>gi|26553487|ref|NP_757421.1| holo-acyl carrier protein synthase [Mycoplasma penetrans HF-2] >gi|26453493|dbj|BAC43825.1| holo-acyl carrier protein synthase [Mycoplasma penetrans HF-2] (120 aa)
Score = 481, Expect = 4.3e-47, Identities = 119/120 (99%), Positives = 120/120 (100%)
  Q:     1 VNYKMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAIYLN 120
           +NYKMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAIYLN
  S:     1 MNYKMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAIYLN 120
>gi|161511506|ref|NP_853187.2| 4'-phosphopantetheinyl transferase [Mycoplasma gallisepticum R] >gi|61211598|sp|Q7NB74|ACPS_MYCGA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) (111 aa)
Score = 162, Expect = 3.7e-10, Identities = 44/102 (43%), Positives = 69/102 (67%)
  Q:    16 IGIDVTKIDYF-VNKSDKFIKRLLTDNEYNQYLK-IDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVK--VSISYDGNQVFATAI 117
           +GIDV  ID F   KSD+FIK+LLT++E N+Y   I  + +  FLA RW+LKEA FKA+  + +  F  +E I+  + +Y C+  + +K  +SIS++G ++ A A+
  S:     5 VGIDVVSIDRFQAKKSDEFIKKLLTEHEQNKYKTVIGESNQNIFLAIRWSLKEAIFKALKTWDE--FTQLE-IRKIHGAYECSLNEKIKLHLSISHEGQRLVAMAV 107
>gi|12045065|ref|NP_072876.1| 4'-phosphopantetheinyl transferase [Mycoplasma genitalium G37] >gi|6225001|sp|Q9ZB79|ACPS_MYCGE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|3844819|gb|AAC71438.1| holo-(acyl-carrier-protein) synthase [Mycoplasma genitalium G37] >gi|166078942|gb|ABY79560.1| holo-(acyl-carrier-protein) synthase [synthetic Mycoplasma genitalium JCVI-1.0] (114 aa)
Score = 159, Expect = 9.5e-10, Identities = 45/104 (43%), Positives = 58/104 (55%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAIYL 119
           IGIDV ++  F   V  SD F KRLLT NE N Y K++NN +  FLA  W LKEA +KA +   K  F  +E  K  NN Y C   +N+ + +S        +AI L
  S:     5 IGIDVVQLKRFLTLVETSDCFAKRLLTSNELNSYWKLNNNQRANFLAVHWTLKEAIYKATSHI-KPLFTKLEIYKL-NNQYRCEFIQNINLLLSVSYTNCHVSAICL 109
>gi|31541454|gb|AAP56755.1| AcpS [Mycoplasma gallisepticum R] (116 aa)
Score = 158, Expect = 1.0e-09, Identities = 44/102 (43%), Positives = 69/102 (67%)
  Q:    16 IGIDVTKIDYF-VNKSDKFIKRLLTDNEYNQYLK-IDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVK--VSISYDGNQVFATAI 117
           +GIDV  ID F   KSD+FIK+LLT++E N+Y   I  + +  FLA RW+LKEA FKA+  + +  F  +E I+  + +Y C+  + +K  +SIS++G ++ A A+
  S:    10 VGIDVVSIDRFQAKKSDEFIKKLLTEHEQNKYKTVIGESNQNIFLAIRWSLKEAIFKALKTWDE--FTQLE-IRKIHGAYECSLNEKIKLHLSISHEGQRLVAMAV 112
>gi|144574962|gb|AAZ43519.2| holo-acyl-carrier protein synthase [Mycoplasma synoviae 53] (101 aa)
Score = 137, Expect = 2.8e-07, Identities = 44/103 (42%), Positives = 64/103 (62%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           N+G+D+  I  F NK+ +FI+RLL++ E  ++ K+DN   K  FLA  WA+KEA FKA N + K   IN+  I N+ N      FKN K+SIS++ + + A  I
  S:     2 NLGVDLVTISRFKNKNKEFIERLLSEEELVEFNKLDNEESKELFLARSWAIKEAIFKADNSYFKFNKINLIKINNEWN------FKNFKISISHENDLLIAFVI 99
>gi|47459314|ref|YP_016176.1| holo-acyl carrier protein synthase [Mycoplasma mobile 163K] >gi|61211502|sp|Q6KHG5|ACPS_MYCMO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|47458644|gb|AAT27965.1| holo-acyl carrier protein synthase [Mycoplasma mobile 163K] (107 aa)
Score = 135, Expect = 4.9e-07, Identities = 42/102 (41%), Positives = 64/102 (62%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           IG+D+TKI  F NKS+KF KR+L+  E+ ++   + N    FLA+RWA+KEA +KA N F +   IN   +K DN  +    F+N  +S+S++G+ + A  I
  S:     7 IGVDLTKISRFKNKSEKFAKRILSHEEFEKW---EINKDHSFLATRWAIKEAIYKADNNFFEFSKIN---VKKDNYYW----FQNFYISVSHEGDLIIAFVI 98
>gi|15828584|ref|NP_325944.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Mycoplasma pulmonis UAB CTIP] >gi|20137428|sp|Q98R97|ACPS_MYCPU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|14089526|emb|CAC13286.1| HOLO-[ACYL-CARRIER PROTEIN] SYNTHASE (HOLO-ACP SYNTHASE) [Mycoplasma pulmonis] (108 aa)
Score = 133, Expect = 1.0e-06, Identities = 39/99 (39%), Positives = 54/99 (54%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFA 114
           IG+D+ KI+   NKSD F++++L+ +EY  Y K     K  FLA+RWA+KEA FKA N+     F  I   K DN       F    +S+S +   V A
  S:     6 IGVDLVKIERLENKSDHFVRKILSLDEYELYQK--TKAKAIFLATRWAIKEALFKADNQ--HFCFKKINITKKDN----VYKFDGFAISVSSEKEYVIA 96
>gi|13508037|ref|NP_109986.1| 4'-phosphopantetheinyl transferase [Mycoplasma pneumoniae M129] >gi|6225002|sp|P75480|ACPS_MYCPN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|1674234|gb|AAB96186.1| holo-acyl-carrier protein synthase-like protein [Mycoplasma pneumoniae M129] (119 aa)
Score = 131, Expect = 1.7e-06, Identities = 41/102 (40%), Positives = 58/102 (56%)
  Q:    16 IGIDVTKIDYF---VNKSDK-FIKRLLTDNEYNQYLKI-DNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVK--VSISYDGNQVFATAI 117
           IGID+ +I  F     ++D  F KRLLT  EY  Y K+  ++ K  FLA  W+LKEA +KA+N   K  F  +E  K  N  Y C     ++  +S+SY  N + A  +
  S:     5 IGIDLVEIKRFEQLARQTDNCFAKRLLTSTEYAHYAKLRKDSEKSSFLAVHWSLKEAIYKAVNHI-KPLFSQLEITKK-NQRYNCQIDPKIELLLSVSYSSNNITAICL 111
>gi|14719536|pdb|1F7T|A Chain A, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719537|pdb|1F7T|B Chain B, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719538|pdb|1F7T|C Chain C, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719539|pdb|1F7T|D Chain D, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719540|pdb|1F7T|E Chain E, Holo-(Acyl Carrier Protein) Synthase At 1.8a >gi|14719541|pdb|1F7T|F Chain F, Holo-(Acyl Carrier Protein) Synthase At 1.8a (122 aa)
Score = 121, Expect = 2.2e-05, Identities = 34/103 (33%), Positives = 54/103 (52%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNS--YTCTTFKNVKVSISYDGNQVFATA 116
           + IG+D+T   +I     +  +F +R+LT +E +QY ++    K  FLA R+A KEA  KA       ++ F +IE  K+ N      CT      V +S    + +A A
  S:     4 YGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSPAAVHVSITHTKEYAAA 113
>gi|16077529|ref|NP_388343.1| 4'-phosphopantetheinyl transferase [Bacillus subtilis subsp. subtilis str. 168] >gi|6225000|sp|P96618|ACPS_BACSU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|1881272|dbj|BAA19299.1| ydcB [Bacillus subtilis] >gi|2632762|emb|CAB12269.1| holo-acyl carrier protein synthase [Bacillus subtilis subsp. subtilis str. 168] (121 aa)
Score = 121, Expect = 2.5e-05, Identities = 34/103 (33%), Positives = 54/103 (52%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNS--YTCTTFKNVKVSISYDGNQVFATA 116
           + IG+D+T   +I     +  +F +R+LT +E +QY ++    K  FLA R+A KEA  KA       ++ F +IE  K+ N      CT      V +S    + +A A
  S:     3 YGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAA 112
>gi|14719507|pdb|1F80|A Chain A, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) >gi|14719508|pdb|1F80|B Chain B, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) >gi|14719509|pdb|1F80|C Chain C, Holo-(Acyl Carrier Protein) Synthase In Complex With Holo- (Acyl Carrier Protein) (120 aa)
Score = 121, Expect = 2.6e-05, Identities = 34/103 (33%), Positives = 54/103 (52%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNS--YTCTTFKNVKVSISYDGNQVFATA 116
           + IG+D+T   +I     +  +F +R+LT +E +QY ++    K  FLA R+A KEA  KA       ++ F +IE  K+ N      CT      V +S    + +A A
  S:     2 YGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEARKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAA 111
>gi|14719535|pdb|1F7L|A Chain A, Holo-(Acyl Carrier Protein) Synthase In Complex With Coenzyme A At 1.5a (121 aa)
Score = 120, Expect = 2.9e-05, Identities = 34/103 (33%), Positives = 54/103 (52%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNS--YTCTTFKNVKVSISYDGNQVFATA 116
