>gi|26553756|ref|NP_757690.1| putative integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453763|dbj|BAC44094.1| putative integral membrane protein [Mycoplasma penetrans HF-2] (626 aa)
Score = 2639, Expect = 0.0e+00, Identities = 626/626 (100%), Positives = 626/626 (100%)
  Q:     1 MDGRNQELNINSKNDVKVKKDFSIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKIPADTATLLSTMSFLNQGADLNFSSFNTSVSSSNPGMSHITVRPTVSWPNAGTAYPYQYLYLNTTTASSITSNTMLHKYRIKKSYSYNEFAQMNKTIYDYNAANSSTNETTDSTTSVKYWEDAWNKYKETNGTSGNSNTTLESFVTKFFKERTSSTTTSTNGQTALSLFNRTEAQELLKEFNTIQYSAYLNLLRKGVSVSVNAATTTPSTLTEWFTAIAKGVSEEEKVELGLLGINLFDQDDVLSNTIDFKYQISNGTTSPTNTMSLSIANPFNLMLRDWMNTARVTTVVSVMKNEIVIPVWVSIAVILFIVSMVLYYKRDFA 626
           MDGRNQELNINSKNDVKVKKDFSIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKIPADTATLLSTMSFLNQGADLNFSSFNTSVSSSNPGMSHITVRPTVSWPNAGTAYPYQYLYLNTTTASSITSNTMLHKYRIKKSYSYNEFAQMNKTIYDYNAANSSTNETTDSTTSVKYWEDAWNKYKETNGTSGNSNTTLESFVTKFFKERTSSTTTSTNGQTALSLFNRTEAQELLKEFNTIQYSAYLNLLRKGVSVSVNAATTTPSTLTEWFTAIAKGVSEEEKVELGLLGINLFDQDDVLSNTIDFKYQISNGTTSPTNTMSLSIANPFNLMLRDWMNTARVTTVVSVMKNEIVIPVWVSIAVILFIVSMVLYYKRDFA
  S:     1 MDGRNQELNINSKNDVKVKKDFSIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKIPADTATLLSTMSFLNQGADLNFSSFNTSVSSSNPGMSHITVRPTVSWPNAGTAYPYQYLYLNTTTASSITSNTMLHKYRIKKSYSYNEFAQMNKTIYDYNAANSSTNETTDSTTSVKYWEDAWNKYKETNGTSGNSNTTLESFVTKFFKERTSSTTTSTNGQTALSLFNRTEAQELLKEFNTIQYSAYLNLLRKGVSVSVNAATTTPSTLTEWFTAIAKGVSEEEKVELGLLGINLFDQDDVLSNTIDFKYQISNGTTSPTNTMSLSIANPFNLMLRDWMNTARVTTVVSVMKNEIVIPVWVSIAVILFIVSMVLYYKRDFA 626
>gi|26553550|ref|NP_757484.1| integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453556|dbj|BAC43888.1| predicted integral membrane protein [Mycoplasma penetrans HF-2] (679 aa)
Score = 338, Expect = 2.0e-29, Identities = 135/479 (28%), Positives = 221/479 (46%)
  Q:    22 FSIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVN-----NLSDNSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKIPADTATLLSTMSFLNQGADLNFSSFNTSVSSSNPGMSHITVRPTVSWPNAGTAYPYQYLYLNT--TTASSITSNTMLHKYRIKKSYSYNEFAQMNKTIYDYNAANSSTNETTDSTTSVKYWEDAWN-----KYKETNGTSGNSN-TTLESFVTKFFKERTSSTTTSTNG------QTALSLFNRTEAQELLKEFNTIQYSAYLNLLRKGV 500
           + +F+K++F F F L   K S+YI IFVY+ +I   +II P +    PI L +    ++ L+  +A+++ YI +EIFRT +DDGTEL+T+SKP+ R +I F K  +  I    I++ G   S+           D   ++ G F  T++   +FGSI    S++  KI S+L + GL F++++ ++L +  + T  N     N S+N+  +  +N   V+  G   ++Q        + ++NSS T+   +       +       +     FDFG QLS++F LN  P DT   +  M  +     L+FS       S+  G S   V P      +       +L++ T  T  SS  ++ +   Y             +  T+YDYN       +  D  T    +E+  N     ++     T  NSN +T E+  TK            TNG      Q    L+N T   + +K  N +    Y  + R  V
  S:    26 YEMFSKEYFQFIFSLNFKKKSIYINIFVYILMIVACAIIAPLIIGFQPILLLSYPVLSLILVLIIAIISSYITVEIFRTPVDDGTELMTLSKPLHRSQIFFCKCLVLTIIGTTIALTGAIFSSIGLTIPSIDKVDQLKVIGGIFIATIICFAVFGSITVFFSLFANKIISLLSTTGLVFVIIVTSILGSLTIDTKTNFDTGTNFSENTNQIGYLN---VTEQGKPSAVQ------GYTPNSNSSRTAEESY-------QVEFDTKVFPKFALFDFGQQLSSMFTLNMAPKDTFAKMKIMDTMKSPFKLSFSPIQD--FSNFTGTSLKLVYPMEPSSQSSQTQEENFLFVPTYDTGISSTNASNLFGTY-------------VQYTLYDYNNV-----KLVDGNTEYLDFENLINQRFEYRWDNVQWTQNNSNGSTQETDATKIILNYADDFFKLTNGVAEDVVQNYFDLYNLTNYTQRVKAINKLNQIIYTGIYRNFV 487
>gi|31544579|ref|NP_853157.1| hypothetical protein MGA_1302 [Mycoplasma gallisepticum R] >gi|31541424|gb|AAP56725.1| NosY [Mycoplasma gallisepticum R] (652 aa)
Score = 238, Expect = 6.3e-18, Identities = 87/320 (27%), Positives = 153/320 (47%)
  Q:    14 NDVKVKKDFSIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYN--LSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSD------GSTVSIQQGLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKIPADTATLLSTMSFLNQGADLNFSSFNTSV 333
