV G+ +QVP  V   R  TL LRWL+  AR R EK+M E+L  E++DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRQLMTDPVYGSPLVTALINKVLRDGKRSLAQSIVYNALEGAREKTGQDPLVILKRAIDNVKPTLEVRSRRVGGATYQVPVEVRASRSTTLALRWLVQYARLRREKTMTERLMNELVDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|88799214|ref|ZP_01114793.1| 30S ribosomal protein S7 [Reinekea sp. MED297] >gi|88777973|gb|EAR09169.1| 30S ribosomal protein S7 [Reinekea sp. MED297] (156 aa)
Score = 394, Expect = 4.9e-37, Identities = 79/154 (51%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREILPDP + S+ + K +N +M++GKK +A++IVY + D++K+K +ED +E+F+K+LE+I P +E++ RRV G+ +QVP  V   R++ L +RWL+  +RKR EKSM ++LA E++D+++G GAA KK+ED HKMAEANKAF+H RF
  S:     3 RRRVAAKREILPDPKFGSQTLAKFMNHVMVDGKKSVAEKIVYGALDIVKEKGHEDPVELFEKSLESIAPLVEVKSRRVGGATYQVPVEVRPARREALAMRWLVEYSRKRGEKSMRQRLAGELLDSAEGKGAAVKKREDVHKMAEANKAFSHYRF 156
>gi|146192859|emb|CAL76864.1| 30S ribosomal subunit protein S7 [Bradyrhizobium sp. ORS278] (145 aa)
Score = 394, Expect = 5.1e-37, Identities = 76/145 (52%), Positives = 111/145 (76%)
  Q:    11 ILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           +LPDP + + +VTK +N++M  GKK +A+ IVY +F +I+ KT +  + VF++ALEN+MP++E+R RRV G+ +QVP  V   R+Q LG+RWLI +AR RNEK+M E+L+AE++DAS   G A KK+ED H+MAEAN+AF+H R+
  S:     1 MLPDPKFGNIIVTKFMNSVMYAGKKSVAEGIVYGAFGIIEAKTKQSPLTVFEQALENVMPTIEVRSRRVGGATYQVPVEVRSTRRQALGIRWLISAARDRNEKTMTERLSAELLDASNNRGNAVKKREDVHRMAEANRAFSHYRW 145
>gi|23502114|ref|NP_698241.1| 30S ribosomal protein S7 [Brucella suis 1330] >gi|62290148|ref|YP_221941.1| 30S ribosomal protein S7 [Brucella abortus bv. 1 str. 9-941] >gi|82700071|ref|YP_414645.1| 30S ribosomal protein S7 [Brucella melitensis biovar Abortus 2308] >gi|148560336|ref|YP_001259157.1| 30S ribosomal protein S7 [Brucella ovis ATCC 25840] >gi|161619193|ref|YP_001593080.1| 30S ribosomal protein S7 [Brucella canis ATCC 23365] >gi|163843503|ref|YP_001627907.1| 30S ribosomal protein S7 [Brucella suis ATCC 23445] >gi|189024386|ref|YP_001935154.1| Ribosomal protein S7 [Brucella abortus S19] >gi|166227420|sp|A5VR10|RS7_BRUO2 30S ribosomal protein S7 >gi|189045599|sp|A9M5Q4|RS7_BRUC2 30S ribosomal protein S7 >gi|189045600|sp|B0CH36|RS7_BRUSI 30S ribosomal protein S7 >gi|38258382|sp|Q8G074|RS7_BRUSU 30S ribosomal protein S7 >gi|75505260|sp|Q57CQ4|RS7_BRUAB 30S ribosomal protein S7 >gi|90120398|sp|Q2YLZ9|RS7_BRUA2 30S ribosomal protein S7 >gi|23348074|gb|AAN30156.1| ribosomal protein S7 [Brucella suis 1330] >gi|62196280|gb|AAX74580.1| RpsG, ribosomal protein S7 [Brucella abortus biovar 1 str. 9-941] >gi|82616172|emb|CAJ11215.1| Ribosomal protein S7:Ribosomal protein S7, bacterial and organelle form [Brucella melitensis biovar Abortus 2308] >gi|148371593|gb|ABQ61572.1| ribosomal protein S7 [Brucella ovis ATCC 25840] >gi|161336004|gb|ABX62309.1| ribosomal protein S7 [Brucella canis ATCC 23365] >gi|163674226|gb|ABY38337.1| ribosomal protein S7 [Brucella suis ATCC 23445] >gi|189019958|gb|ACD72680.1| Ribosomal protein S7 [Brucella abortus S19] (156 aa)
Score = 394, Expect = 5.3e-37, Identities = 75/154 (48%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A KREI PDP +   ++TK +NA+ML GKK +A+ IVY + D I+ K   + + +F +AL+N+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +M+++L+ E++DA+   G+A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHKAEKREINPDPKFGDLVITKFMNAVMLHGKKSVAESIVYGALDAIEAKAKSEPVALFHQALDNVAPHIEVRSRRVGGATYQVPVDVRPERRQALAIRWLINAARGRNETTMVDRLSGELLDAANNRGSAVKKREDTHRMAEANRAFSHYRW 156
>gi|54027051|ref|YP_121293.1| 30S ribosomal protein S7 [Nocardia farcinica IFM 10152] >gi|62287212|sp|Q5YPG2|RS7_NOCFA 30S ribosomal protein S7 >gi|54018559|dbj|BAD59929.1| putative ribosomal protein S7 [Nocardia farcinica IFM 10152] (156 aa)
Score = 394, Expect = 5.7e-37, Identities = 80/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT+ +N I+L+GKK  A++IVY + +  ++KT  D +   K+AL+N+ PSLE++ RRV G+ +QVP  V   R  TL LRWL+  AR R EK+M+E+LA E++DAS G GA+ K++EDTHKMAE+N+AFAH R+
  S:     3 RKGPAPKRPLINDPVYGSPLVTQLVNKILLDGKKSTAERIVYGALEQAREKTGTDPVVTLKRALDNVKPSLEVKPRRVGGATYQVPVEVRPGRANTLALRWLVNFARARREKTMVERLANELLDASNGLGASVKRREDTHKMAESNRAFAHYRW 156
>gi|25027071|ref|NP_737125.1| 30S ribosomal protein S7 [Corynebacterium efficiens YS-314] >gi|62287340|sp|Q8FS86|RS7_COREF 30S ribosomal protein S7 >gi|23492351|dbj|BAC17325.1| putative 30S ribosomal protein S7 [Corynebacterium efficiens YS-314] (155 aa)
Score = 393, Expect = 5.9e-37, Identities = 79/155 (50%), Positives = 113/155 (72%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK+ A KR ++ DPVY+S LVT+ +N I+L+GKK  A++IVY + ++ ++KT  + +   +KAL N+ P LE+R RRV G+ +QVP  V   R  TL LRWL+   R+R E +M+E+LA EI+DA+ G GA+ K++EDTHKMAEAN+AFAH R+
  S:     1 MRKSAAPKRPVVKDPVYDSELVTQLVNKILLDGKKSTAERIVYGALEICREKTGLEPVGTLEKALGNVRPDLEVRSRRVGGATYQVPVEVRPARATTLALRWLVTFTRQRRENTMVERLANEIMDAANGLGASVKRREDTHKMAEANRAFAHYRW 155
>gi|84494792|ref|ZP_00993911.1| 30S ribosomal protein S7 [Janibacter sp. HTCC2649] >gi|84384285|gb|EAQ00165.1| 30S ribosomal protein S7 [Janibacter sp. HTCC2649] (156 aa)
Score = 393, Expect = 5.9e-37, Identities = 81/154 (52%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR +L DPVY S LVT+ +N I+L+GKK +A+ IVY + +  ++KT  D + + K+AL+NI P+LE++ RRV G+ +QVP  V   R  TL LRWL+  +R+R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+N+AFAH R+
  S:     3 RKGPAPKRPLLIDPVYQSPLVTQLVNKILLDGKKSIAETIVYGALEGAREKTGTDPVLLLKRALDNIKPTLEVKSRRVGGATYQVPIEVKPNRAVTLSLRWLVGYSRQRREKTMTERLMNEILDASNGLGAAVKRREDTHKMAESNRAFAHYRW 156
>gi|154507868|ref|ZP_02043510.1| hypothetical protein ACTODO_00350 [Actinomyces odontolyticus ATCC 17982] >gi|153797502|gb|EDN79922.1| hypothetical protein ACTODO_00350 [Actinomyces odontolyticus ATCC 17982] (156 aa)
Score = 393, Expect = 6.1e-37, Identities = 78/154 (50%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A +R ++ DPVY S++VT+ +N ++L+GKK +A++IVY + + ++++T ++ + V K+ALENI P+LE+R RRV G+ +QVP  V   R  TL LRWL+  +R+R EK+M E+LA EI+DAS G GAA K++ED HKMAE+N+AFAH R+
  S:     3 RKGPAPRRPLVDDPVYGSKVVTQLVNRVLLDGKKTVAERIVYGALETVRERTEQEPVSVLKRALENIRPALEVRSRRVGGATYQVPVEVRPARATTLALRWLVDFSRQRREKTMTERLANEILDASNGLGAAVKRREDMHKMAESNRAFAHYRW 156
>gi|118475749|ref|YP_892464.1| 30S ribosomal protein S7 [Campylobacter fetus subsp. fetus 82-40] >gi|166227431|sp|A0RQI1|RS7_CAMFF 30S ribosomal protein S7 >gi|118414975|gb|ABK83395.1| ribosomal protein S7 [Campylobacter fetus subsp. fetus 82-40] (156 aa)
Score = 392, Expect = 8.5e-37, Identities = 79/155 (50%), Positives = 117/155 (75%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNE-DGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ +A  RE++PDP+Y ++++TK IN++M +GKK +A +I+Y +   I  K  +  GI VF  A++N+ P +E++ RRV G+ +QVP  V   R+Q L +RW+I  ARKR+E++M+EKLAAE++DA+   GA+FKKKEDT+KMAEANKAFAH R+
  S:     1 MRRRKAPVREVMPDPIYGNKIITKFINSLMYDGKKSVATEIMYGALKTIDAKGGDLKGINVFNDAIDNVKPIMEVKSRRVGGATYQVPVEVRPARQQALAIRWIISFARKRSERTMMEKLAAELLDAANSKGASFKKKEDTYKMAEANKAFAHYRW 156
>gi|192359877|ref|YP_001981204.1| ribosomal protein S7 [Cellvibrio japonicus Ueda107] >gi|190686042|gb|ACE83720.1| ribosomal protein S7 [Cellvibrio japonicus Ueda107] (156 aa)
Score = 392, Expect = 8.6e-37, Identities = 80/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE LPDP +    + K +N +M+ GKK +A++IVY + D++K K N D +EVF +ALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  +RKR+EKSM ++LA E+IDAS+G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVVAKREALPDPKFGDVTLAKFMNHVMISGKKSVAERIVYGALDVVKTKLNRDPLEVFSEALENIAPLVEVKSRRVGGATYQVPVEVRASRRSALAMRWLVDYSRKRSEKSMPQRLAGELIDASQGKGAAVKKREDVHRMAEANKAFSHFRF 156
>gi|83312233|ref|YP_422497.1| 30S ribosomal protein S7 [Magnetospirillum magneticum AMB-1] >gi|109894833|sp|Q2W2I7|RS7_MAGMM 30S ribosomal protein S7 >gi|82947074|dbj|BAE51938.1| Ribosomal protein S7 [Magnetospirillum magneticum AMB-1] (156 aa)
Score = 392, Expect = 9.6e-37, Identities = 78/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI PD  ++  +V K +N +ML+GKK  A+ IVY + D I+ KT +D ++VF +AL+N+ P+LE+R RRV G+ +QVP  V  +R+Q L +RWLI  +RKR+E +MI++L+ E++DA+   GAA KK+EDTH+MAEANKAF+H R+
  S:     3 RRHAAEKREITPDAKFHDYVVAKFMNCLMLDGKKSAAEAIVYGALDKIQAKTGQDPLKVFHEALDNVKPALEVRSRRVGGATYQVPVEVRSDRRQALAIRWLIDYSRKRSETTMIDRLSGELLDAANNRGAAVKKREDTHRMAEANKAFSHYRW 156
>gi|148244325|ref|YP_001219019.1| 30S ribosomal protein S7 [Candidatus Vesicomyosocius okutanii HA] >gi|146326152|dbj|BAF61295.1| 30S ribosomal protein S7 [Candidatus Vesicomyosocius okutanii HA] (155 aa)
Score = 392, Expect = 9.9e-37, Identities = 85/155 (54%), Positives = 112/155 (72%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+  A KREILPDP +   ++ K IN +M +GKK +A++IVY++ D IK K N   IEVFK+AL+ I P +E++ RRV GS +QVP  V  ERK  L +RW+I ++RKR  KSM  +LA EI+DA +  G AFKKKED+H+MAEANKAFAH R+
  S:     1 MRRRSAPKREILPDPKFGDLVLAKFINILMFDGKKSVAEKIVYEALDTIKAKGNAQPIEVFKQALDKIGPQVEIKSRRVGGSTYQVPIEVRTERKSALAMRWIIEASRKRGAKSMKLRLAGEILDAIQNRGNAFKKKEDSHRMAEANKAFAHFRW 155
>gi|50843330|ref|YP_056557.1| 30S ribosomal protein S7 [Propionibacterium acnes KPA171202] >gi|62287234|sp|Q6A6L4|RS7_PROAC 30S ribosomal protein S7 >gi|50840932|gb|AAT83599.1| 30S ribosomal protein S7 [Propionibacterium acnes KPA171202] (156 aa)
Score = 391, Expect = 1.0e-36, Identities = 79/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LV++ ++ I+L+GKK +AQ IVY + +  + K N D ++  K+AL+NI PSLE++ RRV G+ +QVP  V   R+ TL +RWL+  +R+R EK+M E+L  EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPVMVDPVYGSPLVSQLVSKILLDGKKTVAQNIVYTALEGCRAKNNTDPVQTLKRALDNIKPSLEVKSRRVGGATYQVPVEVKPARQTTLAMRWLVNFSRERREKTMAERLMNEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|17987036|ref|NP_539670.1| 30S ribosomal protein S7 [Brucella melitensis 16M] >gi|21263970|sp|Q8YHP4|RS7_BRUME 30S ribosomal protein S7 >gi|17982692|gb|AAL51934.1| SSU ribosomal protein S7P [Brucella melitensis 16M] (156 aa)
Score = 391, Expect = 1.0e-36, Identities = 74/154 (48%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A KREI PDP +   ++TK +NA+ML GKK +A+ IVY + D I+     + + +F +AL+N+ P +E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +M+++L+ E++DA+   G+A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHKAEKREINPDPKFGDLVITKFMNAVMLHGKKSVAESIVYGALDAIEATAKSEPVALFHQALDNVAPHIEVRSRRVGGATYQVPVDVRPERRQALAIRWLINAARGRNETTMVDRLSGELLDAANNRGSAVKKREDTHRMAEANRAFSHYRW 156
>gi|23013730|ref|ZP_00053594.1| COG0049: Ribosomal protein S7 [Magnetospirillum magnetotacticum MS-1] (156 aa)
Score = 391, Expect = 1.0e-36, Identities = 78/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI PD  ++  +V K +N +ML+GKK  A+ IVY + D I+ KT +D ++VF +AL+N+ P+LE+R RRV G+ +QVP  V  +R+Q L +RWLI  +RKR+E +MI++L+ E++DA+   GAA KK+EDTH+MAEANKAF+H R+
  S:     3 RRHAAEKREITPDAKFHDYVVAKFMNCLMLDGKKSAAEAIVYGALDKIQAKTGQDPLKVFHEALDNVKPALEVRSRRVGGATYQVPVEVRTDRRQALAIRWLIDYSRKRSETTMIDRLSGELLDAANNRGAAVKKREDTHRMAEANKAFSHYRW 156
>gi|182436638|ref|YP_001824357.1| putative 30S ribosomal protein S7 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|3122832|sp|P95847|RS7_STRFL 30S ribosomal protein S7 >gi|1685025|gb|AAC44744.1| ribosomal protein S7 >gi|178465154|dbj|BAG19674.1| putative 30S ribosomal protein S7 [Streptomyces griseus subsp. griseus NBRC 13350] (156 aa)
Score = 391, Expect = 1.1e-36, Identities = 81/154 (52%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY+S LVT  IN I+L+GK+  A++IVY + + +++KT  D +   K+ALEN+ PSLE++ RRV G+ +QVP  V   R  TL LRWL+  +R R EK+M E+L  E++DAS G GA+ KK+EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVIIDPVYSSPLVTSLINKILLDGKRSTAERIVYGAMEGLREKTGNDPVITLKRALENVKPSLEVKSRRVGGATYQVPIEVKPGRASTLALRWLVGYSRARREKTMTERLMNELLDASNGLGASVKKREDTHKMAESNKAFAHYRW 156
>gi|194342076|gb|EDX23042.1| 30S ribosomal protein S7 [Streptomyces sp. Mg1] (156 aa)
Score = 391, Expect = 1.1e-36, Identities = 82/154 (53%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT  IN I+L GK+  A++IVY + + +++KT  D +   K+ALEN+ PSLE++ RRV G+ +QVP  V   R+ TL LRWL+  +R R EK+M E+L  E++DAS G GAA KK+EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVIIDPVYASPLVTSLINKILLNGKRSTAERIVYGAMEGLREKTGNDPVITLKRALENVKPSLEVKSRRVGGATYQVPVEVKPGRQSTLALRWLVGYSRARREKTMTERLMNELLDASNGLGAAVKKREDTHKMAESNKAFAHYRW 156
>gi|62424421|ref|ZP_00379567.1| COG0049: Ribosomal protein S7 [Brevibacterium linens BL2] (156 aa)
Score = 391, Expect = 1.2e-36, Identities = 82/154 (53%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR I+ DPV++S +VT+ IN I+L+GK+  A++IVY + +  ++K   D +   KKAL+NI PSLE+R RRV G+ +QVP  V   R  TL LRWL+  +R+R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPIVIDPVFSSPIVTQLINKILLDGKRSTAERIVYGALEGTREKNGNDPVVNLKKALDNIRPSLEVRSRRVGGATYQVPVDVRPVRSTTLALRWLVAYSRQRREKTMTERLMNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|86137193|ref|ZP_01055771.1| 30S ribosomal protein S7 [Roseobacter sp. MED193] >gi|85826517|gb|EAQ46714.1| 30S ribosomal protein S7 [Roseobacter sp. MED193] (156 aa)
Score = 391, Expect = 1.2e-36, Identities = 81/154 (52%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  R++TK +N +M++GKK +A++IVY +FD ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +ARKRNE +M E+LA E++DA +  G A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKSVAEKIVYNAFDRVEGKIKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITAARKRNENTMEERLAGELMDAVQSRGTAVKKREDTHKMAEANKAFSHYRW 156
>gi|126737171|ref|ZP_01752906.1| 30S ribosomal protein S7 [Roseobacter sp. SK209-2-6] >gi|126721756|gb|EBA18459.1| 30S ribosomal protein S7 [Roseobacter sp. SK209-2-6] (156 aa)
Score = 391, Expect = 1.2e-36, Identities = 80/154 (51%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  R++TK +N +M++GKK +A++IVY +FD ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +AR RNE +M E+LA E++DA +  G A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKAVAERIVYNAFDRVEGKIKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITAARNRNENTMEERLAGELLDAVQSRGTAVKKREDTHKMAEANKAFSHYRW 156
>gi|29831461|ref|NP_826095.1| 30S ribosomal protein S7 [Streptomyces avermitilis MA-4680] >gi|62287321|sp|Q82DQ2|RS7_STRAW 30S ribosomal protein S7 >gi|29608576|dbj|BAC72630.1| putative ribosomal protein S7 [Streptomyces avermitilis MA-4680] (156 aa)
Score = 391, Expect = 1.3e-36, Identities = 82/154 (53%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT  IN ++L GK+  A++IVY + + +++KT  D I   K+ALENI P+LE++ RRV G+ +QVP  V   R  TL LRWL+  +R R EK+M E+L  E++DAS G GAA KK+EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVIIDPVYGSPLVTSLINKVLLNGKRSTAERIVYGAMEGLREKTGNDPIITLKRALENIKPTLEVKSRRVGGATYQVPIEVKPGRANTLALRWLVGYSRARREKTMTERLLNELLDASNGLGAAVKKREDTHKMAESNKAFAHYRW 156
>gi|119478603|ref|ZP_01618525.1| 30S ribosomal protein S7 [marine gamma proteobacterium HTCC2143] >gi|119448438|gb|EAW29688.1| 30S ribosomal protein S7 [marine gamma proteobacterium HTCC2143] (156 aa)
Score = 390, Expect = 1.4e-36, Identities = 78/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP Y +  + K +N +M+ GKK +A+ IVY + D++K++ N+D IE F +ALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  +R R EKSM ++LA EI+DAS+G G+A KK+ED H+MAEAN+AF+H RF
  S:     3 RRRVVAKREILPDPKYGNLTLAKFMNHVMVSGKKSVAESIVYGALDIVKERLNKDPIESFDEALENIAPMVEVKSRRVGGATYQVPVEVRPSRRAALAMRWLVEYSRGRGEKSMRQRLAGEIVDASQGKGSAVKKREDVHRMAEANRAFSHYRF 156
>gi|24216115|ref|NP_713596.1| 30S ribosomal protein S7 [Leptospira interrogans serovar Lai str. 56601] >gi|45656650|ref|YP_000736.1| 30S ribosomal protein S7 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|62287294|sp|Q72UA5|RS7_LEPIC 30S ribosomal protein S7 >gi|62287339|sp|Q8F0S5|RS7_LEPIN 30S ribosomal protein S7 >gi|24197358|gb|AAN50614.1|AE011500_1 ribosomal protein S7 [Leptospira interrogans serovar Lai str. 56601] >gi|45599886|gb|AAS69373.1| 30S ribosomal protein S7 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (157 aa)
Score = 390, Expect = 1.5e-36, Identities = 83/154 (53%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ +   R+I PDPVYN   V K IN +ML GKK +A+Q+ Y + ++I+KKT  D    F++ALEN  P +E++ RRV G  +QVP  V  ER+  LG+RWLI  +R RNEK M  KLAAE I+A KGTG+A KKKED  KMAEANKAF+H R+
  S:     4 RRGKVEPRKITPDPVYNDVQVAKFINCLMLSGKKSVAEQLFYDALEIIQKKTGNDPYTTFREALENAKPQVEVKSRRVGGVTYQVPVEVRPERRLALGIRWLIRYSRDRNEKGMAAKLAAEFIEAQKGTGSAIKKKEDIRKMAEANKAFSHYRW 157
>gi|21223041|ref|NP_628820.1| 30S ribosomal protein S7 [Streptomyces coelicolor A3(2)] >gi|13431831|sp|Q9L0K4|RS7_STRCO 30S ribosomal protein S7 >gi|7288056|emb|CAB81851.1| 30S ribosomal protein S7 [Streptomyces coelicolor A3(2)] (156 aa)
Score = 389, Expect = 1.8e-36, Identities = 81/154 (52%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT  IN ++L GK+  A++IVY + + +++KT  D +   K+ALENI P+LE++ RRV G+ +QVP  V   R  TL LRWL+  +R R EK+M E+L  E++DAS G GAA KK+EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPVIIDPVYGSPLVTSLINKVLLNGKRSTAERIVYGAMEGLREKTGNDPVITLKRALENIKPTLEVKSRRVGGATYQVPIEVKPGRANTLALRWLVGYSRARREKTMTERLLNELLDASNGLGAAVKKREDTHKMAESNKAFAHYRW 156
>gi|110833242|ref|YP_692101.1| 30S ribosomal protein S7 [Alcanivorax borkumensis SK2] >gi|123149720|sp|Q0VSL9|RS7_ALCBS 30S ribosomal protein S7 >gi|110646353|emb|CAL15829.1| 30S ribosomal protein S7 [Alcanivorax borkumensis SK2] (156 aa)
Score = 389, Expect = 2.0e-36, Identities = 77/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + S+++ K +N +M+ GKK ++++IVY + D+I ++   D +E F+KAL+NI P++E++ RRV G+ +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DA++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVVAKREILPDPKFGSQILAKFMNHVMVSGKKSVSERIVYGALDIITERKGLDSLETFEKALDNIRPAVEVKSRRVGGATYQVPVEVRPSRRTALAMRWLVDAARKRGEKSMPARLAGEVMDAAEGKGAAMKKREDVHRMAEANKAFSHFRF 156
>gi|99080081|ref|YP_612235.1| 30S ribosomal protein S7 [Silicibacter sp. TM1040] >gi|122984458|sp|Q1GK43|RS7_SILST 30S ribosomal protein S7 >gi|99036361|gb|ABF62973.1| SSU ribosomal protein S7P [Silicibacter sp. TM1040] (156 aa)
Score = 389, Expect = 2.0e-36, Identities = 79/154 (51%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  R++TK +N +M++GKK +A++IVY +FD ++ K     +EVF +AL+N+ PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +AR RNE +M E+LA E++DA +  G A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKSVAERIVYNAFDRVESKIKRAPVEVFHEALDNVKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITAARGRNENTMEERLAGELLDAVQSRGTAVKKREDTHKMAEANKAFSHYRW 156
>gi|68536932|ref|YP_251637.1| 30S ribosomal protein S7 [Corynebacterium jeikeium K411] >gi|109932866|sp|Q4JT38|RS7_CORJK 30S ribosomal protein S7 >gi|68264531|emb|CAI38019.1| 30S ribosomal protein S7 [Corynebacterium jeikeium K411] (156 aa)
Score = 388, Expect = 2.5e-36, Identities = 78/154 (50%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A  R+++ DPVY   LV++ +N ++L+GKK  A++IVY + +  ++KT  D I   KKAL+N+ P+LE+R RRV G+ +QVP  V   R  TL LRWL+   R+R E +M E+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPSRQLVKDPVYGDVLVSQLVNKVLLDGKKSTAERIVYGALEQCREKTGTDPILTLKKALDNVKPALEVRSRRVGGATYQVPVEVRPGRSTTLALRWLVTFTRQRRENTMTERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|118602209|ref|YP_903424.1| 30S ribosomal protein S7 [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567148|gb|ABL01953.1| SSU ribosomal protein S7P [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (157 aa)
Score = 388, Expect = 2.5e-36, Identities = 83/155 (53%), Positives = 117/155 (75%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKT--NEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+  A KR+ILPDP +   ++ K +N +ML+GKK +A++IVY++ D+I+ +   NE  IEVFK+AL+NI P +E++ RRV GS +QVP  V  ERK  L +RW+I ++RKR EK M  +LA E++DA +  G+AFKKK+DTH+MAEANKAFAH R+
  S:     1 MRRRSAPKRKILPDPKFGDLVLAKFVNILMLDGKKSVAEKIVYEALDIIEIRGGGNEQPIEVFKQALDNIGPQVEIKSRRVGGSTYQVPIEVRAERKIALAMRWIIEASRKRGEKGMKLRLAGEVLDAVQNRGSAFKKKKDTHRMAEANKAFAHFRW 157
>gi|114773731|ref|ZP_01450756.1| 30S ribosomal protein S7 [alpha proteobacterium HTCC2255] (156 aa)
Score = 388, Expect = 2.6e-36, Identities = 79/154 (51%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +ML+GKK  A++IVY + D++ +KT++  ++VF+ ALENI P++E++ RRV GS +QVP  V   R+  LG+RWL+ ++RKR EKSM ++LAAE++DAS+  G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFKSELLAKFMNVVMLDGKKSTAEKIVYGALDIVAEKTSKPHLDVFEDALENIRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWLVEASRKRGEKSMAQRLAAEMLDASENKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|89070562|ref|ZP_01157851.1| 30S ribosomal protein S7 [Oceanicola granulosus HTCC2516] >gi|89043869|gb|EAR50067.1| 30S ribosomal protein S7 [Oceanicola granulosus HTCC2516] (156 aa)
Score = 388, Expect = 2.6e-36, Identities = 78/154 (50%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  R++TK +N +M++GKK +A++IVY +FD ++ +  +  +EVF +AL+NI PSLE+R RRV G+ +QVP  V  ER++ L +RWLI +A+ RNE +M E+LA E++DA  G G A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHAAEKREVLPDAKFGDRVLTKFMNNLMVDGKKSVAERIVYNAFDRVENRLKKAPVEVFHEALDNIKPSLEVRSRRVGGATYQVPVEVRPERREALAIRWLIAAAKARNENTMEERLAGELLDAVNGRGTAVKKREDTHKMADANRAFSHYRW 156
>gi|109896929|ref|YP_660184.1| 30S ribosomal protein S7 [Pseudoalteromonas atlantica T6c] >gi|123171715|sp|Q15YA8|RS7_PSEA6 30S ribosomal protein S7 >gi|109699210|gb|ABG39130.1| SSU ribosomal protein S7P [Pseudoalteromonas atlantica T6c] (156 aa)
Score = 388, Expect = 2.6e-36, Identities = 77/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S+L+ K +N +ML+GKK  A++IVY + D++  K  +  +E+F+ AL+NI P++E++ RRV GS +QVP  V   R+  LG+RWL+ +ARKR EKSM ++LAAE++DA++  G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFGSQLLAKFMNVVMLDGKKSTAEKIVYGALDIVADKAGKSHLEIFEDALDNIRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWLVDAARKRGEKSMAQRLAAEMLDAAENKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|84515202|ref|ZP_01002565.1| 30S ribosomal protein S7 [Loktanella vestfoldensis SKA53] >gi|84511361|gb|EAQ07815.1| 30S ribosomal protein S7 [Loktanella vestfoldensis SKA53] (156 aa)
Score = 387, Expect = 3.1e-36, Identities = 77/154 (50%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KR++LPD  +   ++TK +N +M++GKK +A++IVY +FD ++ K  +  +EVF + L+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +A+KRNE +M E+LA E++DA +G G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKRQVLPDAKFGDTVLTKFMNNLMVDGKKAVAERIVYNAFDRVEGKLKKSPVEVFHECLDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLIAAAKKRNENTMEERLAGELLDAVQGRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|126734500|ref|ZP_01750246.1| 30S ribosomal protein S7 [Roseobacter sp. CCS2] >gi|126715055|gb|EBA11920.1| 30S ribosomal protein S7 [Roseobacter sp. CCS2] (156 aa)