           + IG+D+T   +I     +  +F +R+LT +E +QY ++    K  FLA R+A KEA  KA       ++ F +IE  K+ N      CT      V +S    + +A A
  S:     3 YGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSPAAVHVSITHTKEYAAA 112
>gi|71894122|ref|YP_278230.1| holo-acyl-carrier protein synthase [Mycoplasma synoviae 53] (95 aa)
Score = 118, Expect = 5.1e-05, Identities = 41/95 (43%), Positives = 58/95 (61%)
  Q:    23 IDYFVNKSDKFIKRLLTDNEYNQYLKIDNN-LKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           I  F NK+ +FI+RLL++ E  ++ K+DN   K  FLA  WA+KEA FKA N + K   IN+  I N+ N      FKN K+SIS++ + + A  I
  S:     4 ISRFKNKNKEFIERLLSEEELVEFNKLDNEESKELFLARSWAIKEAIFKADNSYFKFNKINLIKINNEWN------FKNFKISISHENDLLIAFVI 93
>gi|42518358|ref|NP_964288.1| acyl carrier protein synthase [Lactobacillus johnsonii NCC 533] >gi|61211576|sp|Q74LB3|ACPS_LACJO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|41582643|gb|AAS08254.1| acyl carrier protein synthase [Lactobacillus johnsonii NCC 533] (119 aa)
Score = 117, Expect = 6.2e-05, Identities = 34/102 (33%), Positives = 58/102 (56%)
  Q:    16 IGID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           +GID   V ++   V K DKF KR+LT  E+ QY ++    K  +L  R++LKE+  KA+       + F +IE + +D      T+ K   N+  SI++D +++    +
  S:     5 VGIDSVEVERMKKIVEKGDKFAKRVLTPKEFEQYQQLKGKRKVEYLGGRFSLKESFSKAMGTGLGKYVGFQDIETLWDDLGHPVMTSTKFSGNIFPSITHDDHEIITVVV 114
>gi|55821699|ref|YP_140141.1| 4'-phosphopantetheinyl transferase [Streptococcus thermophilus LMG 18311] >gi|55823620|ref|YP_142061.1| 4'-phosphopantetheinyl transferase [Streptococcus thermophilus CNRZ1066] >gi|81558969|sp|Q5LY70|ACPS_STRT1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|81560158|sp|Q5M2S6|ACPS_STRT2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|55737684|gb|AAV61326.1| holo-(acyl carrier protein) synthase [Streptococcus thermophilus LMG 18311] >gi|55739605|gb|AAV63246.1| holo-(acyl carrier protein) synthase [Streptococcus thermophilus CNRZ1066] (119 aa)
Score = 117, Expect = 7.4e-05, Identities = 37/104 (35%), Positives = 60/104 (57%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           F  GID+ +I       +++ +F K++LT  E+ ++  +    +  FLA RWA KEA  KA       + F +IE + ND  +   T + F+ NV +SIS+ G+ V A+ I
  S:     3 FGHGIDLQEISAVKKAYDRNPRFAKKVLTPKEWERFESLSGERQMSFLAGRWAGKEAFSKAWGTGIGAVGFKDIEILNNDKGAPVVTQSPFEGNVFISISHSGDFVQASVI 113
>gi|104773513|ref|YP_618493.1| Holo-[acyl-carrier protein] synthase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|122984014|sp|Q1GBP7|ACPS_LACDA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|103422594|emb|CAI97197.1| Holo-[acyl-carrier protein] synthase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (137 aa)
Score = 116, Expect = 8.0e-05, Identities = 31/103 (30%), Positives = 60/103 (58%)
  Q:    15 NIGID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTT---FKNVKVSISYDGNQVFATAI 117
           NIG+D   V +I   V++ D F +++LTD E+ QY  + +  K  +L  R+A+KEA  KA        + F ++E ++ ++ +   T+      +  SI++D +++ A  +
  S:     4 NIGVDQIEVDRIAKVVDRGDGFARKVLTDREFAQYQDLTHKRKIEYLGGRFAIKEAFSKAWGTGIGQAVSFEDVETLRTESGAPVTTSRIFTGRIFSSIAHDDHEIVAVVV 114
>gi|116513508|ref|YP_812414.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275722|sp|Q04C46|ACPS_LACDB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116092823|gb|ABJ57976.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (137 aa)
Score = 116, Expect = 8.0e-05, Identities = 31/103 (30%), Positives = 60/103 (58%)
  Q:    15 NIGID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTT---FKNVKVSISYDGNQVFATAI 117
           NIG+D   V +I   V++ D F +++LTD E+ QY  + +  K  +L  R+A+KEA  KA        + F ++E ++ ++ +   T+      +  SI++D +++ A  +
  S:     4 NIGVDQIEVDRIAKVVDRGDGFARKVLTDREFAQYQDLTHKRKIEYLGGRFAIKEAFSKAWGTGIGQAVSFEDVETLRTESGAPVTTSRIFTGRIFSSIAHDDHEIVAVVV 114
>gi|58336607|ref|YP_193192.1| holo-acyl-carrier protein [Lactobacillus acidophilus NCFM] >gi|75433045|sp|Q5FMB3|ACPS_LACAC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|58253924|gb|AAV42161.1| holo-acyl-carrier protein [Lactobacillus acidophilus NCFM] (118 aa)
Score = 116, Expect = 8.2e-05, Identities = 31/100 (31%), Positives = 58/100 (57%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           I+V ++   ++K D F K++LT NE+ QY K++   K  +L  R++LKE+  KA+       + F +IE + +D      T+ K   N+  SI++D +++    +
  S:    10 IEVERVKKIIDKGDLFAKKVLTPNEFAQYQKLEGKRKVEYLGGRFSLKESFSKAMGTGLGKSVGFQDIETLWDDLGHPVMTSTKFDGNIFPSITHDNHEIITFVV 114
>gi|16802926|ref|NP_464411.1| hypothetical protein lmo0885 [Listeria monocytogenes EGD-e] >gi|46907118|ref|YP_013507.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b F2365] >gi|47092093|ref|ZP_00229886.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b H7858] >gi|47094892|ref|ZP_00232506.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 1/2a F6854] >gi|153166203|ref|ZP_01926822.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N1-017] >gi|153178961|ref|ZP_01932248.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes F6900] >gi|153185406|ref|ZP_01935993.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J0161] >gi|153190278|ref|ZP_01937700.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J2818] >gi|153197805|ref|ZP_01942017.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes 10403S] >gi|153201586|ref|ZP_01943395.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes HPB2262] >gi|167014248|ref|ZP_02276781.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J1-194] >gi|167053018|ref|ZP_02279416.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL F2-515] >gi|167211821|ref|ZP_02282128.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes LO28] >gi|167214077|ref|ZP_02284384.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL R2-503] >gi|167453556|ref|ZP_02319779.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J2-064] >gi|20137363|sp|Q8Y8L2|ACPS_LISMO Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797787|sp|Q721T0|ACPS_LISMF Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|16410288|emb|CAC98963.1| lmo0885 [Listeria monocytogenes] >gi|46880385|gb|AAT03684.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b F2365] >gi|47016774|gb|EAL07693.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 1/2a F6854] >gi|47019533|gb|EAL10273.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes str. 4b H7858] >gi|126941972|gb|EBA19844.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J0161] >gi|127632764|gb|EBA22206.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes 10403S] >gi|127766210|gb|EBA26552.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes J2818] >gi|133727719|gb|EBA29417.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N1-017] >gi|133733649|gb|EBA35347.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes F6900] >gi|133735894|gb|EBA37592.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes HPB2262] (118 aa)
Score = 116, Expect = 8.4e-05, Identities = 36/100 (36%), Positives = 58/100 (57%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHK-IFFINIEFIKNDNNSYTCT----TFKNVKVSISYDGNQVFATAI 117
           ID+ ++   V K+ +FI+R+LT+ E  Q+ K + N K  FLA R+A KEA  KA    F K + F ++E ++ ++     T    + +NV VSI++      A  I
  S:    10 IDLERVKQVVEKNPRFIERVLTEKEIKQFEKYEGNRKIEFLAGRFAAKEAYAKANGTGFGKHLSFTDVEILQVEDGRPHVTLPVKSGENVFVSITHTARSAAAQVI 115