           N VK  K F I+    F F  K +  K  V+     Y  ++    +I P   + +P + +N  +   + FL+  V++    +A+ +F+ G+ DGTE++ +SKP+SRK  V  K  + ++  L+ S L +  +A   ++      +   +MLG F G  +N + FGSI  +IS  L K ++++I     F++   T L+A    +P   LSD+   L   + ++   D      G TV+ Q                T ++       L+ QA  ++ YN S  F+ G  L++++ LN           ++S+ N G ++NF S NT +
  S:     2 NRVKQPKQFWIY----FAFLIKQIVKKPFVWATFSAYFIMLLVILLIFPLYQETSPANYWNNPVIHVSTFLIPVVSIFGIMVAMFLFKDGVADGTEIIIISKPVSRKIYVSAKFLVLILTCLVFSFLLIITAAIAKINPQFQLQNMKDLMLGIFIGNFINSLFFGSISILISFGLSKNSTIVIVFLATFLMNFQTPLSALFFKSPSRVLSDSQHTLVERSLLTNKQDRNHQPVGETVAFQ---------------PTPSDAKQNIKQLYEQAEASTFYNQSFYFNLGNALNSIYNLN-----------SLSYENSG-NINFLSANTKI 298
>gi|26554048|ref|NP_757982.1| hypothetical protein MYPE5960 [Mycoplasma penetrans HF-2] >gi|26454056|dbj|BAC44386.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (713 aa)
Score = 232, Expect = 3.2e-17, Identities = 83/281 (29%), Positives = 140/281 (49%)
  Q:    23 SIFNKKFFCFSFKLMASKISVYIGIFVY---LFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNK 303
           ++FNK+ F F F L   KIS YI I +Y   L +  C S+I+    D  P   ++   +  FL+F + VV  YI I+I++T I+DG+EL+ VSKP++R  I   KL I  I+ LI S++ + I +  +    S +S S   +LG  T ++V  + F SI    SI+ KK  +++I      I++  +++  FV+   + N  DN+ A             ++  IQ  LV  + +         ++  ++  + +        Y      +F  QLSN++ LN+
  S:    23 NVFNKECFTFLFVLYIKKISYYIAIALYQLLLLVFICLSLII----DVQPTYFFSNPITITFLIFLLTVVASYITIDIYKTPIEDGSELIIVSKPLNRSSIFISKLFIISIFGLINSLISIPIVSIVFSFPNSVHSYSLIALLGIPTASLVIYLAFSSISLFASIFFKKAIALVIVSVFNVIMLFFSIINIFVVDIQLKN--DNTFA-------------TSYKIQYPLVLDNQNKIDEIKVVKSSNNIDFKNTYLTYFDKRTYPKLTPINFYQQLSNMYGLNR 287
>gi|26554049|ref|NP_757983.1| hypothetical protein MYPE5970 [Mycoplasma penetrans HF-2] >gi|26454057|dbj|BAC44387.1| hypothetical protein [Mycoplasma penetrans HF-2] (198 aa)
Score = 197, Expect = 4.1e-13, Identities = 59/171 (34%), Positives = 97/171 (56%)
  Q:    18 VKKDF-SIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKK 188
           VK  F ++FNK  F F F L   K+S Y+ I +Y  II  + I +  +    P   +    S  FL+F + V++ YI+ +I++T I+DG+ELL VSKP++R  I   K++I  ++ LI +++ + ++A  +    S +S S   + G    ++V  + F SI   ISI+LKK
  S:    18 VKNHFKNMFNKHCFIFLFVLYIKKVSYYVSILLYQAIIILF-ICLSLIRGDEPTYFFANPISITFLIFLLTVISSYISTDIYKTPIEDGSELLIVSKPLNRANIFISKISIISMFGLINALVALPVTAICFAFPNSVHSYSLIALFGIPIASLVIYLAFASISLFISIFLKK 188
>gi|13508072|ref|NP_110021.1| hypothetical protein MPN333 [Mycoplasma pneumoniae M129] >gi|2496463|sp|P75445|Y333_MYCPN Uncharacterized protein MPN_333 >gi|1674196|gb|AAB96151.1| hypothetical protein MPN_333 [Mycoplasma pneumoniae M129] (750 aa)
Score = 179, Expect = 4.5e-11, Identities = 60/231 (25%), Positives = 114/231 (49%)
  Q:    74 NLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSDGST-----VSIQQ-GLVGIDNSSSTNSSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKI 304
           N+   ++ L+  V ++   I  +IF  G ++G EL   SKPISR  I+ +KL + L+Y+ I++VL   + +  Y       S    + L  F GT++NGIIF ++  +++     I S++I +    +   ++ +   +  TP   LS    +++ +N ++ S   +      VS+++  L G+D         +     +   +L+ +A R S Y NS   + GY   +L+ L  +
  S:    28 NVFQFSLILIPLVTLLAGSITADIFIEGYNNGIELFLFSKPISRDRILLIKLLVLLMYLSIVAVLSTAVVSLGYFTRNEIESYLDDLALSIFVGTILNGIIFSAVTIMLATRFSNIQSLIILLLFVSLFSFSSPIARLIFDTPAKTLSQQGYSVRQINGIAHSESPNVERKIYVSVKKRRLTGVDREEK-ELWKSDEQAALRGRNLYEEAQRTSSYINSFYTNIGYLFGSLYRLGAL 263
>gi|13508074|ref|NP_110023.1| hypothetical protein MPN335 [Mycoplasma pneumoniae M129] >gi|2496462|sp|P75443|Y335_MYCPN Uncharacterized protein MPN_335 >gi|1674194|gb|AAB96149.1| hypothetical protein MPN_335 [Mycoplasma pneumoniae M129] (741 aa)
