>gi|26553485|ref|NP_757419.1| hypothetical protein MYPE330 [Mycoplasma penetrans HF-2] >gi|26453491|dbj|BAC43823.1| hypothetical protein [Mycoplasma penetrans HF-2] (338 aa)
Score = 955, Expect = 2.1e-101, Identities = 338/338 (100%), Positives = 338/338 (100%)
  Q:     1 MYRNKKKMIIVGATSVGVLAVFGVSAWAIINQSYKTPLDSVSGARVSGATVFLGDNGQFQYGKMSFNDWLIYNYAHKIDVARSGSTTTYTFYSRAASPTTGGTGGTGGGTTQAAEYVFATLAYDSSNNSYLLKTGSNQDFELVNSTITGTSSDSSFGVANNYSSWSSTTSLNQSFTFNQGSDSSTHIYSGANYSISYSKATSTGGGSGTSTNTTTYTTRVTSTATNSTLWERTMVIPGAGDTSTATRTTYTSATLGGSLTITYTPTATDGNITSYTVAYTSNTTSGGTGGGTGGSTVASQSQLFTFLGITSTSNTKADFSQSRLSSEDYFLYLPDMTL 338
           MYRNKKKMIIVGATSVGVLAVFGVSAWAIINQSYKTPLDSVSGARVSGATVFLGDNGQFQYGKMSFNDWLIYNYAHKIDVARSGSTTTYTFYSRAASPTTGGTGGTGGGTTQAAEYVFATLAYDSSNNSYLLKTGSNQDFELVNSTITGTSSDSSFGVANNYSSWSSTTSLNQSFTFNQGSDSSTHIYSGANYSISYSKATSTGGGSGTSTNTTTYTTRVTSTATNSTLWERTMVIPGAGDTSTATRTTYTSATLGGSLTITYTPTATDGNITSYTVAYTSNTTSGGTGGGTGGSTVASQSQLFTFLGITSTSNTKADFSQSRLSSEDYFLYLPDMTL
  S:     1 MYRNKKKMIIVGATSVGVLAVFGVSAWAIINQSYKTPLDSVSGARVSGATVFLGDNGQFQYGKMSFNDWLIYNYAHKIDVARSGSTTTYTFYSRAASPTTGGTGGTGGGTTQAAEYVFATLAYDSSNNSYLLKTGSNQDFELVNSTITGTSSDSSFGVANNYSSWSSTTSLNQSFTFNQGSDSSTHIYSGANYSISYSKATSTGGGSGTSTNTTTYTTRVTSTATNSTLWERTMVIPGAGDTSTATRTTYTSATLGGSLTITYTPTATDGNITSYTVAYTSNTTSGGTGGGTGGSTVASQSQLFTFLGITSTSNTKADFSQSRLSSEDYFLYLPDMTL 338
>gi|169234732|ref|NP_001007209.2| coagulation factor V [Danio rerio] >gi|169145580|emb|CAC94896.2| novel protein similar to vertebrate coagulation factor V and VIII [Danio rerio] (2101 aa)
Score = 103, Expect = 1.6e-02, Identities = 54/201 (26%), Positives = 98/201 (48%)
  Q:   120 TLAYDSSNNSYLL----KTGSNQDFELVNSTITGTSSDSSF-GVANNYSSWSSTTSLNQSFTFNQGSDSSTHIYSGANYSISYSKATSTGGGSGTSTNTTTYTTRVTSTATNSTLWERTMVIPGAGDTSTATRTTYTSATLGGS--LTITYTPTATDGNITSYTVAYTSNTTSGGTGGGTGGSTVASQSQLFTFLGITSTSNTK-ADFS 320
           T+ YD S    +     +T  +Q+      T +G     S   + + ++  SS+   N S   N+ S+ +  + S A +S S + ATS+       ++T T+     +T +N+T  + +  I    D+S AT +  ++ATL  S   T++ +  AT  + ++ T++ +SN T   +   T      S S   T  G++ +SNT  +DFS
  S:   997 TMEYDVSQKDTVKGESKETAQSQELSSTKKTYSGEIILESLPDITSAFNLNSSSVLRNNSLESNESSNETLFMSSNATFSDS-TNATSS------DSSTATFADFSNTTFSNATFSDFSNRISQMSDSSNATLSDSSNATLSDSSNATLSDSSNATLSDSSNATLSNSSNATFSDSSNKT-----FSDSSNATLFGVSYSSNTTLSDFS 1193