>gi|157151675|ref|YP_001449733.1| 4'-phosphopantetheinyl transferase [Streptococcus gordonii str. Challis substr. CH1] >gi|157076469|gb|ABV11152.1| holo-(acyl-carrier-protein) synthase [Streptococcus gordonii str. Challis substr. CH1] (144 aa)
Score = 115, Expect = 1.1e-04, Identities = 35/101 (34%), Positives = 59/101 (58%)
  Q:    17 GIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+   + I     K+ +F K++LT+ E+ ++ ++    K  +LA RW+ KEA  KA      K+ F ++E + ++  +  +T T F   V VSIS+ G  V A+ I
  S:    30 GIDIEELSSIQRAYEKNARFAKKVLTEKEWFRFEELSGKRKIEYLAGRWSAKEAFSKAWGTGIGKLSFQDLEVLNDERGAPVFTKTPFSGKVWVSISHAGTLVMASVI 137
>gi|116628422|ref|YP_821041.1| 4'-phosphopantetheinyl transferase [Streptococcus thermophilus LMD-9] >gi|122266983|sp|Q03IX7|ACPS_STRTD Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116101699|gb|ABJ66845.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus thermophilus LMD-9] (119 aa)
Score = 115, Expect = 1.1e-04, Identities = 37/104 (35%), Positives = 60/104 (57%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           F  GID+ +I       +++ +F K++LT  E+ ++  +    +  FLA RWA KEA  KA       + F +IE + ND  +   T + F+ NV +SIS+ G+ V A+ I
  S:     3 FGHGIDLQEISAVKKAYDRNPRFAKKVLTPKEWERFESLSGERQMSFLAGRWAGKEAFSKAWGTGIGAVGFKDIEILNNDKGAPVVTQSPFEGNVFISISHSGDFVQASVI 113
>gi|153173817|ref|ZP_01929512.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N3-165] >gi|167403947|ref|ZP_02308762.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J2-003] >gi|168265455|ref|ZP_02687420.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL J2-071] >gi|133730651|gb|EBA32349.1| holo-(acyl-carrier-protein) synthase [Listeria monocytogenes FSL N3-165] (118 aa)
Score = 115, Expect = 1.2e-04, Identities = 35/100 (35%), Positives = 57/100 (56%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHK-IFFINIEFIKNDNN----SYTCTTFKNVKVSISYDGNQVFATAI 117
           ID+ ++   V K+ +FI+R+LT+ E  Q+ K + N K  FLA R+A KEA  KA    F K + F ++E ++ ++     +      +NV VSI++      A  I
  S:    10 IDLERVKQVVEKNPRFIERVLTEKEIKQFEKYEGNRKIEFLAGRFAAKEAYAKANGTGFGKHLSFTDVEILQVEDGRPHVTLPANAGENVFVSITHTARSAAAQVI 115
>gi|116628940|ref|YP_814112.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus gasseri ATCC 33323] >gi|116094522|gb|ABJ59674.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus gasseri ATCC 33323] (125 aa)
Score = 113, Expect = 2.0e-04, Identities = 30/100 (30%), Positives = 56/100 (56%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           ++V ++   V K DKF KR+LT  E+ QY ++    +  +L  R++LKE+  KA+       + F +IE + +D      T+ K   N+  SI++D +++    +
  S:    16 VEVERMKKIVEKGDKFAKRVLTPKEFAQYQQLKGKRRVEYLGGRFSLKESFSKALGTGLGKYVGFQDIETLWDDLGYPVTTSTKFSGNIFASITHDDHEIITGVV 120
>gi|81097174|ref|ZP_00875480.1| Holo-acyl carrier protein synthase:Phosphopantethiene-protein transferase [Streptococcus suis 89/1591] >gi|80976778|gb|EAP40355.1| Holo-acyl carrier protein synthase:Phosphopantethiene-protein transferase [Streptococcus suis 89/1591] (119 aa)
Score = 113, Expect = 2.1e-04, Identities = 35/101 (34%), Positives = 57/101 (56%)
  Q:    17 GIDVTKIDYFVN---KSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +++   +   K   F K++LT+ E+ +Y  +    +  +LA RW+ KEA  KA+     KI F +IE +         T + F  N+ +SIS+ GN V A+ I
  S:     6 GIDLQEMEAIESARIKPQGFPKKILTEKEFERYQSLSGRRQLEYLAGRWSAKEALTKALGTGIGKIGFHDIEILNTSKGVPYVTKSPFDGNIWLSISHSGNFVQASVI 113
>gi|146319467|ref|YP_001199179.1| 4'-phosphopantetheinyl transferase [Streptococcus suis 05ZYH33] >gi|146321664|ref|YP_001201375.1| 4'-phosphopantetheinyl transferase [Streptococcus suis 98HAH33] >gi|166198239|sp|A4W3N6|ACPS_STRS2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198241|sp|A4VXE0|ACPS_STRSY Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|145690273|gb|ABP90779.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus suis 05ZYH33] >gi|145692470|gb|ABP92975.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus suis 98HAH33] (119 aa)
Score = 113, Expect = 2.2e-04, Identities = 35/101 (34%), Positives = 57/101 (56%)
  Q:    17 GIDVTKIDYFVN---KSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +++   +   K   F K++LT+ E+ +Y  +    +  +LA RW+ KEA  KA+     KI F +IE +         T + F  N+ +SIS+ GN V A+ I
  S:     6 GIDLQEMEAIESARIKHQGFPKKILTEKEFERYQSLSGRRQLEYLAGRWSAKEALTKALGTGIGKIGFHDIEILNTSKGVPYVTKSPFDGNIWLSISHSGNFVQASVI 113
>gi|16799957|ref|NP_470225.1| hypothetical protein lin0884 [Listeria innocua Clip11262] >gi|20137392|sp|Q92DD0|ACPS_LISIN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|16413334|emb|CAC96116.1| lin0884 [Listeria innocua] (118 aa)
Score = 112, Expect = 2.6e-04, Identities = 24/54 (44%), Positives = 35/54 (64%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           ID+ ++   V K+ +FI+R+LT+ E  QY K + + K  FLA R+A KEA  KA
  S:    10 IDLDRVKQAVEKNPRFIERILTEKETKQYEKYEGSRKIEFLAGRFAAKEAYAKA 63
>gi|171324879|ref|ZP_02913390.1| holo-acyl-carrier-protein synthase [Geobacillus sp. WCH70] >gi|171089154|gb|EDT35488.1| holo-acyl-carrier-protein synthase [Geobacillus sp. WCH70] (119 aa)
Score = 111, Expect = 3.0e-04, Identities = 33/101 (32%), Positives = 58/101 (57%)
  Q:    16 IGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNS-YTCTTFKNVKVSISYDGNQVFATA 116
           IGID+    +I+  + K++KFI R+LT+ E   + ++    K  FLA R+A KEA  KAI       + F +I+ + +DN      +  K+ ++ +S   ++ +A A
  S:     5 IGIDIVELERIEQLMMKNEKFIDRILTEEEKRIFFQLSPKRKVEFLAGRFAAKEAYAKAIGTGIGKNVSFHDIQIMNDDNGKPIVVSNGKDCRIHVSISHSRDYAIA 111
>gi|184154686|ref|YP_001843026.1| holo-[acyl-carrier protein] synthase [Lactobacillus fermentum IFO 3956] >gi|183226030|dbj|BAG26546.1| holo-[acyl-carrier protein] synthase [Lactobacillus fermentum IFO 3956] (119 aa)
Score = 110, Expect = 4.2e-04, Identities = 34/102 (33%), Positives = 52/102 (50%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           IGIDV +ID     V K+  FI ++LT  E  Q   + N     ++A R++LKEA  KA+       + F+++E I N+       +         S+S+ G  VF   I
  S:     5 IGIDVAEIDRIKRAVEKTPSFINKVLTKGEQAQLATLKNQRYYEYIAGRFSLKEAYSKALGTGIGRHVSFLDVEIIDNELGQPVVVSHPFDGPAHASVSHTGQLVFTEVI 114
>gi|14701595|dbj|BAB62032.1| fatty acid synthase alpha-subunit [Schizosaccharomyces pombe] (1842 aa)
Score = 109, Expect = 5.5e-04, Identities = 37/113 (32%), Positives = 60/113 (53%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAI 117
           +  ++   N N+G+DV  +      ++ FI+R  TD E  +Y     N +  F A RW+ KEA FK++    K       +IE I +++             + T    K+V VSIS+D NQ  + A+
  S:  1714 LTTSLTNSNENVGVDVELVSAISIDNETFIERNFTDTE-RKYCFAAPNPQASF-AGRWSAKEAVFKSLGISGKGAAAPLKDIEIISSESGAPEVVLHGEAAKAATTAGVKSVSVSISHDDNQSVSVAL 1839
>gi|14701591|dbj|BAB62030.1| fatty acid synthase alpha-subunit [Schizosaccharomyces pombe] (1842 aa)
Score = 109, Expect = 5.5e-04, Identities = 37/113 (32%), Positives = 60/113 (53%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAI 117
           +  ++   N N+G+DV  +      ++ FI+R  TD E  +Y     N +  F A RW+ KEA FK++    K       +IE I +++             + T    K+V VSIS+D NQ  + A+
  S:  1714 LTTSLTNSNENVGVDVELVSAISIDNETFIERNFTDTE-RKYCFAAPNPQASF-AGRWSAKEAVFKSLGISGKGAAAPLKDIEIISSESGAPEVVLHGEAAKAATTAGVKSVSVSISHDDNQSVSVAL 1839
>gi|1199960|dbj|BAA11913.1| fatty acid synthetase alpha subunit [Schizosaccharomyces pombe] (1842 aa)
Score = 109, Expect = 5.5e-04, Identities = 37/113 (32%), Positives = 60/113 (53%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAI 117
           +  ++   N N+G+DV  +      ++ FI+R  TD E  +Y     N +  F A RW+ KEA FK++    K       +IE I +++             + T    K+V VSIS+D NQ  + A+
  S:  1714 LTTSLTNSNENVGVDVELVSAISIDNETFIERNFTDTE-RKYCFAAPNPQASF-AGRWSAKEAVFKSLGISGKGAAAPLKDIEIISSESGAPEVVLHGEAAKAATTAGVKSVSVSISHDDNQSVSVAL 1839