Score = 161, Expect = 6.4e-09, Identities = 68/267 (25%), Positives = 138/267 (51%)
  Q:    60 IVPRVADKAPISLYN---LSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVL-GMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTN-----SSTTSTNPFVEPSSLWRQAVRNSGYNNSIKFDFGYQLSNLFILNKIPADTATLLSTMSFLNQGADLNF 326
           I+P    + P+ L++   +  S++ + F +A+    I  ++F  G  +G E+L +++  +R  + F +L +  I++   + L G+ +S    L   +T+   T ++L  F G ++  ++F  ++ II+ +L +  SML+ +    +    T++ AF +  P  NL DN    Q +N +S+ S   + S++     ID+S+ ++      S   TN    P ++W +   +S + +   ++ GY +++LF LN + +D       + FLN    LNF
  S:    53 IIPAFTKQDPLFLWSHPVVQMSSLIIPF-IALFATIITFQVFINGYYNGLEILLITRFFTRGRLFFARLAVLFIWITGTAFLSGLFVSLTATLG--ATSQTVTDLVLSVFFGVLLLSLLFSCVLIIIAQFLNRTQSMLLLLLGVSLASFTTVILAFSIKPPSENLRDN--GYQPLN-LSLISKSKSKSVENVFTIIDSSNVSDPRNKKKSIVKTN----PQAIWDEYGESSFFQSQYYWNVGYWINSLFRLNSL-SDYRNFDVNLYFLN--TKLNF 315
>gi|26553808|ref|NP_757742.1| hypothetical protein MYPE3550 [Mycoplasma penetrans HF-2] >gi|26453815|dbj|BAC44146.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (468 aa)
Score = 133, Expect = 9.7e-06, Identities = 63/235 (26%), Positives = 116/235 (49%)
  Q:    29 FFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-----MGISAFTYLDDLSTNSDS--------TTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSD---NSKALQTVNAVSVSSDGSTVSIQQGLVGIDNSSSTNSSTTS 263
           +F F F  + +K   +I   +   +   +SII    ++ +  ++Y +++ ++  + +++ +T    I +F+    +G E+L VSKPI R +I+F K +I ++  L+ISVL      +G+S       L T+  +            L  F  ++   ++FGSI ++I+I   K  S  I + L  ++ M T  ++ +     N  S     +K  QT +     S   T       +G + SS  NSST S
  S:    66 YFYFLFIFLINKKGTWIMPIIIFLLPLLFSIIAITSSEGSTNTIY-ITSLSIICVLTISFITSK-TINLFKDSETEGVEILIVSKPIERWQIIFGKFSILILVSLLISVLNFISNLIGVSIVNAFKKLDTSQTAIFNQVDLNVNYALLVFGASIALCLLFGSITSLITIKCSKKLSSSIPIMLFMLMYMGTFFSSIISTIGENGSSAYNFYNKWSQTSSIQYNQSFKYTHVNNSVWIGFEKSSIENSSTDS 314
>gi|186701774|ref|ZP_02971454.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186701049|gb|EDU19331.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (594 aa)
Score = 121, Expect = 2.7e-04, Identities = 70/273 (25%), Positives = 124/273 (45%)
  Q:    32 FSFKLMASKISVYIGIFVYLFIIACYSIIVP-RVAD--KAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSD----GSTVSIQQGLVGIDNSSSTNSSTTSTNP-FVEPSSLWRQAVRNSGYNNSIKF------DFGYQLSNLFILNKI 304
           F  +L+  K S Y  + + LF+   + II    +A+  K  + L+ L TS   L+    V T   AI +F+   D+G E+L  SK ISRK I+F K+   ++ ++  S++   ++   Y+ ++  N+      L  F      G+IF SI  +I        +M+I +         +    F++   V NL   SK  Q    ++++ D     + + +++  +   N      +    NP F +  + + +A  +   N S  F         YQL+N F  N I
  S:    15 FLSRLVLFKKSTYFLVGISLFVNLIFIIINGLNIANNIKTYLILFYLFTSINSLL--TIVFTTIKAINLFKDLKDEGIEILVFSKSISRKNIIFTKIGFLILNIVFWSLITYILNIIFYVVNIKNNNGINFFYLYAFFNYYFCGLIFASIAALIVSRWSNKVAMIIPI---------SCFLPFLIAGGVANLYSTSKINQVAKYMNINYDKYDSNTILDVEKFYLNNHNDEVYLITKNLNNPQFSKRQNYFLKAAFDHAKNASTFFHVLSWLSIPYQLNNSFYKNDI 290
>gi|13357953|ref|NP_078227.1| hypothetical protein UU392 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762196|ref|YP_001752475.1| hypothetical protein UPA3_0408 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920322|ref|ZP_02931666.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508457|ref|ZP_02689190.2| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|11292844|pir||F82895 hypothetical protein UU392 [imported] - Ureaplasma urealyticum >gi|6899378|gb|AAF30802.1|AE002137_1 unique hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827773|gb|ACA33035.1| putative membrane protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902741|gb|EDT49030.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675868|gb|EDT87773.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (594 aa)