Score = 387, Expect = 3.2e-36, Identities = 78/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +   ++TK +N +M++GKK +A++IVY +FD ++ K  +  +EVF + L+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +A+KRNE +M E+LA E++DA  G G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDLVLTKFMNNLMVDGKKSVAERIVYNAFDRVEDKLKKSPVEVFHECLDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLISAAKKRNENTMEERLAGELMDAVNGRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|184200258|ref|YP_001854465.1| 30S ribosomal protein S7 [Kocuria rhizophila DC2201] >gi|183580488|dbj|BAG28959.1| 30S ribosomal protein S7 [Kocuria rhizophila DC2201] (156 aa)
Score = 387, Expect = 3.4e-36, Identities = 80/154 (51%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S +VT+ IN ++ +GKK  A++IVY + + ++ KTN D +   KKALEN+ P+LE+R RRV G+ +QVP  V   R Q L LRWL+  ++ R E +M E+L  EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPLVVDPVYGSPVVTQLINKVLQDGKKSTAERIVYGALEGVRNKTNSDPVATLKKALENVKPALEVRSRRVGGATYQVPVEVKAGRAQALSLRWLVGYSKARRENTMTERLQNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|67157004|ref|ZP_00418366.1| Ribosomal protein S7, bacterial and organelle form [Azotobacter vinelandii AvOP] >gi|67085681|gb|EAM05153.1| Ribosomal protein S7, bacterial and organelle form [Azotobacter vinelandii AvOP] (156 aa)
Score = 387, Expect = 3.6e-36, Identities = 81/154 (52%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREIL DP Y S+++ K +N +M  GKK +A++IVY + D +K + N D +E+F+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+ SARKR EKSM  +LA E++DAS+G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVYGALDTVKSRKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDSARKRGEKSMALRLAGELLDASEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|114570349|ref|YP_757029.1| 30S ribosomal protein S7 [Maricaulis maris MCS10] >gi|122315782|sp|Q0ANP6|RS7_MARMM 30S ribosomal protein S7 >gi|114340811|gb|ABI66091.1| SSU ribosomal protein S7P [Maricaulis maris MCS10] (156 aa)
Score = 387, Expect = 3.8e-36, Identities = 80/154 (51%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREI PDP +  R +TK +N IML+GKK +A++IVY + +++++K   + I VF  AL+N+ P +E+R RRV G+ +QVP  V  ERK+ L +RWL  +AR RNE +M E+LAAE++DAS   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHRAEKREIFPDPKFGDRDLTKFMNYIMLDGKKSVAERIVYGALEIVEEKLKREPIRVFHDALDNVAPEVEVRSRRVGGATYQVPVEVRAERKKALAIRWLTGAARGRNENTMRERLAAEMMDASANRGTAVKKREDTHRMAEANRAFSHYRW 156
>gi|158424182|ref|YP_001525474.1| 30S ribosomal protein S7 [Azorhizobium caulinodans ORS 571] >gi|172047988|sp|A8IAT5|RS7_AZOC5 30S ribosomal protein S7 >gi|158331071|dbj|BAF88556.1| ribosomal protein S7 [Azorhizobium caulinodans ORS 571] (156 aa)
Score = 386, Expect = 3.8e-36, Identities = 75/154 (48%), Positives = 119/154 (77%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+++A +RE++PD  + + +V++ +N+IM +GKK +A+ IVY + D+++ K   + +++F  ALEN+ P++E+R RRV G+ +QVP  V  ER+QTL +RWLI SAR RNEK+M+E+L+AE++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHKAERREVIPDAKFGNIIVSRFMNSIMRDGKKSVAESIVYGALDVVEAKAKSNPLDLFVTALENVAPAVEVRSRRVGGATYQVPVEVRTERRQTLAIRWLIASARARNEKTMVERLSAELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|86141137|ref|ZP_01059683.1| 30S ribosomal protein S7 [Flavobacterium sp. MED217] >gi|85831696|gb|EAQ50151.1| 30S ribosomal protein S7 [Leeuwenhoekiella blandensis MED217] (158 aa)
Score = 386, Expect = 3.9e-36, Identities = 84/155 (54%), Positives = 116/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR +LPDP +N +LVT+ +N +M +GKK +A +I Y + D++++K N D    +EV+K AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++WLI  ARKRNEKSM  KLAAE++ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRQAKKRPLLPDPRFNDQLVTRFVNMMMWDGKKSVAFKIFYDAMDIVEEKKNNDEKTALEVWKDALSNVMPHVEVRSRRVGGATFQIPMQIRPDRKISTAMKWLISFARKRNEKSMASKLAAEVLAAAKEEGAAVKKRTDTHKMAEANKAFSHFRF 158
>gi|115376088|ref|ZP_01463333.1| ribosomal protein S7 [Stigmatella aurantiaca DW4/3-1] >gi|115366903|gb|EAU65893.1| ribosomal protein S7 [Stigmatella aurantiaca DW4/3-1] (156 aa)
Score = 386, Expect = 3.9e-36, Identities = 81/154 (52%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR+ILPDP Y  RLVTK +N +M +GKK +A+ + Y +F LI+++  ED ++ FKKAL+N+ P LE++ RRV G+ +QVP  V ++R+  LG+RW+I  ++ R EK+M EKLA EI+DA+   G A KK+EDTHKMAEANKAFAH R+
  S:     3 RRRVVAKRKILPDPKYQDRLVTKFVNDLMRKGKKSIAEGVCYGAFSLIEERAKEDPLKTFKKALDNVKPVLEVKSRRVGGATYQVPVEVRQDRRVALGMRWIISYSKARGEKTMQEKLAGEIMDAANNRGNAVKKREDTHKMAEANKAFAHYRW 156
>gi|7240600|gb|AAB35202.2| ribosomal protein S7; MboS7 [Mycobacterium bovis] (156 aa)
Score = 386, Expect = 4.0e-36, Identities = 79/154 (51%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++  PVY+S+LVT+ +N ++L+GKK LA++IVY + +  + KT  D +   K+AL+N+ P+LE+R  RV G+ +QVP  V  +R  TL LRWL+  + +R EK+MIE+LA EI+DAS G GA+ K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVQRPVYDSQLVTQLVNKVLLKGKKSLAERIVYGALEQARDKTGTDPVITLKRALDNVKPALEVRSLRVGGATYQVPVEVRPDRSTTLALRWLVGYSLQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 156
>gi|172039988|ref|YP_001799702.1| 30S ribosomal protein S7 [Corynebacterium urealyticum DSM 7109] >gi|171851292|emb|CAQ04268.1| 30S ribosomal protein S7 [Corynebacterium urealyticum DSM 7109] (156 aa)
Score = 386, Expect = 4.0e-36, Identities = 77/154 (50%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R ++ DPVY   LV++ +N I+++GKK  A++IVY + +  ++KT  D +   KKAL+N+ P+LE+R RRV G+ +QVP  V   R  TL LRWL+  +R+R E SMIE+LA EI+DAS G GA+ K++ED HKMAEAN+AFAH R+
  S:     3 RKGPVAQRPLVKDPVYGDVLVSQLVNKILIDGKKSTAERIVYGALEQCREKTGTDPVLTLKKALDNVKPALEVRSRRVGGATYQVPVDVRPGRSTTLALRWLVTFSRQRRENSMIERLANEILDASNGLGASVKRREDIHKMAEANRAFAHYRW 156
>gi|83858570|ref|ZP_00952092.1| 30S ribosomal protein S7 [Oceanicaulis alexandrii HTCC2633] >gi|83853393|gb|EAP91245.1| 30S ribosomal protein S7 [Oceanicaulis alexandrii HTCC2633] (156 aa)
Score = 386, Expect = 4.9e-36, Identities = 77/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREILPDP +  R +TK +N IM++GKK  A+ I+Y + D+I++K   + + VF +A++N+ P +E+R RRV G+ +QVP  V  +R++ L +RWL  +AR RNE +M E+LAAE++DA+   G++ KK+EDTHKMAEAN+AFAH R+
  S:     3 RRHRAEKREILPDPKFGDRDLTKFMNYIMIDGKKSAAEAIIYGALDIIEEKVKREPVRVFHEAMDNVAPEIEVRSRRVGGATYQVPVEVRPDRRKALAIRWLAAAARNRNENTMRERLAAELMDAASNRGSSVKKREDTHKMAEANRAFAHYRW 156
>gi|56698322|ref|YP_168695.1| 30S ribosomal protein S7 [Silicibacter pomeroyi DSS-3] >gi|62287188|sp|Q5LMR3|RS7_SILPO 30S ribosomal protein S7 >gi|56680059|gb|AAV96725.1| ribosomal protein S7 [Silicibacter pomeroyi DSS-3] (156 aa)
Score = 385, Expect = 5.0e-36, Identities = 79/154 (51%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  +++TK +N +M++GKK +A++IVY +FD ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +AR RNE +M E+LA E++DA +  G A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDKVLTKFMNNLMIDGKKSVAERIVYNAFDRVENKIKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLIAAARNRNENTMEERLAGELLDAVQSRGTAVKKREDTHKMAEANKAFSHYRW 156
>gi|158317795|ref|YP_001510303.1| 30S ribosomal protein S7 [Frankia sp. EAN1pec] >gi|158113200|gb|ABW15397.1| ribosomal protein S7 [Frankia sp. EAN1pec] (156 aa)
Score = 385, Expect = 5.0e-36, Identities = 78/154 (50%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A K  ++ DPVY S LVT  +N ++L GKK +A++IVY + +  K KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V   R  TL LRW++  +R R EK+M E+L  E+IDAS G GA+ K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKHPVVVDPVYGSPLVTALVNKVLLSGKKSVAERIVYGALEGAKNKTGNDPVVTLKRALDNVKPTLEVRSRRVGGATYQVPVEVRAGRSTTLALRWIVGYSRGRREKTMTERLMNELIDASNGLGASVKRREDTHKMAESNKAFAHYRW 156
>gi|37912994|gb|AAR05323.1| ribosomal protein S7 [uncultured marine alpha proteobacterium HOT2C01] (156 aa)
Score = 385, Expect = 5.5e-36, Identities = 80/154 (51%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ +A  RE+LPDPV+ S+++TK  NAIM +GKK +A+ I+ +SF  I+ KT E  + VF KA+EN+ P +E+R RRV G+ +QVP  V   R Q L +RW++ + R R EKS++ KL++E+IDA++  G+A KK+EDTHKMAEANKAFAH R+
  S:     3 RRRKAQIREVLPDPVHGSKVLTKFTNAIMFDGKKTVAESIINKSFTNIESKTGEPPMNVFNKAIENVRPLVEVRSRRVGGATYQVPVEVKSNRSQALAIRWIVNAIRNRKEKSLVNKLSSELIDAAENKGSAIKKREDTHKMAEANKAFAHFRW 156
>gi|126732280|ref|ZP_01748080.1| 30S ribosomal protein S7 [Sagittula stellata E-37] >gi|126707149|gb|EBA06215.1| 30S ribosomal protein S7 [Sagittula stellata E-37] (156 aa)
Score = 385, Expect = 5.6e-36, Identities = 78/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y  R++TK +N +M +GKK +A+ IVY + D ++ K     +E+F +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E+IDA +  G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDRVLTKFMNNLMYDGKKSVAESIVYGALDRVENKVKRAPLEIFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITASRNRNENTMEERLAGELIDAVQSRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|163796923|ref|ZP_02190880.1| Ribosomal protein S7 [alpha proteobacterium BAL199] >gi|159177912|gb|EDP62461.1| Ribosomal protein S7 [alpha proteobacterium BAL199] (156 aa)
Score = 385, Expect = 5.9e-36, Identities = 75/154 (48%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KR +LPD  +   +V+K ++ +M +GK+ +A+ IVY +FD + K+T  + I +F  AL N+ P LE+R RRV G+ +QVP  V  ER Q L +RWLI +ARKR+EK+M E+L+ E++DA+   G A KK+EDTH+MA+ANKAF+H R+
  S:     3 RRHRAEKRPVLPDAKFGDEVVSKFMSCLMYDGKRSVAEGIVYGAFDRVAKRTGGEPIRLFHDALGNVKPHLEVRSRRVGGATYQVPVEVRPERAQALAIRWLIDAARKRSEKTMTERLSGELVDAANSRGTAVKKREDTHRMADANKAFSHYRW 156
>gi|84703914|ref|ZP_01017742.1| 30S ribosomal protein S7 [Parvularcula bermudensis HTCC2503] >gi|84690348|gb|EAQ16189.1| 30S ribosomal protein S7 [Parvularcula bermudensis HTCC2503] (156 aa)
Score = 385, Expect = 6.4e-36, Identities = 75/154 (48%), Positives = 117/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ RA KR + PDP ++ + V+K +N +ML+G+K  A++IVY +FD ++++     +E+F++ALEN+ P++E+R RRV G+ +QVP  V  +RK  L +RWLI +AR RNE +M+E+L+ E++DAS+  GAA KK+EDTHKMA+AN+AF+H R+
  S:     3 RRRRADKRPVNPDPKFHDQTVSKFMNYLMLDGRKAAAEKIVYGAFDRVEERLKRPPLELFREALENVTPAVEVRSRRVGGATYQVPVEVRPDRKIALAMRWLIAAARARNEATMVERLSGELMDASQNRGAAVKKREDTHKMADANRAFSHYRW 156
>gi|163739431|ref|ZP_02146841.1| 30S ribosomal protein S7 [Phaeobacter gallaeciensis BS107] >gi|163740225|ref|ZP_02147619.1| 30S ribosomal protein S7 [Phaeobacter gallaeciensis 2.10] >gi|161386083|gb|EDQ10458.1| 30S ribosomal protein S7 [Phaeobacter gallaeciensis 2.10] >gi|161387184|gb|EDQ11543.1| 30S ribosomal protein S7 [Phaeobacter gallaeciensis BS107] (156 aa)
Score = 384, Expect = 6.6e-36, Identities = 79/154 (51%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  R++TK +N +M++GKK +A+ IVY +FD ++ K     +EVF +AL+N+ PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +AR RNE +M E+LA E++DA +  G A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKSVAESIVYNAFDRVESKIKRAPVEVFHEALDNVKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLIKAARARNENTMEERLAGELLDAVQSRGTAVKKREDTHKMAEANKAFSHYRW 156
>gi|158334959|ref|YP_001516131.1| 30S ribosomal protein S7 [Acaryochloris marina MBIC11017] >gi|189045595|sp|B0CCD2|RS7_ACAM1 30S ribosomal protein S7 >gi|158305200|gb|ABW26817.1| 30S ribosomal protein S7 [Acaryochloris marina MBIC11017] (156 aa)
Score = 384, Expect = 6.8e-36, Identities = 78/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ RA KR + PDPVYNSRL++  I  +M  GKK LA +I+Y +  +I+++TN+D +EVF+ A+ N+ P +E++ RRV G+ +QVP  V  +R   L LRW+I  +R+R  +SM+ KLA E+IDA+  TGAA +K+E+TH+MAEANKAFAH R+
  S:     3 RRIRAQKRPVPPDPVYNSRLISMTIRRLMASGKKSLASRILYDALKIIEERTNQDPLEVFETAVRNVTPLVEVKARRVGGATYQVPMEVRSDRGIALALRWIIRFSRQRPGRSMVSKLANELIDAANETGAAIRKREETHRMAEANKAFAHYRY 156
>gi|88704387|ref|ZP_01102101.1| 30S ribosomal protein S7 [gamma proteobacterium KT 71] >gi|88701438|gb|EAQ98543.1| 30S ribosomal protein S7 [Congregibacter litoralis KT71] (156 aa)
Score = 384, Expect = 7.4e-36, Identities = 78/154 (50%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+LPDP + +  + K +N +M+ GKK +A+ IVY + DL++++  +D IEVF +ALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  AR R EKSM ++LA EI+DAS+G G A KK+ED H+MAEANKAF+H RF
  S:     3 RRRVVAKREVLPDPKFANVTLAKFMNHVMVSGKKSVAEGIVYGALDLVQERAGKDPIEVFDEALENIAPMVEVKSRRVGGATYQVPVEVRPSRRIALSMRWLVEYARNRGEKSMRQRLAGEILDASQGKGNAVKKREDVHRMAEANKAFSHFRF 156
>gi|85712782|ref|ZP_01043826.1| 30S ribosomal protein S7 [Idiomarina baltica OS145] >gi|85693422|gb|EAQ31376.1| 30S ribosomal protein S7 [Idiomarina baltica OS145] (156 aa)
Score = 384, Expect = 8.2e-36, Identities = 74/154 (48%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K IN +M++GKK +A++I+Y + D++ +K+ +D +++F+ AL+N+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +AR R EKSM ++LAAE++DAS+  G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFGSELLAKFINVVMVDGKKAVAEKIIYGALDILAEKSGKDHLDIFENALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVDAARTRGEKSMSQRLAAEMLDASENKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|69938871|ref|ZP_00633232.1| Ribosomal protein S7, bacterial and organelle form [Paracoccus denitrificans PD1222] >gi|119383506|ref|YP_914562.1| 30S ribosomal protein S7 [Paracoccus denitrificans PD1222] >gi|166228455|sp|A1B022|RS7_PARDP 30S ribosomal protein S7 >gi|119373273|gb|ABL68866.1| SSU ribosomal protein S7P [Paracoccus denitrificans PD1222] (156 aa)
Score = 384, Expect = 8.2e-36, Identities = 78/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y  R++TK +N +M++GKK +A++IVY + D ++ K   + IEVF +AL+N+ PS+E+R RRV G+ +QVP  V   R++ L +RWLI +++KRNE +M E+LA E+ DA  G G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDRVLTKFMNNLMIDGKKSVAERIVYNALDRVQGKLKREPIEVFHEALDNVKPSVEVRSRRVGGATYQVPVEVRPSRREALAIRWLIDASKKRNEHTMEERLAGELADAVNGRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|116748987|ref|YP_845674.1| 30S ribosomal protein S7 [Syntrophobacter fumaroxidans MPOB] >gi|166228488|sp|A0LII7|RS7_SYNFM 30S ribosomal protein S7 >gi|116698051|gb|ABK17239.1| SSU ribosomal protein S7P [Syntrophobacter fumaroxidans MPOB] (156 aa)
Score = 383, Expect = 8.5e-36, Identities = 75/154 (48%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR +LPDP YNS+L  K IN +M  GKK LA+ ++Y + DLI++++ +D +++F KA+EN+ P +E++ RRV G+ +QVP  V  ER+  L +RW+I  A++R EK+MI++LA E+ DA++  G + KK+EDTH+MAEANKAFAH R+
  S:     3 RRREVPKRYVLPDPKYNSKLAAKFINNLMRRGKKSLAEHVLYGALDLIEQRSKQDPLDLFHKAMENVRPVVEVKSRRVGGATYQVPVEVRHERRDALAMRWIINYAKQRTEKTMIQRLAGELQDAAQNRGGSVKKREDTHRMAEANKAFAHYRW 156
>gi|116327519|ref|YP_797239.1| 30S ribosomal protein S7 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331868|ref|YP_801586.1| 30S ribosomal protein S7 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|122280397|sp|Q04QJ2|RS7_LEPBJ 30S ribosomal protein S7 >gi|122284681|sp|Q054D9|RS7_LEPBL 30S ribosomal protein S7 >gi|116120263|gb|ABJ78306.1| 30S Ribosomal protein S7 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116125557|gb|ABJ76828.1| 30S Ribosomal protein S7 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (157 aa)
Score = 383, Expect = 8.9e-36, Identities = 81/154 (52%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ +   R+I PDPVYN   V K IN +ML G+K +A+++ Y + ++I+KKT  D    F++ALEN  P +E++ RRV G  +QVP  V  ER+  LG+RWLI  +R RNEK M  KLAAE I+A KGTG+A KKKED  KMAEANKAF+H R+
  S:     4 RRGKVEPRKITPDPVYNDVQVAKFINCLMLSGEKSVAERLFYDALEIIQKKTGNDPYTTFREALENAKPQVEVKSRRVGGVTYQVPIEVRPERRLALGIRWLIRYSRDRNEKGMASKLAAEFIEAQKGTGSAIKKKEDIRKMAEANKAFSHYRW 157
>gi|84499864|ref|ZP_00998130.1| 30S ribosomal protein S7 [Oceanicola batsensis HTCC2597] >gi|84391798|gb|EAQ04066.1| 30S ribosomal protein S7 [Oceanicola batsensis HTCC2597] (156 aa)
Score = 383, Expect = 8.9e-36, Identities = 79/154 (51%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREILPD  Y  R++TK +N +M++GKK +A++IVY + D I+ K     +E+F +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA    G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREILPDAKYGDRVLTKFMNNLMIDGKKSVAEKIVYNALDRIEAKVKRAPVELFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITASRSRNENTMEERLAGELLDAVNSRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|160902260|ref|YP_001567841.1| 30S ribosomal protein S7 [Petrotoga mobilis SJ95] >gi|189045620|sp|A9BHA9|RS7_PETMO 30S ribosomal protein S7 >gi|160359904|gb|ABX31518.1| ribosomal protein S7 [Petrotoga mobilis SJ95] (155 aa)
Score = 383, Expect = 9.1e-36, Identities = 76/155 (49%), Positives = 109/155 (70%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+  A KR I+PDP+Y   L++K IN +M +GKK LAQQIVY + + + + T E+ IE F KA++N+ P +E+R RRV GS +QVP  V + R  +L +RW++ SA+ +  + M+ KL+ E+IDA   TG + KKKED H+MAEAN+AFAH R+
  S:     1 MRRRTAEKRNIVPDPIYGDILLSKFINRLMYDGKKSLAQQIVYSALERLAEATKENPIEAFHKAIDNVKPVVEVRSRRVGGSTYQVPFEVPENRATSLAIRWIVTSAQSKKGRDMVSKLSQELIDAYNNTGPSVKKKEDVHRMAEANRAFAHFRW 155
>gi|34541544|ref|NP_906023.1| 30S ribosomal protein S7 [Porphyromonas gingivalis W83] >gi|62287304|sp|Q7MTL0|RS7_PORGI 30S ribosomal protein S7 >gi|34397861|gb|AAQ66922.1| ribosomal protein S7 [Porphyromonas gingivalis W83] (158 aa)
Score = 383, Expect = 9.2e-36, Identities = 84/155 (54%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK-TNED--GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR+ILPDPVY    VTK +N +M +GKK  A  I Y + D++K K +NE+   +E++K AL+NI P +E++ RR+ G+ FQVPT +  ERK+++ ++ LIL ARKR  K+M +KLAAEI+DA    GAAFK+KED H+MAEAN+AFAH RF
  S:     1 MRKAKPKKRQILPDPVYGDVRVTKFVNHLMYDGKKNTAFSIFYGALDIVKTKHSNEEKSALEIWKAALDNITPQVEVKSRRIGGATFQVPTEIRPERKESISMKNLILYARKRGGKTMADKLAAEIVDAFNNQGAAFKRKEDMHRMAEANRAFAHFRF 158
>gi|86739291|ref|YP_479691.1| 30S ribosomal protein S7 [Frankia sp. CcI3] >gi|109894829|sp|Q2JFI0|RS7_FRASC 30S ribosomal protein S7 >gi|86566153|gb|ABD09962.1| SSU ribosomal protein S7P [Frankia sp. CcI3] (156 aa)
Score = 383, Expect = 9.6e-36, Identities = 78/154 (50%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A K  ++ DPVY S LVT  +N ++L GKK +A++IVY + +  K KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V   R  TL LRW++  +R R EK+M E+L  E+IDAS G GA+ K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKHTVVVDPVYGSPLVTALVNKVLLSGKKSVAERIVYGALEGAKNKTGNDPVVTLKRALDNVKPTLEVRSRRVGGATYQVPVEVRAGRSTTLALRWIVGYSRARREKTMTERLMNELIDASNGLGASVKRREDTHKMAESNKAFAHYRW 156
>gi|154253173|ref|YP_001413997.1| 30S ribosomal protein S7 [Parvibaculum lavamentivorans DS-1] >gi|171769624|sp|A7HWQ7|RS7_PARL1 30S ribosomal protein S7 >gi|154157123|gb|ABS64340.1| ribosomal protein S7 [Parvibaculum lavamentivorans DS-1] (156 aa)
Score = 383, Expect = 9.8e-36, Identities = 71/154 (46%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KR+++PD  Y   ++ K +N++M  GKK  A+ I+Y +FD +++K + D +  F +ALEN+MP+LE+R RRV G+ +QVP  V  +R++ L +RW+I +AR RNE +M+ +L+ E++DA+   G+A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRHRAEKRDVIPDAKYGDVILAKFMNSLMYHGKKSAAETIIYGAFDQMQQKASVDPLRTFHEALENVMPALEVRSRRVGGATYQVPVEVRPDRRRALAIRWIIAAARARNETTMVARLSGELLDAANNRGSAVKKREDTHRMAEANRAFSHYRW 156
>gi|196155520|ref|YP_002125009.1| 30S ribosomal subunit protein S7 [Alteromonas macleodii 'Deep ecotype'] >gi|88771951|gb|EAR03261.1| 30S ribosomal subunit protein S7 [Alteromonas macleodii 'Deep ecotype'] >gi|196111299|gb|ACG65015.1| 30S ribosomal subunit protein S7 [Alteromonas macleodii 'Deep ecotype'] (156 aa)
Score = 383, Expect = 1.0e-35, Identities = 75/154 (48%), Positives = 118/154 (76%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILP+P + S+L+ K +N +ML+GKK +A++IVY + D++ +KT +  +++F++AL+NI P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR EKSM ++LAAE++DA+   G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPEPKFGSQLLAKFMNVVMLDGKKSVAERIVYGALDIVAEKTGKAHLDIFEEALDNIRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWMVEAARKRGEKSMAQRLAAEMLDAADNKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|78779986|ref|YP_398098.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9312] >gi|109894841|sp|Q318N3|RS7_PROM9 30S ribosomal protein S7 >gi|78713485|gb|ABB50662.1| SSU ribosomal protein S7P [Prochlorococcus marinus str. MIT 9312] (156 aa)
Score = 383, Expect = 1.1e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +NSRL +  I+ +M  GKK  AQ+I+  +F LI ++T  D +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN KSM +KLA E++DA+  TG++ KK+EDTHKMAEANKAFAH R+
  S:     3 RRNAAVKRPVLPDPQFNSRLASMMISRLMKHGKKSTAQRILSDAFSLISERTGGDAVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVTFSRARNGKSMSQKLAGELMDAANETGSSVKKREDTHKMAEANKAFAHYRY 156
>gi|188995735|ref|YP_001929987.1| 30S ribosomal protein S7 [Porphyromonas gingivalis ATCC 33277] >gi|188595415|dbj|BAG34390.1| 30S ribosomal protein S7 [Porphyromonas gingivalis ATCC 33277] (158 aa)
Score = 382, Expect = 1.1e-35, Identities = 84/155 (54%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK-TNED--GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR+ILPDPVY    VTK +N +M +GKK  A  I Y + D++K K +NE+   +E++K AL+NI P +E++ RR+ G+ FQVPT +  ERK+++ ++ LIL ARKR  K+M +KLAAEI+DA    GAAFK+KED H+MAEAN+AFAH RF
  S:     1 MRKAKPKKRQILPDPVYGDVRVTKFVNHLMYDGKKNTAFSIFYGALDIVKTKLSNEEKSALEIWKAALDNITPQVEVKSRRIGGATFQVPTEIRPERKESISMKNLILYARKRGGKTMADKLAAEIVDAFNNQGAAFKRKEDMHRMAEANRAFAHFRF 158
>gi|117927511|ref|YP_872062.1| 30S ribosomal protein S7 [Acidothermus cellulolyticus 11B] >gi|166227406|sp|A0LRL6|RS7_ACIC1 30S ribosomal protein S7 >gi|117647974|gb|ABK52076.1| SSU ribosomal protein S7P [Acidothermus cellulolyticus 11B] (156 aa)
Score = 382, Expect = 1.1e-35, Identities = 76/154 (49%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR I+ DPVY S LVT  IN ++  GK+ LA++IVY + +  + +T  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V  +R  +L LRW++  A+ R EK+MIE+L  E++DAS G GA+ K++EDTHKMAE+N+AFAH R+
  S:     3 RKGPAPKRPIVSDPVYGSPLVTALINKVLQRGKRSLAERIVYNALEGCRARTGTDPLITLKRALDNVRPTLEVRSRRVGGATYQVPVEVRPQRSTSLALRWIVHYAKLRREKTMIERLTNELLDASNGLGASVKRREDTHKMAESNRAFAHYRW 156
>gi|108763769|ref|YP_631495.1| 30S ribosomal protein S7 [Myxococcus xanthus DK 1622] >gi|123074344|sp|Q1D778|RS7_MYXXD 30S ribosomal protein S7 >gi|108467649|gb|ABF92834.1| ribosomal protein S7 [Myxococcus xanthus DK 1622] (156 aa)
Score = 382, Expect = 1.1e-35, Identities = 80/154 (51%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR+ILPDP +  RLVTK +N +M +GKK +A+ + Y +F LI+++  ED ++ FKKAL+N+ P LE++ RRV G+ +QVP  V ++R+  LG+RW+I  ++ R EK+M EKLA EI+DA+   G A KK+EDTHKMAEANKAFAH R+
  S:     3 RRRVVAKRKILPDPKFQDRLVTKFVNDLMRKGKKSIAEGVCYGAFALIEERAKEDPLKTFKKALDNVKPVLEVKSRRVGGATYQVPVEVRQDRRVALGMRWIITYSKARGEKTMQEKLAGEIMDAANNRGNAVKKREDTHKMAEANKAFAHYRW 156
>gi|77165791|ref|YP_344316.1| 30S ribosomal protein S7 [Nitrosococcus oceani ATCC 19707] >gi|90120509|sp|Q3J8R0|RS7_NITOC 30S ribosomal protein S7 >gi|76884105|gb|ABA58786.1| SSU ribosomal protein S7P [Nitrosococcus oceani ATCC 19707] (156 aa)