>gi|19114735|ref|NP_593823.1| fatty acid synthase alpha subunit Lsd1 (PMID 9693066) [Schizosaccharomyces pombe] >gi|19862944|sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha (p190/210) [Includes: Acyl carrier; 3-oxoacyl-[acyl-carrier-protein] reductase (Beta-ketoacyl reductase); 3-oxoacyl-[acyl-carrier-protein] synthase (Beta-ketoacyl synthase)] >gi|4490649|emb|CAB11481.1| fatty acid synthase alpha subunit Lsd1 (PMID 9693066) [Schizosaccharomyces pombe] >gi|14701589|dbj|BAB62029.1| fatty acid synthase alpha-subunit [Schizosaccharomyces pombe] (1842 aa)
Score = 109, Expect = 5.5e-04, Identities = 37/113 (32%), Positives = 60/113 (53%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAI 117
           +  ++   N N+G+DV  +      ++ FI+R  TD E  +Y     N +  F A RW+ KEA FK++    K       +IE I +++             + T    K+V VSIS+D NQ  + A+
  S:  1714 LTTSLTNSNENVGVDVELVSAISIDNETFIERNFTDTE-RKYCFAAPNPQASF-AGRWSAKEAVFKSLGISGKGAAAPLKDIEIISSESGAPEVVLHGEAAKAATTAGVKSVSVSISHDDNQSVSVAL 1839
>gi|14701593|dbj|BAB62031.1| fatty acid synthase alpha-subunit [Schizosaccharomyces pombe] (1842 aa)
Score = 109, Expect = 5.5e-04, Identities = 37/113 (32%), Positives = 60/113 (53%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAI 117
           +  ++   N N+G+DV  +      ++ FI+R  TD E  +Y     N +  F A RW+ KEA FK++    K       +IE I +++             + T    K+V VSIS+D NQ  + A+
  S:  1714 LTTSLTNSNENVGVDVELVSAISIDNETFIERNFTDTE-RKYCFAAPNPQASF-AGRWSAKEAVFKSLGISGKGAAAPLKDIEIISSESGAPEVVLHGEAAKAATTAGVKSVSVSISHDDNQSVSVAL 1839
>gi|195977513|ref|YP_002122757.1| holo-[acyl-carrier-protein] synthase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974218|gb|ACG61744.1| holo-[acyl-carrier-protein] synthase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (118 aa)
Score = 108, Expect = 6.8e-04, Identities = 33/99 (33%), Positives = 55/99 (55%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNSYTCTTFKNVK----VSISYDGNQVFATAI 117
           D++ I+    ++ +F +++LTD E   + +  +N K  +LA RWA KEA  KA+     ++ F +IE I ND+      T    +    +SIS+ G  V A+ I
  S:    11 DISAIEKVYLRNARFARKVLTDKELALFEQFSHNRKMTYLAGRWAGKEAFSKAMGTGIGQLTFQDIEII-NDSKGRPVITKSPFQGKAFISISHSGGYVQASVI 113
>gi|148269383|ref|YP_001243843.1| holo-acyl-carrier-protein synthase [Thermotoga petrophila RKU-1] >gi|147734927|gb|ABQ46267.1| holo-acyl-carrier-protein synthase [Thermotoga petrophila RKU-1] (169 aa)
Score = 108, Expect = 7.0e-04, Identities = 32/93 (34%), Positives = 52/93 (55%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNSYTCTT-----FKNVKVSISYD 108
           +G+D+ +ID      +KF +R+L   E   +L    N +  F+A R+ALKEA FKA+    +   F ++EF+++      C       F  V VS+S+D
  S:     5 VGVDILEIDRV---PEKFAERILGKAEKRLFLA--RNRRKEFIAGRFALKEAFFKALGTGLNGHSFTDVEFLESGGRPVVCVHKDFGFFNYVHVSLSHD 98
>gi|193216437|ref|YP_001999679.1| holo-acyl carrier protein synthase: phosphopantethiene-protein transferase [Mycoplasma arthritidis 158L3-1] >gi|193001760|gb|ACF06975.1| holo-acyl carrier protein synthase: phosphopantethiene-protein transferase [Mycoplasma arthritidis 158L3-1] (98 aa)
Score = 108, Expect = 8.2e-04, Identities = 34/83 (40%), Positives = 43/83 (51%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTF 98
           IGID T+I  F N  D  + + L  NE  +  K  N  K  ++A+RWALKEA FK  N F    F  IE IK+ +  Y    F
  S:     2 IGIDATRISRFKNFKDHQLVKFLHPNELIECKKAPNFAK--YIATRWALKEAIFKCDNTFSS--FSEIEIIKDQSGRYKFLDF 80
>gi|187603759|ref|ZP_02989971.1| holo-acyl-carrier-protein synthase [Exiguobacterium sp. AT1b] >gi|187484534|gb|EDU22526.1| holo-acyl-carrier-protein synthase [Exiguobacterium sp. AT1b] (122 aa)
Score = 106, Expect = 1.1e-03, Identities = 32/101 (31%), Positives = 53/101 (52%)
  Q:    16 IGIDVTKIDYFVN--KSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           IG+D+ ++D      K  +F+KRLLTD EY    +     +  F++ R+A KEA  KAI     H + + +IE + ++      T     K+ +S   +Q +A A
  S:     5 IGVDIVELDRMARSMKQPRFLKRLLTDAEYELSQQYPLPRQIEFVSGRFAAKEAYAKAIGTGIAHGLSWRHIEILPDETGRPVMTAPFVGKIHVSISHSQTYAIA 109
>gi|116872287|ref|YP_849068.1| holo-(acyl-carrier-protein) synthase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123463648|sp|A0AH03|ACPS_LISW6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116741165|emb|CAK20285.1| acpS [Listeria welshimeri serovar 6b str. SLCC5334] (118 aa)
Score = 106, Expect = 1.3e-03, Identities = 22/54 (40%), Positives = 35/54 (64%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           ID+ ++   + K+ +FI+R+LT+ E  Q+ K + + K  FLA R+A KEA  KA
  S:    10 IDLERVKQVLEKNPRFIERVLTEKEIKQFEKYEGSRKIEFLAGRFAAKEAYAKA 63
>gi|148377985|ref|YP_001256861.1| Holo-[acyl-carrier protein]synthase [Mycoplasma agalactiae PG2] >gi|148292031|emb|CAL59423.1| Holo-[acyl-carrier protein]synthase [Mycoplasma agalactiae PG2] (104 aa)
Score = 106, Expect = 1.3e-03, Identities = 26/61 (42%), Positives = 40/61 (65%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNL-KPRFLASRWALKEATFKAIN 73
           N NIG+D+TKI  F       I R+L+  E+ ++ ++ ++  K +FLA+RW +KEA FKA N
  S:     3 NHNIGLDMTKISRFQELKKSTIIRILSAEEFIEFDELKSDYEKQKFLATRWCIKEAMFKADN 64
>gi|1805261|gb|AAB41493.1| fatty acid synthase, alpha subunit [Emericella nidulans] (1858 aa)
Score = 106, Expect = 1.4e-03, Identities = 37/105 (35%), Positives = 57/105 (54%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTF-------------KNVKVSISYDGNQVFATAI 117
           N  IG+DV  ID     ++ FI+R+L  +E  QY +   + +  F A RW+ KEA FK++    K     ++ I+ +N+S    T              K++ VSIS+   Q  A AI
  S:  1740 NSKIGVDVESIDSINISNETFIERILPASE-QQYCQNAPSPQSSF-AGRWSAKEAVFKSLGVCSKGAGAPLKDIEIENDSNGAPTLHGVAAEAAKEAGVKHISVSISHSDMQAVAVAI 1855
>gi|154149443|ref|YP_001406970.1| holo-(acyl-carrier-protein) synthase [Campylobacter hominis ATCC BAA-381] >gi|166198190|sp|A7I379|ACPS_CAMHC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|153805452|gb|ABS52459.1| holo-(acyl-carrier-protein) synthase [Campylobacter hominis ATCC BAA-381] (124 aa)
Score = 106, Expect = 1.4e-03, Identities = 38/102 (37%), Positives = 56/102 (54%)
  Q:    16 IGIDVTKID----YFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA--INEFHKIFFINIEFIKNDNNS-----YTCT----TFKNVKVSISYDGNQVFATAI 117
           IGID+  I      +    DKF+ ++L+ NE N  L ++ NLK   LA  +A KEA  KA  +       F+++E +KND  +       C       KN  VSI++DG    +  I
  S:     2 IGIDIVSISRISKIYTKFGDKFLDKILSGNEQNSVLNLNYNLKLERLAGIYAAKEAFAKALGVGISADFGFLDVEILKNDRGAPFLEIAPCIIKKFNIKNADVSITHDGGFAISAVI 118
>gi|29375436|ref|NP_814590.1| holo-(acyl-carrier-protein) synthase [Enterococcus faecalis V583] >gi|59797855|sp|Q820V0|ACPS_ENTFA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|29342896|gb|AAO80660.1| holo-(acyl-carrier-protein) synthase [Enterococcus faecalis V583] (117 aa)
Score = 105, Expect = 1.5e-03, Identities = 35/101 (34%), Positives = 51/101 (50%)
  Q:    16 IGID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS-YTCTTFKNVKVSISYDGNQVFATA 116
           IGID   +++I   V K   FI+R+LT NE   + K+    +  FLA R+A KEA  KA      K+   +IE +     + Y   +  N KV +S    +  A A
  S:     5 IGIDAVELSRIKPIVEKQGSFIQRVLTPNELTLFEKLSTKRQIEFLAGRFACKEAFSKAWGTGIGKVGLQDIEVLTEKTGAPYVANSPHNGKVFVSITHTETMAIA 110
>gi|1749640|dbj|BAA13877.1| unnamed protein product [Schizosaccharomyces pombe] (377 aa)
Score = 105, Expect = 1.8e-03, Identities = 37/113 (32%), Positives = 60/113 (53%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAI 117
           +  ++   N N+G+DV  +      ++ FI+R  TD E  +Y     N +  F A RW+ KEA FK++    K       +IE I +++             + T    K+V VSIS+D NQ  + A+