Score = 117, Expect = 7.0e-04, Identities = 54/207 (26%), Positives = 96/207 (46%)
  Q:    32 FSFKLMASKISVYIGIFVYLFIIACYSIIVP-RVAD--KAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSD 238
           F  +L+  K S Y  + + LF+   + II    +A+  K  + L+ L TS   L+    V +   AI +F+   D+G E+L  SK ISRK I+F K+   ++ ++  S++   ++   Y+ ++  N+      L  F      G+IF SI  +I        +M+I +         +    F++   V NL   SK  Q    ++++ D
  S:    15 FLSRLVLFKKSTYFLVGISLFVNLIFIIINGLNIANNIKTYLILFYLFTSINSLL--TIVFSTIKAINLFKDLKDEGIEILVFSKSISRKNIIFTKIGFLILNIVFWSLITYILNIIFYVVNIKNNNGINFFYLYAFFNYYFCGLIFASIAALIVSRWSNKVAMIIPI---------SCFLPFLIAGGVANLYSTSKINQVAKYMNINYD 213
>gi|185178901|ref|ZP_02555053.2| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024093|ref|ZP_02569491.2| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039579|ref|ZP_02528723.2| hypothetical protein Uures_02837 [Ureaplasma urealyticum serovar 8] >gi|188518237|ref|ZP_02555909.2| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524402|ref|ZP_02558181.2| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530961|ref|ZP_02546878.2| hypothetical protein Uurese_01000005_0200002480 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867869|ref|ZP_03079868.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209159|gb|EDU06202.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019140|gb|EDU57180.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998265|gb|EDU67362.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659975|gb|EDX53355.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660446|gb|EDX53704.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (594 aa)
Score = 117, Expect = 8.6e-04, Identities = 38/145 (26%), Positives = 66/145 (45%)
  Q:    94 AIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSD 238
           AI +F+   DDG E+L  SK ISRK I+F K+   ++  ++ S++    +   Y+ +   N+D     L  F       +IFGSI  +I        +M++ +         +    F++   V NL   SK  Q    ++++ D
  S:    78 AINLFKDLKDDGIEILVFSKSISRKNIIFTKIGFLVLNCVLWSLITYIFNIIFYVVNTKNNNDINLFYLYAFFNYYFCALIFGSIAALIVSRWSNKIAMIVPI---------SCFLPFLVAGGVANLYSTSKINQVAKYMNINYD 213
>gi|171920946|ref|ZP_02932088.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188569197|ref|ZP_02829663.2| hypothetical protein Uurealyserovar_03331 [Ureaplasma urealyticum serovar 2] >gi|188592836|ref|ZP_02694999.2| hypothetical protein Uureaserovar_03215 [Ureaplasma urealyticum serovar 10] >gi|171903182|gb|EDT49471.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (594 aa)
Score = 116, Expect = 9.1e-04, Identities = 38/145 (26%), Positives = 66/145 (45%)
  Q:    94 AIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSKALQTVNAVSVSSD 238
           AI +F+   DDG E+L  SK ISRK I+F K+   ++  ++ S++    +   Y+ +   N+D     L  F       +IFGSI  +I        +M++ +         +    F++   V NL   SK  Q    ++++ D
  S:    78 AINLFKDLKDDGIEILVFSKSISRKNIIFTKIGFLVLNCVLWSLITYIFNIIFYVVNTKNNNDINLFYLYAFFNYYFCALIFGSIAALIVSRWSNKIAMIVPI---------SCFLPFLVAGGVANLYSTSKINQVAKYMNINYD 213
>gi|148377723|ref|YP_001256599.1| ABC transporter, permease protein [Mycoplasma agalactiae PG2] >gi|148291769|emb|CAL59158.1| ABC transporter, permease protein [Mycoplasma agalactiae PG2] (621 aa)
Score = 116, Expect = 1.1e-03, Identities = 50/192 (26%), Positives = 94/192 (48%)
  Q:    28 KFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIE---IFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNN 219