Score = 382, Expect = 1.2e-35, Identities = 80/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +RE+LPDP Y S  + K I  +ML GKK LA++I+Y +   + +K N+D ++V +KALEN+ P +E++ RRV G+ +QVP  V  ER+ TL +RWL+ +ARKR+EKSM  +LA E++DA +G G A KK+EDTH+MAEANKAFAH R+
  S:     3 RKRVIARREVLPDPKYGSVQLAKFITILMLSGKKSLAERIIYGALGRVSEKANQDPMDVLEKALENVRPLVEVKSRRVGGATYQVPVEVRPERRSTLAMRWLVEAARKRSEKSMDLRLAGELLDAHEGKGTAVKKREDTHRMAEANKAFAHYRW 156
>gi|163786193|ref|ZP_02180641.1| 30S ribosomal protein S7 [Flavobacteriales bacterium ALC-1] >gi|159878053|gb|EDP72109.1| 30S ribosomal protein S7 [Flavobacteriales bacterium ALC-1] (158 aa)
Score = 382, Expect = 1.2e-35, Identities = 80/155 (51%), Positives = 118/155 (76%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK  A KR +LPDP +N +LVT+ +N +M +GKK +A ++ Y + D++++K N+D    +E++K+AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++WLI  +RKRNEKSM ++LAAE++ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRAAKKRPLLPDPKFNDQLVTRFVNMMMWDGKKSVAFKVFYDAIDIVEEKKNDDEKTALEIWKEALSNVMPHVEVRSRRVGGATFQIPMQIRPDRKVSTAMKWLISYSRKRNEKSMAQRLAAEVLAAAKEEGAAVKKRVDTHKMAEANKAFSHFRF 158
>gi|159042828|ref|YP_001531622.1| 30S ribosomal protein S7 [Dinoroseobacter shibae DFL 12] >gi|189045608|sp|A8LM44|RS7_DINSH 30S ribosomal protein S7 >gi|157910588|gb|ABV92021.1| ribosomal protein S7 [Dinoroseobacter shibae DFL 12] (156 aa)
Score = 382, Expect = 1.3e-35, Identities = 78/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  R++TK +N +M++GKK  A++IVY +FD ++ K     +EVF + L+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA    G+A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKSAAEKIVYNAFDRVESKLKRSPLEVFHECLDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLINASRARNENTMEERLAGELVDAVNSRGSAVKKREDTHKMAEANKAFSHYRW 156
>gi|150385756|ref|ZP_01924357.1| ribosomal protein S7 [Victivallis vadensis ATCC BAA-548] >gi|150257867|gb|EDM95177.1| ribosomal protein S7 [Victivallis vadensis ATCC BAA-548] (156 aa)
Score = 382, Expect = 1.3e-35, Identities = 82/155 (52%), Positives = 110/155 (70%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIK-KKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+    KRE++PD  YNS+LV + IN IM  GKK  AQQIVY + D+I+ KK + + IEVF +ALEN+ P LE++ RRV G+ +QVP  V  +R+  L +RW++  +R R  KSM E LA E++DA   TG++ KKKEDT KMA+ANKAFAH R+
  S:     1 MRRRSVVKRELIPDVKYNSKLVAQLINTIMTRGKKSTAQQIVYGALDMIQGKKADMEAIEVFNQALENVKPKLEVKSRRVGGATYQVPVEVDPDRQVALAMRWIVTYSRGRKGKSMTESLAGELLDAFDNTGSSIKKKEDTFKMAQANKAFAHYRW 156
>gi|83949801|ref|ZP_00958534.1| 30S ribosomal protein S7 [Roseovarius nubinhibens ISM] >gi|83837700|gb|EAP76996.1| 30S ribosomal protein S7 [Roseovarius nubinhibens ISM] (156 aa)
Score = 381, Expect = 1.6e-35, Identities = 78/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  R++TK +N +M++GKK +A++IVY + D ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA +  G+A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDRVLTKFMNNLMIDGKKSVAEKIVYNALDRVEGKIKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITASRARNENTMEERLAGELLDAVQSRGSAVKKREDTHKMAEANKAFSHYRW 156
>gi|120553648|ref|YP_957999.1| 30S ribosomal protein S7 [Marinobacter aquaeolei VT8] >gi|166227458|sp|A1TYJ3|RS7_MARAV 30S ribosomal protein S7 >gi|120323497|gb|ABM17812.1| SSU ribosomal protein S7P [Marinobacter aquaeolei VT8] (156 aa)
Score = 381, Expect = 1.6e-35, Identities = 80/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREI+PDP + S  + K IN +M  GKK +A++IVY + D++ +K+ E+ IE+F+KALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  +RKR EKSM ++LA EI+DA+   GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREIIPDPKFGSARLAKFINHVMESGKKSVAERIVYGALDIVAEKSKEEPIEMFEKALENIQPMVEVKSRRVGGATYQVPVEVRPSRQNALAMRWLVEYSRKRGEKSMAQRLAGEILDAADSKGAAVKKREDVHRMAEANKAFSHFRF 156
>gi|119502918|ref|ZP_01625003.1| 30S ribosomal protein S7 [marine gamma proteobacterium HTCC2080] >gi|119461264|gb|EAW42354.1| 30S ribosomal protein S7 [marine gamma proteobacterium HTCC2080] (156 aa)
Score = 381, Expect = 1.6e-35, Identities = 79/154 (51%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + ++ + K +N +M+ GKK +A+ IVY +  L++++T  D IEVF +ALENI P +E++ RRV G+ +QVP  V   R+  L +RWL   AR R EKSM ++LA EI+DAS+G G A KK+ED H+MAEANKAF+H RF
  S:     3 RRRVVAKREILPDPKFGNQTLAKFMNHVMVSGKKSVAESIVYGALALVEERTKRDPIEVFDEALENIAPMVEVKSRRVGGATYQVPVEVRPARRGALSMRWLADYARNRGEKSMRQRLAGEIVDASQGKGNAVKKREDVHRMAEANKAFSHFRF 156
>gi|144900880|emb|CAM77744.1| 30S ribosomal protein S7 [Magnetospirillum gryphiswaldense MSR-1] (156 aa)
Score = 381, Expect = 1.8e-35, Identities = 75/154 (48%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREI PD  Y   +V K +N +M +GKK  A+ IVY + + I+ KT +D ++VF  AL+N+ P++E+R RRV G+ +QVP  V  +R+Q L +RWLI  +RKR+E +MI++L+ E++DA+   GAA KK+EDTH+MA+ANKAF+H R+
  S:     3 RRHAAEKREINPDAKYGDLVVAKFMNCLMFDGKKSSAEAIVYGALEKIQSKTGQDPLQVFHDALDNVKPAVEVRSRRVGGATYQVPVEVRTDRRQALAIRWLIDYSRKRSETTMIDRLSGELLDAANNRGAAVKKREDTHRMADANKAFSHYRW 156
>gi|89095342|ref|ZP_01168259.1| ribosomal protein S7 [Oceanospirillum sp. MED92] >gi|89080384|gb|EAR59639.1| ribosomal protein S7 [Oceanospirillum sp. MED92] (156 aa)
Score = 380, Expect = 1.9e-35, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREILPDP + + ++ K IN +M+ GKK +A++IVY + D I+++T  D +E+F+KALE + P++E++ RRV G+ +QVP  V   R+  L +RW + +AR R EKSM  +LA E+ DA++G GAA KK+ED H+MAEANKAFAH RF
  S:     3 RRRVAAKREILPDPKFGNTVLAKFINHVMVHGKKSVAEKIVYGALDKIQERTGNDPLELFEKALEAVQPAVEVKSRRVGGATYQVPVEVRPARRMALAMRWTVDAARNRGEKSMALRLAGELADAAEGRGAAVKKREDVHRMAEANKAFAHYRF 156
>gi|116624206|ref|YP_826362.1| 30S ribosomal protein S7 [Solibacter usitatus Ellin6076] >gi|122253079|sp|Q01W88|RS7_SOLUE 30S ribosomal protein S7 >gi|116227368|gb|ABJ86077.1| SSU ribosomal protein S7P [Solibacter usitatus Ellin6076] (156 aa)
Score = 380, Expect = 1.9e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ RA  RE+ PD +YNS LV K +N++M +GKK  AQ I Y + D I+++T++D ++ FKKA+EN  P LE++ RRV G+N+QVP  V + R+ +L +RW+I +AR R EK M EKLA E+ DA+   G A KK++D H+MAEANKAFAH R+
  S:     3 RRRRAVIREVAPDAIYNSTLVEKFVNSMMWQGKKNTAQGIFYDAMDKIRERTSDDPLKAFKKAVENAKPLLEVKTRRVGGANYQVPIEVPQNRRTSLAMRWIITNARTRPEKGMAEKLANELNDAANLRGGAIKKRDDVHRMAEANKAFAHYRW 156
>gi|148263137|ref|YP_001229843.1| 30S ribosomal protein S7 [Geobacter uraniireducens Rf4] >gi|189045611|sp|A5GAY4|RS7_GEOUR 30S ribosomal protein S7 >gi|146396637|gb|ABQ25270.1| SSU ribosomal protein S7P [Geobacter uraniireducens Rf4] (156 aa)
Score = 380, Expect = 1.9e-35, Identities = 80/154 (51%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP Y  R+V K +N IML+GKK  A++ +Y + +L  +K NED +++ KK+L+NI P LE++ RRV GS +QVP  V  ER+ +L +RWL+  A  R+EK++ +KLA EI+DA    GAA KK+EDTHKMAEAN+AFAH R+
  S:     3 RRREVAKRVILPDPKYGDRVVAKLVNIIMLDGKKSTAEKALYGALELASEKVNEDPVKILKKSLDNIKPMLEVKSRRVGGSTYQVPVEVRAERRVSLAMRWLVKYANDRSEKTVTDKLAGEILDAYNNRGAAVKKREDTHKMAEANRAFAHYRW 156
>gi|170729013|ref|YP_001763039.1| ribosomal protein S7 [Shewanella woodyi ATCC 51908] >gi|169814360|gb|ACA88944.1| ribosomal protein S7 [Shewanella woodyi ATCC 51908] (156 aa)
Score = 380, Expect = 2.0e-35, Identities = 79/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP +NS L+ K IN IM +GKK  A++I+Y++ D + +K +ED + + + ALEN+ PS+E++ RRV GS +QVP  V   R+  LG+RWL+ +ARKR EKSM  +LA E++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFNSELLAKFINVIMQDGKKSTAEKIIYKALDTVAEKKSEDHLVILEAALENVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALGMRWLVEAARKRGEKSMALRLAGELLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|33862066|ref|NP_893627.1| 30S ribosomal protein S7 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|123966923|ref|YP_001012004.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9515] >gi|166228461|sp|A2BYN6|RS7_PROM5 30S ribosomal protein S7 >gi|62287311|sp|Q7UZY5|RS7_PROMP 30S ribosomal protein S7 >gi|33634284|emb|CAE19969.1| 30S ribosomal protein S7 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|123201289|gb|ABM72897.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9515] (156 aa)
Score = 380, Expect = 2.0e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +NSRL +  I+ +M  GKK  AQ+I+  +F LI ++T  + +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN KSM +KLA E++DA+  TG+A KK+EDTHKMAEANKAFAH R+
  S:     3 RRNAAVKRPVLPDPQFNSRLASMMISRLMKHGKKSTAQKILSDAFSLISERTGGNAVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVTFSRGRNGKSMSQKLAGELMDAANETGSAVKKREDTHKMAEANKAFAHYRY 156
>gi|87161189|ref|YP_493234.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus USA300] >gi|87127163|gb|ABD21677.1| 30S ribosomal protein S7 [Staphylococcus aureus subsp. aureus USA300_FPR3757] (126 aa)
Score = 380, Expect = 2.0e-35, Identities = 75/126 (59%), Positives = 101/126 (80%)
  Q:    30 MLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           ML+GK+G AQ+I+Y +FDL+++++  D +EVF++A+ NIMP LE++ RRV GSN+QVP  V  ER+ TLGLRWL+  AR R EK+M ++LA EI+DA+  TG A KK+EDTHKMAEANKAFAH R+
  S:     1 MLDGKRGTAQRILYSAFDLVEQRSGRDALEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW 126
>gi|89891151|ref|ZP_01202659.1| 30S ribosomal protein S7 RpsG [Flavobacteria bacterium BBFL7] >gi|89516795|gb|EAS19454.1| 30S ribosomal protein S7 RpsG [Flavobacteria bacterium BBFL7] (158 aa)
Score = 380, Expect = 2.0e-35, Identities = 83/155 (53%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR ILPDP +N +LVT+ +N +ML GKK  A ++ Y + D++++K  +D    +E++K AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++WLI  +RKRNEKS  +KLA+EI+ ASK  GAA KKK DTHKMAEANKAF+H RF
  S:     1 MRKRQAKKRPILPDPRFNDQLVTRFVNMMMLHGKKSTAFKLFYDAIDIVEEKKQDDEKTALELWKDALSNVMPHVEVRSRRVGGATFQIPMQIRPDRKISTAMKWLIGYSRKRNEKSFSQKLASEILAASKEEGAAVKKKTDTHKMAEANKAFSHFRF 158
>gi|118579115|ref|YP_900365.1| 30S ribosomal protein S7 [Pelobacter propionicus DSM 2379] >gi|166228456|sp|A1ALT7|RS7_PELPD 30S ribosomal protein S7 >gi|118501825|gb|ABK98307.1| SSU ribosomal protein S7P [Pelobacter propionicus DSM 2379] (156 aa)
Score = 380, Expect = 2.1e-35, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP ++ + V K IN +ML GKK +A+ I+Y + D++ +KTN++ ++V KK+L+NI P+LE++ RRV GS +QVP  V  +R+ +L +RWLI  +  R+EK+M +KLA EI+DA    GAA KK+ED HKMAEAN+AFAH R+
  S:     3 RRREVPKRNILPDPKFHDKTVAKLINVLMLAGKKSIAESILYGALDIVAQKTNDEAVKVLKKSLDNIKPALEVKSRRVGGSTYQVPIEVRPDRRVSLAMRWLIKYSTLRSEKTMKDKLAGEILDAYNSRGAAVKKREDVHKMAEANRAFAHYRW 156
>gi|126697039|ref|YP_001091925.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9301] >gi|157414111|ref|YP_001484977.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9215] >gi|166228458|sp|A3PEZ9|RS7_PROM0 30S ribosomal protein S7 >gi|167012600|sp|A8G710|RS7_PROM2 30S ribosomal protein S7 >gi|126544082|gb|ABO18324.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9301] >gi|157388686|gb|ABV51391.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9215] (156 aa)
Score = 380, Expect = 2.2e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +NSRL +  I+ +M  GKK  AQ+I+  +F LI ++T  + +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN KSM +KLA E++DA+  TG+A KK+EDTHKMAEANKAFAH R+
  S:     3 RRNAAVKRPVLPDPQFNSRLASMMISRLMKHGKKSTAQRILSDAFSLISERTGGNAVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVTFSRARNGKSMSQKLAGELMDAANETGSAVKKREDTHKMAEANKAFAHYRY 156
>gi|116671527|ref|YP_832460.1| 30S ribosomal protein S7 [Arthrobacter sp. FB24] >gi|166227414|sp|A0JZ90|RS7_ARTS2 30S ribosomal protein S7 >gi|116611636|gb|ABK04360.1| SSU ribosomal protein S7P [Arthrobacter sp. FB24] (156 aa)
Score = 380, Expect = 2.2e-35, Identities = 79/154 (51%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT+ IN ++++GKK  A++IVY + +  + K+  D +   KKA+EN+ PSLE+R RRV G+ +QVP  V   R   L LRWL+  ++ R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPLVLDPVYGSPLVTQLINKVLVDGKKSTAERIVYGALEGARAKSGGDPVAALKKAMENVKPSLEVRSRRVGGATYQVPVEVKPGRSTALALRWLVGYSKARREKTMTERLQNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|111220542|ref|YP_711336.1| 30S ribosomal protein S7 [Frankia alni ACN14a] >gi|123143532|sp|Q0RRS5|RS7_FRAAA 30S ribosomal protein S7 >gi|111148074|emb|CAJ59742.1| 30S ribosomal subunit protein S7, initiates assembly [Frankia alni ACN14a] (156 aa)
Score = 380, Expect = 2.3e-35, Identities = 77/154 (50%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A K  ++ DPVY S LVT  +N +++ GKK +A++IVY + +  K KT  D +   K+AL+N+ P+LE+R RRV G+ +QVP  V   R  TL LRW++  +R R EK+M E+L  E+IDAS G GA+ K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKHAVVVDPVYGSALVTALVNKVLMSGKKSVAERIVYGALEGAKNKTGNDPVVTLKRALDNVKPTLEVRSRRVGGATYQVPVEVRAGRSTTLALRWIVGYSRARREKTMTERLMNELIDASNGLGASVKRREDTHKMAESNKAFAHYRW 156
>gi|88710951|ref|ZP_01105039.1| 30S ribosomal protein S7 [Flavobacteriales bacterium HTCC2170] >gi|88709892|gb|EAR02124.1| 30S ribosomal protein S7 [Flavobacteriales bacterium HTCC2170] (158 aa)
Score = 380, Expect = 2.4e-35, Identities = 81/155 (52%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR +LPDP +N +LVT+ +N +M +GKK +A  + Y + D++++K  ++    +E++K AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++WLI  ARKRNEK M +KLAAEI+ ASK  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRQAKKRPLLPDPRFNDQLVTRFVNMMMWDGKKSVAFSVFYDAIDIVEEKNTDEEKTALELWKDALSNVMPHVEVRSRRVGGATFQIPMQIRPDRKISTAMKWLISFARKRNEKGMSQKLAAEILAASKEEGAAVKKRVDTHKMAEANKAFSHFRF 158
>gi|146298164|ref|YP_001192755.1| 30S ribosomal protein S7 [Flavobacterium johnsoniae UW101] >gi|146152582|gb|ABQ03436.1| SSU ribosomal protein S7P [Flavobacterium johnsoniae UW101] (158 aa)
Score = 380, Expect = 2.4e-35, Identities = 80/155 (51%), Positives = 114/155 (73%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK  A KR +LPDP +N +LVT+ +N +M +GKK  A ++ Y + D+I+ K   D    +E++K AL N+MP +E+R RRV G+ FQ+P  +  +RK ++ ++WLIL AR+RNEKSM ++LA+E + A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRAAKKRPLLPDPRFNDQLVTRFVNNLMWDGKKSTAFKVFYDAIDIIETKKQNDEKTSLEIWKDALTNVMPHVEVRSRRVGGATFQIPMQIRPDRKISMAMKWLILYARRRNEKSMAQRLASECLAAAKEEGAAVKKRMDTHKMAEANKAFSHFRF 158
>gi|119961568|ref|YP_948663.1| 30S ribosomal protein S7 [Arthrobacter aurescens TC1] >gi|166227413|sp|A1R8V1|RS7_ARTAT 30S ribosomal protein S7 >gi|119948427|gb|ABM07338.1| ribosomal protein S7 [Arthrobacter aurescens TC1] (156 aa)
Score = 380, Expect = 2.4e-35, Identities = 78/154 (50%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT+ IN ++++GKK  A++IVY + +  + K+  D +   KKA++N+ PSLE+R RRV G+ +QVP  V   R   L LRWL+  ++ R EK+M E+L  EI+DAS G GAA K++EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPLVSDPVYGSPLVTQLINKVLVDGKKSTAERIVYGALEGARAKSGGDPVAALKKAMDNVKPSLEVRSRRVGGATYQVPVEVKPGRSTALALRWLVGYSKARREKTMTERLQNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW 156
>gi|91070536|gb|ABE11442.1| 30S ribosomal protein S7 [uncultured Prochlorococcus marinus clone HOT0M-5C8] (156 aa)
Score = 380, Expect = 2.4e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +NSRL +  I+ +M  GKK  AQ+I+  +F LI ++T  + +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN KSM +KLA E++DA+  TG+A KK+EDTHKMAEANKAFAH R+
  S:     3 RRNAAVKRPVLPDPQFNSRLASMMISRLMKHGKKSTAQKILSDAFSLITERTGGNAVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVTFSRGRNAKSMSQKLAGELMDAANETGSAVKKREDTHKMAEANKAFAHYRY 156
>gi|149371626|ref|ZP_01891042.1| 30S ribosomal protein S7 [unidentified eubacterium SCB49] >gi|149355253|gb|EDM43813.1| 30S ribosomal protein S7 [unidentified eubacterium SCB49] (158 aa)
Score = 379, Expect = 2.5e-35, Identities = 83/155 (53%), Positives = 114/155 (73%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK  A KR +LPDP +N +LVT+ +N +M +GKK  A ++ Y + D++++K  +D    +E +K AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++WLI  ARKRNEKSM +KLAAEI+ ASK  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRAAKKRPLLPDPRFNDQLVTRFVNNMMWDGKKSTAFKVFYDAIDIVEEKKTDDEKTALETWKDALSNVMPHVEVRSRRVGGATFQIPMQIRADRKISTAMKWLIGYARKRNEKSMAQKLAAEILAASKEEGAAVKKRTDTHKMAEANKAFSHFRF 158
>gi|26987191|ref|NP_742616.1| 30S ribosomal protein S7 [Pseudomonas putida KT2440] >gi|104779751|ref|YP_606249.1| 30S ribosomal protein S7 [Pseudomonas entomophila L48] >gi|146308927|ref|YP_001189392.1| 30S ribosomal protein S7 [Pseudomonas mendocina ymp] >gi|148545735|ref|YP_001265837.1| 30S ribosomal protein S7 [Pseudomonas putida F1] >gi|167031496|ref|YP_001666727.1| 30S ribosomal protein S7 [Pseudomonas putida GB-1] >gi|170723910|ref|YP_001751598.1| ribosomal protein S7 [Pseudomonas putida W619] >gi|123381074|sp|Q1IFX0|RS7_PSEE4 30S ribosomal protein S7 >gi|166228464|sp|A4XZ94|RS7_PSEMY 30S ribosomal protein S7 >gi|166228465|sp|A5VXP3|RS7_PSEP1 30S ribosomal protein S7 >gi|189045622|sp|B0KK63|RS7_PSEPG 30S ribosomal protein S7 >gi|38258324|sp|Q88QN9|RS7_PSEPK 30S ribosomal protein S7 >gi|24981828|gb|AAN66080.1|AE016237_4 ribosomal protein S7 [Pseudomonas putida KT2440] >gi|95108738|emb|CAK13432.1| 30S ribosomal protein S7 [Pseudomonas entomophila L48] >gi|145577128|gb|ABP86660.1| SSU ribosomal protein S7P [Pseudomonas mendocina ymp] >gi|148509793|gb|ABQ76653.1| SSU ribosomal protein S7P [Pseudomonas putida F1] >gi|166857984|gb|ABY96391.1| ribosomal protein S7 [Pseudomonas putida GB-1] >gi|169761913|gb|ACA75229.1| ribosomal protein S7 [Pseudomonas putida W619] (156 aa)
Score = 379, Expect = 2.5e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREIL DP Y S+++ K +N +M  GKK +A++IVY + D +K + N D +E+F+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+  ARKR EKSM  +LA E++DA++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVYGALDTVKARKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDYARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|189424406|ref|YP_001951583.1| ribosomal protein S7 [Geobacter lovleyi SZ] >gi|189420665|gb|ACD95063.1| ribosomal protein S7 [Geobacter lovleyi SZ] (156 aa)
Score = 379, Expect = 2.6e-35, Identities = 78/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP YN + V K IN +M+ GKK +A+ I+Y++ D+++ K+ E+ ++  KK L+NI P+LE++ RRV GS +QVP  V  +R+ +L +RWLI  +  R+EK+M EK+A EI+DA    GAA KK+EDTHKMAEAN+AFAH R+
  S:     3 RRREVPKRVILPDPKYNDKTVAKLINILMVGGKKSVAESILYRALDIVESKSGEEAVKALKKCLDNIKPALEVKSRRVGGSTYQVPVEVRPDRRVSLAMRWLIKYSAARSEKTMTEKMAGEILDAFNSRGAAVKKREDTHKMAEANRAFAHYRW 156
>gi|94968250|ref|YP_590298.1| 30S ribosomal protein S7 [Acidobacteria bacterium Ellin345] >gi|123381605|sp|Q1ISC6|RS7_ACIBL 30S ribosomal protein S7 >gi|94550300|gb|ABF40224.1| SSU ribosomal protein S7P [Acidobacteria bacterium Ellin345] (157 aa)
Score = 379, Expect = 2.6e-35, Identities = 82/154 (53%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTN-EDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    KRE L DPVY S L  K +N++M +GKK  AQ I Y++   ++ K   E+ I++FKKA+EN  P LE++ RRV G+N+QVP  V+ +R+ +L +RWLI  +R R EK MI+KLA E++DA+ G GAA KKKED H+MAEANKAFAH R+
  S:     3 RKGHIAKREPLADPVYGSTLANKFVNSMMWDGKKSTAQGIFYEAMKKLEAKGGGEEAIKLFKKAVENAKPLLEVKTRRVGGANYQVPVEVNADRRTSLAIRWLISYSRGRGEKGMIDKLANELLDAANGRGAAIKKKEDVHRMAEANKAFAHYRW 157
>gi|148260942|ref|YP_001235069.1| 30S ribosomal protein S7 [Acidiphilium cryptum JF-5] >gi|166227407|sp|A5FZW8|RS7_ACICJ 30S ribosomal protein S7 >gi|146402623|gb|ABQ31150.1| SSU ribosomal protein S7P [Acidiphilium cryptum JF-5] (158 aa)
Score = 379, Expect = 2.7e-35, Identities = 75/154 (48%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK--TNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPDP +   ++++ +N +M +GKK +A+ IVY + D +KK+   N D + +F +AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RW+I SARKR E +M ++L+ E++DA    GAA KK+EDTH+MAEANKAF+H R+
  S:     3 RRHSAVKREVLPDPKFGDVVISRFMNVLMYDGKKSVAESIVYGALDSLKKRGGQNADPVRLFHEALDNVKPAIEVRSRRVGGATYQVPVEVRSERRQALAIRWIIESARKRGEHTMEDRLSNELLDAVNNRGAAVKKREDTHRMAEANKAFSHYRW 158
>gi|153812160|ref|ZP_01964828.1| hypothetical protein RUMOBE_02557 [Ruminococcus obeum ATCC 29174] >gi|149831815|gb|EDM86901.1| hypothetical protein RUMOBE_02557 [Ruminococcus obeum ATCC 29174] (140 aa)
Score = 379, Expect = 3.0e-35, Identities = 81/140 (57%), Positives = 108/140 (77%)
  Q:    16 VYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           +YN+++VTK IN IML+GKKG+AQ+IVY +F  I++K  +  IEVF++A+ NIMP LE++ RR+ G+ +QVP  V  +R+Q L LRWL   +RKR EK+M E+LA E++DA   TGA+ KKKED HKMAEANKAFAH RF
  S:     1 MYNNKVVTKLINNIMLDGKKGVAQKIVYGAFARIEEKAGKPAIEVFEEAMNNIMPLLEVKARRIGGATYQVPIEVRADRRQALALRWLTTYSRKRGEKTMEERLANELLDAMNNTGASVKKKEDMHKMAEANKAFAHYRF 140
>gi|114764149|ref|ZP_01443387.1| 30S ribosomal protein S7 [Roseovarius sp. HTCC2601] >gi|114543301|gb|EAU46317.1| 30S ribosomal protein S7 [Roseovarius sp. HTCC2601] (156 aa)
Score = 379, Expect = 3.0e-35, Identities = 77/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y   ++TK +N +M++GKK +A++IVY + D ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA +  G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDIVLTKFMNNLMVDGKKSVAEKIVYNALDRVEGKVKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITASRSRNENTMEERLAGELLDAVQSRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|33594475|ref|NP_882119.1| 30S ribosomal protein S7 [Bordetella pertussis Tohama I] >gi|33594747|ref|NP_882390.1| 30S ribosomal protein S7 [Bordetella parapertussis 12822] >gi|33599018|ref|NP_886578.1| 30S ribosomal protein S7 [Bordetella bronchiseptica RB50] >gi|62287316|sp|Q7VTD6|RS7_BORPE 30S ribosomal protein S7 >gi|62287317|sp|Q7W2F9|RS7_BORPA 30S ribosomal protein S7 >gi|62287318|sp|Q7WRC8|RS7_BORBR 30S ribosomal protein S7 >gi|33564550|emb|CAE43867.1| 30S ribosomal protein S7 [Bordetella pertussis Tohama I] >gi|33564823|emb|CAE39766.1| 30S ribosomal protein S7 [Bordetella parapertussis] >gi|33575064|emb|CAE30527.1| 30S ribosomal protein S7 [Bordetella bronchiseptica RB50] (156 aa)
Score = 378, Expect = 3.3e-35, Identities = 81/154 (52%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + S  + K +N +ML+GKK +A++I+Y + + ++ KT +D IEVF  A+ NI P +E++ RRV G+N+QVP  V   R+  L +RWL  +A+KR EKSM  +LA E+IDAS+G GAA KK+EDTHKMAEANKAF+H R+
  S:     3 RRREVPKREILPDPKFGSVELAKFMNVVMLDGKKAVAERIIYGALEQVQVKTGKDAIEVFNLAINNIKPIVEVKSRRVGGANYQVPVEVRPVRRLALAMRWLREAAKKRGEKSMDLRLAGELIDASEGRGAAMKKREDTHKMAEANKAFSHFRW 156
>gi|90020574|ref|YP_526401.1| 30S ribosomal protein S7 [Saccharophagus degradans 2-40] >gi|109894849|sp|Q21M90|RS7_SACD2 30S ribosomal protein S7 >gi|89950174|gb|ABD80189.1| SSU ribosomal protein S7P [Saccharophagus degradans 2-40] (156 aa)