  S:   249 LTTSLTNSNENVGVDVELVSAISIDNETFIERNFTDTE-RKYCFAAPNPQASF-AGRWSAKEAVFKSLGISGKGAAAPLKDIEIISSESGAPEVVLHGEAAKAATTAGVKSVSVSISHDDNQSVSVAL 374
>gi|154684965|ref|YP_001420126.1| 4'-phosphopantetheinyl transferase [Bacillus amyloliquefaciens FZB42] >gi|166198173|sp|A7Z1L9|ACPS_BACA2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|154350816|gb|ABS72895.1| AcpS [Bacillus amyloliquefaciens FZB42] (121 aa)
Score = 104, Expect = 1.9e-03, Identities = 23/58 (39%), Positives = 38/58 (65%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           F IGID+    +I+  +++  +F +R+LT+ EY ++  + +  K  FLA R+A KEA  KA
  S:     3 FGIGIDIVELHRIENMLSRQARFPQRILTEAEYARFTLLSDKRKIEFLAGRFAAKEAFSKA 63
>gi|94676947|ref|YP_588728.1| holo-(acyl-carrier-protein) synthase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|123260568|sp|Q1LTI6|ACPS_BAUCH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|94220097|gb|ABF14256.1| holo-(acyl-carrier-protein) synthase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (146 aa)
Score = 104, Expect = 2.1e-03, Identities = 28/74 (37%), Positives = 44/74 (59%)
  Q:    16 IGIDVTKI----DYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKND 89
           IG D+ +I       V   ++FI R+L+  EY QY + +N++   FLA R+A+KEA  KA+     H I F+  E   ++
  S:     6 IGTDIVEIARIHTVLVRCGERFIDRILSPIEYKQYHQQNNSV--HFLAKRFAVKEAAAKALGTGICHGIAFVQFELFHDE 83
>gi|194467666|ref|ZP_03073653.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri 100-23] >gi|194454702|gb|EDX43599.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri 100-23] (120 aa)
Score = 104, Expect = 2.3e-03, Identities = 36/102 (35%), Positives = 52/102 (50%)
  Q:    16 IGIDVTKIDYFVNKS----DKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           IGID+T+I+  V K+     +FI+ +LT  E  QY +        +LA RW+LKE+  KA       K+ F +IE I N   +   T      N   S+S+    V    I
  S:     5 IGIDITEIER-VKKAATAHSQFIQHVLTPPELEQYSQFSGQRSVEYLAGRWSLKESFAKAYGTGIGAKLGFHDIEIIDNQYGAPIVTKSPYNGNAHASVSHTATLVMTEVI 114
>gi|149192071|ref|ZP_01870296.1| 4'-phosphopantetheinyl transferase [Vibrio shilonii AK1] >gi|148834096|gb|EDL51108.1| 4'-phosphopantetheinyl transferase [Vibrio shilonii AK1] (126 aa)
Score = 103, Expect = 2.8e-03, Identities = 30/91 (32%), Positives = 48/91 (52%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSIS 106
           +G D+ +I+          + F +R+LTDNE  Q+ ++    + RFLA R+A+KEA  KA+     H + F + E + ND N     T       I+
  S:     6 LGTDIAEIERVEKALARSGEAFAQRILTDNELVQFQQLKQ--QGRFLAKRFAVKEAASKALGTGIAHGVTFQDFE-VSNDENGKPILTLTKKAAEIA 99
>gi|15643455|ref|NP_228501.1| holo-(acyl carrier protein) synthase [Thermotoga maritima MSB8] >gi|170288041|ref|YP_001738279.1| holo-acyl-carrier-protein synthase [Thermotoga sp. RQ2] >gi|8134303|sp|Q9WZF6|ACPS_THEMA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|4981215|gb|AAD35774.1|AE001741_7 holo-(acyl carrier protein) synthase [Thermotoga maritima MSB8] >gi|170175544|gb|ACB08596.1| holo-acyl-carrier-protein synthase [Thermotoga sp. RQ2] (169 aa)
Score = 103, Expect = 2.9e-03, Identities = 33/102 (32%), Positives = 57/102 (55%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNSYTCTT-----FKNVKVSISYDGNQVFATAI 117
           +GIDV +++      +KF +R+L ++E   +L      +  F+A R+ALKEA FKA+    +   F ++EF++++     C       F    VS+S+D    FA A+
  S:     5 VGIDVLEVERV---PEKFAERILGESEKRLFLT--RKRRREFIAGRFALKEAFFKALGTGLNGHSFTDVEFLESNGKPVLCVHKDFGFFNYAHVSLSHDR---FAVAL 104
>gi|67904840|ref|XP_682676.1| FAS2_PENPA Fatty acid synthase subunit alpha [Aspergillus nidulans FGSC A4] >gi|40747318|gb|EAA66474.1| FAS2_PENPA Fatty acid synthase subunit alpha [Aspergillus nidulans FGSC A4] (1858 aa)
Score = 103, Expect = 3.1e-03, Identities = 37/105 (35%), Positives = 56/105 (53%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTF-------------KNVKVSISYDGNQVFATAI 117
           N  IG+DV  ID     ++ FI+R  T +E  QY +   + +  F A RW+ KEA FK++    K     ++ I+ +N+S    T              K++ VSIS+   Q  A AI
  S:  1740 NSKIGVDVESIDSINISNETFIERNFTASE-QQYCQNAPSPQSSF-AGRWSAKEAVFKSLGVCSKGAGAPLKDIEIENDSNGAPTLHGVAAEAAKEAGVKHISVSISHSDMQAVAVAI 1855
>gi|171779288|ref|ZP_02920259.1| hypothetical protein STRINF_01136 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282344|gb|EDT47771.1| hypothetical protein STRINF_01136 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (119 aa)
Score = 102, Expect = 3.6e-03, Identities = 36/101 (35%), Positives = 56/101 (55%)
  Q:    17 GIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKAINE-FHKIFFINIEFIKND-------NNSYTCTTFKNVKVSISYDGNQVFATAI 117
           GID+ +ID       K+++F KR+LT+ E+  +       +   FLA RWA KEA  KA+      + F +IE + N         + +T   F    +S+S+ GN V A+ I
  S:     6 GIDLQEIDAIKRAYEKNNRFAKRVLTEKEFQVFSGFKAEKRQMEFLAGRWAAKEAFAKAMGTGIGTLGFQDIEILNNQLGAPEITQSPFTGRCF----ISLSHTGNLVQASVI 114
>gi|161506850|ref|YP_001576804.1| Holo-acyl-carrier protein [Lactobacillus helveticus DPC 4571] >gi|172048358|sp|A8YXI2|ACPS_LACH4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|160347839|gb|ABX26513.1| Holo-acyl-carrier protein [Lactobacillus helveticus DPC 4571] (118 aa)
Score = 102, Expect = 3.6e-03, Identities = 29/100 (28%), Positives = 55/100 (55%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           I+V ++   V K D F +++LT  E+ QY K+    K  +L  R++LKE+  KA+       + F ++E + +D      T+ K   N+  SI++D +++    +
  S:    10 IEVERVKKIVAKGDSFAEKVLTPKEFAQYQKMKGKRKVEYLGGRFSLKESFSKAMGTGLGKYVGFQDVETLWDDLGHPVMTSTKFDGNIFPSITHDNHEIITFVV 114
>gi|149021205|ref|ZP_01835451.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP23-BS72] >gi|147930306|gb|EDK81290.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP23-BS72] (120 aa)
Score = 101, Expect = 4.2e-03, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:    17 GIDVTK---IDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +   I+  V + + F KR+LT  E  ++  +    +  +LA RW+ KEA  KA+     K+ F ++E + N+  +  ++   F   + +SIS+    V A+ I
  S:     6 GIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVIASVI 113
>gi|114773404|ref|ZP_01450588.1| holo-(acyl-carrier protein) synthase [alpha proteobacterium HTCC2255] (130 aa)
Score = 101, Expect = 5.3e-03, Identities = 24/61 (39%), Positives = 38/61 (62%)
  Q:    12 PNFNIGIDVTKIDYFVN------KSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           P   +G D+ +I  F        K D+  +++LT NE++ YL+  +    RFLA R+A+KEA  KA+
  S:     2 PIIGLGTDIVQISRFEEMEDTSVKRDRLAQKVLTPNEFDMYLQ--HAHPARFLAKRFAVKEAAVKAL 66
>gi|52144991|ref|YP_081839.1| holo-[acyl-carrier protein] synthase [Bacillus cereus E33L] >gi|59797688|sp|Q63GX2|ACPS_BACCZ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|51978460|gb|AAU20010.1| holo-[acyl-carrier protein] synthase [Bacillus cereus E33L] (119 aa)
Score = 100, Expect = 5.5e-03, Identities = 32/101 (31%), Positives = 54/101 (53%)
  Q:    16 IGIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           IGID+    +I+  ++   KF++R+LT+NE N    +  +    F+A R+A KEA  KA+      ++ F++IE   +D       T     V +S   ++ FA A
  S:     5 IGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVA 110