           K+  F+F ++  KIS     F+   +I  +S+I+  V   A    Y+L ++ +F+  S +    + +I+   IF+    +G E++T+SKPISR  ++  KL + LIY  ++  L M ++A   L  +          L  F  +++  ++FG    +I   L +  +M I + L   L +   L +    + +NN
  S:     7 KYSRFAFNIVFRKIST----FILPILILVFSLIIGLVYKFAVGENYHLLSAYIFIFISASATVIFSSIKALNIFKDFDSEGLEIITLSKPISRNNLILGKL-LALIYFGLLWSLIMFVAALFGLYAVYEIKQFFLASLLFFFVSLMTYLLFGLFTALICYKLSQKIAMTIPIALFIPLALGGSLISANSASNINN 196
>gi|13357649|ref|NP_077923.1| membrane lipoprotein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761999|ref|YP_001752173.1| hypothetical protein UPA3_0093 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508508|ref|ZP_02958036.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|11292842|pir||E82934 hypothetical protein UU092 [imported] - Ureaplasma urealyticum >gi|6899046|gb|AAF30498.1|AE002109_1 unique hypothetical membrane lipoprotein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827576|gb|ACA32838.1| putative membrane protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675938|gb|EDT87843.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (595 aa)
Score = 111, Expect = 3.8e-03, Identities = 38/136 (27%), Positives = 78/136 (57%)
  Q:    75 LSTSTMFLMFSVAVVTCYI---AIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTA 210
           L  S + +MF++ + T +    A+ IF+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   +     + ++    +  +IFG I +++++ L    S+LI   ++FI ++   + A
  S:    56 LIISYVMIMFNLLMTTIFASLKALNIFKDFSEDGIDILVISKPISRKNIVWSKIFFFVLTGIVWSLVSFLGLLIF-YLISFNFAKNVNYYWILSYISPFICYLIFGLITSLLALKLNAKISILIPF-VSFIPLLTIGIIA 193
>gi|186701597|ref|ZP_02971306.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|186700827|gb|EDU19109.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (595 aa)
Score = 111, Expect = 3.9e-03, Identities = 38/136 (27%), Positives = 78/136 (57%)
  Q:    75 LSTSTMFLMFSVAVVTCYI---AIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTA 210
           L  S + +MF++ + T +    A+ IF+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   +     + ++    +  +IFG I +++++ L    S+LI   ++FI ++   + A
  S:    56 LIISYVMIMFNLLMTTIFASLKALNIFKDFSEDGIDILVISKPISRKNIVWSKIFFFVLTGIVWSLVSFLGLLIF-YLISFNFAKNVNYYWILSYISPFICYLIFGLITSLLALKLNAKISILIPF-VSFIPLLTIGIIA 193
>gi|171920295|ref|ZP_02691002.2| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902708|gb|EDT48997.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] (595 aa)
Score = 110, Expect = 4.8e-03, Identities = 35/120 (29%), Positives = 70/120 (58%)
  Q:    75 LSTSTMFLMFSVAVVTCYI---AIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLI 194
           L  S + +MF++ + T +    A+ IF+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   +     + ++    +  +IFG I +++++ L    S+LI
  S:    56 LIISYVMIMFNLLMTTIFASLKALNIFKDFSEDGIDILVISKPISRKNIVWSKIFFFVLTGIVWSLVSFLGLLIF-YLISFNFAKNVNYYWILSYISPFICYLIFGLITSLLALKLNAKISILI 178
>gi|171920804|ref|ZP_02931987.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903568|gb|EDT49857.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (596 aa)
Score = 104, Expect = 2.6e-02, Identities = 45/189 (23%), Positives = 95/189 (50%)
  Q:    25 FNKKFFCFSF--KLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVM 213
           FN  F    F  + +  K + YI   +   I+    IIV  V ++    L       +F +    +     A+ +F+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   D     L ++    +  ++FG + +++++ L    S+LI + ++F+ ++A  + + ++
  S:     7 FNSSFAYVGFLTRHIIVKKTTYILPIITFLIMLIVGIIVGCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSLISFLGLLIF-YLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPL-VSFVPLLAVGIVSNIV 196