Score = 378, Expect = 3.5e-35, Identities = 75/154 (48%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+LPDP + S  + K +N +M+ GKK  A++IVY + D++ +K N+D +E F +ALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  +R R EKSM ++LA E+IDA++  G A KK+ED H+MAEANKAF+H RF
  S:     3 RRRVVAKREVLPDPKFGSSTLAKFMNHVMISGKKSTAEKIVYGALDIVSEKLNKDPLETFSEALENISPLVEVKSRRVGGATYQVPVEVRPARRTALAMRWLVEYSRNRGEKSMAQRLAGELIDAAQSKGGAVKKREDVHRMAEANKAFSHFRF 156
>gi|110681140|ref|YP_684147.1| 30S ribosomal protein S7 [Roseobacter denitrificans OCh 114] >gi|123172023|sp|Q160Y2|RS7_ROSDO 30S ribosomal protein S7 >gi|109457256|gb|ABG33461.1| ribosomal protein S7, putative [Roseobacter denitrificans OCh 114] (156 aa)
Score = 378, Expect = 3.7e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y   ++TK +N +M++GKK +A+ IVY +   ++ K     IEVF +AL+NI PS+E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +M E+LA E++DA +  G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDLVLTKFMNNLMIDGKKSVAETIVYNALTRVETKIKRAPIEVFHEALDNIQPSVEVRSRRVGGATYQVPVEVRPERRQALAIRWLIKAARSRNENTMEERLAGELLDAVQSRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|126666817|ref|ZP_01737794.1| 30S ribosomal protein S7 [Marinobacter sp. ELB17] >gi|126628862|gb|EAZ99482.1| 30S ribosomal protein S7 [Marinobacter sp. ELB17] (156 aa)
Score = 378, Expect = 3.7e-35, Identities = 79/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREI+PDP + S  + K IN +M  GKKG+A++IVY +  ++ +K+ E+ I++F+KALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  +RKR EKSM ++LA EI+DA +  GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRIAAKREIIPDPKFGSARLAKFINHVMESGKKGVAERIVYGALTIVAEKSKEEPIDMFEKALENIQPMVEVKSRRVGGATYQVPVEVRPSRQHALAMRWLVDFSRKRGEKSMAQRLAGEILDAVESKGAAVKKREDVHRMAEANKAFSHFRF 156
>gi|162449109|ref|YP_001611476.1| 30S ribosomal protein S7 [Sorangium cellulosum 'So ce 56'] >gi|189045634|sp|A9ETC1|RS7_SORC5 30S ribosomal protein S7 >gi|161159691|emb|CAN90996.1| 30S ribosomal protein S7 [Sorangium cellulosum 'So ce 56'] (156 aa)
Score = 378, Expect = 3.7e-35, Identities = 77/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR+I+PDP Y  +LV K  N++M  GKK  A+ I+Y +FD+++ +  E+ I+VF+KAL+N+ P LE++ RRV G+ +QVP  V  ER+  L +RWL+  +R R EK+M E+LAAE++DA++  G A KK++DTHKMAEANKAFAH R+
  S:     3 RRREVPKRKIIPDPKYKDKLVAKFTNSLMQSGKKATAEGILYGAFDIVRDRFKEEPIDVFRKALDNVKPKLEVKSRRVGGATYQVPVEVRPERRVALAMRWLVTYSRGRGEKTMRERLAAELVDAAQNRGNAVKKRDDTHKMAEANKAFAHYRW 156
>gi|114327215|ref|YP_744372.1| 30S ribosomal protein S7 [Granulibacter bethesdensis CGDNIH1] >gi|122327805|sp|Q0BUQ3|RS7_GRABC 30S ribosomal protein S7 >gi|114315389|gb|ABI61449.1| SSU ribosomal protein S7P [Granulibacter bethesdensis CGDNIH1] (158 aa)
Score = 378, Expect = 3.9e-35, Identities = 75/154 (48%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK--TNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ RA KREILPDP +   ++T+ +NA+M +GKK +A+ IVY + D++KK+     D + +F +AL+N+ P++E+R RRV G+ +QVP  V  +R+Q L +RW+I ++RKR E +M E+L+ E++DA    G+A KK+EDTH+MAEANKAF+H R+
  S:     3 RRRRAVKREILPDPKFGDIVITRFMNALMYDGKKSVAEGIVYGALDVLKKRGGNQADPVRMFHEALDNVKPAVEVRSRRVGGATYQVPVEVRADRRQALAIRWIIDASRKRGEHTMEERLSNELLDAVHNRGSAVKKREDTHRMAEANKAFSHYRW 158
>gi|119773350|ref|YP_926090.1| 30S ribosomal protein S7 [Shewanella amazonensis SB2B] >gi|166228474|sp|A1S214|RS7_SHEAM 30S ribosomal protein S7 >gi|119765850|gb|ABL98420.1| 30S ribosomal protein S7 [Shewanella amazonensis SB2B] (156 aa)
Score = 378, Expect = 3.9e-35, Identities = 78/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP +NS L+ K IN IM +GKK +A++I+Y++ D++ +K  ED + V + AL+N+ PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DAS   G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFNSELLAKFINVIMQDGKKSVAEKIIYKALDVVAEKKGEDHLVVLEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDASDNKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|56459459|ref|YP_154740.1| 30S ribosomal protein S7 [Idiomarina loihiensis L2TR] >gi|62287197|sp|Q5QWB5|RS7_IDILO 30S ribosomal protein S7 >gi|56178469|gb|AAV81191.1| Ribosomal protein S7 [Idiomarina loihiensis L2TR] (156 aa)
Score = 378, Expect = 3.9e-35, Identities = 76/154 (49%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K IN +M++GKK +A++I+Y + D++ +K+ +D +EVF   L+NI P +E++ RRV GS +QVP  V   R+  L +RWL+ +AR R EKSM ++LAAE++DAS+  G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFGSELLAKFINVVMVDGKKAVAEKIIYGALDILAEKSGKDRLEVFDTILDNIRPMVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVDAARTRGEKSMSQRLAAEMLDASENKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|145297386|ref|YP_001140227.1| 30S ribosomal protein S7 [Aeromonas salmonicida subsp. salmonicida A449] >gi|166227411|sp|A4SHV7|RS7_AERS4 30S ribosomal protein S7 >gi|142850158|gb|ABO88479.1| ribosomal protein S7 [Aeromonas salmonicida subsp. salmonicida A449] (156 aa)
Score = 378, Expect = 3.9e-35, Identities = 73/154 (47%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK +++ IVY + D+I  K+ +D + VF++AL+NI P++E++ RRV G+ +QVP  V   R+  L +RWL+ +ARKR EKSM ++LA E++DA+   G++ KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFGSELLAKFVNVVMVDGKKSVSEAIVYGALDIIATKSGKDHLAVFEEALDNIRPAVEVKSRRVGGATYQVPVEVRPVRRNALAMRWLVDAARKRGEKSMAQRLAGELLDAADNKGSSVKKREDVHRMAEANKAFAHFRW 156
>gi|52306270|gb|AAU36770.1| RpsG protein [Mannheimia succiniciproducens MBEL55E] (168 aa)
Score = 378, Expect = 4.0e-35, Identities = 76/154 (49%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+     R+ILPDP + S L+ K IN +M++GKK +A+ IVY + D + ++TN+D +  F++ALEN+ P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR +KSM  +LA E+ DAS+  G+A KK+ED H+MAEANKAFAH R+
  S:    15 RRRSIEPRKILPDPKFGSELLAKFINVLMVDGKKSIAESIVYNALDTLAQRTNKDALVAFEEALENVRPTVEVKSRRVGGSTYQVPVEVRPARRNALGMRWIVEAARKRGDKSMALRLANELSDASENKGSAVKKREDVHRMAEANKAFAHYRW 168
>gi|149184307|ref|ZP_01862625.1| 30S ribosomal protein S7 [Erythrobacter sp. SD-21] >gi|148831627|gb|EDL50060.1| 30S ribosomal protein S7 [Erythrobacter sp. SD-21] (156 aa)
Score = 378, Expect = 4.1e-35, Identities = 75/154 (48%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  KREILPDP +N ++++K +N +M +G+K +A+ IVY + D ++ K   + +EVF  ALENI P +E+R RRV G+ +QVP  V  ER Q L +RWLI +AR R E +M  +L+ E++DAS   G A KK+EDTH+MA+AN+AF+H R+
  S:     3 RRRRPEKREILPDPKFNDQVLSKFMNNLMYDGRKAVAEGIVYTALDTVEAKAKANPVEVFHSALENIKPQVEVRSRRVGGATYQVPVEVRPERAQALAIRWLIGAARGRPETTMAARLSGELMDASNNRGNAVKKREDTHRMADANRAFSHYRW 156
>gi|123969245|ref|YP_001010103.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. AS9601] >gi|166228462|sp|A2BT85|RS7_PROMS 30S ribosomal protein S7 >gi|123199355|gb|ABM70996.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. AS9601] (156 aa)
Score = 378, Expect = 4.1e-35, Identities = 78/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +NSRL +  I+ +M  GKK  AQ+I+  +F LI ++T  + +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN KSM +KLA E++DA+  TG++ KK+EDTHKMAEANKAFAH R+
  S:     3 RRNAAVKRPVLPDPQFNSRLASMMISRLMKHGKKSTAQRILSDAFSLISERTGGNAVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVTFSRARNGKSMSQKLAGELMDAANETGSSVKKREDTHKMAEANKAFAHYRY 156
>gi|149376690|ref|ZP_01894449.1| 30S ribosomal protein S7 [Marinobacter algicola DG893] >gi|149359063|gb|EDM47528.1| 30S ribosomal protein S7 [Marinobacter algicola DG893] (156 aa)
Score = 378, Expect = 4.2e-35, Identities = 78/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREI+PDP + S  + K IN +M  GKK +A++IVY + D++  K+ E+ I++F+KALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  +RKR EKSM ++LA EI+DA+   G+A KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREIIPDPKFGSARLAKFINHVMESGKKAVAERIVYGALDIVADKSKEEPIDMFEKALENIQPMVEVKSRRVGGATYQVPVEVRPSRQNALAMRWLVEYSRKRGEKSMAQRLAGEILDAADSKGSAVKKREDVHRMAEANKAFSHFRF 156
>gi|163752920|ref|ZP_02160044.1| 30S ribosomal protein S7 [Kordia algicida OT-1] >gi|161326652|gb|EDP97977.1| 30S ribosomal protein S7 [Kordia algicida OT-1] (158 aa)
Score = 377, Expect = 4.2e-35, Identities = 80/155 (51%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR +LPDP +N +LVT+ +N +M +GKK +A +I Y + D++  K  +D    +E++K AL N+MP +E+R RRV G+ FQ+P  +  +RK ++ ++WLI  +RKRNEKSM  KLA+E++ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRKAKKRPLLPDPRFNDQLVTRFVNNLMWDGKKSVAFKIFYDAMDIVDSKKTDDEKTALELWKDALSNVMPHVEVRSRRVGGATFQIPMQIRPDRKVSMAMKWLISYSRKRNEKSMALKLASEVLAAAKEEGAAVKKRVDTHKMAEANKAFSHFRF 158
>gi|83856561|ref|ZP_00950090.1| 30S ribosomal protein S7 [Croceibacter atlanticus HTCC2559] >gi|83850361|gb|EAP88229.1| 30S ribosomal protein S7 [Croceibacter atlanticus HTCC2559] (158 aa)
Score = 377, Expect = 4.2e-35, Identities = 83/155 (53%), Positives = 117/155 (75%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR +LPDP +N +LVT+ +N +M +GKK +A +I Y + +++++K  +D    +EV+K+AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++WLI  ARKRNEKSM  KLAAEI+ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRQAKKRPLLPDPKFNDQLVTRFVNMMMWDGKKSVAFKIFYDAMEVVEEKKQDDEKSALEVWKEALSNVMPHVEVRSRRVGGATFQIPMQIRPDRKVSTAMKWLISFARKRNEKSMANKLAAEILAAAKEEGAAVKKRTDTHKMAEANKAFSHFRF 158
>gi|163732884|ref|ZP_02140329.1| 30S ribosomal protein S7 [Roseobacter litoralis Och 149] >gi|161394244|gb|EDQ18568.1| 30S ribosomal protein S7 [Roseobacter litoralis Och 149] (156 aa)
Score = 377, Expect = 4.3e-35, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y   ++TK +N +M++GKK +A+ IVY +   ++ K     IEVF +AL+NI PS+E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +M E+LA E++DA +  G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDLVLTKFMNNLMIDGKKSIAETIVYNALTRVETKIKRAPIEVFHEALDNIQPSVEVRSRRVGGATYQVPVEVRPERRQALAIRWLIKAARSRNENTMEERLAGELMDAVQSRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|84685441|ref|ZP_01013339.1| 30S ribosomal protein S7 [Rhodobacterales bacterium HTCC2654] >gi|84666598|gb|EAQ13070.1| 30S ribosomal protein S7 [Rhodobacterales bacterium HTCC2654] (156 aa)
Score = 377, Expect = 4.3e-35, Identities = 76/154 (49%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREILPD  Y  +++TK +N +M++GKK  A++IVY +   ++ K     +E+F +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI + R RNE +M E+LA E++DA  G G A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHAAEKREILPDAKYGDKVLTKFMNNLMVDGKKSAAEKIVYNALGRVEDKVKRAPVEIFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLITACRARNENTMEERLAGELLDAVNGRGTAVKKREDTHKMADANRAFSHYRW 156
>gi|183603174|ref|ZP_02710469.2| ribosomal protein S7 [Streptococcus pneumoniae CDC1087-00] >gi|183570877|gb|EDT91405.1| ribosomal protein S7 [Streptococcus pneumoniae CDC1087-00] (126 aa)
Score = 377, Expect = 4.4e-35, Identities = 76/126 (60%), Positives = 97/126 (76%)
  Q:    30 MLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           ML+GK+G A  IVY +F+ IK+ T  D +EVF+ A+ENIMP LE+R RRV GSN+QVP  V  ER+ TLGLRWL+  AR R E +M ++LA EI+DA+  TGAA KK+EDTH+MAEAN+AFAH R+
  S:     1 MLDGKRGTAASIVYGAFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW 126
>gi|58038858|ref|YP_190822.1| 30S ribosomal protein S7 [Gluconobacter oxydans 621H] >gi|81672729|sp|Q5FTY0|RS7_GLUOX 30S ribosomal protein S7 >gi|58001272|gb|AAW60166.1| SSU ribosomal protein S7P [Gluconobacter oxydans 621H] (158 aa)
Score = 377, Expect = 4.5e-35, Identities = 75/154 (48%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK--TNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREILPDP +   ++T+ +NA+M +GKK  A+ IVY + ++++++  T  D + +F  AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RWLI ++RKR E +M E+L+ E++DA    G+A KK+EDTH+MAEANKAF+H R+
  S:     3 RRHRAVKREILPDPKFGDVVITRFMNALMYDGKKSTAEGIVYGALEVMRRRGGTTADPVAMFHSALDNVKPAVEVRSRRVGGATYQVPVEVRAERRQALAIRWLIDASRKRGENTMQERLSNELMDAVNNRGSAVKKREDTHRMAEANKAFSHYRW 158
>gi|161511009|ref|YP_087355.2| 30S ribosomal protein S7 [Mannheimia succiniciproducens MBEL55E] >gi|62287220|sp|Q65W90|RS7_MANSM 30S ribosomal protein S7 (156 aa)
Score = 377, Expect = 4.5e-35, Identities = 76/154 (49%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+     R+ILPDP + S L+ K IN +M++GKK +A+ IVY + D + ++TN+D +  F++ALEN+ P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR +KSM  +LA E+ DAS+  G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRSIEPRKILPDPKFGSELLAKFINVLMVDGKKSIAESIVYNALDTLAQRTNKDALVAFEEALENVRPTVEVKSRRVGGSTYQVPVEVRPARRNALGMRWIVEAARKRGDKSMALRLANELSDASENKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|86158372|ref|YP_465157.1| 30S ribosomal protein S7 [Anaeromyxobacter dehalogenans 2CP-C] >gi|109894821|sp|Q2IJ92|RS7_ANADE 30S ribosomal protein S7 >gi|85774883|gb|ABC81720.1| SSU ribosomal protein S7P [Anaeromyxobacter dehalogenans 2CP-C] (156 aa)
Score = 377, Expect = 4.6e-35, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR+ILPDP +  R+V K +N +M +GKK   ++I+Y +FD ++ K  +D ++VFKKAL+N+ P +E++ RRV G+ +QVP  V ++R+  L +RWLI  +R R EK+M+EKLA EI+DA+   G A KK+EDTHKMAEANKAFAH R+
  S:     3 RRREVEKRKILPDPKFQDRIVAKFVNNLMRKGKKSTGERIIYGAFDQVEAKLKDDPLKVFKKALDNVKPVVEVKSRRVGGATYQVPVEVRQDRRTALAMRWLIDYSRGRGEKTMVEKLAGEIMDAASNRGNAVKKREDTHKMAEANKAFAHYRW 156
>gi|149203507|ref|ZP_01880477.1| 30S ribosomal protein S7 [Roseovarius sp. TM1035] >gi|149143340|gb|EDM31379.1| 30S ribosomal protein S7 [Roseovarius sp. TM1035] (156 aa)
Score = 377, Expect = 4.7e-35, Identities = 77/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y  R++TK +N +M++GKK +A+ IVY + + ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA +  G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDRVLTKFMNNLMIDGKKSVAETIVYNALERVEGKIKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLINASRSRNENTMEERLAGELLDAVQSRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|85703982|ref|ZP_01035085.1| 30S ribosomal protein S7 [Roseovarius sp. 217] >gi|85671302|gb|EAQ26160.1| 30S ribosomal protein S7 [Roseovarius sp. 217] (156 aa)
Score = 377, Expect = 4.7e-35, Identities = 77/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y  R++TK +N +M++GKK +A+ IVY + + ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA +  G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDRVLTKFMNNLMIDGKKSVAETIVYNALERVEAKIKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLINASRSRNENTMEERLAGELVDAVQSRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|90417539|ref|ZP_01225460.1| 30S ribosomal protein S7 [marine gamma proteobacterium HTCC2207] >gi|90330631|gb|EAS45921.1| 30S ribosomal protein S7 [marine gamma proteobacterium HTCC2207] (156 aa)
Score = 377, Expect = 5.1e-35, Identities = 74/154 (48%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KR+ILPDP + +  + K +N +M+ GKK +A++IVY + DL++++  +D +EVF++AL+N+ P +E++ RRV G+ +QVP  V   R+  L +RWL+  AR R EKSM ++LA E+IDA+   G A KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKRDILPDPKFGNITLAKFMNMVMVSGKKSVAERIVYGALDLVEQRLKKDPVEVFQEALDNVAPMVEVKSRRVGGATYQVPVEVRPSRRTALAMRWLVEYARNRGEKSMPQRLAGELIDAAASKGGAVKKREDVHRMAEANKAFSHFRF 156
>gi|163745532|ref|ZP_02152892.1| 30S ribosomal protein S7 [Oceanibulbus indolifex HEL-45] >gi|161382350|gb|EDQ06759.1| 30S ribosomal protein S7 [Oceanibulbus indolifex HEL-45] (156 aa)
Score = 377, Expect = 5.2e-35, Identities = 80/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y   ++TK +N +M++GKK +A++IVY +   ++ K     IEVF +ALENI PS+E+R RRV G+ +QVP  V  ER+Q L +RWLI +AR RNE +M E+LA E++DA +  G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDLVLTKFMNNLMIDGKKSVAERIVYNAMTRVEDKIKRAPIEVFHEALENIQPSVEVRSRRVGGATYQVPVEVRPERRQALAIRWLIKAARARNENTMEERLAGELMDAVQSRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|157377453|ref|YP_001476053.1| 30S ribosomal protein S7 [Shewanella sediminis HAW-EB3] >gi|189045633|sp|A8G1F2|RS7_SHESH 30S ribosomal protein S7 >gi|157319827|gb|ABV38925.1| 30S ribosomal protein S7 [Shewanella sediminis HAW-EB3] (156 aa)
Score = 377, Expect = 5.2e-35, Identities = 79/154 (51%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP +NS L+ K IN IM +GKK  A++I+Y++ D   +K +ED + + + ALEN+ PS+E++ RRV GS +QVP  V   R+  LG+RWL+ +ARKR EKSM  +LA E++DAS   G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFNSELLAKFINVIMQDGKKSTAEKIIYKALDTASEKKSEDHLVILEAALENVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALGMRWLVEAARKRGEKSMALRLAGELLDASDNKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|163840914|ref|YP_001625319.1| 30S ribosomal protein S7 [Renibacterium salmoninarum ATCC 33209] >gi|189045623|sp|A9WSW7|RS7_RENSM 30S ribosomal protein S7 >gi|162954390|gb|ABY23905.1| SSU ribosomal protein S7P [Renibacterium salmoninarum ATCC 33209] (156 aa)
Score = 377, Expect = 5.2e-35, Identities = 79/154 (51%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT+ IN I+++GKK  A++IVY + +  ++K+  D +   KKA+ENI PSLE++ RRV G+ +QVP  V   R   L LRWL+  ++ R EK+M E+L  EI+DA  G GAA K++EDTHKMAEAN+AFAH R+
  S:     3 RKGPAPKRPLVLDPVYGSPLVTQLINKILVDGKKSTAERIVYGALEGAREKSGGDPVAALKKAMENIKPSLEVKSRRVGGATYQVPVEVKPGRATALALRWLVGYSKARREKTMTERLRNEILDACNGLGAAVKRREDTHKMAEANRAFAHYRW 156
>gi|119718144|ref|YP_925109.1| 30S ribosomal protein S7 [Nocardioides sp. JS614] >gi|166227473|sp|A1SNN7|RS7_NOCSJ 30S ribosomal protein S7 >gi|119538805|gb|ABL83422.1| SSU ribosomal protein S7P [Nocardioides sp. JS614] (156 aa)
Score = 377, Expect = 5.3e-35, Identities = 78/154 (50%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR I  DPVY S+LV++ ++ ++ +GKK +AQ+IVY + +  ++KT  D +   K+AL+N+ P++E++ RRV G+ +QVP  V   R  TL LRWL+  A+ R EK+M E+L  EI+DAS G GAA KK+EDTHKMAE+NKAFAH R+
  S:     3 RKGPAPKRPIDIDPVYGSQLVSQLVSKVLQDGKKQVAQRIVYTALEGCREKTGTDPVVTLKRALDNVKPAIEVKSRRVGGATYQVPIEVKGTRGTTLALRWLVGYAQDRREKTMHERLMNEILDASNGLGAAVKKREDTHKMAESNKAFAHYRW 156
>gi|77462255|ref|YP_351759.1| 30S ribosomal protein S7 [Rhodobacter sphaeroides 2.4.1] >gi|126461117|ref|YP_001042231.1| 30S ribosomal protein S7 [Rhodobacter sphaeroides ATCC 17029] >gi|126461131|ref|YP_001042245.1| 30S ribosomal protein S7 [Rhodobacter sphaeroides ATCC 17029] >gi|146278572|ref|YP_001168731.1| 30S ribosomal protein S7 [Rhodobacter sphaeroides ATCC 17025] >gi|166228468|sp|A4WVL2|RS7_RHOS5 30S ribosomal protein S7 >gi|90120539|sp|Q3J5S6|RS7_RHOS4 30S ribosomal protein S7 >gi|77386673|gb|ABA77858.1| SSU ribosomal protein S7P [Rhodobacter sphaeroides 2.4.1] >gi|126102781|gb|ABN75459.1| SSU ribosomal protein S7P [Rhodobacter sphaeroides ATCC 17029] >gi|126102795|gb|ABN75473.1| SSU ribosomal protein S7P [Rhodobacter sphaeroides ATCC 17029] >gi|145556813|gb|ABP71426.1| SSU ribosomal protein S7P [Rhodobacter sphaeroides ATCC 17025] (156 aa)
Score = 376, Expect = 5.6e-35, Identities = 77/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KREILPD  +   ++TK +N +M++GKK +A+ IVY + D ++ +   + +E F +AL+N+ PS+E+R RRV G+ +QVP  V  ER++ L +RWLI +ARKRNE +M E+LAAE+ DA    G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREILPDAKFGDTVLTKFMNNLMIDGKKSVAESIVYNALDRVQTRLKREPLEAFHEALDNVKPSVEVRSRRVGGATYQVPVEVRTERREALAIRWLITAARKRNENTMEERLAAELADACNNRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|163768751|ref|ZP_02175734.1| ribosomal protein S7 [Anaeromyxobacter sp. K] >gi|167456828|ref|ZP_02323045.1| ribosomal protein S7 [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417118|gb|EDR83827.1| ribosomal protein S7 [Anaeromyxobacter dehalogenans 2CP-1] >gi|196172185|gb|ACG73158.1| ribosomal protein S7 [Anaeromyxobacter sp. K] (156 aa)
Score = 376, Expect = 5.7e-35, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR+ILPDP +  R+V K +N +M +GKK   ++I+Y +FD ++ K  +D ++VFKKAL+N+ P +E++ RRV G+ +QVP  V ++R+  L +RWLI  +R R EK+M+EKLA EI+DA+   G A KK+EDTHKMAEANKAFAH R+
  S:     3 RRREVEKRKILPDPKFQDRIVAKFVNNLMRKGKKSTGERIIYGAFDQVEAKLKDDPLKVFKKALDNVKPVVEVKSRRVGGATYQVPVEVRQDRRTALAMRWLIEYSRGRGEKTMVEKLAGEIMDAASNRGNAVKKREDTHKMAEANKAFAHYRW 156
>gi|92112550|ref|YP_572478.1| 30S ribosomal protein S7 [Chromohalobacter salexigens DSM 3043] >gi|123084228|sp|Q1R0H9|RS7_CHRSD 30S ribosomal protein S7 >gi|91795640|gb|ABE57779.1| SSU ribosomal protein S7P [Chromohalobacter salexigens DSM 3043] (156 aa)
Score = 376, Expect = 6.1e-35, Identities = 74/154 (48%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + S  + K +N +M+ GKK +A++IVY + D + +++ ++ +E+F KALE I P +E++ RRV G+ +QVP  V   R+Q L +RWL+ +AR R EK+M+++LA E++DA++G GAA KK+ED H+MA+ANKAF+H RF
  S:     3 RRKVVAKREILPDPKFGSERLAKFMNHLMVSGKKSVAERIVYGALDKVAERSKDEPLEIFDKALETIQPMVEVKSRRVGGATYQVPVEVRPSRRQALAMRWLVDAARSRGEKTMVQRLAGEMLDAAEGKGAAVKKREDVHRMADANKAFSHYRF 156
>gi|153004770|ref|YP_001379095.1| 30S ribosomal protein S7 [Anaeromyxobacter sp. Fw109-5] >gi|166227412|sp|A7HBL5|RS7_ANADF 30S ribosomal protein S7 >gi|152028343|gb|ABS26111.1| ribosomal protein S7 [Anaeromyxobacter sp. Fw109-5] (156 aa)
Score = 376, Expect = 6.9e-35, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR+ILPDP +  R+V K +N +M EGKK   ++I+Y +FD +++K  +D +++FKKAL+N+ P +E++ RRV G+ +QVP  V ++R+  L +RWLI  ++ R EK+M EKLA EIIDA+   G A KK+EDTHKMAEANKAFAH R+
  S:     3 RRREVEKRKILPDPKFQDRIVAKFVNNLMREGKKSTGERIIYGAFDQVEQKLKDDPLKIFKKALDNVKPVVEVKSRRVGGATYQVPVEVRQDRRTALAMRWLIDYSKARGEKTMQEKLAGEIIDAANNRGNAVKKREDTHKMAEANKAFAHYRW 156
>gi|71281890|ref|YP_271410.1| 30S ribosomal protein S7 [Colwellia psychrerythraea 34H] >gi|110826000|sp|Q47UW2|RS7_COLP3 30S ribosomal protein S7 >gi|71147630|gb|AAZ28103.1| ribosomal protein S7 [Colwellia psychrerythraea 34H] (156 aa)
Score = 375, Expect = 7.1e-35, Identities = 76/154 (49%), Positives = 116/154 (75%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP +++ L+ K IN +M++GKK  A++IVY + D++ +K+ +D +E+F++AL+NI PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM ++LA E++DAS   G+A KK+ED H+MA+ANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFHNELLAKFINILMVDGKKSTAEKIVYGALDILAQKSEKDQLELFEEALDNIRPSVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAQRLANEMLDASDSKGSAVKKREDVHRMADANKAFAHYRW 156
>gi|15639236|ref|NP_218684.1| 30S ribosomal protein S7 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025477|ref|YP_001933249.1| ribosomal protein S7 [Treponema pallidum subsp. pallidum SS14] >gi|6094195|sp|O83272|RS7_TREPA 30S ribosomal protein S7 >gi|3322516|gb|AAC65233.1| ribosomal protein S7 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018052|gb|ACD70670.1| ribosomal protein S7 [Treponema pallidum subsp. pallidum SS14] (156 aa)
Score = 375, Expect = 7.4e-35, Identities = 77/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK R ++R   PD  YNS ++ K I  +ML GKK  A  I+Y   + I+++T E+ + VF KALEN+ P++E++ RRV GS +QVP  + + R++ LG+RW+I +AR+R+ + M E+LAAEI+DA   TG AFK+KEDTH+MAEANKAF+H R+
  S:     3 RKRRVSRRVPPPDARYNSVVLAKFICRMMLAGKKATAVGIMYDCLERIQQRTGEEPLPVFTKALENVKPAVEVKSRRVGGSTYQVPMEIRETRREALGMRWIIGAARRRSGRGMSERLAAEILDAYHSTGTAFKRKEDTHRMAEANKAFSHYRW 156