>gi|30260426|ref|NP_842803.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Ames] >gi|47525507|ref|YP_016856.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49183269|ref|YP_026521.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Sterne] >gi|49480319|ref|YP_034577.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65317678|ref|ZP_00390637.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Bacillus anthracis str. A2012] >gi|118475998|ref|YP_893149.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis str. Al Hakam] >gi|165871559|ref|ZP_02216205.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0488] >gi|166995276|ref|ZP_02261736.1| holo- [Bacillus cereus AH820] >gi|167634179|ref|ZP_02392501.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0442] >gi|167640318|ref|ZP_02398583.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0193] >gi|170687791|ref|ZP_02879006.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0465] >gi|170707834|ref|ZP_02898284.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0389] >gi|177653365|ref|ZP_02935575.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0174] >gi|190567415|ref|ZP_03020329.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis Tsiankovskii-I] >gi|196036030|ref|ZP_03103431.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus W] >gi|196041134|ref|ZP_03108430.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus NVH0597-99] >gi|196046246|ref|ZP_03113473.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus 03BB108] >gi|166198174|sp|A0R8U9|ACPS_BACAH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797763|sp|Q6HPE3|ACPS_BACHK Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61211622|sp|Q81JG3|ACPS_BACAN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|30253747|gb|AAP24289.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Ames] >gi|47500655|gb|AAT29331.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49177196|gb|AAT52572.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. Sterne] >gi|49331875|gb|AAT62521.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118415223|gb|ABK83642.1| holo-[acyl-carrier protein] synthase [Bacillus thuringiensis str. Al Hakam] >gi|164712663|gb|EDR18194.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0488] >gi|167511720|gb|EDR87101.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0193] >gi|167530493|gb|EDR93208.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0442] >gi|170127192|gb|EDS96069.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0389] >gi|170668318|gb|EDT19066.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0465] >gi|172081405|gb|EDT66478.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis str. A0174] >gi|190561542|gb|EDV15513.1| holo-(acyl-carrier-protein) synthase [Bacillus anthracis Tsiankovskii-I] >gi|195991399|gb|EDX55366.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus W] >gi|196022991|gb|EDX61671.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus 03BB108] >gi|196028069|gb|EDX66680.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus NVH0597-99] (119 aa)
Score = 100, Expect = 5.7e-03, Identities = 32/101 (31%), Positives = 54/101 (53%)
  Q:    16 IGIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           IGID+    +I+  ++   KF++R+LT+NE N    +  +    F+A R+A KEA  KA+      ++ F++IE   +D       T     V +S   ++ FA A
  S:     5 IGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVA 110
>gi|168487533|ref|ZP_02712041.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1087-00] >gi|183569643|gb|EDT90171.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1087-00] (120 aa)
Score = 100, Expect = 6.0e-03, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:    17 GIDVTK---IDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +   I+  V + + F KR+LT  E  ++  +    +  +LA RW+ KEA  KA+     K+ F ++E + N+  +  ++   F   + +SIS+    V A+ I
  S:     6 GIDIEELASIESAVTRHEGFAKRVLTTQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVI 113
>gi|116333169|ref|YP_794696.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus brevis ATCC 367] >gi|122270142|sp|Q03T07|ACPS_LACBA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116098516|gb|ABJ63665.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus brevis ATCC 367] (122 aa)
Score = 100, Expect = 6.6e-03, Identities = 25/76 (32%), Positives = 41/76 (53%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKND 89
           +  GID+T   ++   V +  +F+ ++LT NE   Y K+       F+A RW+ KE+  KA+       + F +IE   ND
  S:     3 YGTGIDITDLKRVQRVVERQPRFLTKVLTPNERVDYQKLSGQRALEFIAGRWSAKESYSKAMGTGIGATVTFQDIEIRDND 83
>gi|183603780|ref|ZP_02721074.2| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae MLV-016] >gi|183578878|gb|EDT99406.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae MLV-016] (122 aa)
Score = 99, Expect = 7.3e-03, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:    17 GIDVTK---IDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +   I+  V + + F KR+LT  E  ++  +    +  +LA RW+ KEA  KA+     K+ F ++E + N+  +  ++   F   + +SIS+    V A+ I
  S:     8 GIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVI 115
>gi|182684641|ref|YP_001836388.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae CGSP14] >gi|182629975|gb|ACB90923.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae CGSP14] (123 aa)
Score = 99, Expect = 7.3e-03, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:    17 GIDVTK---IDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +   I+  V + + F KR+LT  E  ++  +    +  +LA RW+ KEA  KA+     K+ F ++E + N+  +  ++   F   + +SIS+    V A+ I
  S:     9 GIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVI 116
>gi|15901533|ref|NP_346137.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae TIGR4] >gi|15903584|ref|NP_359134.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae R6] >gi|111657515|ref|ZP_01408258.1| hypothetical protein SpneT_02001281 [Streptococcus pneumoniae TIGR4] >gi|116515875|ref|YP_816965.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae D39] >gi|148984141|ref|ZP_01817436.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP3-BS71] >gi|148989350|ref|ZP_01820718.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP6-BS73] >gi|148994016|ref|ZP_01823372.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP9-BS68] >gi|148997752|ref|ZP_01825316.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP11-BS70] >gi|149001991|ref|ZP_01826945.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP14-BS69] >gi|149006638|ref|ZP_01830337.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP18-BS74] >gi|149011436|ref|ZP_01832683.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP19-BS75] >gi|168484890|ref|ZP_02709835.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1873-00] >gi|168488584|ref|ZP_02712783.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae SP195] >gi|168491419|ref|ZP_02715562.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC0288-04] >gi|168493603|ref|ZP_02717746.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC3059-06] >gi|169833456|ref|YP_001695075.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae Hungary19A-6] >gi|194398007|ref|YP_002038310.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae G54] >gi|122278189|sp|Q04J73|ACPS_STRP2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61217886|sp|P0A2W6|ACPS_STRPN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|61217889|sp|P0A2W7|ACPS_STRR6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|10764422|gb|AAG22706.1| acyl carrier protein synthase; AcpS [Streptococcus pneumoniae] >gi|14973193|gb|AAK75777.1| holo-(acyl-carrier protein) synthase [Streptococcus pneumoniae TIGR4] >gi|15459205|gb|AAL00345.1| Acyl Carrier protein synthase [Streptococcus pneumoniae R6] >gi|116076451|gb|ABJ54171.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae D39] >gi|147756251|gb|EDK63293.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP11-BS70] >gi|147759800|gb|EDK66790.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP14-BS69] >gi|147761936|gb|EDK68899.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP18-BS74] >gi|147764426|gb|EDK71357.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP19-BS75] >gi|147923430|gb|EDK74543.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP3-BS71] >gi|147925100|gb|EDK76180.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP6-BS73] >gi|147927483|gb|EDK78511.1| 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae SP9-BS68] >gi|168995958|gb|ACA36570.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae Hungary19A-6] >gi|172041955|gb|EDT50001.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC1873-00] >gi|183572725|gb|EDT93253.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae SP195] >gi|183574238|gb|EDT94766.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC0288-04] >gi|183576263|gb|EDT96791.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae CDC3059-06] >gi|194357674|gb|ACF56122.1| holo-(acyl-carrier-protein) synthase [Streptococcus pneumoniae G54] (120 aa)