>gi|188568748|ref|ZP_03005495.1| hypothetical protein Uurealyserovar_01370 [Ureaplasma urealyticum serovar 2] >gi|188592562|ref|ZP_03005880.1| hypothetical protein Uureaserovar_01380 [Ureaplasma urealyticum serovar 10] (592 aa)
Score = 102, Expect = 4.1e-02, Identities = 45/189 (23%), Positives = 94/189 (49%)
  Q:    25 FNKKFFCFSF--KLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVM 213
           FN  F    F  + +  K + YI   +   I     IIV  V ++    L       +F +    +     A+ +F+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   D     L ++    +  ++FG + +++++ L    S+LI + ++F+ ++A  + + ++
  S:     3 FNSSFAYVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSLISFLGLLIF-YLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPL-VSFVPLLAVGIVSNIV 192
>gi|188024353|ref|ZP_02997024.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039343|ref|ZP_02998120.1| hypothetical protein Uures_01215 [Ureaplasma urealyticum serovar 8] >gi|188518702|ref|ZP_03004128.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188531103|ref|ZP_03005342.1| hypothetical protein Uurese_01000009_0200003488 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188018619|gb|EDU56659.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997703|gb|EDU66800.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (592 aa)
Score = 102, Expect = 4.1e-02, Identities = 45/189 (23%), Positives = 94/189 (49%)
  Q:    25 FNKKFFCFSF--KLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVM 213
           FN  F    F  + +  K + YI   +   I     IIV  V ++    L       +F +    +     A+ +F+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   D     L ++    +  ++FG + +++++ L    S+LI + ++F+ ++A  + + ++
  S:     3 FNSSFAYVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSLISFLGLLIF-YLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPL-VSFVPLLAVGIVSNIV 192
>gi|185178700|ref|ZP_02964520.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|195867364|ref|ZP_03079368.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209293|gb|EDU06336.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|195660840|gb|EDX54093.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (596 aa)
Score = 102, Expect = 4.1e-02, Identities = 45/189 (23%), Positives = 94/189 (49%)
  Q:    25 FNKKFFCFSF--KLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVM 213
           FN  F    F  + +  K + YI   +   I     IIV  V ++    L       +F +    +     A+ +F+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   D     L ++    +  ++FG + +++++ L    S+LI + ++F+ ++A  + + ++
  S:     7 FNSSFAYVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYVMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSLISFLGLLIF-YLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPL-VSFVPLLAVGIVSNIV 196
>gi|188524135|ref|ZP_03004208.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659940|gb|EDX53320.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (592 aa)
Score = 101, Expect = 4.9e-02, Identities = 45/189 (23%), Positives = 94/189 (49%)
  Q:    25 FNKKFFCFSF--KLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLG-MGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVM 213
           FN  F    F  + +  K + YI   +   I     IIV  V ++    L       +F +    +     A+ +F+   +DG ++L +SKPISRK IV+ K+  F++  ++ S++  +G+  F YL   +   D     L ++    +  ++FG + +++++ L    S+LI + ++F+ ++A  + + ++
  S:     3 FNSSFAYVGFLTRHIIVKKTTYILPIITFLITLIVGIIVGCVVNQKSQFLIISYIMIIFNLLMTTIFASLKALNVFKDFSEDGIDILVISKPISRKNIVWSKIFFFILTGVVWSLISFLGLLIF-YLISFNFAKDVNYYWLLSYISPFICYLVFGLLTSLLALKLNAKISVLIPL-VSFVPLLAVGIVSNIV 192