>gi|177671516|ref|ZP_02944574.1| ribosomal protein S7 [Micrococcus luteus NCTC 2665] >gi|172071448|gb|EDT57490.1| ribosomal protein S7 [Micrococcus luteus NCTC 2665] (156 aa)
Score = 375, Expect = 7.4e-35, Identities = 78/154 (50%), Positives = 106/154 (68%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK  A KR ++ DPVY S LVT+ IN ++++GKK  A++IVY + +  + K   D +   KKA++NI P+LE+R RRV G+ +QVP  V   R   L LRWL+  ++ R EK+M E+L  EI+DAS G G A K++EDTHKMAEANKAFAH R+
  S:     3 RKGPAPKRPLVVDPVYGSPLVTQLINKVLVDGKKSTAERIVYGALEGARAKNGADPVATLKKAMDNIKPALEVRSRRVGGATYQVPVEVKPGRSTALALRWLVGFSKARREKTMTERLMNEILDASNGLGGAVKRREDTHKMAEANKAFAHYRW 156
>gi|149915840|ref|ZP_01904364.1| 30S ribosomal protein S7 [Roseobacter sp. AzwK-3b] >gi|149810163|gb|EDM70009.1| 30S ribosomal protein S7 [Roseobacter sp. AzwK-3b] (156 aa)
Score = 375, Expect = 8.2e-35, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y  R++TK +N +M++GKK +A++IVY +   ++ K     +EVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA    G A KK+EDTHKMAEANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDRVLTKFMNNLMIDGKKSVAEKIVYNALGRVEDKAKRAPVEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLINASRARNENTMEERLAGELLDAVNSRGTAVKKREDTHKMAEANKAFSHYRW 156
>gi|146281166|ref|YP_001171319.1| 30S ribosomal protein S7 [Pseudomonas stutzeri A1501] >gi|166228466|sp|A4VHM6|RS7_PSEU5 30S ribosomal protein S7 >gi|145569371|gb|ABP78477.1| ribosomal protein S7 [Pseudomonas stutzeri A1501] (156 aa)
Score = 375, Expect = 8.2e-35, Identities = 80/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREIL DP Y S ++ K +N +M  GKK +A++IVY + D +K++ N D +EVF+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DA +G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREILDDPKYGSLILAKFMNHVMESGKKAVAERIVYGALDKVKERKNGDPLEVFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDAARKRGEKSMALRLAGELLDAFEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|119468172|ref|ZP_01611298.1| 30S ribosomal protein S7 [Alteromonadales bacterium TW-7] >gi|119448165|gb|EAW29429.1| 30S ribosomal protein S7 [Alteromonadales bacterium TW-7] (156 aa)
Score = 375, Expect = 8.4e-35, Identities = 77/154 (50%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +ML+GKK  A++IVY + D+  +K+ +  +E+F+ AL+NI P +E++ RRV GS +QVP  V   R+  LG+RWL+ +ARKR EKSM  +LA EI+DA+   G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFGSELLAKFVNIVMLDGKKSTAEKIVYGALDVAAEKSGKSHLEIFESALDNIRPQVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWLVDAARKRGEKSMGLRLAQEIVDAADNKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|117618933|ref|YP_858448.1| 30S ribosomal protein S7 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166227410|sp|A0KQ97|RS7_AERHH 30S ribosomal protein S7 >gi|117560340|gb|ABK37288.1| ribosomal protein S7 [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (156 aa)
Score = 375, Expect = 8.7e-35, Identities = 73/154 (47%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK +++ IVY + D+I  KT ++ + VF++AL+NI P++E++ RRV G+ +QVP  V   R+  L +RWL+ +ARKR EKSM ++LA E++DA+   G++ KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFGSELLAKFVNVVMVDGKKSVSEAIVYGALDIIATKTGKEHLAVFEEALDNIRPAVEVKSRRVGGATYQVPVEVRPVRRNALAMRWLVDAARKRGEKSMAQRLAGELLDAADNKGSSVKKREDVHRMAEANKAFAHFRW 156
>gi|162149177|ref|YP_001603638.1| 30S ribosomal protein S7 [Gluconacetobacter diazotrophicus PAl 5] >gi|187596886|ref|ZP_02983147.1| ribosomal protein S7 [Gluconacetobacter diazotrophicus PAl 5] >gi|189045612|sp|A9H3R8|RS7_GLUDA 30S ribosomal protein S7 >gi|161787754|emb|CAP57350.1| 30S ribosomal protein S7 [Gluconacetobacter diazotrophicus PAl 5] >gi|187491244|gb|EDU29184.1| ribosomal protein S7 [Gluconacetobacter diazotrophicus PAl 5] (158 aa)
Score = 374, Expect = 9.3e-35, Identities = 74/154 (48%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK--TNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++RA KREILPDP +   ++T+ +NA+M +GKK  A+ IVY + ++++++   + D + +F  AL+N+ P++E+R RRV G+ +QVP  V  ER+Q L +RWLI ++RKR E +M E+L+ E++DA    G+A KK+EDTH+MAEANKAF+H R+
  S:     3 RRHRAVKREILPDPKFGDVVITRFMNALMYDGKKSTAEGIVYGALEVLRRRGGASADPVVMFHSALDNVKPAVEVRSRRVGGATYQVPVEVRTERRQALAIRWLIDASRKRGENTMQERLSNELLDAVNNRGSAVKKREDTHRMAEANKAFSHYRW 158
>gi|163859277|ref|YP_001633575.1| 30S ribosomal protein S7 [Bordetella petrii DSM 12804] >gi|163263005|emb|CAP45308.1| 30S ribosomal protein S7 [Bordetella petrii] (156 aa)
Score = 374, Expect = 9.8e-35, Identities = 81/154 (52%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + S  + K +N +ML+GKK +A++IVY + + ++ KT ++ IEVF  A+ NI P +E++ RRV G+N+QVP  V   R+  L +RWL  +A+KR EKSM  +LA E+IDAS+G GAA KK+EDTHKMAEANKAF+H R+
  S:     3 RRREVPKREILPDPKFGSVELAKFMNVVMLDGKKAVAERIVYGALEQVQAKTGKEPIEVFSLAINNIKPIVEVKSRRVGGANYQVPVEVRPVRRLALAMRWLREAAKKRGEKSMDLRLAGELIDASEGRGAAMKKREDTHKMAEANKAFSHFRW 156
>gi|189501585|ref|YP_001957302.1| ribosomal protein S7 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497026|gb|ACE05573.1| ribosomal protein S7 [Candidatus Amoebophilus asiaticus 5a2] (155 aa)
Score = 374, Expect = 9.9e-35, Identities = 79/154 (51%), Positives = 107/154 (69%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLR 154
           MRK    KR +LPDP Y   LVT+ +N +M  GKK LA  I Y + D++  KT E G+EV+KKAL N+ PS+E++ RRV G+  QVP  V  ER+ +LG++W++  AR R EK+M E+LA EII AS+G G + KKK D HKMAE+N+AF+H +
  S:     1 MRKGSPKKRTLLPDPKYKDTLVTRFVNNLMKGGKKNLAYDIFYSAVDIVGDKTGESGLEVWKKALSNVFPSVEVKRRRVGGATLQVPIEVRPERRISLGIKWMLEQARLRGEKTMQERLAYEIIAASQGEGKSVKKKADMHKMAESNRAFSHFK 154
>gi|152977965|ref|YP_001343594.1| 30S ribosomal protein S7 [Actinobacillus succinogenes 130Z] >gi|171472932|sp|A6VL12|RS7_ACTSZ 30S ribosomal protein S7 >gi|150839688|gb|ABR73659.1| ribosomal protein S7 [Actinobacillus succinogenes 130Z] (156 aa)
Score = 374, Expect = 1.1e-34, Identities = 76/154 (49%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R   R+ILPDP + S L+ K IN +M++GKK +A+ IVY + + + ++T +D +E F+ ALEN+ P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR +KSM  +LA E+ DA    GAA KK+ED H+MAEANKAFAH R+
  S:     3 RRRRIEPRKILPDPKFGSELLAKFINVLMVDGKKSIAESIVYNALETLAQRTGKDALESFEIALENVRPTVEVKSRRVGGSTYQVPVEVRPTRRNALGMRWIVEAARKRGDKSMALRLANELSDAVDNKGAAVKKREDVHRMAEANKAFAHFRW 156
>gi|108804978|ref|YP_644915.1| 30S ribosomal protein S7 [Rubrobacter xylanophilus DSM 9941] >gi|123368029|sp|Q1AU25|RS7_RUBXD 30S ribosomal protein S7 >gi|108766221|gb|ABG05103.1| ribosomal protein S7 [Rubrobacter xylanophilus DSM 9941] (156 aa)
Score = 374, Expect = 1.1e-34, Identities = 77/154 (50%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREI PDPVY S LV + IN +M +GKK  A++IVY +  +++++T ++ + V  +AL+NI P LE+R RRV G+ +QVP  V   R  TL LRWL+  AR R EK+M  +LA EI+DA    GA+ +KKE+TH+MAEAN+AFAH R+
  S:     3 RRGAPPKREIPPDPVYGSVLVQQLINKVMKDGKKSKAEKIVYNALSMVEERTGDNPVTVLSQALDNIKPRLEVRSRRVGGATYQVPVEVPPRRANTLALRWLVNFARARREKTMGHRLAGEILDAKDNIGASIRKKEETHRMAEANRAFAHYRW 156
>gi|42526558|ref|NP_971656.1| 30S ribosomal protein S7 [Treponema denticola ATCC 35405] >gi|62287297|sp|Q73NV4|RS7_TREDE 30S ribosomal protein S7 >gi|41816751|gb|AAS11537.1| ribosomal protein S7 [Treponema denticola ATCC 35405] (156 aa)
Score = 374, Expect = 1.1e-34, Identities = 77/154 (50%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R     +R + PD  YNS +VT+ I  +ML GKK +  +I+Y SFD IK+KT E+ + VF KAL+N+ P +E++ RRV G+ +QVP  + + R++ L +RW+I +ARKR+   M E+LA+E+IDA   TG AFKKKE+ H+MAEANKAFAH R+
  S:     3 RGKITARRPVAPDSKYNSVVVTRFIGRMMLSGKKSITTKIMYDSFDKIKEKTGEEPLAVFSKALDNVKPVVEVKSRRVGGATYQVPMDIPEGRREALAMRWIIGAARKRSGHEMSERLASELIDAYNNTGTAFKKKEEVHRMAEANKAFAHFRW 156
>gi|33864047|ref|NP_895607.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9313] >gi|124024053|ref|YP_001018360.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9303] >gi|166228460|sp|A2CC85|RS7_PROM3 30S ribosomal protein S7 >gi|62287312|sp|Q7V502|RS7_PROMM 30S ribosomal protein S7 >gi|33635631|emb|CAE21955.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9313] >gi|123964339|gb|ABM79095.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9303] (156 aa)
Score = 374, Expect = 1.1e-34, Identities = 79/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +N+RL T  I+ +M  GKK  AQ+I+ Q+F LI ++T  D IE+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLAAE++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPVLPDPQFNNRLATMMISRLMKHGKKSTAQRILAQAFGLINERTGGDPIELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVNFSRARNGRSMSQKLAAELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|170078667|ref|YP_001735305.1| ribosomal protein S7 [Synechococcus sp. PCC 7002] >gi|169886336|gb|ACB00050.1| ribosomal protein S7 [Synechococcus sp. PCC 7002] (156 aa)
Score = 373, Expect = 1.2e-34, Identities = 80/154 (51%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++   KR + PD VYN+RL++  I  +M  GKK LA +IVY + D+IK++T  D IEVF+ A+ N+ P +E++ RRV G+ +QVP  V + R   L LRWLI  AR+R+ KSM  KLA E++DA+  TG A KK+EDTH+MAEANKAFAH R+
  S:     3 RRSVTKKRVVPPDAVYNNRLLSMTIRRVMKSGKKSLAARIVYDALDIIKERTGSDPIEVFETAIRNLTPLVEVKARRVGGATYQVPMEVRQGRGTALALRWLIGYARQRSGKSMAIKLANELMDAANETGGAIKKREDTHRMAEANKAFAHYRY 156
>gi|126724857|ref|ZP_01740700.1| 30S ribosomal protein S7 [Rhodobacterales bacterium HTCC2150] >gi|126706021|gb|EBA05111.1| 30S ribosomal protein S7 [Rhodobacterales bacterium HTCC2150] (156 aa)
Score = 373, Expect = 1.3e-34, Identities = 77/154 (50%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  +  +++TK +N +M++GKK +A+ IVY + D ++ K     IEVF +AL+NI P++E+R RRV G+ +QVP  V  ER++ L +RW+I +AR RNE +M E+LA E++DA  G G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKFGDKVLTKFMNNLMIDGKKSVAESIVYNALDRVETKLKRAPIEVFTEALDNIKPAVEVRSRRVGGATYQVPVEVRVERREALAIRWMIKAARARNENTMEERLAGELMDAVSGRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|78221842|ref|YP_383589.1| 30S ribosomal protein S7 [Geobacter metallireducens GS-15] >gi|90120432|sp|Q39Y10|RS7_GEOMG 30S ribosomal protein S7 >gi|78193097|gb|ABB30864.1| SSU ribosomal protein S7P [Geobacter metallireducens GS-15] (156 aa)
Score = 373, Expect = 1.4e-34, Identities = 75/154 (48%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP +N R+V K +N IM+ GKK  A++ +Y + +++ +KT E+ ++V KK L+NI P+LE++ RRV GS +QVP  V  +R+ +L +RWL+  A  R+EK++ +KLA EI+D     GAA KK+EDTH+MAEAN+AFAH R+
  S:     3 RRREVAKRVILPDPKFNDRVVAKLVNVIMVGGKKSTAERALYGALEVVSQKTGEEAVKVLKKCLDNIKPTLEVKSRRVGGSTYQVPVEVRADRRVSLAMRWLVKYANDRSEKTVTDKLAGEILDVYNNRGAAVKKREDTHRMAEANRAFAHYRW 156
>gi|113461782|ref|YP_719851.1| 30S ribosomal protein S7 [Haemophilus somnus 129PT] >gi|170718094|ref|YP_001785128.1| ribosomal protein S7 [Haemophilus somnus 2336] >gi|122945408|sp|Q0I536|RS7_HAES1 30S ribosomal protein S7 >gi|189045613|sp|B0UWC5|RS7_HAES2 30S ribosomal protein S7 >gi|112823825|gb|ABI25914.1| SSU ribosomal protein S7P [Haemophilus somnus 129PT] >gi|168826223|gb|ACA31594.1| ribosomal protein S7 [Haemophilus somnus 2336] (156 aa)
Score = 373, Expect = 1.5e-34, Identities = 76/154 (49%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R   R+ILPDP + S L+ K IN +M++GKK +A+ IVY + + + ++T ++ +E F+ ALEN+ P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR +KSM  +LA E+ DAS+  GAA KK+ED H+MAEANKAFAH R+
  S:     3 RRRRIEPRKILPDPKFGSELLAKFINVLMVDGKKSIAESIVYGALETLSQRTGKEALEAFEIALENVRPTVEVKSRRVGGSTYQVPVEVRPTRRNALGMRWIVEAARKRGDKSMALRLANELSDASENKGAAVKKREDVHRMAEANKAFAHYRW 156
>gi|91216913|ref|ZP_01253877.1| 30S ribosomal protein S7 [Psychroflexus torquis ATCC 700755] >gi|91185074|gb|EAS71453.1| 30S ribosomal protein S7 [Psychroflexus torquis ATCC 700755] (158 aa)
Score = 373, Expect = 1.6e-34, Identities = 79/155 (50%), Positives = 116/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR ILPDP ++ +LVT+ +N +M +GKK +A +I Y + D+I++K  +D    +E++K+ L N+MP +E+R RRV G+ FQ+P+ +  +RK ++ ++WLI  +RKRNEK+M  KLA E + A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRQAKKRPILPDPKFHDQLVTRFVNMMMWDGKKSIAFKIFYDAMDIIEEKKQDDEKSALEIWKEGLSNVMPHVEVRSRRVGGATFQIPSQIRPDRKISIAMKWLIGYSRKRNEKTMAAKLAGESMAAAKEEGAAVKKRLDTHKMAEANKAFSHFRF 158
>gi|89053067|ref|YP_508518.1| 30S ribosomal protein S7 [Jannaschia sp. CCS1] >gi|109894832|sp|Q28UW9|RS7_JANSC 30S ribosomal protein S7 >gi|88862616|gb|ABD53493.1| SSU ribosomal protein S7P [Jannaschia sp. CCS1] (156 aa)
Score = 373, Expect = 1.6e-34, Identities = 75/154 (48%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KR++LPD  +   ++TK +N +M++GKK +A++IVY +FD ++ K     +EVF +ALENI P++E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA    G+A KK+EDTHKMA+AN+AF+H R+
  S:     3 RRHAAEKRQVLPDAKFGDMVLTKFMNNLMIDGKKAVAERIVYNAFDRVEGKLKRAPVEVFHEALENIKPAVEVRSRRVGGATYQVPVDVRPERREALAIRWLINASRARNENTMEERLAGELVDAVNMRGSAVKKREDTHKMADANRAFSHYRW 156
>gi|169181074|ref|ZP_02841667.1| ribosomal protein S7 [Thauera sp. MZ1T] >gi|169011573|gb|EDS58330.1| ribosomal protein S7 [Thauera sp. MZ1T] (156 aa)
Score = 373, Expect = 1.6e-34, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+LPDP + ++ V+K IN IM  GKK +A++IVY +FD I  K+ +D +EVF  A+ N+ P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR EKSM ++LA E+++AS+G G+A KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKREVLPDPKFGNQDVSKFINVIMQSGKKSVAERIVYGAFDHISSKSGKDPLEVFSVAVANVKPVVEVKSRRVGGANYQVPVEVRPSRRMALSMRWLREAARKRAEKSMAQRLAGELLEASEGRGSAMKKREEVHRMAEANKAFSHYRF 156
>gi|120437177|ref|YP_862863.1| 30S ribosomal protein S7 [Gramella forsetii KT0803] >gi|117579327|emb|CAL67796.1| 30S ribosomal protein S7 [Gramella forsetii KT0803] (158 aa)
Score = 372, Expect = 1.6e-34, Identities = 80/155 (51%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR +LPDP +N +LVT+ +N +M +GKK +A +I Y +  ++ +K  ++   G+E++K AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++WLI  +RKRNEKSM  KLAAE++ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRQAKKRPLLPDPKFNDQLVTRFVNMMMWDGKKSVAFKIFYDAIAIVDEKKQDEEKTGLEIWKDALSNVMPHVEVRSRRVGGATFQIPMQIRPDRKVSTAMKWLISFSRKRNEKSMAGKLAAEVLAAAKEEGAAVKKRVDTHKMAEANKAFSHFRF 158
>gi|34499645|ref|NP_903860.1| 30S ribosomal protein S7 [Chromobacterium violaceum ATCC 12472] >gi|62287308|sp|Q7NQE9|RS7_CHRVO 30S ribosomal protein S7 >gi|34105495|gb|AAQ61850.1| 30S ribosomal protein S7 [Chromobacterium violaceum ATCC 12472] (156 aa)
Score = 372, Expect = 1.6e-34, Identities = 77/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + S+ ++K +N +M++GKK +A++I+Y + + I+KKT ++ IEVF  AL N  P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR EKSM  +LA E+IDA++G G A KK+++ H+MAEANKAF+H RF
  S:     3 RRREVPKREILPDPKFGSQDLSKFMNVVMIDGKKSVAERIIYGALEQIEKKTGKNAIEVFNTALSNAKPVVEVKSRRVGGANYQVPVEVRPSRRMALAMRWLRDAARKRGEKSMDLRLAGELIDAAEGRGGAMKKRDEVHRMAEANKAFSHFRF 156
>gi|56551410|ref|YP_162249.1| 30S ribosomal protein S7 [Zymomonas mobilis subsp. mobilis ZM4] >gi|62287192|sp|Q5NQ67|RS7_ZYMMO 30S ribosomal protein S7 >gi|56542984|gb|AAV89138.1| ribosomal protein S7 [Zymomonas mobilis subsp. mobilis ZM4] (156 aa)
Score = 372, Expect = 1.6e-34, Identities = 73/154 (47%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  KREILPDP Y   +++K +N++ML+GKK +A++I+Y + D I+ +     +EVF +AL+N+ P +E+R RRV G+ +QVP  V  +R Q L +RWLI ++R R+E SM  +L+ E++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRRRPEKREILPDPKYGDVVLSKFMNSVMLDGKKSVAERILYSALDSIEARVKRVPLEVFHEALDNVKPGIEVRSRRVGGATYQVPVEVRPDRAQALAIRWLIAASRARSEHSMSARLSGELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|39997953|ref|NP_953904.1| 30S ribosomal protein S7 [Geobacter sulfurreducens PCA] >gi|62287299|sp|Q748Y7|RS7_GEOSL 30S ribosomal protein S7 >gi|39984898|gb|AAR36254.1| ribosomal protein S7 [Geobacter sulfurreducens PCA] (156 aa)
Score = 372, Expect = 1.6e-34, Identities = 75/154 (48%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP +N R+V K ++ IML+GKK  A++ +Y + D++ +K  E+ ++V KK L+NI P L ++ RRV GS +QVP  V  +R+ +L +RWL+  A +R+EK++ +KLA EI+DA    GAA KK+EDTH+MAEAN+AFAH R+
  S:     3 RRREVAKRVILPDPKFNDRVVAKLVSVIMLDGKKSTAERALYGALDIVSQKAGEEPVKVLKKCLDNIKPMLGVKSRRVGGSTYQVPVEVRADRRVSLAMRWLVRYANERSEKTITDKLAGEILDAYNNRGAAVKKREDTHRMAEANRAFAHYRW 156
>gi|78185587|ref|YP_378021.1| 30S ribosomal protein S7 [Synechococcus sp. CC9902] >gi|116072132|ref|ZP_01469400.1| 30S ribosomal protein S7 [Synechococcus sp. BL107] >gi|109894857|sp|Q3AW55|RS7_SYNS9 30S ribosomal protein S7 >gi|78169881|gb|ABB26978.1| SSU ribosomal protein S7P [Synechococcus sp. CC9902] >gi|116065755|gb|EAU71513.1| 30S ribosomal protein S7 [Synechococcus sp. BL107] (156 aa)
Score = 372, Expect = 1.7e-34, Identities = 77/154 (50%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR ILPDP +NSRL T  +  +M  GKK  AQ+I+  +F LI ++T  D +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAVKRPILPDPQFNSRLATMMVARLMQHGKKSTAQRILSDAFGLINERTGGDPLELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVSFSRARNGRSMSQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|15603220|ref|NP_246294.1| 30S ribosomal protein S7 [Pasteurella multocida subsp. multocida str. Pm70] >gi|17367644|sp|Q9CL85|RS7_PASMU 30S ribosomal protein S7 >gi|12721725|gb|AAK03439.1| RpS7 [Pasteurella multocida subsp. multocida str. Pm70] (156 aa)
Score = 372, Expect = 1.7e-34, Identities = 75/154 (48%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+     R+ILPDP + S L+ K IN +M++GKK +A++IVY + D + ++T ++ +E F+ AL+N+ P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR +KSM  +LA E+ DAS+  GAA KK+ED H+MAEANKAFAH R+
  S:     3 RRRSIEPRKILPDPKFGSELLAKFINVLMVDGKKSIAEKIVYSALDTLAQRTGKEALEAFEAALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWIVDAARKRGDKSMALRLANELSDASENKGAAVKKREDVHRMAEANKAFAHYRW 156
>gi|196245263|ref|ZP_03143987.1| ribosomal protein S7 [Cyanothece sp. PCC 8802] >gi|196206792|gb|EDY01587.1| ribosomal protein S7 [Cyanothece sp. PCC 8802] (171 aa)
Score = 372, Expect = 1.8e-34, Identities = 75/154 (48%), Positives = 105/154 (68%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R + PDPVYNSRL++  I  +M  GKK +A  I+Y +   I +KT  D +EVF+KA++N+ P +E++ RRV G+ +QVP  V   R  TL LRWL+  AR R  ++M  KLA EI+DA+  TG A KK+++TH+MAEANKAFAH R+
  S:     3 RRGNIKRRPVPPDPVYNSRLISMTIRRVMKSGKKSVAAGIMYDALTSIGEKTGSDPLEVFEKAIKNLTPLVEVKARRVGGATYQVPMEVRSSRGTTLALRWLVHYARIRGGRTMSSKLANEIMDAANETGGAMKKRDETHRMAEANKAFAHFRY 156
>gi|116075713|ref|ZP_01472972.1| 30S ribosomal protein S7 [Synechococcus sp. RS9916] >gi|116067028|gb|EAU72783.1| 30S ribosomal protein S7 [Synechococcus sp. RS9916] (156 aa)
Score = 372, Expect = 1.8e-34, Identities = 78/154 (50%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR ILPDP +NSRL T  +  +M  GKK  AQ+I+  +F LI ++T  D IE+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G A +K+E+THKMAEANKAFAH R+
  S:     3 RRNTAVKRPILPDPQFNSRLATMMVARLMKHGKKSTAQRILSDAFGLIGERTGNDPIELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVSFSRARNGRSMAQKLAGELMDAANEAGNAVRKREETHKMAEANKAFAHYRY 156
>gi|183221351|ref|YP_001839347.1| 30S ribosomal protein S7 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911444|ref|YP_001962999.1| 30S Ribosomal protein S7 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776120|gb|ABZ94421.1| 30S Ribosomal protein S7 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779773|gb|ABZ98071.1| 30S ribosomal protein S7 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (157 aa)
Score = 372, Expect = 1.8e-34, Identities = 78/154 (50%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ +   R I  DP YN ++++K IN +M++GKK +A+ + Y + ++I KKT +D   VF++ALEN  P +E++ RRV G  +QVP  V  ER+  LG+RWLI  +R RNEKSM  KLAAE ++A KGTG+A KKKED  KMA+ANKAF+H R+
  S:     4 RRGKVEPRHIEGDPKYNDKVISKFINCLMVDGKKSVAESVFYDALEVIAKKTGQDPFAVFQEALENAKPQVEVKSRRVGGVTYQVPIEVRPERRLALGIRWLIKYSRGRNEKSMKNKLAAEFMEAQKGTGSAIKKKEDIRKMADANKAFSHYRW 157
>gi|139438562|ref|ZP_01772078.1| Hypothetical protein COLAER_01076 [Collinsella aerofaciens ATCC 25986] >gi|133776101|gb|EBA39921.1| Hypothetical protein COLAER_01076 [Collinsella aerofaciens ATCC 25986] (157 aa)
Score = 372, Expect = 1.9e-34, Identities = 76/154 (49%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNE-DGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A +RE+ PD VYN+RLVT+ IN ++L+GKK  A++IVY +F+++ +K+   D +  FKKA++N+ P+LE++ +RV G+ +QVP  V+  R   LG+RW++  +R R EK+M E+LA EI+DAS G GA+ KK+ED  KMAEAN+AF+H R+
  S:     3 RRAAANRREVQPDAVYNNRLVTQLINKVLLDGKKATAERIVYTAFEIVAEKSEGGDALATFKKAMDNVKPTLEVKPKRVGGATYQVPMEVNSRRSTALGIRWIVNFSRARKEKTMAERLANEILDASNGLGASVKKREDVFKMAEANRAFSHYRW 157
>gi|33866668|ref|NP_898227.1| 30S ribosomal protein S7 [Synechococcus sp. WH 8102] >gi|62287309|sp|Q7U4D3|RS7_SYNPX 30S ribosomal protein S7 >gi|33633446|emb|CAE08651.1| 30S ribosomal protein S7 [Synechococcus sp. WH 8102] (156 aa)
Score = 372, Expect = 2.0e-34, Identities = 76/154 (49%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +NSRL T  ++ +M  GKK  AQ+I+  +F LI ++T  D +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPVLPDPQFNSRLATMMVSRLMQHGKKSTAQRILSDAFGLINERTGGDPLELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVSFSRARNGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|187476535|ref|YP_784559.1| 30S ribosomal protein S7 [Bordetella avium 197N] >gi|109894825|sp|Q2L2H3|RS7_BORA1 30S ribosomal protein S7 >gi|115421121|emb|CAJ47605.1| 30S ribosomal protein S7 [Bordetella avium 197N] (156 aa)
Score = 372, Expect = 2.1e-34, Identities = 81/154 (52%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + S  + K +N +ML+GKK +A++IVY +   ++ KT ++ IEVF  A+ NI P +E++ RRV G+N+QVP  V   R+  L +RWL  +A+KR EKSM  +LA E+IDAS+G GAA KK+EDTHKMAEANKAF+H R+
  S:     3 RRREVPKREILPDPKFGSVELAKFMNVVMLDGKKAVAERIVYGALAQVQTKTGKEPIEVFTLAINNIKPIVEVKSRRVGGANYQVPVEVRPVRRLALAMRWLREAAKKRGEKSMDLRLAGELIDASEGRGAAMKKREDTHKMAEANKAFSHFRW 156
>gi|27364736|ref|NP_760264.1| 30S ribosomal protein S7 [Vibrio vulnificus CMCP6] >gi|37681215|ref|NP_935824.1| 30S ribosomal protein S7 [Vibrio vulnificus YJ016] >gi|31340390|sp|Q8DCQ9|RS7_VIBVU 30S ribosomal protein S7 >gi|62287303|sp|Q7MH41|RS7_VIBVY 30S ribosomal protein S7 >gi|27360881|gb|AAO09791.1|AE016801_110 Ribosomal protein S7 [Vibrio vulnificus CMCP6] >gi|37199966|dbj|BAC95795.1| ribosomal protein S7 [Vibrio vulnificus YJ016] (156 aa)
Score = 371, Expect = 2.2e-34, Identities = 77/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK +A++IVY + D + +K+ +D + VF++ALEN+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LAAE++DAS   G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFKSELLAKFVNILMVDGKKSVAEKIVYTALDTMAEKSGKDHLAVFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAARLAAEMLDASDNKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|88861463|ref|ZP_01136090.1| 30S ribosomal subunit protein S7 [Pseudoalteromonas tunicata D2] >gi|88816545|gb|EAR26373.1| 30S ribosomal subunit protein S7 [Pseudoalteromonas tunicata D2] (156 aa)