Score = 99, Expect = 7.3e-03, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:    17 GIDVTK---IDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +   I+  V + + F KR+LT  E  ++  +    +  +LA RW+ KEA  KA+     K+ F ++E + N+  +  ++   F   + +SIS+    V A+ I
  S:     6 GIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVI 113
>gi|73662115|ref|YP_300896.1| phosphopantetheinyl transferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90111953|sp|Q49Z25|ACPS_STAS1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|72494630|dbj|BAE17951.1| phosphopantetheinyl transferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (116 aa)
Score = 99, Expect = 8.5e-03, Identities = 29/99 (29%), Positives = 54/99 (54%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           I++++I     +  K + R+LT NE +++ + +N   K  FLA R+A KEA  KA+       + F +I+ + ND +   C  ++  KV +S    + +A +
  S:    10 IEISRIKNLYKRQSKLVDRILTINEQHKFNQFNNEQRKMEFLAGRFATKEAFSKALGSGLGKTVSFTDIDCV-NDEDGKPCIHYEGYKVHVSISHTEHYAMS 110
>gi|148543491|ref|YP_001270861.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri F275] >gi|184152899|ref|YP_001841240.1| holo-[acyl-carrier protein] synthase [Lactobacillus reuteri F275] >gi|166918337|sp|A5VI50|ACPS_LACRF Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|148530525|gb|ABQ82524.1| holo-acyl-carrier-protein synthase [Lactobacillus reuteri F275] >gi|183224243|dbj|BAG24760.1| holo-[acyl-carrier protein] synthase [Lactobacillus reuteri F275] (120 aa)
Score = 98, Expect = 9.2e-03, Identities = 33/102 (32%), Positives = 48/102 (47%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           IGID+T+I+          +FI+ +LT  E  QY +        +LA RW+LKE+  KA        + F +IE I N   +   T      N   S+S+    V    I
  S:     5 IGIDITEIERVKKAATAHSQFIQHVLTPTELEQYSQFSGQRSVEYLAGRWSLKESFAKAYGTGIGANLGFHDIEIIDNQYGAPIVTKSPYNGNAHASVSHTATLVMTEVI 114
>gi|15616867|ref|NP_240080.1| holo-[acyl-carrier protein] synthase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11131242|sp|P57344|ACPS_BUCAI Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|25304172|pir||F84959 holo-[acyl-carrier-protein] synthase (EC 2.7.8.7) [imported] - Buchnera sp. (strain APS) >gi|10038931|dbj|BAB12966.1| holo-[acyl-carrier protein] synthase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (126 aa)
Score = 98, Expect = 9.5e-03, Identities = 29/73 (39%), Positives = 47/73 (64%)
  Q:    16 IGIDVTKI----DYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKN 88
           IGID  +I    + F+   DKF +++L+  E+ +Y+ ID+++   FLA ++  KEA  KA+     H+I F  +EF KN
  S:     6 IGIDFVEILRIKNIFLKYGDKFARKILSTEEWKKYILIDDSIS--FLAKKFVAKEAASKALGTGINHQITFNQLEFYKN 82
>gi|22537825|ref|NP_688676.1| 4'-phosphopantetheinyl transferase [Streptococcus agalactiae 2603V/R] >gi|25011769|ref|NP_736164.1| 4'-phosphopantetheinyl transferase [Streptococcus agalactiae NEM316] >gi|76787432|ref|YP_330299.1| 4'-phosphopantetheinyl transferase [Streptococcus agalactiae A909] >gi|77406431|ref|ZP_00783489.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae H36B] >gi|77409006|ref|ZP_00785726.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae COH1] >gi|77412403|ref|ZP_00788711.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae CJB111] >gi|77414521|ref|ZP_00790667.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae 515] >gi|54036694|sp|P63472|ACPS_STRA5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54040678|sp|P63471|ACPS_STRA3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90111954|sp|Q3JZK4|ACPS_STRA1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|22534719|gb|AAN00549.1|AE014268_9 holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae 2603V/R] >gi|24413309|emb|CAD47388.1| unknown [Streptococcus agalactiae NEM316] >gi|76562489|gb|ABA45073.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae A909] >gi|77159419|gb|EAO70584.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae 515] >gi|77161538|gb|EAO72541.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae CJB111] >gi|77172390|gb|EAO75539.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae COH1] >gi|77174964|gb|EAO77775.1| holo-(acyl-carrier-protein) synthase [Streptococcus agalactiae H36B] (119 aa)
Score = 98, Expect = 9.5e-03, Identities = 36/101 (35%), Positives = 55/101 (54%)
  Q:    17 GIDVTKIDYFVN---KSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNSYTCTT--FKNVK-VSISYDGNQVFATAI 117
           GID+ +I+       ++ +F +R+LT+ E   +  I N   +  FL  RWA KEA  KA+     K+ F +IE + +D  +   T   F     VSIS+ GN   A+ I
  S:     6 GIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSDDKGAPLITKEPFNGKSFVSISHSGNYAQASVI 114
>gi|42779351|ref|NP_976598.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus ATCC 10987] >gi|166984386|ref|ZP_02255737.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus AH187] >gi|168162567|ref|ZP_02597800.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus H3081.97] >gi|59797814|sp|Q73ET8|ACPS_BACC1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|42735266|gb|AAS39206.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus ATCC 10987] (119 aa)
Score = 98, Expect = 1.0e-02, Identities = 31/101 (30%), Positives = 54/101 (53%)
  Q:    16 IGIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           IGID+    +I+  ++   KF++R+LT++E N    +  +    F+A R+A KEA  KA+      ++ F++IE   +D       T     V +S   ++ FA A
  S:     5 IGIDIIELNRIEKMIDGKLKFMERILTESERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVA 110
>gi|71904185|ref|YP_280988.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS6180] >gi|90111955|sp|Q48RM7|ACPS_STRPM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|71803280|gb|AAX72633.1| holo-[acyl-carrier protein] synthase [Streptococcus pyogenes MGAS6180] (118 aa)
Score = 98, Expect = 1.0e-02, Identities = 34/101 (33%), Positives = 56/101 (55%)
  Q:    17 GID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID   ++ I+    ++ +F +++LT+ E   +       +  +LA RWA KEA  KAI     ++ F +IE + +       T + FK N  +SIS+ GN V A+ I
  S:     6 GIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVI 113
>gi|188533142|ref|YP_001906939.1| Holo-[acyl-carrier-protein] synthase [Erwinia tasmaniensis] >gi|188028184|emb|CAO96042.1| Holo-[acyl-carrier-protein] synthase [Erwinia tasmaniensis] (126 aa)
Score = 98, Expect = 1.0e-02, Identities = 24/56 (42%), Positives = 37/56 (66%)
