>gi|26553486|ref|NP_757420.1| hypothetical protein MYPE340 [Mycoplasma penetrans HF-2] >gi|26453492|dbj|BAC43824.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (117 aa)
Score = 432, Expect = 2.0e-41, Identities = 117/117 (100%), Positives = 117/117 (100%)
  Q:     1 MKENIKKLYNDILERKFSKNMSAGYEPLEVDIFLDSVRSALVGIDKEQRSLYQDLNQKNQEILDLKNIINQKDSIIQSLRADNESLKKDGYQSQKLMNDLGKLHVAVSELQNGKNNK 117
           MKENIKKLYNDILERKFSKNMSAGYEPLEVDIFLDSVRSALVGIDKEQRSLYQDLNQKNQEILDLKNIINQKDSIIQSLRADNESLKKDGYQSQKLMNDLGKLHVAVSELQNGKNNK
  S:     1 MKENIKKLYNDILERKFSKNMSAGYEPLEVDIFLDSVRSALVGIDKEQRSLYQDLNQKNQEILDLKNIINQKDSIIQSLRADNESLKKDGYQSQKLMNDLGKLHVAVSELQNGKNNK 117
>gi|71022901|ref|XP_761680.1| hypothetical protein UM05533.1 [Ustilago maydis 521] >gi|46101157|gb|EAK86390.1| hypothetical protein UM05533.1 [Ustilago maydis 521] (1576 aa)
Score = 90, Expect = 1.0e-01, Identities = 31/112 (27%), Positives = 54/112 (48%)
  Q:     3 ENIKKLYNDILERKFSKNMSAGYEPLEVDIFLDSVRSALVGIDKEQRSLYQDLNQKNQEILDLKNIINQKDSIIQSLRADNESLKKDGYQSQKLMNDLGKLHVAVSELQNGK 114
           E   KL  D+ ER+  +  S   + L  ++  D   S L  +  E+  L Q L +  +++ D+K  +N   +  +SL+   E L+KD  Q QK +  + K  +A +E +  K
  S:   605 ETETKLVKDLEERQ--QKQSVELKELRENVIRD--ESELSALKAEKDELEQALMRDREDVRDMKKRMNDVQAETKSLKEQLEKLRKDARQ-QKGLVAISKKQLATAEAEQDK 711
>gi|118053100|ref|ZP_01521645.1| tetratricopeptide TPR_2 [Comamonas testosteroni KF-1] >gi|117999406|gb|EAV13565.1| tetratricopeptide TPR_2 [Comamonas testosteroni KF-1] (253 aa)
Score = 84, Expect = 4.5e-01, Identities = 22/68 (32%), Positives = 33/68 (48%)
  Q:    35 DSVRSALVGIDKEQRSLYQDLNQKNQEILDLKNIINQKDSIIQSLRADNESLKKDGYQSQKLMNDLGK 102
           D  R A++ + +   SL Q   Q  + +LDL++ I    S    LR  NE L +D  + Q+   DL K
  S:    38 DEARRAIIELRQRVDSLQQSQEQTRRSLLDLQSQIESLKSDQAKLRGQNEQLTRDAAELQRGQKDLAK 105
>gi|15229868|ref|NP_187791.1| unknown protein [Arabidopsis thaliana] >gi|42572387|ref|NP_974289.1| unknown protein [Arabidopsis thaliana] >gi|6671941|gb|AAF23201.1|AC016795_14 hypothetical protein [Arabidopsis thaliana] >gi|20466598|gb|AAM20616.1| unknown protein [Arabidopsis thaliana] >gi|22136430|gb|AAM91293.1| unknown protein [Arabidopsis thaliana] (504 aa)
Score = 81, Expect = 9.2e-01, Identities = 25/86 (29%), Positives = 50/86 (58%)
  Q:     2 KENIKKLYNDILERKFSKNMSAGYEPLEVDIFLDSVRSALVGIDKE----QRSLYQDLNQKNQEILDLKNIINQKDSIIQSLRADNESLK 87
           ++ I+ LY+++ + + + + +A     E    + ++      ID E    QRS+ + LN +NQEI  L+N++ Q+D  IQ+L  + ++ K
  S:    73 QQTIQDLYHELEQERIASSTAAD----ETVKMIQTLEREKAKIDLELKQLQRSVDETLNYENQEIEALENMVYQRDQTIQALTFETQAYK 158