>gi|124006182|ref|ZP_01691018.1| membrane protein, putative [Microscilla marina ATCC 23134] >gi|123988359|gb|EAY28012.1| membrane protein, putative [Microscilla marina ATCC 23134] (500 aa)
Score = 98, Expect = 1.2e-01, Identities = 50/191 (26%), Positives = 84/191 (43%)
  Q:    32 FSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGT--------VVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSD 222
           +   L+   +  Y+GI VYL             AD+  +S +   T    L+F + +    I   +     + GT  L  S+ +S + +V  K     +Y LI     +GI+ FT+L  L+     T ++ G   GT        ++   IF SIV I SI++K  +  L+S      L+   M+T   +P     ++D
  S:   114 YPLSLIDPGVDRYLGISVYLEAHKRNEAQFMAAADQTGLSRFGSITPDFVLLFLIPLFIILIGHNVVSKEHEKGTLRLVKSQGVSMRSLVAGKW--LGMYALI-----LGITGFTFLM-LTIFLSQTNVLTGLDWGTFGLVFFTYLIYYAIFNSIVLIGSIHIKHASLSLVS------LLAIWMITCLALPKASTTITD 298
>gi|71893818|ref|YP_279264.1| hypothetical protein MHJ_0467 [Mycoplasma hyopneumoniae J] >gi|71851945|gb|AAZ44553.1| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (593 aa)
Score = 94, Expect = 3.6e-01, Identities = 34/171 (19%), Positives = 75/171 (43%)
  Q:    26 NKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISV 196
           + ++F F FKL   K  +Y+ I +   +    ++I    A +   SL++     + L  ++ ++  Y+ + IF+       +++T  KP SR+  +  KL     + ++ SV    +    Y+ +        + +L  F  +  + +IFG++  +         S+ I+V
  S:    13 SNQYFRFLFKLSFKKKVIYVFITLSFLMTMMLALIAKFYATEKSFSLFSFIILFINLSLTI-IIASYMFLSIFKDLSTSSVDIITFIKPYSRQYFILTKLLFLTFFGILWSVFISFLLVSFYMINFKYLGQVNSPLLWGFLSSFFSFMIFGAMTALFGNKFSSKLSLSIAV 182
>gi|72080802|ref|YP_287860.1| hypothetical protein MHP7448_0470 [Mycoplasma hyopneumoniae 7448] >gi|71913926|gb|AAZ53837.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (593 aa)
Score = 94, Expect = 3.6e-01, Identities = 34/171 (19%), Positives = 75/171 (43%)
  Q:    26 NKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISV 196
           + ++F F FKL   K  +Y+ I +   +    ++I    A +   SL++     + L  ++ ++  Y+ + IF+       +++T  KP SR+  +  KL     + ++ SV    +    Y+ +        + +L  F  +  + +IFG++  +         S+ I+V
  S:    13 SNQYFRFLFKLSFKKKVIYVFITLSFLMTMMLALIAKFYATEKSFSLFSFIILFINLSLTI-IIASYMFLSIFKDLSTSSVDIITFIKPYSRQYFILTKLLFLTFFGILWSVFISFLLVSFYMINFKYLGQVNSPLLWGFLSSFFSFMIFGAMTALFGNKFSSKLSLSIAV 182
>gi|54020528|ref|YP_115978.1| hypothetical protein mhp468 [Mycoplasma hyopneumoniae 232] >gi|53987701|gb|AAV27902.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (593 aa)
Score = 94, Expect = 3.7e-01, Identities = 34/171 (19%), Positives = 75/171 (43%)
  Q:    26 NKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISV 196
           + ++F F FKL   K  +Y+ I +   +    ++I    A +   SL++     + L  ++ ++  Y+ + IF+       +++T  KP SR+  +  KL     + ++ SV    +    Y+ +        + +L  F  +  + +IFG++  +         S+ I+V
  S:    13 SNQYFRFLFKLSFKKKVIYVFITLSFLMTMMLALIAKFYATEKSFSLFSFIILFINLSLTI-IIASYMFLSIFKDLSTSSVDIITFIKPYSRQYFILTKLLFLTFFGILWSVFISFLLVSFYMINFKYLGQVNSPLLWGFLSSFFSFMIFGAMTALFGNKFSSKLSLSIAV 182
>gi|42560871|ref|NP_975322.1| ABC transporter, permease component (Na+?) [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492368|emb|CAE76964.1| ABC transporter, permease component (Na+?) [Mycoplasma mycoides subsp. mycoides SC str. PG1] (610 aa)
Score = 94, Expect = 4.0e-01, Identities = 37/140 (26%), Positives = 70/140 (50%)
  Q:    79 TMFLMFSVAVVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVN 218
           T+ L+ +  V +   ++ IF+   ++G E++T+SKPISRK IV  KL     + L+ S + + I     L  + +  D     L     ++V  ++ G +V ++S  L +  SM I + L   L++   + +  + + VN