Score = 371, Expect = 2.2e-34, Identities = 75/154 (48%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +ML+GKK  A++IVY + D+  +K+ +  +E+F+ AL+N+ P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR EKSM  +LA E++DAS   G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFGSELLAKFVNVLMLDGKKSTAEKIVYGALDVAAEKSGKSHLEIFEAALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWIVDAARKRGEKSMGLRLAQEMLDASDNKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|114771273|ref|ZP_01448693.1| 30S ribosomal protein S7 [alpha proteobacterium HTCC2255] >gi|114548198|gb|EAU51085.1| 30S ribosomal protein S7 [alpha proteobacterium HTCC2255] (156 aa)
Score = 371, Expect = 2.3e-34, Identities = 78/154 (50%), Positives = 115/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y + ++TK +N +ML+G+K  A++IVY + D ++ K     IEVF++AL+NI P++E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LAAE++DA    G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHSAVKREVLPDAKYGNTVLTKFMNNLMLDGRKSAAERIVYGALDRVETKLKRAPIEVFEEALDNIKPAVEVRSRRVGGATYQVPVEVRVERREALAIRWLIKASRTRNENTMEERLAAELMDAINSRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|88803754|ref|ZP_01119278.1| 30S ribosomal protein S7 [Polaribacter irgensii 23-P] >gi|88780487|gb|EAR11668.1| 30S ribosomal protein S7 [Polaribacter irgensii 23-P] (158 aa)
Score = 371, Expect = 2.4e-34, Identities = 77/155 (49%), Positives = 116/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNED---GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK  A KR +LPDP +N +LVT+ +N +M  GKK +A ++ Y + D+++++  E+    +E++K+ L N+MP +E+R RRV G+ FQ+P  +  +RK ++ ++W+IL  RKRNEK+M ++LAAEI+ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRAAKKRVLLPDPKFNDQLVTRFVNNLMWAGKKSVAFKVFYDALDIVEERKGEEEKSALELWKEGLSNVMPHVEVRSRRVGGATFQIPMQIRPDRKVSMAIKWMILYTRKRNEKTMAQRLAAEILAAAKEEGAAVKKRTDTHKMAEANKAFSHFRF 158
>gi|126662267|ref|ZP_01733266.1| 30S ribosomal protein S7 [Flavobacteria bacterium BAL38] >gi|126625646|gb|EAZ96335.1| 30S ribosomal protein S7 [Flavobacteria bacterium BAL38] (158 aa)
Score = 371, Expect = 2.4e-34, Identities = 79/155 (50%), Positives = 113/155 (72%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLI---KKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK  A KR +LPDP +N +LVT+ +N +M +GKK  A ++ Y + D++   K+   +  +EV+K AL N+MP +E+R RRV G+ FQ+P  +  +RK +  ++W+IL AR+RNEKSM  KLA+EI+ A+K  GAA KK+ DTHKMA+ANKAF+H RF
  S:     1 MRKRAAKKRPLLPDPKFNDQLVTRFVNNLMWDGKKSTAFKVFYDALDIVEAKKQDAEKTALEVWKDALTNVMPHVEVRSRRVGGATFQIPMQIRPDRKISYSMKWMILYARRRNEKSMAGKLASEILAAAKEEGAAVKKRMDTHKMADANKAFSHFRF 158
>gi|163726938|ref|ZP_02134442.1| ribosomal protein S7 [Desulfatibacillum alkenivorans AK-01] >gi|161399817|gb|EDQ24081.1| ribosomal protein S7 [Desulfatibacillum alkenivorans AK-01] (156 aa)
Score = 371, Expect = 2.5e-34, Identities = 76/154 (49%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+LPD  YNS LV K +N IM +GKK +A+ I+Y +FD+++++T E  +E+F+KA+ NI P +E++ RRV GS +Q+P  V   R+  L ++W++  +R R+EK M  KLA E++DA    GA+ KKKEDTH+MAEANKAFAH R+
  S:     3 RRREVPKREVLPDSRYNSELVAKFVNVIMRDGKKSVAEGILYDAFDIMEERTKEAPLEIFEKAINNIKPVIEVKSRRVGGSTYQIPMEVRANRRTALAMKWIMTYSRSRSEKKMSAKLAGELLDAYNNRGASIKKKEDTHRMAEANKAFAHYRW 156
>gi|70732886|ref|YP_262654.1| 30S ribosomal protein S7 [Pseudomonas fluorescens Pf-5] >gi|110826002|sp|Q4K529|RS7_PSEF5 30S ribosomal protein S7 >gi|68347185|gb|AAY94791.1| ribosomal protein S7 [Pseudomonas fluorescens Pf-5] (156 aa)
Score = 371, Expect = 2.7e-34, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREIL DP Y S+++ K +N +M  GKK +A++IVY + + +K++ N D +E+F+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+  ARKR EKSM  +LA E++DA++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVYGALEKVKERKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|71905957|ref|YP_283544.1| 30S ribosomal protein S7 [Dechloromonas aromatica RCB] >gi|115305707|sp|Q47JA7|RS7_DECAR 30S ribosomal protein S7 >gi|71845578|gb|AAZ45074.1| SSU ribosomal protein S7P [Dechloromonas aromatica RCB] (156 aa)
Score = 371, Expect = 2.7e-34, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR+ILPDP + +  V+K +NAIM  GKK +A++IVY +FD+I  K  +D +EVF  A+ N+ P +E++ RRV G+N+QVP  V   R+  L +RWL  SARKR+EKSM ++LAAE+++A++  G A KK+++ H+MAEANKAFAH RF
  S:     3 RRREVPKRDILPDPKFGNVEVSKFVNAIMQSGKKSVAERIVYGAFDIITTKGGKDPLEVFSAAMSNVKPMVEVKSRRVGGANYQVPVEVRPARRAALAMRWLRESARKRSEKSMGQRLAAEMLEAAENRGGAVKKRDEVHRMAEANKAFAHFRF 156
>gi|83854983|ref|ZP_00948513.1| 30S ribosomal protein S7 [Sulfitobacter sp. NAS-14.1] >gi|83941505|ref|ZP_00953967.1| 30S ribosomal protein S7 [Sulfitobacter sp. EE-36] >gi|83842826|gb|EAP81993.1| 30S ribosomal protein S7 [Sulfitobacter sp. NAS-14.1] >gi|83847325|gb|EAP85200.1| 30S ribosomal protein S7 [Sulfitobacter sp. EE-36] (156 aa)
Score = 370, Expect = 2.9e-34, Identities = 77/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y   ++TK +N +M++GKK +A++IVY + + ++ K     IEVF +AL+NI PS+E+R RRV G+ +QVP  V  ER++ L +RWLI ++R RNE +M E+LA E++DA +  G A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDLVLTKFMNNLMIDGKKSVAERIVYNAMNRVEDKIKRAPIEVFHEALDNIKPSVEVRSRRVGGATYQVPVEVRPERREALAIRWLIKASRARNENTMEERLAGELLDAVQSRGTAVKKREDTHKMADANKAFSHYRW 156
>gi|163752497|ref|ZP_02159685.1| 30S ribosomal protein S7 [Shewanella benthica KT99] >gi|161327616|gb|EDP98812.1| 30S ribosomal protein S7 [Shewanella benthica KT99] (156 aa)
Score = 370, Expect = 3.1e-34, Identities = 77/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP +NS L+ K IN IM +GKK  A++I+Y++ D   +K  E+ + + + AL+N+ PS+E++ RRV GS +QVP  V   R+  LG+RWL+ +ARKR EKSM  +LA E++DAS+  G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFNSELLAKFINVIMQDGKKSTAEKIIYKALDTAFEKKGEEHLVILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALGMRWLVEAARKRGEKSMALRLAGELLDASENKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|150025410|ref|YP_001296236.1| 30S ribosomal protein S7 [Flavobacterium psychrophilum JIP02/86] >gi|149771951|emb|CAL43425.1| 30S ribosomal protein S7 [Flavobacterium psychrophilum JIP02/86] (158 aa)
Score = 370, Expect = 3.4e-34, Identities = 76/155 (49%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNE---DGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK  A KR +LPDP +N +LVT+ +N +M +GKK  A ++ Y + D+++ K  +     ++++K AL N+MP +E+R RRV G+ FQ+P  +  +RK ++ ++W+IL +R+RNEKSM +KLA+E++ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRAAKKRPLLPDPRFNDQLVTRFVNNLMWDGKKSTAFKVFYDAMDIVEAKKQDQEKSSVDIWKDALTNVMPHVEVRSRRVGGATFQIPMQIRPDRKISMAMKWMILYSRRRNEKSMAQKLASEVLAAAKEEGAAVKKRMDTHKMAEANKAFSHFRF 158
>gi|77359196|ref|YP_338771.1| 30S ribosomal protein S7 [Pseudoalteromonas haloplanktis TAC125] >gi|90120532|sp|Q3ILP6|RS7_PSEHT 30S ribosomal protein S7 >gi|76874107|emb|CAI85328.1| 30S ribosomal subunit protein S7 [Pseudoalteromonas haloplanktis TAC125] (156 aa)
Score = 370, Expect = 3.4e-34, Identities = 76/154 (49%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +ML+GKK  A++IVY + ++  +K+ +  +E+F+ AL+NI P +E++ RRV GS +QVP  V   R+  LG+RWL+ +ARKR EKSM  +LA EI+DA+   G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFGSELLAKFVNIVMLDGKKSTAEKIVYGALNVAAEKSGKSHLEIFETALDNIRPQVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWLVDAARKRGEKSMGLRLAQEIVDAADNKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|90407959|ref|ZP_01216132.1| 30S ribosomal protein S7 [Psychromonas sp. CNPT3] >gi|90310897|gb|EAS39009.1| 30S ribosomal protein S7 [Psychromonas sp. CNPT3] (156 aa)
Score = 369, Expect = 3.6e-34, Identities = 75/154 (48%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+     R+ILPDP + S ++ K IN +M++GKK ++++IVY + ++  KKT +D +E+F+ ALENI PS+E++ RRV GS +QVP  V   R+  L +RWL+ ++RKR EKSM  +LA E++DA+   G+A KK+ED H+MA+ANKAFAH R+
  S:     3 RRRVIATRKILPDPKFGSEVLAKFINVVMVDGKKSISEKIVYVALEVSSKKTEKDALELFESALENIRPSVEVKSRRVGGSTYQVPVEVRPSRRNALAMRWLVEASRKRGEKSMALRLAGELVDAADNKGSAVKKREDVHRMADANKAFAHYRW 156
>gi|166710823|ref|ZP_02242030.1| 30S ribosomal protein S7 [Xanthomonas oryzae pv. oryzicola BLS256] (155 aa)
Score = 369, Expect = 3.8e-34, Identities = 77/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R +LPDP + S  + + IN +M  GKK +A++IVY + D+I +K N + IE+ +KAL+N+ P++E++ RRV G+ +QVP  V   R+  L +RWLI SARKR E +M  KLAAE++DA++G G A KK+E+TH+MAEANKAFAH R+
  S:     3 RKGSTPQRTVLPDPKHGSETIARFINMVMQSGKKSVAEKIVYGAMDVIGEK-NPNAIELVQKALDNVAPAVEVKSRRVGGATYQVPVEVRSSRRMALAMRWLIDSARKRGENTMPRKLAAELLDAAEGRGGAIKKREETHRMAEANKAFAHYRW 155
>gi|71733660|ref|YP_276710.1| 30S ribosomal protein S7 [Pseudomonas syringae pv. phaseolicola 1448A] >gi|110826001|sp|Q48D32|RS7_PSE14 30S ribosomal protein S7 >gi|71554213|gb|AAZ33424.1| ribosomal protein S7 [Pseudomonas syringae pv. phaseolicola 1448A] (156 aa)
Score = 369, Expect = 3.9e-34, Identities = 77/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KRE+L DP Y S+++ K +N +M  GKK +A++IVY + + +K++ N D +E+F+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+  ARKR EKSM  +LA E++DA++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREVLDDPKYGSQILAKFMNHVMESGKKAVAERIVYGALEKVKERKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|171462875|ref|YP_001796988.1| ribosomal protein S7 [Polynucleobacter necessarius STIR1] >gi|171192413|gb|ACB43374.1| ribosomal protein S7 [Polynucleobacter necessarius STIR1] (156 aa)
Score = 369, Expect = 3.9e-34, Identities = 76/154 (49%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ +  KREILPDP + +  V K +N +ML+GKK +A++IVY +FD I+KK N++ +E+F  A+ N+ P +E++ RRV G+N+QVP  V   R+  L +RWL  +A+KR EKSM ++LA E+++A++G G A KK+E+ H+MAEANKAF+H RF
  S:     3 RRRKVPKREILPDPKFGNVEVAKFMNVLMLDGKKSVAERIVYGAFDHIEKKANKEPLEIFSTAMGNVKPMVEVKSRRVGGANYQVPVEVRPSRRSALAMRWLREAAKKRGEKSMAQRLANELLEAAEGRGGAMKKREEVHRMAEANKAFSHFRF 156
>gi|91774631|ref|YP_544387.1| 30S ribosomal protein S7 [Methylobacillus flagellatus KT] >gi|122985650|sp|Q1H4P1|RS7_METFK 30S ribosomal protein S7 >gi|91708618|gb|ABE48546.1| SSU ribosomal protein S7P [Methylobacillus flagellatus KT] (156 aa)
Score = 369, Expect = 3.9e-34, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP + S+ V+K +N +M  GKK +A++I+Y +FD I +K+ ++ +EVF  A+ N+ P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR EKSM  +LAAE+I+AS+G GAA KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKRNILPDPKFGSQEVSKFVNVLMTGGKKSVAERILYGAFDQITQKSGKEALEVFTLAISNLRPVVEVKSRRVGGANYQVPVEVRPARRSALAMRWLRDAARKRGEKSMGLRLAAELIEASEGRGAAIKKREEVHRMAEANKAFSHFRF 156
>gi|153844208|ref|ZP_01993634.1| ribosomal protein S7 [Vibrio parahaemolyticus AQ3810] >gi|149745250|gb|EDM56501.1| ribosomal protein S7 [Vibrio parahaemolyticus AQ3810] (153 aa)
Score = 369, Expect = 3.9e-34, Identities = 75/148 (50%), Positives = 112/148 (75%)
  Q:     8 KREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           +R+ILPDP + S L+ K +N +M++GKK  A++IVY + D + +K+ +D + +F++ALEN+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM ++LAAE++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     6 QRKILPDPKFKSELLAKFVNILMVDGKKSTAEKIVYTALDSMAEKSGKDHLAIFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAQRLAAEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 153
>gi|88807942|ref|ZP_01123453.1| 30S ribosomal protein S7 [Synechococcus sp. WH 7805] >gi|88787981|gb|EAR19137.1| 30S ribosomal protein S7 [Synechococcus sp. WH 7805] (156 aa)
Score = 369, Expect = 4.0e-34, Identities = 76/154 (49%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +N+RL T  +  +M  GKK  AQ+I+  +F LI ++T  D IE+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAVKRPVLPDPQFNNRLATMLVARLMKHGKKSTAQRILSDAFGLIGERTGGDPIELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVSFSRARNGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|59710838|ref|YP_203614.1| 30S ribosomal protein S7 [Vibrio fischeri ES114] >gi|163730902|ref|ZP_02138371.1| 30S ribosomal protein S7 [Vibrio fischeri MJ11] >gi|75507113|sp|Q5E8C0|RS7_VIBF1 30S ribosomal protein S7 >gi|59478939|gb|AAW84726.1| 30S ribosomal subunit protein S7 [Vibrio fischeri ES114] >gi|161395757|gb|EDQ20057.1| 30S ribosomal protein S7 [Vibrio fischeri MJ11] (156 aa)
Score = 369, Expect = 4.0e-34, Identities = 75/154 (48%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK  A++IVY + DL+ +K+ +D + VF++ALEN+ P++E++ RRV GS +QVP  V   R+  L +RW++ +ARKR EKSM ++LA E++DAS+  G A KK+ED H+MA+ANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFKSELLAKFVNIVMVDGKKSTAEKIVYGALDLMAEKSGKDHLAVFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWMVEAARKRGEKSMAQRLANEMLDASENKGTAVKKREDVHRMADANKAFAHYRW 156
>gi|28899546|ref|NP_799151.1| 30S ribosomal protein S7 [Vibrio parahaemolyticus RIMD 2210633] >gi|31340373|sp|Q87L44|RS7_VIBPA 30S ribosomal protein S7 >gi|28807782|dbj|BAC61035.1| ribosomal protein S7 [Vibrio parahaemolyticus RIMD 2210633] (156 aa)
Score = 369, Expect = 4.4e-34, Identities = 76/154 (49%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK  A++IVY + D + +K+ +D + +F++ALEN+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM ++LAAE++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFKSELLAKFVNILMVDGKKSTAEKIVYTALDSMAEKSGKDHLAIFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAQRLAAEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|86132541|ref|ZP_01051134.1| 30S ribosomal protein S7 [Cellulophaga sp. MED134] >gi|85816783|gb|EAQ37968.1| 30S ribosomal protein S7 [Dokdonia donghaensis MED134] (158 aa)
Score = 369, Expect = 4.6e-34, Identities = 83/155 (53%), Positives = 116/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK-TNED--GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +A KR ILPDP +N +LVT+ +N +M  GKK  A ++ Y + D++++K TNE+   +E++K AL N+MP +E+R RRV G+ +Q+P  +  +RK +  ++WLI  +RKRNEKSM  KLAAEI+ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKKQAKKRPILPDPKFNDQLVTRFVNMMMWSGKKSTAFKVFYDAIDIVEEKNTNEEKTALELWKDALSNVMPHVEVRSRRVGGATYQIPNQIRPDRKISTAMKWLISFSRKRNEKSMAAKLAAEIMAAAKEEGAAVKKRVDTHKMAEANKAFSHFRF 158
>gi|148238717|ref|YP_001224104.1| 30S ribosomal protein S7 [Synechococcus sp. WH 7803] >gi|166228489|sp|A5GIP2|RS7_SYNPW 30S ribosomal protein S7 >gi|147847256|emb|CAK22807.1| 30S ribosomal protein S7 [Synechococcus sp. WH 7803] (156 aa)
Score = 368, Expect = 4.7e-34, Identities = 76/154 (49%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +N+RL T  +  +M  GKK  AQ+I+  +F LI ++T  D IE+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAVKRPVLPDPQFNNRLATMLVARLMKHGKKSTAQRILSDAFSLIGERTGGDPIELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVSFSRARNGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|119899710|ref|YP_934923.1| 30S ribosomal protein S7 [Azoarcus sp. BH72] >gi|166227415|sp|A1KB31|RS7_AZOSB 30S ribosomal protein S7 >gi|119672123|emb|CAL96037.1| 30S ribosomal protein S7 [Azoarcus sp. BH72] (156 aa)
Score = 368, Expect = 4.8e-34, Identities = 79/154 (51%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KRE+LPDP + S+ V+K IN IM  GKK +A++IVY +FD I  K ++D +EVF  A+ N+ P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR EKSM ++LA E+++A++G GAA KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKREVLPDPKFASQDVSKFINVIMQSGKKSVAERIVYGAFDHITAKASKDPLEVFAAAVANVKPVVEVKSRRVGGANYQVPVEVRPSRRMALSMRWLREAARKRAEKSMAQRLAGELLEAAEGRGAAMKKREEVHRMAEANKAFSHYRF 156
>gi|85858143|ref|YP_460345.1| 30S ribosomal protein S7 [Syntrophus aciditrophicus SB] >gi|85721234|gb|ABC76177.1| SSU ribosomal protein S7P [Syntrophus aciditrophicus SB] (158 aa)
Score = 368, Expect = 4.8e-34, Identities = 79/154 (51%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP Y + LV K +N ++ EGKK +A+ I+Y +FDLI+KK  E  +E+F++A+ N+ P +E++ RRV GS +QVPT V+  R+  L +RW+I +A+ R EK+M EKLA E IDA+   G + KK+E  HKMAEANKAFAH RF
  S:     5 RRREIAKRVILPDPKYKNILVAKFVNNLLKEGKKSIAESILYGAFDLIEKKAKESPVELFERAVNNVKPVIEVKSRRVGGSTYQVPTEVAASRRVALAIRWIISNAKDRAEKTMREKLAGEFIDAANNRGGSIKKRESVHKMAEANKAFAHYRF 158
>gi|83648856|ref|YP_437291.1| 30S ribosomal protein S7 [Hahella chejuensis KCTC 2396] >gi|109894831|sp|Q2S908|RS7_HAHCH 30S ribosomal protein S7 >gi|83636899|gb|ABC32866.1| ribosomal protein S7 [Hahella chejuensis KCTC 2396] (156 aa)
Score = 368, Expect = 4.8e-34, Identities = 79/154 (51%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KREILPDP + S+ + K IN +M  GKK +A++IVY + D++  K  ++ IE F+ ALENI P +E++ RRV G+ +QVP  V   R+  L +RWL+  +RKR EKSM  +LAAE+++A++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREILPDPKFGSKKLAKFINHVMESGKKSVAERIVYGALDIVSNKAKKEPIETFELALENIQPLVEVKSRRVGGATYQVPVEVRPSRQMALSMRWLVEYSRKRGEKSMAARLAAEMLEAAEGRGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|33241115|ref|NP_876057.1| 30S ribosomal protein S7 [Prochlorococcus marinus subsp. marinus str. CCMP1375] >gi|62287313|sp|Q7VA03|RS7_PROMA 30S ribosomal protein S7 >gi|33238645|gb|AAQ00710.1| Ribosomal protein S7 [Prochlorococcus marinus subsp. marinus str. CCMP1375] (156 aa)
Score = 368, Expect = 4.9e-34, Identities = 77/154 (50%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +N+RL T  +  +M  GKK  AQ+I+ Q+F LI ++T  D IE+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM  KLA E++DA+   G A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPVLPDPQFNNRLATMMVARLMKHGKKSTAQKILSQAFGLINERTGGDPIELFETAIKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVNFSRSRNGRSMAHKLAGELMDAANEAGNAVRKREETHKMAEANKAFAHYRY 156
>gi|24638199|sp|P59061|RS7_RHOCA 30S ribosomal protein S7 >gi|22203339|gb|AAM92274.1| ribosomal protein S7 [Rhodobacter capsulatus] (156 aa)
Score = 368, Expect = 4.9e-34, Identities = 74/154 (48%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R++ A KRE+LPD  Y  R++TK +N +M++GKK +A++IVY + + ++ +     +EVF +AL+N+ PS+E+R RRV G+ +QVP  V   R++ L +RWLI +A+ RNE +M E+LA E++DA    G+A KK+EDTHKMA+ANKAF+H R+
  S:     3 RRHAAEKREVLPDAKYGDRVLTKFMNNLMIDGKKSVAERIVYSALERVEGRVKRAPVEVFHEALDNVKPSVEVRSRRVGGATYQVPVEVRPSRREALAIRWLINAAKNRNENTMEERLAGELLDAMNSRGSAVKKREDTHKMADANKAFSHYRW 156
>gi|87125020|ref|ZP_01080867.1| ribosomal protein S7 [Synechococcus sp. RS9917] >gi|86167340|gb|EAQ68600.1| ribosomal protein S7 [Synechococcus sp. RS9917] (156 aa)
Score = 368, Expect = 5.2e-34, Identities = 77/154 (50%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR ILPDP +NSRL T  +  +M  GKK  AQ+I+  +F LI ++T  D +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+  +G A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPILPDPQFNSRLATMMVARLMKHGKKSTAQRILSDAFGLIGERTGGDPLELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVNFSRSRNGRSMAQKLAGELMDAANESGNAVRKREETHKMAEANKAFAHYRY 156
>gi|163802785|ref|ZP_02196675.1| 30S ribosomal protein S7 [Vibrio campbellii AND4] >gi|159173492|gb|EDP58314.1| 30S ribosomal protein S7 [Vibrio campbellii AND4] (156 aa)
Score = 368, Expect = 5.3e-34, Identities = 76/154 (49%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK  A++IVY + D + +K+ +D + VF++ALEN+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM ++LAAE++DAS+  G A KK+ED H+MA+ANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFKSELLAKFVNILMVDGKKSTAEKIVYTALDSMAEKSGKDHLAVFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAQRLAAEMLDASENKGTAVKKREDVHRMADANKAFAHYRW 156
>gi|28867850|ref|NP_790469.1| 30S ribosomal protein S7 [Pseudomonas syringae pv. tomato str. DC3000] >gi|38258315|sp|Q889X5|RS7_PSESM 30S ribosomal protein S7 >gi|28851086|gb|AAO54164.1| ribosomal protein S7 [Pseudomonas syringae pv. tomato str. DC3000] (156 aa)
Score = 368, Expect = 5.5e-34, Identities = 77/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KRE+L DP Y S+++ K +N +M  GKK +A++IVY + + +K++ N D +E+F+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+  ARKR EKSM  +LA E++DA++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREVLDDPKYGSQILAKFMNHVMESGKKAVAERIVYGALEKVKERKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRLAGELMDAAEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|78211874|ref|YP_380653.1| 30S ribosomal protein S7 [Synechococcus sp. CC9605] >gi|109894858|sp|Q3AMT4|RS7_SYNSC 30S ribosomal protein S7 >gi|78196333|gb|ABB34098.1| ribosomal protein S7 [Synechococcus sp. CC9605] (156 aa)
Score = 368, Expect = 5.5e-34, Identities = 77/154 (50%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR ILPDP +NSRL T  +  +M  GKK  AQ+I+  +F LI ++T  D +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPILPDPQFNSRLATMMVVRLMQHGKKSTAQRILSDAFGLINERTGGDPLELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVSFSRARNGRSMAQKLAGELMDAANEAGNAVRKREETHKMAEANKAFAHYRY 156
>gi|86135519|ref|ZP_01054100.1| 30S ribosomal protein S7 [Tenacibaculum sp. MED152] >gi|85819692|gb|EAQ40849.1| 30S ribosomal protein S7 [Polaribacter dokdonensis MED152] (159 aa)
Score = 368, Expect = 5.5e-34, Identities = 77/155 (49%), Positives = 114/155 (73%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNE----DGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK  A KR +LPDP +N +LVT+ +N +M  GKK +A ++ Y + D+++++  E      +E++K  L N+MP +E+R RRV G+ FQ+P  +  +RK ++ ++W+IL  RKRNEK+M ++LAAEI+ A+K  GAA KK+ DTHKMAEANKAF+H RF
  S:     1 MRKRAAKKRVLLPDPKFNDQLVTRFVNNLMWSGKKSVAFKVFYDALDIVEERKGEGEEKSALEIWKDGLSNVMPHVEVRSRRVGGATFQIPMQIRPDRKVSMAIKWMILYTRKRNEKTMAQRLAAEILAAAKEEGAAVKKRVDTHKMAEANKAFSHFRF 159