  S:    57 TIALILTTVVFSSIKSLNIFKDLENEGIEIITLSKPISRKNIVLGKLASLTFFGLLWSFV-LFICGLISLYAIHSFKDLILYSLLLMFVSLVTYLMVGLLVALLSNKLNQKISMTIPLVLFVPLILTGSIISANVSSNVN 195
>gi|119508935|ref|ZP_01628087.1| hypothetical protein N9414_21185 [Nodularia spumigena CCY9414] >gi|119466464|gb|EAW47349.1| hypothetical protein N9414_21185 [Nodularia spumigena CCY9414] (259 aa)
Score = 91, Expect = 7.7e-01, Identities = 46/173 (26%), Positives = 84/173 (48%)
  Q:    51 LFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVA-------VVTCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVK-LTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVN--NLSDN 223
           L+II  Y+I++  +A +        +   MFL F +        +V  +I   +    ID  T L+ ++KP+SR EI+  K L +  +  ++++V+ +    F  + ++  ++ S  I            ++  S++T ++I     TS L++V L F    A  L   + P  VN   LSDN
  S:    23 LYIIGFYAILLA-IALRVLPEFAAATEDKMFLDFGLGAMSAVCLIVAIFIGTGLVNKEIDKRTILVLIAKPVSRSEIIAGKFLGLSAVLAVLVAVMTILYLGFLQIGNIPHSALSILIAASFL-------VLQLSLITAVAITFGVFTSSLLAVTLTF----AVYLMGNITPDLVNLGRLSDN 193
>gi|83319360|ref|YP_424746.1| ABC transporter, permease protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283246|gb|ABC01178.1| ABC transporter, permease protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (621 aa)
Score = 91, Expect = 8.2e-01, Identities = 56/203 (27%), Positives = 91/203 (44%)
  Q:    23 SIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVVTCYI-AIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNSK 225
           SIF    F F F ++  K S  + IF  +F I    +I   V D+  ++L   S   +FL+  + V+   I ++ IF+    +G E+++ SKPISR  ++  KL     Y LI S     I   ++L  L  N     ++L +     V  I +  I  I +I   K+T     + L   L++   L+   M    N  S+ +K
  S:     4 SIFKYCQFAF-FTILYKKSSYLLPIFTLVFSIII-GLIFKFVIDEKYLALS--SYLYIFLLLIITVIFSAIKSLNIFKDLDQEGLEIISFSKPISRNSLILGKLLCLSFYGLIWS----SILLISFLVSLYANYSFINLILTSLLLWFVGLITYLLISLITAILSYKLTQ---KIALTIPLVLFIFLSIIGMVLSSNTTSNLNK 196
>gi|42561436|ref|NP_975887.1| hypothetical protein MSC_0919 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492935|emb|CAE77529.1| Conserved hypothetical transmembrane protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (487 aa)
Score = 91, Expect = 8.4e-01, Identities = 49/203 (24%), Positives = 96/203 (47%)
  Q:    22 FSIFNKKFFCFSFKLMASKISVYIGIFVYLFIIACYSIIVPRVADKAPISLYNLSTSTMFLMFSVAVV-TCYIAIEIFRTGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTYLDDLSTNSDSTTIMLGTFTGTVVNGIIFGSIVTIISIYLKKITSMLISVGLAFILMMATMLTAFVMPTPVNNLSDNS 224
            + F    F F + ++  K S+ + IF  L       +I+  V +   + L  LS   +F++ ++ VV +C  A+ IF+    +G E++++SKP++R+ ++  KL     + LI S L + IS+F  L  + +        L      ++  ++F     ++S  L +  SM+I     F+L +   LT  ++   V +  D +
  S:     3 LNFFKYSQFAF-YTILKKKSSIILPIFT-LISSLIIGLILKFVVNNKYVEL--LSFLYVFILITLTVVFSCIKALNIFKDLEQEGLEIISLSKPLTRESLIIGKLLCLTFFGLIWS-LTLLISSFLSLYAVYSFLYLFLTSLLLGFVGLITYLLFSLFTVLLSYKLAQKISMII----PFVLFIPLSLTGMILSINVKSNVDQA 197
>gi|118587369|ref|ZP_01544795.1| ABC transporter, permease [Oenococcus oeni ATCC BAA-1163] >gi|118432193|gb|EAV38933.1| ABC transporter, permease [Oenococcus oeni ATCC BAA-1163] (545 aa)
Score = 90, Expect = 9.9e-01, Identities = 38/125 (30%), Positives = 67/125 (53%)
  Q:    79 TMFLMFSVAVVTCYIAIEIFR--TGIDDGTELLTVSKPISRKEIVFVKLTIFLIYVLIISVLGMGISAFTY--LDDLSTNSDSTTIMLGT-FTGTVVNGIIFGSIVTIISIYLKKITSML-ISVGLAFILM 203
           +M  +F + + T      IFR    ID+G E +  SKPISR    F  LT +L+  +I+++   G S ++   L +L       +I   T F G++ + ++F S+   +     KI S+L +  GL+F+++
  S:   361 SMISIFMLVLSTVAGLQMIFRLKKDIDNGLEEMIASKPISR----FRLLTSYLLPAIIVTICSFGSSIYSMMLLGNLELKVPIESIKFNTLFFGSLPSAMLFLSLAVFLINCFPKIYSILYVYAGLSFVVL 487