>gi|16272524|ref|NP_438738.1| 30S ribosomal protein S7 [Haemophilus influenzae Rd KW20] >gi|53733097|ref|ZP_00155572.2| COG0049: Ribosomal protein S7 [Haemophilus influenzae R2846] >gi|53733339|ref|ZP_00156398.2| COG0049: Ribosomal protein S7 [Haemophilus influenzae R2866] >gi|68249208|ref|YP_248320.1| 30S ribosomal protein S7 [Haemophilus influenzae 86-028NP] >gi|145629758|ref|ZP_01785553.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.1-21] >gi|145631887|ref|ZP_01787644.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.4-21] >gi|145633463|ref|ZP_01789192.1| 30S ribosomal protein S7 [Haemophilus influenzae 3655] >gi|145635870|ref|ZP_01791560.1| 30S ribosomal protein S7 [Haemophilus influenzae PittAA] >gi|145637943|ref|ZP_01793584.1| 30S ribosomal protein S7 [Haemophilus influenzae PittHH] >gi|145638510|ref|ZP_01794119.1| 30S ribosomal protein S7 [Haemophilus influenzae PittII] >gi|145640558|ref|ZP_01796142.1| 30S ribosomal protein S7 [Haemophilus influenzae R3021] >gi|148825140|ref|YP_001289893.1| 30S ribosomal protein S7 [Haemophilus influenzae PittEE] >gi|148827806|ref|YP_001292559.1| 30S ribosomal protein S7 [Haemophilus influenzae PittGG] >gi|166227450|sp|A5U9Q9|RS7_HAEIE 30S ribosomal protein S7 >gi|166227451|sp|A5UHC0|RS7_HAEIG 30S ribosomal protein S7 >gi|1173274|sp|P44376|RS7_HAEIN 30S ribosomal protein S7 >gi|81336388|sp|Q4QMT7|RS7_HAEI8 30S ribosomal protein S7 >gi|1573568|gb|AAC22238.1| ribosomal protein S7 (rpS7) [Haemophilus influenzae Rd KW20] >gi|68057407|gb|AAX87660.1| 30S ribosomal protein S7 [Haemophilus influenzae 86-028NP] >gi|144977997|gb|EDJ87781.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.1-21] >gi|144982490|gb|EDJ90053.1| 30S ribosomal protein S7 [Haemophilus influenzae R3021] >gi|144985832|gb|EDJ92440.1| 30S ribosomal protein S7 [Haemophilus influenzae 3655] >gi|145266882|gb|EDK06896.1| 30S ribosomal protein S7 [Haemophilus influenzae PittAA] >gi|145268857|gb|EDK08819.1| 30S ribosomal protein S7 [Haemophilus influenzae PittHH] >gi|145272105|gb|EDK12013.1| 30S ribosomal protein S7 [Haemophilus influenzae PittII] >gi|145275144|gb|EDK15006.1| 30S ribosomal protein S7 [Haemophilus influenzae 22.4-21] >gi|148715300|gb|ABQ97510.1| 30S ribosomal protein S7 [Haemophilus influenzae PittEE] >gi|148719048|gb|ABR00176.1| 30S ribosomal protein S7 [Haemophilus influenzae PittGG] (156 aa)
Score = 368, Expect = 5.5e-34, Identities = 76/154 (49%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+     R+ILPDP + S L+ K IN IM++GKK +A+ IVY + + + ++T ++ +E F+ ALEN+ P++E++ RRV GS +QVP  V   R+  LG+RW++ +ARKR +KSM  +LA E+ DAS   GAA KK+ED H+MAEANKAFAH R+
  S:     3 RRRSVEARKILPDPKFGSELLAKFINVIMVDGKKSVAESIVYGALETLAQRTGKEPLEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWIVEAARKRGDKSMALRLANELSDASDNKGAAVKKREDVHRMAEANKAFAHYRW 156
>gi|87301864|ref|ZP_01084698.1| 30S ribosomal protein S7 [Synechococcus sp. WH 5701] >gi|87283432|gb|EAQ75387.1| 30S ribosomal protein S7 [Synechococcus sp. WH 5701] (156 aa)
Score = 368, Expect = 5.6e-34, Identities = 76/154 (49%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +NSRL +  +  +M  GKK  AQ+I+  +F LI  +T  D +EVF+ A+ N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPVLPDPQFNSRLASMVVARLMKHGKKSTAQRILSDAFGLINDRTGTDPLEVFETAVRNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVNFSRARNGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|113474342|ref|YP_720403.1| 30S ribosomal protein S7 [Trichodesmium erythraeum IMS101] >gi|122965256|sp|Q118Z4|RS7_TRIEI 30S ribosomal protein S7 >gi|110165390|gb|ABG49930.1| SSU ribosomal protein S7P [Trichodesmium erythraeum IMS101] (156 aa)
Score = 368, Expect = 5.8e-34, Identities = 77/154 (50%), Positives = 108/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R I PDP YNSRLVT  +  IM  GKK +A  IVY +F  I+++T+ D +E+F+KA+ N+ P +E++ RRV G+ +QVP  V  +R  TL LRWL+  +R R  K+M  KLA E++DA+  TG+A +K+E+THKMAEANKAFAH R+
  S:     3 RRRVIQRRPIPPDPKYNSRLVTMIVRRIMRHGKKSVAYNIVYDAFKAIEERTDSDPLELFEKAVRNLTPLVEVKARRVGGATYQVPMEVRSDRGTTLALRWLVQYSRSRGGKTMAMKLANELMDAANETGSAIRKREETHKMAEANKAFAHYRY 156
>gi|72382914|ref|YP_292269.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. NATL2A] >gi|124026656|ref|YP_001015771.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. NATL1A] >gi|166228459|sp|A2C4U7|RS7_PROM1 30S ribosomal protein S7 >gi|115305713|sp|Q46IW2|RS7_PROMT 30S ribosomal protein S7 >gi|72002764|gb|AAZ58566.1| SSU ribosomal protein S7P [Prochlorococcus marinus str. NATL2A] >gi|123961724|gb|ABM76507.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. NATL1A] (156 aa)
Score = 368, Expect = 5.9e-34, Identities = 75/154 (48%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +N+RL +  ++ +M  GKK  AQ+I+  +F LI ++T  D IE+F+ A++N+ P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPVLPDPQFNNRLASMMVHRLMKHGKKSTAQKILSDAFGLINERTGSDPIELFETAVKNVTPLVEVRARRVGGATYQVPMEVRQERGIAMALRWLVNFSRSRNGRSMAQKLAGELMDAANEAGNAVRKREETHKMAEANKAFAHYRY 156
>gi|117918653|ref|YP_867845.1| 30S ribosomal protein S7 [Shewanella sp. ANA-3] >gi|166228478|sp|A0KRM0|RS7_SHESA 30S ribosomal protein S7 >gi|117610985|gb|ABK46439.1| ribosomal protein S7 [Shewanella sp. ANA-3] (156 aa)
Score = 367, Expect = 6.4e-34, Identities = 76/154 (49%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP ++S L+ K IN IM +GKK  A++I+Y++ D+I +K   + ++V + AL+N+ PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYKALDVIAEKKGANHLDVLEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|109894853|sp|Q2LQA4|RS7_SYNAS 30S ribosomal protein S7 (156 aa)
Score = 367, Expect = 6.6e-34, Identities = 79/154 (51%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP Y + LV K +N ++ EGKK +A+ I+Y +FDLI+KK  E  +E+F++A+ N+ P +E++ RRV GS +QVPT V+  R+  L +RW+I +A+ R EK+M EKLA E IDA+   G + KK+E  HKMAEANKAFAH RF
  S:     3 RRREIAKRVILPDPKYKNILVAKFVNNLLKEGKKSIAESILYGAFDLIEKKAKESPVELFERAVNNVKPVIEVKSRRVGGSTYQVPTEVAASRRVALAIRWIISNAKDRAEKTMREKLAGEFIDAANNRGGSIKKRESVHKMAEANKAFAHYRF 156
>gi|15640387|ref|NP_230014.1| 30S ribosomal protein S7 [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121730316|ref|ZP_01682683.1| ribosomal protein S7 [Vibrio cholerae V52] >gi|147673949|ref|YP_001218630.1| 30S ribosomal protein S7 [Vibrio cholerae O395] >gi|153226309|ref|ZP_01954901.1| ribosomal protein S7 [Vibrio cholerae MAK 757] >gi|153831434|ref|ZP_01984101.1| ribosomal protein S7 [Vibrio cholerae 623-39] >gi|172047709|sp|A5F3J8|RS7_VIBC3 30S ribosomal protein S7 >gi|17367728|sp|Q9KUZ8|RS7_VIBCH 30S ribosomal protein S7 >gi|9654777|gb|AAF93533.1| ribosomal protein S7 [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121627934|gb|EAX60505.1| ribosomal protein S7 [Vibrio cholerae V52] >gi|124117169|gb|EAY35912.1| ribosomal protein S7 [Vibrio cholerae MAK 757] >gi|146315832|gb|ABQ20371.1| ribosomal protein S7 [Vibrio cholerae O395] >gi|148873086|gb|EDL71221.1| ribosomal protein S7 [Vibrio cholerae 623-39] >gi|150421951|gb|EDN13926.1| ribosomal protein S7 [Vibrio cholerae AM-19226] (156 aa)
Score = 367, Expect = 7.0e-34, Identities = 76/154 (49%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK  A++IVY + D + +K+ +D + VF++ALEN+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LAAE++DA++  G+A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFKSELLAKFVNILMVDGKKSTAEKIVYTALDTMAEKSGKDHLAVFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAARLAAEMLDAAENKGSAVKKREDVHRMAEANKAFAHYRW 156
>gi|156972436|ref|YP_001443343.1| 30S ribosomal protein S7 [Vibrio harveyi ATCC BAA-1116] >gi|166228494|sp|A7MZ63|RS7_VIBHB 30S ribosomal protein S7 >gi|156524030|gb|ABU69116.1| hypothetical protein VIBHAR_00056 [Vibrio harveyi ATCC BAA-1116] (156 aa)
Score = 367, Expect = 7.2e-34, Identities = 75/154 (48%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP + S L+ K +N +M++GKK  A++IVY + D + +K+ +D + +F++ALEN+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM ++LAAE++DAS+  G A KK+ED H+MA+ANKAFAH R+
  S:     3 RRRVIGQRKILPDPKFKSELLAKFVNILMVDGKKSTAEKIVYTALDSMAEKSGKDHLAIFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAQRLAAEMLDASENKGTAVKKREDVHRMADANKAFAHYRW 156
>gi|66047779|ref|YP_237620.1| 30S ribosomal protein S7 [Pseudomonas syringae pv. syringae B728a] >gi|81307857|sp|Q4ZMP0|RS7_PSEU2 30S ribosomal protein S7 >gi|63258486|gb|AAY39582.1| Ribosomal protein S7, bacterial and organelle form [Pseudomonas syringae pv. syringae B728a] (156 aa)
Score = 367, Expect = 7.3e-34, Identities = 76/154 (49%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KR++L DP Y S+++ K +N +M  GKK +A++IVY + + +K++ N D +E+F+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+  ARKR EKSM  +LA E++DA++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKRDVLDDPKYGSQILAKFMNHVMESGKKAVAERIVYGALEKVKERKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRLAGELMDAAEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|114561332|ref|YP_748845.1| 30S ribosomal protein S7 [Shewanella frigidimarina NCIMB 400] >gi|122301118|sp|Q089Q8|RS7_SHEFN 30S ribosomal protein S7 >gi|114332625|gb|ABI70007.1| SSU ribosomal protein S7P [Shewanella frigidimarina NCIMB 400] (156 aa)
Score = 367, Expect = 7.4e-34, Identities = 75/154 (48%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP ++S L+ K IN IM +GKK  A++I+Y++ D++ +K +E+ + + + AL+N+ PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYKALDVVAEKKSENHLSILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|82701896|ref|YP_411462.1| 30S ribosomal protein S7 [Nitrosospira multiformis ATCC 25196] >gi|109894838|sp|Q2YB01|RS7_NITMU 30S ribosomal protein S7 >gi|82409961|gb|ABB74070.1| SSU ribosomal protein S7P [Nitrosospira multiformis ATCC 25196] (156 aa)
Score = 367, Expect = 7.6e-34, Identities = 79/154 (51%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP Y++  V K +N +M  GKK +A++I+Y + D I KKT +D +EVF +AL N+ P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR EKSM  +LA E+ +A++G G A KK+E+ H+MAEANKAFAH RF
  S:     3 RRREVPKREILPDPKYHNAEVAKFVNVLMTRGKKSVAERIIYGAMDQIHKKTGKDPVEVFTQALSNVRPMVEVKSRRVGGANYQVPVEVRSIRRNALAMRWLRDAARKRAEKSMGARLAGELAEAAEGRGGAVKKREEVHRMAEANKAFAHYRF 156
>gi|158520722|ref|YP_001528592.1| 30S ribosomal protein S7 [Desulfococcus oleovorans Hxd3] >gi|158509548|gb|ABW66515.1| ribosomal protein S7 [Desulfococcus oleovorans Hxd3] (156 aa)
Score = 366, Expect = 8.6e-34, Identities = 79/154 (51%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK     R +LPD  YNS+LV+  I+ +M +GKK  A+ I+Y++FD+I +KT +  +EVF++AL N+ P LE++ RRV GS +QVPT + + R+  L +RW+I  AR R EK M  KLA E++DA+   GA+ KK+EDTHKMAEANKAFAH R+
  S:     3 RKREVPVRPVLPDARYNSKLVSMFIHKLMRDGKKSTAESILYKAFDIINEKTGKAPLEVFEEALANVKPKLEVKSRRVGGSTYQVPTEIREARRLALAIRWMIGYARSRAEKGMDVKLAGELMDAAGQRGASVKKREDTHKMAEANKAFAHYRW 156
>gi|24371825|ref|NP_715867.1| 30S ribosomal protein S7 [Shewanella oneidensis MR-1] >gi|113968540|ref|YP_732333.1| 30S ribosomal protein S7 [Shewanella sp. MR-4] >gi|114045703|ref|YP_736253.1| 30S ribosomal protein S7 [Shewanella sp. MR-7] >gi|123030071|sp|Q0HNU1|RS7_SHESM 30S ribosomal protein S7 >gi|123131843|sp|Q0I0A9|RS7_SHESR 30S ribosomal protein S7 >gi|62287336|sp|Q8EK72|RS7_SHEON 30S ribosomal protein S7 >gi|24345634|gb|AAN53312.1|AE015472_4 ribosomal protein S7 [Shewanella oneidensis MR-1] >gi|113883224|gb|ABI37276.1| ribosomal protein S7 [Shewanella sp. MR-4] >gi|113887145|gb|ABI41196.1| ribosomal protein S7 [Shewanella sp. MR-7] (156 aa)
Score = 366, Expect = 8.6e-34, Identities = 75/154 (48%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP ++S L+ K IN IM +GKK  A++I+Y++ D+I +K   + +++ + AL+N+ PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYKALDVIAEKKGANHLDILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|74316419|ref|YP_314159.1| 30S ribosomal protein S7 [Thiobacillus denitrificans ATCC 25259] >gi|90120574|sp|Q3SLQ3|RS7_THIDA 30S ribosomal protein S7 >gi|74055914|gb|AAZ96354.1| Ribosomal protein S7 [Thiobacillus denitrificans ATCC 25259] (156 aa)
Score = 366, Expect = 8.7e-34, Identities = 77/154 (50%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + ++ V+K +N +M  GKK +A++IVY +F+ I  K+ +D +EVF  AL N  P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR EKSM  +LA E++DA++G G A KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKREILPDPKFGNQEVSKFMNVVMSSGKKSVAERIVYGAFEQITTKSGKDPLEVFSTALNNARPLVEVKSRRVGGANYQVPVEVRSSRRTALAMRWLKDAARKRGEKSMGARLAGELLDAAEGRGGAVKKREEVHRMAEANKAFSHFRF 156
>gi|163812929|ref|ZP_02204578.1| ribosomal protein S7 [Dehalococcoides sp. VS] >gi|157403455|gb|EDO69526.1| ribosomal protein S7 [Dehalococcoides sp. VS] (156 aa)
Score = 366, Expect = 9.1e-34, Identities = 76/154 (49%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  KR + PD  YNS +++  IN +M+ G+K  AQ+IVY + D++ K+ N++G+ VF++ L+N  P +E++ RRV G+ +QVP  V  +R QT+ +RW+I +ARKR  KSM E+LAAE+++AS+  GAA KK+E+THKMAEAN+AFAH R+
  S:     3 RRARKFKRAVAPDSRYNSLMLSNFINKLMMHGQKATAQRIVYDAIDIMGKQENKEGLAVFEQGLKNATPFIEVKPRRVGGATYQVPIEVRPDRAQTMAMRWIIKAARKRTGKSMAERLAAEMLEASREQGAAVKKREETHKMAEANRAFAHYRW 156
>gi|113954691|ref|YP_729615.1| 30S ribosomal protein S7 [Synechococcus sp. CC9311] >gi|123031883|sp|Q0ID57|RS7_SYNS3 30S ribosomal protein S7 >gi|113882042|gb|ABI47000.1| ribosomal protein S7 [Synechococcus sp. CC9311] (156 aa)
Score = 366, Expect = 9.3e-34, Identities = 75/154 (48%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR ILPDP +N+RL T  +  +M  GKK  AQ+I+  +F +I ++T  D +E+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM +KLA E++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAVKRPILPDPQFNNRLATMMVARLMKHGKKSTAQRILSDAFGMIGERTGGDPVELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVNFSRARNGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|37912947|gb|AAR05279.1| ribosomal protein S7 [uncultured marine gamma proteobacterium EB000-45B06] >gi|40063174|gb|AAR38011.1| ribosomal protein S7 [uncultured marine bacterium 562] (156 aa)
Score = 366, Expect = 9.3e-34, Identities = 76/154 (49%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP Y   ++ K +N +M +GKK +A++IVY +FD I K + ED + +F KALE + P +E++ RRV G+N+QVP  +   R+Q L +RW++ +ARKR+EKSM  +LA E++DAS+  G+A +K+ED HKMAEANKAF+H RF
  S:     3 RRRSPEKRKVLPDPKYKDVILAKFMNNLMKDGKKSVAEKIVYGAFDQITKTSKEDPLGIFMKALEEVSPVVEVKSRRVGGANYQVPIEIRPSRRQALAMRWIVDAARKRSEKSMNLRLAGELMDASQKKGSAVRKREDVHKMAEANKAFSHFRF 156
>gi|118047082|ref|ZP_01515724.1| ribosomal protein S7 [Chloroflexus aggregans DSM 9485] >gi|117996399|gb|EAV10598.1| ribosomal protein S7 [Chloroflexus aggregans DSM 9485] (157 aa)
Score = 366, Expect = 9.4e-34, Identities = 77/151 (50%), Positives = 106/151 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAH 152
           R+    +R I PD  YNS LV K IN +M  GKK LA++IVYQ+ DL  +K  +  +E+F++AL N  PS+E++ +RV G+ +QVP  V  +R+ +L +RWLI+SAR R  K M+E+LAAE+IDA   TG   K+KED H+MAEAN+AFAH
  S:     3 RRGVVERRPIPPDARYNSVLVQKFINKVMERGKKSLAERIVYQALDLAAEKLKKPQLEIFEQALRNASPSIEVKPKRVGGATYQVPVEVKSDRRYSLAMRWLIMSARARTGKPMVERLAAELIDAYNNTGTTIKRKEDVHRMAEANRAFAH 153
>gi|85374470|ref|YP_458532.1| 30S ribosomal protein S7 [Erythrobacter litoralis HTCC2594] >gi|123099512|sp|Q2N9A6|RS7_ERYLH 30S ribosomal protein S7 >gi|84787553|gb|ABC63735.1| ribosomal protein S7 [Erythrobacter litoralis HTCC2594] (156 aa)
Score = 366, Expect = 9.5e-34, Identities = 72/154 (46%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  KREILPDP +  ++++K +N +ML+GKK +A+ IVY + D ++ K   D +++F  AL NI P +E+R RRV G+ +QVP  V  ER Q L +RW+I +AR R E +M  +L+ E++DA+   G A KK+ED H+MAEAN+AF+H R+
  S:     3 RRRRPEKREILPDPKFGDQVLSKFMNNLMLDGKKAVAEGIVYTALDTVEAKAKTDPVQLFHDALNNIKPQVEVRSRRVGGATYQVPVEVRPERAQALAIRWMISAARGRPETTMAARLSGELMDAANNRGNAVKKREDAHRMAEANRAFSHYRW 156
>gi|16330915|ref|NP_441643.1| 30S ribosomal protein S7 [Synechocystis sp. PCC 6803] >gi|2500417|sp|P74229|RS7_SYNY3 30S ribosomal protein S7 >gi|1653409|dbj|BAA18323.1| 30S ribosomal protein S7 [Synechocystis sp. PCC 6803] (156 aa)
Score = 366, Expect = 9.5e-34, Identities = 77/154 (50%), Positives = 105/154 (68%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR + PDPVYNS L++  I  +M  GKK LA  IVY +   + +KT ED +EVF+KA++N+ P +E++ RRV G+ +QVP  V   R   L LRWL+  +R R  ++M  KLA EI+DA+  TGAA KK+E+TH+MAEANKAFAH R+
  S:     3 RRGNVKKRPVPPDPVYNSTLLSMTIRRVMRSGKKSLASSIVYNALASVGEKTGEDPLEVFEKAIKNLTPLVEVKARRVGGATYQVPMEVRPARGTALALRWLVHFSRARGGRTMESKLANEIMDAANETGAAIKKREETHRMAEANKAFAHYRY 156
>gi|145588238|ref|YP_001154835.1| 30S ribosomal protein S7 [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189045621|sp|A4SUV7|RS7_POLSQ 30S ribosomal protein S7 >gi|145046644|gb|ABP33271.1| SSU ribosomal protein S7P [Polynucleobacter sp. QLW-P1DMWA-1] (156 aa)
Score = 366, Expect = 9.6e-34, Identities = 75/154 (48%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + +  V K +N +ML+GKK +A++IVY +FD I+KK N++ +E+F  A+ N+ P +E++ RRV G+N+QVP  V   R+  L +RW+  +A+KR EKSM ++LA E+++A++G G A KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKREILPDPKFGNVEVAKFMNVLMLDGKKSVAERIVYGAFDHIEKKANKEPLEIFSTAMGNVKPMVEVKSRRVGGANYQVPVEVRPSRRSALAMRWVREAAKKRGEKSMAQRLANELLEAAEGRGGAMKKREEVHRMAEANKAFSHFRF 156
>gi|150003390|ref|YP_001298134.1| 30S ribosomal protein S7 [Bacteroides vulgatus ATCC 8482] >gi|149931814|gb|ABR38512.1| 30S ribosomal protein S7 [Bacteroides vulgatus ATCC 8482] (158 aa)
Score = 366, Expect = 9.8e-34, Identities = 79/155 (50%), Positives = 113/155 (72%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK---TNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR ILPDPV+N + V+K +N +M +GKK  + +I Y + + +K K     +  +E++KKAL+N+ P +E++ RRV G+ FQVPT +  +RK+++ ++ LIL ARKR  KSM +KLAAEIIDA    G A+K+KED H+MAEAN+AFAH RF
  S:     1 MRKAKPKKRVILPDPVFNDQKVSKFVNHLMYDGKKNTSYEIFYAALETVKTKLPNEEKSALEIWKKALDNVTPQIEVKSRRVGGATFQVPTEIRPDRKESISMKNLILFARKRGGKSMADKLAAEIIDAFNEQGGAYKRKEDMHRMAEANRAFAHFRF 158
>gi|15599463|ref|NP_252957.1| 30S ribosomal protein S7 [Pseudomonas aeruginosa PAO1] >gi|116052302|ref|YP_788852.1| 30S ribosomal protein S7 [Pseudomonas aeruginosa UCBPP-PA14] >gi|152989581|ref|YP_001346219.1| 30S ribosomal protein S7 [Pseudomonas aeruginosa PA7] >gi|194548114|ref|YP_002083142.1| 30S ribosomal protein S7 [Pseudomonas aeruginosa C3719] >gi|122261451|sp|Q02T84|RS7_PSEAB 30S ribosomal protein S7 >gi|166228463|sp|A6UZI4|RS7_PSEA7 30S ribosomal protein S7 >gi|17367718|sp|Q9HWD1|RS7_PSEAE 30S ribosomal protein S7 >gi|9950485|gb|AAG07655.1|AE004842_4 30S ribosomal protein S7 [Pseudomonas aeruginosa PAO1] >gi|115587523|gb|ABJ13538.1| 30S ribosomal protein S7 [Pseudomonas aeruginosa UCBPP-PA14] >gi|126169060|gb|EAZ54571.1| 30S ribosomal protein S7 [Pseudomonas aeruginosa C3719] >gi|150964739|gb|ABR86764.1| ribosomal protein S7 [Pseudomonas aeruginosa PA7] (156 aa)
Score = 366, Expect = 1.0e-33, Identities = 77/154 (50%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+  A KRE+L DP Y S+++ K +N +M  GKK +A++IVY + D +K++   D +E F+KAL+ I P +E++ RRV G+ +QVP  V   R+  L +RWL+  ARKR EKSM  +LA E++DA++G GAA KK+ED H+MAEANKAF+H RF
  S:     3 RRRVAAKREVLADPKYGSQILAKFMNHVMESGKKAVAERIVYGALDKVKERGKADPLETFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWLVDFARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF 156
>gi|177666113|ref|ZP_02941909.1| ribosomal protein S7 [Cyanothece sp. PCC 8801] >gi|172074797|gb|EDT60214.1| ribosomal protein S7 [Cyanothece sp. PCC 8801] (156 aa)
Score = 365, Expect = 1.0e-33, Identities = 75/154 (48%), Positives = 105/154 (68%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R + PDPVYNSRL++  I  +M  GKK +A  I+Y +   I +KT  D +EVF+KA++N+ P +E++ RRV G+ +QVP  V   R  TL LRWL+  AR R  ++M  KLA EI+DA+  TG A KK+++TH+MAEANKAFAH R+
  S:     3 RRGNIKRRPVPPDPVYNSRLISMTIRRVMKSGKKSVAAGIMYDALTSIGEKTGSDPLEVFEKAIKNLTPLVEVKARRVGGATYQVPMEVRSSRGTTLALRWLVHYARIRGGRTMSSKLANEIMDAANETGGAMKKRDETHRMAEANKAFAHYRY 156
>gi|163847918|ref|YP_001635962.1| 30S ribosomal protein S7 [Chloroflexus aurantiacus J-10-fl] >gi|187599471|ref|ZP_02985705.1| ribosomal protein S7 [Chloroflexus sp. Y-400-fl] >gi|189045602|sp|A9WH61|RS7_CHLAA 30S ribosomal protein S7 >gi|163669207|gb|ABY35573.1| ribosomal protein S7 [Chloroflexus aurantiacus J-10-fl] >gi|187488903|gb|EDU26870.1| ribosomal protein S7 [Chloroflexus sp. Y-400-fl] (157 aa)
Score = 365, Expect = 1.1e-33, Identities = 76/151 (50%), Positives = 106/151 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAH 152
           R+    +R I PD  YNS LV K IN +M  GKK LA++IVYQ+ DL  ++  +  +E+F++AL N  PS+E+R +RV G+ +QVP  V  +R+ +L +RWL++SAR R  K M+E+LAAE+IDA   TG   K+KED H+MAEAN+AFAH
  S:     3 RRGNIERRPIPPDARYNSVLVQKFINKVMERGKKSLAERIVYQALDLAAERLKKPQMEIFEQALRNASPSIEVRPKRVGGATYQVPVEVKSDRRYSLAMRWLLMSARARTGKPMVERLAAELIDAYNNTGTTIKRKEDVHRMAEANRAFAH 153
>gi|196254764|ref|ZP_03153303.1| ribosomal protein S7 [Cyanothece sp. PCC 7822] >gi|196203961|gb|EDX98777.1| ribosomal protein S7 [Cyanothece sp. PCC 7822] (156 aa)
Score = 365, Expect = 1.2e-33, Identities = 77/154 (50%), Positives = 105/154 (68%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R I PDPV+NS LV   I  +M  GKK LA  IVY +   + ++T  D +EVF++A++NI P +E++ RRV G+ +QVP  V   R  TL LRWLI  +R RN ++M  KLA+EI+DA+  TG A KK+E+TH+MAEANKAFAH R+
  S:     3 RRKNLKRRPIPPDPVFNSYLVNMTIRRVMRSGKKSLASTIVYDALKNVGERTGRDALEVFEQAVKNITPLVEVKARRVGGATYQVPMEVRPGRGTTLALRWLISFSRNRNGRTMAAKLASEIMDAANETGGAIKKREETHRMAEANKAFAHYRY 156
>gi|120596985|ref|YP_961559.1| 30S ribosomal protein S7 [Shewanella sp. W3-18-1] >gi|124550258|ref|ZP_01707979.1| ribosomal protein S7 [Shewanella putrefaciens 200] >gi|146294845|ref|YP_001185269.1| 30S ribosomal protein S7 [Shewanella putrefaciens CN-32] >gi|166228477|sp|A4YBY7|RS7_SHEPC 30S ribosomal protein S7 >gi|166228479|sp|A1REB0|RS7_SHESW 30S ribosomal protein S7 >gi|120557078|gb|ABM23005.1| ribosomal protein S7 [Shewanella sp. W3-18-1] >gi|124507546|gb|EAY51678.1| ribosomal protein S7 [Shewanella putrefaciens 200] >gi|145566535|gb|ABP77470.1| ribosomal protein S7 [Shewanella putrefaciens CN-32] (156 aa)
Score = 365, Expect = 1.2e-33, Identities = 75/154 (48%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP ++S L+ K IN IM +GKK  A++I+Y++ D++ +K +E+ + + + AL+N+ PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYKALDVVAEKKSENHLVILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|15839219|ref|NP_299907.1| 30S ribosomal protein S7 [Xylella fastidiosa 9a5c] >gi|17367760|sp|Q9PA89|RS7_XYLFA 30S ribosomal protein S7 >gi|9107857|gb|AAF85427.1|AE004069_8 30S ribosomal protein S7 [Xylella fastidiosa 9a5c] (155 aa)
Score = 365, Expect = 1.2e-33, Identities = 77/154 (50%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R +LPDP Y S  + + IN +M  GKK +A++IVY + ++I +K N + IE+ +KAL+N+ P++E++ RRV G+ +QVP  V   R+  L +RWLI S+RKR E SM  KLAAE++DAS+  G A KK+E+TH+MAEANKAFAH R+
  S:     3 RKGSTPQRNVLPDPKYGSETIARFINMVMKSGKKSVAEKIVYGAMNVIGEK-NSNAIELLQKALDNVSPAVEVKSRRVGGATYQVPVEVRASRRMALAMRWLIDSSRKRGENSMPHKLAAELLDASESRGGAIKKREETHRMAEANKAFAHYRW 155
>gi|148243267|ref|YP_001228424.1| 30S ribosomal protein S7 [Synechococcus sp. RCC307] >gi|166228490|sp|A5GW12|RS7_SYNR3 30S ribosomal protein S7 >gi|147851577|emb|CAK29071.1| 30S ribosomal protein S7 [Synechococcus sp. RCC307] (156 aa)
Score = 365, Expect = 1.2e-33, Identities = 76/154 (49%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR ILPDP +NSRL +  +  +M  GKK  AQ+I+  +F LI ++T  D +EVF+ A+ N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R R  +SM +KLA E++DA+   G+A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAVKRPILPDPQFNSRLASMMVARLMKHGKKSTAQRILSDAFGLIGERTGADPLEVFETAVRNSTPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVNFSRSRGGRSMAQKLAGELMDAANEAGSAVRKREETHKMAEANKAFAHYRY 156
>gi|159904174|ref|YP_001551518.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9211] >gi|159889350|gb|ABX09564.1| 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9211] (156 aa)
Score = 365, Expect = 1.3e-33, Identities = 76/154 (49%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+N A KR +LPDP +N+RL T  +  +M  GKK  AQ+I+  +F LI ++T  D IE+F+ A++N  P +E+R RRV G+ +QVP  V +ER   + LRWL+  +R RN +SM  KLA E++DA+   G A +K+E+THKMAEANKAFAH R+
  S:     3 RRNAAEKRPVLPDPQFNNRLATMMVARLMKHGKKSTAQRILSDAFGLINERTGSDPIELFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVNFSRSRNGRSMAHKLAGELMDAANEAGNAVRKREETHKMAEANKAFAHYRY 156
>gi|87199266|ref|YP_496523.1| 30S ribosomal protein S7 [Novosphingobium aromaticivorans DSM 12444] >gi|109894839|sp|Q2G8Y4|RS7_NOVAD 30S ribosomal protein S7 >gi|87134947|gb|ABD25689.1| SSU ribosomal protein S7P [Novosphingobium aromaticivorans DSM 12444] (156 aa)
Score = 365, Expect = 1.3e-33, Identities = 70/154 (45%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  KR ILPDP +  ++++K +N +ML+GKK +A+ IVY + ++++ +   D +++F  AL N+ P +E+R RRV G+ +QVP  V  ER Q L +RWLI +AR R+E +M  +L+AE++DA+   G A KK+EDTH+MA+AN+AF+H R+
  S:     3 RRRRPEKRVILPDPKFGDQVLSKFMNNLMLDGKKSVAESIVYGALEVMQTRAKADPVQLFHDALNNVRPQIEVRSRRVGGATYQVPVEVRPERAQALAIRWLITAARNRSETTMAARLSAELLDAANNRGNAVKKREDTHRMADANRAFSHYRW 156
>gi|126090323|ref|YP_001041766.1| 30S ribosomal protein S7 [Shewanella baltica OS155] >gi|149117651|ref|ZP_01844328.1| ribosomal protein S7 [Shewanella baltica OS223] >gi|152998745|ref|YP_001364426.1| 30S ribosomal protein S7 [Shewanella baltica OS185] >gi|160873322|ref|YP_001552638.1| 30S ribosomal protein S7 [Shewanella baltica OS195] >gi|166228475|sp|A6WHS4|RS7_SHEB8 30S ribosomal protein S7 >gi|189045630|sp|A9KW98|RS7_SHEB9 30S ribosomal protein S7 >gi|125999943|gb|ABN64011.1| ribosomal protein S7 [Shewanella baltica OS155] >gi|146862244|gb|EDK47962.1| ribosomal protein S7 [Shewanella baltica OS223] >gi|151363363|gb|ABS06363.1| ribosomal protein S7 [Shewanella baltica OS185] >gi|160858844|gb|ABX47378.1| ribosomal protein S7 [Shewanella baltica OS195] (156 aa)
Score = 365, Expect = 1.3e-33, Identities = 75/154 (48%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP ++S L+ K IN IM +GKK  A++I+Y++ D++ +K +E  + + + AL+N+ PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYKALDVVAEKKSESHLTILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|150020841|ref|YP_001306195.1| 30S ribosomal protein S7 [Thermosipho melanesiensis BI429] >gi|166228491|sp|A6LLK9|RS7_THEM4 30S ribosomal protein S7 >gi|149793362|gb|ABR30810.1| ribosomal protein S7 [Thermosipho melanesiensis BI429] (155 aa)
Score = 364, Expect = 1.3e-33, Identities = 74/155 (47%), Positives = 111/155 (71%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MR+ RA  R++ PDP+YN  LV+K IN +M +GKK +AQ+IVY++ +++ +KT +  +E   +A+EN+ P +E+R RRV G+ +QVP  V + RK +L LRW++ +AR +  + M EKL  E+++A   TG A KKKED H+MAEAN+AFAH R+
  S:     1 MRRRRAEIRKVPPDPIYNDVLVSKLINRVMWDGKKSIAQKIVYKAMEILAEKTKKAPLEALHQAIENVRPIVEVRPRRVGGATYQVPIEVQEPRKTSLALRWIVEAARAKKGRPMAEKLGEELVNAFNNTGTAIKKKEDVHRMAEANRAFAHFRW 155
>gi|148554278|ref|YP_001261860.1| 30S ribosomal protein S7 [Sphingomonas wittichii RW1] >gi|166228481|sp|A5V606|RS7_SPHWW 30S ribosomal protein S7 >gi|148499468|gb|ABQ67722.1| SSU ribosomal protein S7P [Sphingomonas wittichii RW1] (156 aa)
Score = 364, Expect = 1.4e-33, Identities = 71/154 (46%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  KREILPDP +   +++K +N++ML+GKK +A+ IVY + + I+ +   + + VF +AL N+ P +E+R RRV G+ +QVP  V  +R Q L +RWLI +AR R+E +M  +L+ E++DA+   G A KK+EDTH+MAEAN+AF+H R+
  S:     3 RRRRPEKREILPDPKFGDVVLSKFMNSVMLDGKKSVAEGIVYGALETIETRAKREPLGVFHEALNNVKPGIEVRSRRVGGATYQVPVEVRPDRSQALAIRWLISAARARSEHTMAGRLSGELLDAANNRGNAVKKREDTHRMAEANRAFSHYRW 156
>gi|21241733|ref|NP_641315.1| 30S ribosomal protein S7 [Xanthomonas axonopodis pv. citri str. 306] >gi|78046550|ref|YP_362725.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|23822116|sp|Q8PNS7|RS7_XANAC 30S ribosomal protein S7 >gi|90120581|sp|Q3BWY8|RS7_XANC5 30S ribosomal protein S7 >gi|21107103|gb|AAM35851.1| 30S ribosomal protein S7 [Xanthomonas axonopodis pv. citri str. 306] >gi|78034980|emb|CAJ22625.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. vesicatoria str. 85-10] (155 aa)
Score = 364, Expect = 1.4e-33, Identities = 77/154 (50%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R +LPDP + S  + + IN +M  GKK +A++IVY + D+I +K N + IE+ +KAL+N+ P++E++ RRV G+ +QVP  V   R+  L +RWLI SARKR E +M  KLAAE++DAS+  G A KK+E+TH+MAEANKAFAH R+
  S:     3 RKGSTPQRTVLPDPKHGSETIARFINMVMQSGKKSVAEKIVYGAMDVIGEK-NPNAIELVQKALDNVAPAVEVKSRRVGGATYQVPVEVRSSRRMALAMRWLIDSARKRGENTMPRKLAAELLDASESRGGAIKKREETHRMAEANKAFAHYRW 155
>gi|53715469|ref|YP_101461.1| 30S ribosomal protein S7 [Bacteroides fragilis YCH46] >gi|60683441|ref|YP_213585.1| 30S ribosomal protein S7 [Bacteroides fragilis NCTC 9343] >gi|62287219|sp|Q64NK5|RS7_BACFR 30S ribosomal protein S7 >gi|81313511|sp|Q5L8A6|RS7_BACFN 30S ribosomal protein S7 >gi|52218334|dbj|BAD50927.1| 30S ribosomal protein S7 [Bacteroides fragilis YCH46] >gi|60494875|emb|CAH09682.1| putative 30S ribosomal protein S7 [Bacteroides fragilis NCTC 9343] (158 aa)
Score = 364, Expect = 1.4e-33, Identities = 81/155 (52%), Positives = 115/155 (74%)
  Q:     1 MRKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKK-TNED--GIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           MRK +  KR ILPDPV+N + V+K +N +M +GKK  + +I Y + + +K K  NE+   +E++KKAL+N+ P +E++ RRV G+ FQVPT +  +RK+++ ++ LIL ARKR  KSM +KLAAEI+DA    G AFK+KED H+MAEAN+AFAH RF
  S:     1 MRKAKPKKRVILPDPVFNDQKVSKFVNHLMYDGKKNTSYEIFYAALETVKAKLPNEEKTALEIWKKALDNVTPQVEVKSRRVGGATFQVPTEIRPDRKESISMKNLILFARKRGGKSMADKLAAEIMDAFNEQGGAFKRKEDMHRMAEANRAFAHFRF 158
>gi|71892335|ref|YP_278069.1| 30S ribosomal protein S7 [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|110825999|sp|Q492B0|RS7_BLOPB 30S ribosomal protein S7 >gi|71796441|gb|AAZ41192.1| 30S ribosomal subunit protein S7 [Candidatus Blochmannia pennsylvanicus str. BPEN] (156 aa)
Score = 364, Expect = 1.4e-33, Identities = 76/154 (49%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+   TKR ILPDP + S L+ K IN +ML GKK  A+ IVY + D + +++N++ +E F+ AL N+ P +E++ RRV GS +QVP  V   R+ TL +RW+I +ARKRN+KSM  +LA+E++DA +G G A KK+E+ H++AE+NKAFAH R+
  S:     3 RRRIVTKRNILPDPRFGSDLLAKFINILMLNGKKSTAESIVYSALDSLFRRSNKNCLEAFEIALNNVRPVVEVKSRRVGGSTYQVPVEVRLVRRNTLAMRWIIEAARKRNDKSMELRLASELLDAIEGKGHAVKKREEIHRIAESNKAFAHYRW 156
>gi|91205976|ref|YP_538331.1| 30S ribosomal protein S7 [Rickettsia bellii RML369-C] >gi|109894848|sp|Q1RHC2|RS7_RICBR 30S ribosomal protein S7 >gi|91069520|gb|ABE05242.1| 30S ribosomal protein S7 [Rickettsia bellii RML369-C] (163 aa)
Score = 364, Expect = 1.4e-33, Identities = 83/152 (54%), Positives = 106/152 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHL 153
           R++ A KR ILPD  YNS L+++ IN IM EGKK LA++IVY +FD I+KK   D  + F  A+ N+ P LE+   RV G+N+QVPT V + R   L  RW+I +A KR+EK MI+KLA E+ +AS   G A KKKEDTHKMAEANKAF+H 
  S:     3 RRHAAEKRVILPDMKYNSVLLSRFINNIMKEGKKALAEKIVYSAFDKIEKKHKADPYQTFSNAMNNVKPYLEVTSVRVGGANYQVPTPVDERRGYALASRWIITAATKRSEKMMIDKLAEELFEASNNRGVAIKKKEDTHKMAEANKAFSHF 154
>gi|190572940|ref|YP_001970785.1| putative 30S ribosomal protein S7 [Stenotrophomonas maltophilia K279a] >gi|194364530|ref|YP_002027140.1| ribosomal protein S7 [Stenotrophomonas maltophilia R551-3] >gi|190010862|emb|CAQ44471.1| putative 30S ribosomal protein S7 [Stenotrophomonas maltophilia K279a] >gi|194347334|gb|ACF50457.1| ribosomal protein S7 [Stenotrophomonas maltophilia R551-3] (157 aa)
Score = 364, Expect = 1.4e-33, Identities = 78/154 (50%), Positives = 112/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLI-KKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R +LPDP + S  + + IN +M  GKK +A++IVY + D+I +K ++ + IE+ +KAL+N+ P++E++ RRV G+ +QVP  V   RK  L +RWLI SARKR E +M +KLAAE+IDAS+  G A KK+E+TH+MAEANKAFAH R+
  S:     3 RKGNTPQRSVLPDPKHGSETIARFINMVMQSGKKSVAEKIVYGAMDVITEKNSSANAIELVQKALDNVAPAVEVKSRRVGGATYQVPVEVRSSRKMALAMRWLIDSARKRGENTMPKKLAAELIDASENRGGAIKKREETHRMAEANKAFAHYRW 157
>gi|153868765|ref|ZP_01998510.1| Ribosomal protein S7 [Beggiatoa sp. PS] >gi|152074642|gb|EDN71477.1| Ribosomal protein S7 [Beggiatoa sp. PS] (156 aa)
Score = 364, Expect = 1.5e-33, Identities = 79/154 (51%), Positives = 106/154 (68%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+   TKR ILPDP Y    V K IN +M  GKK +A+ IVY +   + +KT  + +++F KAL++I P +E++ RRV GS +QVP  V   R+ TL +RWL+ SARKR EKSM  +LA EI+DAS+  G A KK+ED H+MAEANKAF+H R+
  S:     3 RRRIITKRAILPDPKYGDETVAKFINIVMKNGKKSVAEHIVYGALFRVAEKTKGEALDIFTKALDHIRPVVEVKSRRVGGSTYQVPVEVRPVRRTTLAMRWLVESARKRGEKSMGLRLAGEILDASEKKGTAIKKREDVHRMAEANKAFSHFRW 156
>gi|15676065|ref|NP_273195.1| 30S ribosomal protein S7 [Neisseria meningitidis MC58] >gi|15793164|ref|NP_282986.1| 30S ribosomal protein S7 [Neisseria meningitidis Z2491] >gi|121634012|ref|YP_974257.1| 30S ribosomal protein S7 [Neisseria meningitidis FAM18] >gi|161870920|ref|YP_001600100.1| 30S ribosomal protein S7 [Neisseria meningitidis 053442] >gi|166227471|sp|A1KRG9|RS7_NEIMF 30S ribosomal protein S7 >gi|189045618|sp|A9M3X1|RS7_NEIM0 30S ribosomal protein S7 >gi|54039543|sp|P66614|RS7_NEIMB 30S ribosomal protein S7 >gi|54041984|sp|P66613|RS7_NEIMA 30S ribosomal protein S7 >gi|7225355|gb|AAF40596.1| 30S ribosomal protein S7 [Neisseria meningitidis MC58] >gi|120865718|emb|CAM09445.1| 30S ribosomal protein S7 [Neisseria meningitidis FAM18] >gi|121051183|emb|CAM07454.1| 30S ribosomal protein S7 [Neisseria meningitidis Z2491] >gi|161596473|gb|ABX74133.1| 30S ribosomal protein S7 [Neisseria meningitidis 053442] (156 aa)
Score = 364, Expect = 1.6e-33, Identities = 77/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP + S  +TK +N +M++GKK +A++IVY + + I+KKT +  IEVF +A+ N  P +E++ RRV G+N+QVP  V   R+  L +RW+  +ARKR EKSM  +LA E+IDAS+G G A KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKRDVLPDPKFGSVELTKFMNVLMIDGKKSVAERIVYGALEQIEKKTGKVAIEVFNEAIANAKPIVEVKSRRVGGANYQVPVEVRPSRRLALAMRWVRDAARKRGEKSMDLRLAGELIDASEGRGGALKKREEVHRMAEANKAFSHFRF 156
>gi|73748313|ref|YP_307552.1| 30S ribosomal protein S7 [Dehalococcoides sp. CBDB1] >gi|147669093|ref|YP_001213911.1| 30S ribosomal protein S7 [Dehalococcoides sp. BAV1] >gi|189045607|sp|A5FRY6|RS7_DEHSB 30S ribosomal protein S7 >gi|90120415|sp|Q3ZZM7|RS7_DEHSC 30S ribosomal protein S7 >gi|73660029|emb|CAI82636.1| ribosomal protein S7 [Dehalococcoides sp. CBDB1] >gi|146270041|gb|ABQ17033.1| SSU ribosomal protein S7P [Dehalococcoides sp. BAV1] (156 aa)
Score = 364, Expect = 1.7e-33, Identities = 75/154 (48%), Positives = 114/154 (74%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+ R  KR + PD  YNS +++  IN +M+ G+K  AQ+IVY + D++ K+ N++G+ VF++ L+N  P +E++ RRV G+ +QVP  V  +R QT+ +RW+I +ARKR  KSM E+LA+E+++AS+  GAA KK+E+THKMAEAN+AFAH R+
  S:     3 RRARKFKRAVAPDSRYNSLMLSNFINKLMMHGQKATAQRIVYDAIDIMGKQENKEGLAVFEQGLKNATPFIEVKPRRVGGATYQVPIEVRPDRAQTMAMRWIIKAARKRTGKSMAERLASEMLEASREQGAAVKKREETHKMAEANRAFAHYRW 156
>gi|54307535|ref|YP_128555.1| 30S ribosomal protein S7 [Photobacterium profundum SS9] >gi|90415154|ref|ZP_01223104.1| 30S ribosomal protein S7 [Photobacterium profundum 3TCK] >gi|62287278|sp|Q6LVC2|RS7_PHOPR 30S ribosomal protein S7 >gi|46911955|emb|CAG18753.1| putative ribosomal protein S7 [Photobacterium profundum SS9] >gi|90323715|gb|EAS40346.1| 30S ribosomal protein S7 [Photobacterium profundum 3TCK] (156 aa)
Score = 364, Expect = 1.7e-33, Identities = 73/154 (47%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+IL DP + S L+ K +N +M++GKK  A++IVY + D + +++ E+ + VF+KALEN+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM ++LA E++DA+   G A KK+ED H+MA+ANKAFAH R+
  S:     3 RRRVIGQRKILSDPKFGSDLLAKFVNILMVDGKKSTAEKIVYTALDTMTERSGEECLSVFEKALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWLVEAARKRGEKSMAQRLAGEMLDAADNKGTAVKKREDVHRMADANKAFAHYRW 156
>gi|127511088|ref|YP_001092285.1| 30S ribosomal protein S7 [Shewanella loihica PV-4] >gi|166228476|sp|A3Q978|RS7_SHELP 30S ribosomal protein S7 >gi|126636383|gb|ABO22026.1| ribosomal protein S7 [Shewanella loihica PV-4] (156 aa)
Score = 364, Expect = 1.7e-33, Identities = 74/154 (48%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP +NS L+ K IN IM +GKK  A++I+Y++ D++ +K  E+ + + + AL+N+ P++E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DA++  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFNSELLAKFINVIMQDGKKSTAEKIIYKALDVVAEKKGEEHLVILEAALDNVRPTVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDAAENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|56477590|ref|YP_159179.1| 30S ribosomal protein S7 [Azoarcus sp. EbN1] >gi|62287193|sp|Q5P336|RS7_AZOSE 30S ribosomal protein S7 >gi|56313633|emb|CAI08278.1| 30S ribosomal protein S7 [Azoarcus sp. EbN1] (156 aa)
Score = 363, Expect = 1.8e-33, Identities = 78/154 (50%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + S+ V+K IN IM  GKK +A++IVY +F  I  K  +D +EVF  A+ N+ P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR EKSM ++LA E+++A++G G+A KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKREILPDPKFGSQDVSKFINVIMQAGKKSVAERIVYGAFAQISGKAGKDPLEVFSSAVANVKPVVEVKSRRVGGANYQVPVEVRPSRRMALSMRWLREAARKRAEKSMAQRLAGELLEAAEGRGSAMKKREEVHRMAEANKAFSHYRF 156
>gi|91791535|ref|YP_561186.1| 30S ribosomal protein S7 [Shewanella denitrificans OS217] >gi|123166589|sp|Q12SW3|RS7_SHEDO 30S ribosomal protein S7 >gi|91713537|gb|ABE53463.1| ribosomal protein S7 [Shewanella denitrificans OS217] (156 aa)
Score = 363, Expect = 1.8e-33, Identities = 75/154 (48%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    +R+ILPDP ++S L+ K IN IM +GKK  A++I+Y++ D++ +K +E  + + + AL+N+ PS+E++ RRV GS +QVP  V   R+  L +RWL+ +ARKR EKSM  +LA E++DAS+  G A KK+ED H+MAEANKAFAH R+
  S:     3 RRRVVGQRKILPDPKFHSELLAKFINVIMQDGKKSTAEKIIYKALDVVAEKKSEAHLSILEAALDNVRPSVEVKSRRVGGSTYQVPCEVRPVRRNALAMRWLVEAARKRGEKSMALRLAGEMLDASENKGTAVKKREDVHRMAEANKAFAHYRW 156
>gi|166367019|ref|YP_001659292.1| 30S ribosomal protein S7 [Microcystis aeruginosa NIES-843] >gi|189045616|sp|B0JSE2|RS7_MICAN 30S ribosomal protein S7 >gi|166089392|dbj|BAG04100.1| 30S ribosomal protein S7 [Microcystis aeruginosa NIES-843] (156 aa)
Score = 363, Expect = 1.8e-33, Identities = 78/154 (50%), Positives = 103/154 (66%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR I PDPVYNS LV+  I  IM  GKK LA  IVY +   + ++T ++ +EVF+KA++N  P +E++ RRV G+ +QVP  V   R  TL LRWL+  AR R  K+M  KLA EI+DA+  TG   KK+E+TH+MAEANKAFAH R+
  S:     3 RRKNVKKRPIPPDPVYNSCLVSMTIRRIMRSGKKSLAANIVYDALKTVGERTGQEPLEVFEKAVKNATPLVEVKARRVGGATYQVPMEVRSNRGSTLALRWLVHYARTRGGKTMAGKLANEIMDAANETGGTIKKREETHRMAEANKAFAHYRY 156
>gi|163785644|ref|ZP_02180188.1| 30S ribosomal protein S7 [Hydrogenivirga sp. 128-5-R1-1] >gi|159879087|gb|EDP73047.1| 30S ribosomal protein S7 [Hydrogenivirga sp. 128-5-R1-1] (159 aa)
Score = 363, Expect = 1.8e-33, Identities = 81/154 (52%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEK---SMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK     REI+PDPVY   LV K IN +M +GKK  A++IVY +  ++ +KT E+ +    KA+ENI P +E+R RRV GS +QVP  V   R+++L LRWL+ +AR R+ K   +MIEKL+ E+ DA    G A KKKEDTH+MAEANKAFAH R+
  S:     3 RKGPVKPREIMPDPVYQDVLVHKLINKVMKDGKKSKAEKIVYTAMKILAEKTGEEPLAALHKAIENIKPVMEVRPRRVGGSTYQVPMEVPPRRQESLALRWLVEAARSRSGKGNYTMIEKLSNELYDAYNERGGAVKKKEDTHRMAEANKAFAHYRW 159
>gi|17547742|ref|NP_521144.1| 30S ribosomal protein S7 [Ralstonia solanacearum GMI1000] >gi|153887293|ref|ZP_02008445.1| ribosomal protein S7 [Ralstonia pickettii 12D] >gi|187930368|ref|YP_001900855.1| ribosomal protein S7 [Ralstonia pickettii 12J] >gi|21263969|sp|Q8XV09|RS7_RALSO 30S ribosomal protein S7 >gi|17430047|emb|CAD16732.1| probable 30s ribosomal protein s7. [Ralstonia solanacearum] >gi|151576381|gb|EDN40785.1| ribosomal protein S7 [Ralstonia pickettii 12D] >gi|187727258|gb|ACD28423.1| ribosomal protein S7 [Ralstonia pickettii 12J] (156 aa)
Score = 363, Expect = 1.8e-33, Identities = 78/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP + +  V K +N +ML+GKK +A++IVY +FD I+KK  +  IEVF  A+ NI P +E++ RRV G+N+QVP  V   R+  L +RWL  +A+KR+EKSM  +LA E+++AS+G G A KK+++ H+MAEANKAF+H RF
  S:     3 RRREVPKREILPDPKFGNVEVAKFMNVLMLDGKKSVAERIVYGAFDQIEKKAGKAPIEVFTLAIGNIKPVVEVKSRRVGGANYQVPVEVRPSRRLALAMRWLREAAKKRSEKSMALRLAGELLEASEGRGGAMKKRDEVHRMAEANKAFSHFRF 156
>gi|145620221|ref|ZP_01776257.1| ribosomal protein S7 [Geobacter bemidjiensis Bem] >gi|144943447|gb|EDJ78536.1| ribosomal protein S7 [Geobacter bemidjiensis Bem] >gi|197086679|gb|ACH37950.1| ribosomal protein S7 [Geobacter bemidjiensis Bem] (156 aa)
Score = 363, Expect = 1.9e-33, Identities = 77/154 (50%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP Y  R+V K IN IML+GKK  A++ +Y + ++   K  E+ ++V KK L+NI P LE++ RRV GS +QVP  V  ER+ +L +RWL+  +  R+EK++ +KLA EI+DA    G+A KK+EDTHKMAEAN+AFAH R+
  S:     3 RRREVAKRVILPDPKYADRVVAKLINIIMLDGKKSTAEKALYGAMEIAAGKAGEEPVKVLKKCLDNIKPMLEVKSRRVGGSTYQVPVEVRPERRVSLAMRWLVKYSNTRSEKTVTDKLAGEILDAYNNRGSAVKKREDTHKMAEANRAFAHYRW 156
>gi|59802165|ref|YP_208877.1| 30S ribosomal protein S7 [Neisseria gonorrhoeae FA 1090] >gi|75507295|sp|Q5F5S2|RS7_NEIG1 30S ribosomal protein S7 >gi|59719060|gb|AAW90465.1| putative 30S ribosomal protein S7 [Neisseria gonorrhoeae FA 1090] (156 aa)
Score = 363, Expect = 1.9e-33, Identities = 77/154 (50%), Positives = 111/154 (72%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR++LPDP + S  +TK +N +M++GKK +A++IVY + + I+KKT +  IEVF +A+ N  P +E++ RRV G+N+QVP  V   R+  L +RW+  +ARKR EKSM  +LA E+IDAS+G G A KK+E+ H+MAEANKAF+H RF
  S:     3 RRREVPKRDVLPDPKFGSVELTKFMNVLMIDGKKSVAERIVYGALEQIEKKTGKAAIEVFNEAIANSKPIVEVKSRRVGGANYQVPVEVRPSRRLALAMRWVRDAARKRGEKSMDLRLAGELIDASEGRGGALKKREEVHRMAEANKAFSHFRF 156
>gi|21230360|ref|NP_636277.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66769646|ref|YP_244408.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. campestris str. 8004] >gi|188992858|ref|YP_001904868.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. campestris] >gi|23822114|sp|Q8PC53|RS7_XANCP 30S ribosomal protein S7 >gi|81304399|sp|Q4URD5|RS7_XANC8 30S ribosomal protein S7 >gi|21111915|gb|AAM40201.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66574978|gb|AAY50388.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. campestris str. 8004] >gi|167734618|emb|CAP52828.1| 30S ribosomal protein S7 [Xanthomonas campestris pv. campestris] (155 aa)
Score = 363, Expect = 1.9e-33, Identities = 76/154 (49%), Positives = 110/154 (71%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           RK    +R +LPDP + S  + + IN +M  GKK +A++IVY + D+I +K N + +E+ +KAL+N+ P++E++ RRV G+ +QVP  V   R+  L +RWLI SARKR E +M  KLAAE++DAS+  G A KK+E+TH+MAEANKAFAH R+
  S:     3 RKGSTPQRTVLPDPKHGSETIARFINMVMQSGKKSVAEKIVYGAMDVIGEK-NPNAVELVQKALDNVAPAVEVKSRRVGGATYQVPVEVRSSRRMALAMRWLIDSARKRGENTMPRKLAAELLDASESRGGAIKKREETHRMAEANKAFAHYRW 155
>gi|86608399|ref|YP_477161.1| 30S ribosomal protein S7 [Synechococcus sp. JA-2-3B'a(2-13)] >gi|109894855|sp|Q2JMX9|RS7_SYNJB 30S ribosomal protein S7 >gi|86556941|gb|ABD01898.1| ribosomal protein S7 [Synechococcus sp. JA-2-3B'a(2-13)] (156 aa)
Score = 363, Expect = 2.0e-33, Identities = 70/154 (45%), Positives = 109/154 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+NRA +R++ PDP Y SRLVT  I  +M+ GK  LA +I+Y++ D+++++T +D + + + A+ N  P +E++ RRV G+ +QVP  V  ER  +L LRWL+  +R R  ++M  KLA E+IDA+  TG+A +++E+ H+MAEANKAFAH R+
  S:     3 RRNRAPRRDVPPDPKYGSRLVTMLIRKLMMRGKASLAARILYEALDIVRERTGQDPLPLLENAVRNATPLVEVKARRVGGATYQVPVEVRGERGTSLALRWLVTFSRTRPGRTMAAKLANELIDAANETGSAIRRREEVHRMAEANKAFAHYRY 156
>gi|30249994|ref|NP_842064.1| 30S ribosomal protein S7 [Nitrosomonas europaea ATCC 19718] >gi|62287322|sp|Q82T69|RS7_NITEU 30S ribosomal protein S7 >gi|30139101|emb|CAD85965.1| Ribosomal protein S7 [Nitrosomonas europaea ATCC 19718] (156 aa)
Score = 363, Expect = 2.0e-33, Identities = 77/154 (50%), Positives = 113/154 (73%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KREILPDP Y++  + K +N +M  GKK +A+QI+Y + + ++KKT +D +EVF +AL NI P +E++ RRV G+N+QVP  V   R+  L +RWL  +ARKR+EKSM  +LA+E+++AS+  GAA KK+E+ H+MAE+NKAF+H RF
  S:     3 RRREVPKREILPDPKYHNIELAKFVNVLMTRGKKSVAEQIIYGALNHLEKKTGKDPVEVFTQALSNIRPVVEVKSRRVGGANYQVPVEVRSIRRSALAMRWLRDAARKRSEKSMDLRLASELLEASENRGAAIKKREEVHRMAESNKAFSHFRF 156
>gi|191163797|ref|ZP_03025668.1| ribosomal protein S7 [Geobacter sp. M21] >gi|190994962|gb|EDV70419.1| ribosomal protein S7 [Geobacter sp. M21] (156 aa)
Score = 363, Expect = 2.1e-33, Identities = 77/154 (50%), Positives = 107/154 (69%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR ILPDP Y  R+V K IN IML+GKK  A++ +Y + ++   K  E+ ++V KK L+NI P LE++ RRV GS +QVP  V  ER+ +L +RWL+  +  R+EK++ +KLA EI+DA    G+A KK+EDTHKMAEAN+AFAH R+
  S:     3 RRREVAKRVILPDPKYADRVVAKLINIIMLDGKKSTAEKALYGAMEIAAGKAGEEPVKVLKKCLDNIKPMLEVKSRRVGGSTYQVPVEVRPERRVSLAMRWLVKYSNARSEKTVTDKLAGEILDAYNNRGSAVKKREDTHKMAEANRAFAHYRW 156
>gi|67459546|ref|YP_247170.1| 30S ribosomal protein S7 [Rickettsia felis URRWXCal2] >gi|75536050|sp|Q4UKC6|RS7_RICFE 30S ribosomal protein S7 >gi|67005079|gb|AAY62005.1| 30S ribosomal protein S7 [Rickettsia felis URRWXCal2] (159 aa)
Score = 363, Expect = 2.1e-33, Identities = 83/152 (54%), Positives = 107/152 (70%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHL 153
           R++ A KR ILPD  YNS L+++ IN IM EGKK LA++IVY +F+ I+KK   D  + F  A+ N+ P LE+   RV G+N+QVPT V + R  TL  RW+I +A KR+EK MI+KLA E+ +AS   G A KKKEDTHKMAEANKAF+H 
  S:     3 RRHAAEKRVILPDMKYNSILLSRFINNIMKEGKKALAEKIVYSAFNKIEKKHRVDPYQTFNNAMHNVKPHLEVTSVRVGGANYQVPTHVDERRGYTLASRWIINAASKRSEKMMIDKLAEELFEASNNRGVAIKKKEDTHKMAEANKAFSHF 154
>gi|159029230|emb|CAO87590.1| rpsG [Microcystis aeruginosa PCC 7806] (156 aa)
Score = 363, Expect = 2.1e-33, Identities = 78/154 (50%), Positives = 103/154 (66%)
  Q:     2 RKNRATKREILPDPVYNSRLVTKAINAIMLEGKKGLAQQIVYQSFDLIKKKTNEDGIEVFKKALENIMPSLELRVRRVAGSNFQVPTVVSKERKQTLGLRWLILSARKRNEKSMIEKLAAEIIDASKGTGAAFKKKEDTHKMAEANKAFAHLRF 155
           R+    KR I PDPVYNS LV+  I  IM  GKK LA  IVY +   + ++T ++ +EVF+KA++N  P +E++ RRV G+ +QVP  V   R  TL LRWL+  AR R  K+M  KLA EI+DA+  TG   KK+E+TH+MAEANKAFAH R+
  S:     3 RRKNVKKRPIPPDPVYNSCLVSMTIRRIMRSGKKSLAANIVYDALKTVGERTGQEPLEVFEKAVKNATPLVEVKARRVGGATYQVPMEVRTNRGSTLALRWLVHYARTRGGKTMAGKLANEIMDAANETGGTIKKREETHRMAEANKAFAHYRY 156