  Q:    16 IGIDVTKIDYFV----NKSDKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKA 71
           +G D+ +ID          D+  +R+L+DNE+ QY    ++ +P RFLA R+A+KEA  KA
  S:     6 LGSDIVEIDRIAAVISRTGDRLARRVLSDNEWRQY---QSHQQPVRFLAKRFAVKEAASKA 63
>gi|170091748|ref|XP_001877096.1| predicted protein [Laccaria bicolor S238N-H82] >gi|164648589|gb|EDR12832.1| predicted protein [Laccaria bicolor S238N-H82] (157 aa)
Score = 98, Expect = 1.1e-02, Identities = 30/114 (26%), Positives = 64/114 (56%)
  Q:     4 KMEKTINKPNFNIGID---VTKIDYFVNKSD--KFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIK---NDNNSY------------TCTTFKNVKVSISYDGNQVFATAI 117
           + E + +     IG+D   + +I   +++ D  +F  R+L+ +E   +  +  N + +FLA RW +KEA +KA+    +  + ++ +      DN  +            +      + VS+S+DG+ V+A+ +
  S:    19 RRETSTSMAILGIGVDLVNIPRITALLSRRDPQRFASRILSSDELALWQSMPLNRRVQFLAVRWGVKEAAYKAMFPVARPTWKDLTYHGAKVADNGQWQKPSLTYRPPGSSIPVIDQIHVSVSHDGDYVYASVL 152
>gi|83319324|ref|YP_424380.1| holo-(acyl-carrier-protein) synthase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123535761|sp|Q2SS83|ACPS_MYCCT Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|83283210|gb|ABC01142.1| holo-(acyl-carrier-protein) synthase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (110 aa)
Score = 98, Expect = 1.1e-02, Identities = 31/103 (30%), Positives = 56/103 (54%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           N+GID+ + +  +   ++FI ++L+ NE   +   +   K  FLA RWA+KEA  K +++   +  I+IE+I ND         +N+ +SIS++       A+
  S:     4 NVGIDIVE-NKRIKLKEEFIVKVLSANEIKTFNIKNKKQKREFLAGRWAIKEAIIKTLDQPISMNKIDIEYI-NDKPVIKNQELQNILISISHEKKYAVGIAL 104
>gi|46121887|ref|XP_385497.1| hypothetical protein FG05321.1 [Gibberella zeae PH-1] (1856 aa)
Score = 98, Expect = 1.2e-02, Identities = 35/111 (31%), Positives = 61/111 (54%)
  Q:     7 KTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI---NEFHKIFFINIEFIKNDNNSYTCTT------------FKNVKVSISYDGNQVFATAI 117
           K  NK N  +G+DV  I      ++ F++R  T NE + Y +   + +  F A RW+ KEA FK++   ++       +IE +K +N + T +              K++ +SIS+  +Q  A A+
  S:  1731 KVANK-NSQVGVDVEDISAVNIDNETFVERNFTANEIS-YCRQAPSPQSSF-AGRWSAKEAVFKSLGVASQGAGAAMKDIEIVKGENGAPTVSLHGDAAAAAQKAGVKDITLSISHSDSQAIAVAV 1853
>gi|15613081|ref|NP_241384.1| holo-(acyl carrier protein) synthase [Bacillus halodurans C-125] >gi|20137512|sp|Q9KFG1|ACPS_BACHD Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|10173131|dbj|BAB04237.1| holo-(acyl carrier protein) synthase [Bacillus halodurans C-125] (119 aa)
Score = 98, Expect = 1.2e-02, Identities = 20/56 (35%), Positives = 35/56 (62%)
  Q:    17 GIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           GID+    +I   V K  +F+K++LT+NE   + ++    +  ++A R+A KEA  KA+
  S:     6 GIDIVELERIQSMVEKHPRFVKKILTENEQEVFARLSRRRRLEYIAGRFAAKEAFVKAV 64
>gi|153956181|ref|YP_001396946.1| 4'-phosphopantetheinyl transferase [Clostridium kluyveri DSM 555] >gi|189027325|sp|A5N379|ACPS_CLOK5 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|146349039|gb|EDK35575.1| AcpS [Clostridium kluyveri DSM 555] (134 aa)
Score = 97, Expect = 1.2e-02, Identities = 32/97 (32%), Positives = 52/97 (53%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGN 110
           F +G+D+ +I      + K + FI R+ + NE  +YLK + NL+P F+A R+A KEA  K++   F    F +IE  +  +   T       K+  +  GN
  S:     3 FGVGVDIVEIRRIKEAIEKHNTFIDRIFSKNEI-EYLK-NRNLRPEFVAGRFAAKEAVVKSLGSGFRGFDFKDIEIDRTASGRPTVVLKGKAKLMANKYGN 101
>gi|119179463|ref|XP_001241314.1| hypothetical protein CIMG_08477 [Coccidioides immitis RS] >gi|90300100|gb|EAS29731.1| hypothetical protein CIMG_08477 [Coccidioides immitis RS] (1861 aa)
Score = 97, Expect = 1.2e-02, Identities = 40/116 (34%), Positives = 59/116 (50%)
  Q:     1 VNYKMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCTTFK-------------NVKVSISYDGNQVFATA 116
           V Y  + T+   N  +G+DV  I+    ++D FI+R  T+ E  +Y +   + +  F A RW+ KEA FK++    K       +IE I ND N     T                V VSIS+  +Q  A A
  S:  1729 VEYLAKATVTA-NTRVGVDVESIEAINLENDTFIQRNFTEAE-QKYCRQAASPQASF-AGRWSAKEAVFKSLGVCGKGAGAALKDIEII-NDTNGTPVVTLHGDAAAAAKQAGVVGVTVSISHSDSQAVAVA 1856
>gi|168138518|ref|ZP_02581747.1| holo- [Bacillus cereus B4264] (119 aa)
Score = 97, Expect = 1.4e-02, Identities = 32/98 (32%), Positives = 59/98 (60%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNS---YTCTTFKNVKVSISYDGNQVFATA 116
           ++ +I+  ++   KF++R+LT+NE N  +++  +    F+A R+A KEA  KA+      ++ F++IE +KND         +T   V +SIS+  ++ FA A
  S:    11 ELNRIEKMLDGKLKFMERILTENERNVAMELKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIE-VKNDERGKPILITSTEHIVHLSISH--SKEFAVA 110
>gi|155382643|gb|ABU23831.1| fatty acid synthase [Mycosphaerella pini] (325 aa)
Score = 97, Expect = 1.4e-02, Identities = 34/102 (33%), Positives = 59/102 (57%)
  Q:    16 IGIDVTKIDYF-VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDN----NSYTCTTFKNVKVSISYDGNQVFATAI 117
           +GID+  +  F  ++++ FI+R  T+ E   + K   + K  F ASRWA KEA FK ++   K       +IE +K+DN     +      +++++SIS+  + + A AI
  S:   206 VGIDLVDLSAFSAHENETFIERNFTEQE-KAFAKQSLDQKMAF-ASRWAAKEAVFKCLHTQTKGAGAAMKDIEIVKSDNAPQGQAGRKAGLEDIQLSISHGEDCLIAVAI 313
>gi|90580329|ref|ZP_01236136.1| 4'-phosphopantetheinyl transferase [Vibrio angustum S14] >gi|90438631|gb|EAS63815.1| 4'-phosphopantetheinyl transferase [Vibrio angustum S14] (126 aa)
Score = 97, Expect = 1.5e-02, Identities = 22/57 (38%), Positives = 37/57 (64%)
  Q:    16 IGIDVTKID----YFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +G D+ +I+     F    D F +++L+ +E  Q+ ++   LK RFLA R+A+KEA  KA+
  S:     6 LGTDIAEIERVEKVFARSGDAFAQKILSSSELEQFQQL--KLKGRFLAKRFAVKEAASKAL 64
>gi|145607265|ref|XP_001407660.1| hypothetical protein MGG_12154 [Magnaporthe grisea 70-15] >gi|145014852|gb|EDJ99420.1| hypothetical protein MGG_12154 [Magnaporthe grisea 70-15] (1857 aa)
Score = 97, Expect = 1.5e-02, Identities = 33/113 (29%), Positives = 56/113 (49%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTC------------TTFKNVKVSISYDGNQVFATAI 117
           + K++  P   +G+D   I+     +D F++R  T  E  +Y +   N +  F A RW+ KEA FK++    K       +IE  ++ + + T                K + VSIS+   Q  A A+
  S:  1727 LAKSLESPTNKVGVDFEDIEGINIDNDTFVERNFTAKEI-EYCRSSPNPRAAF-AGRWSAKEAVFKSLGVASKGAGAPLKDIEIARDSHGAPTVVLHGDASNAANEAKVKKISVSISHSDTQAVAIAV 1852
>gi|47567487|ref|ZP_00238199.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus G9241] >gi|47555889|gb|EAL14228.1| holo-(acyl-carrier-protein) synthase [Bacillus cereus G9241] (119 aa)
Score = 97, Expect = 1.6e-02, Identities = 31/101 (30%), Positives = 54/101 (53%)
  Q:    16 IGIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           IGID+    +I+  ++   KF++R+LT++E N    +  +    F+A R+A KEA  KA+      ++ F++IE   +D       T     V +S   ++ FA A
  S:     5 IGIDIIELNRIEKMLDGKLKFMERILTESERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVA 110
>gi|30018499|ref|NP_830130.1| Holo-[acyl-carrier protein] synthase [Bacillus cereus ATCC 14579] >gi|59797854|sp|Q81IT7|ACPS_BACCR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|29894039|gb|AAP07331.1| Holo-[acyl-carrier protein] synthase [Bacillus cereus ATCC 14579] (119 aa)
Score = 96, Expect = 1.7e-02, Identities = 27/98 (27%), Positives = 53/98 (54%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           ++ +I+  ++   KF++R+LT+NE N  +++  +    F+A R+A KEA  KA+      ++ F++IE   ++       T     V +S   ++ FA A
  S:    11 ELNRIEKMLDGKLKFMERILTENERNVAMELKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVKNDERGKPILITSTEYIVHLSISHSKEFAVA 110
>gi|1169645|sp|P43098|FAS2_CANAL Fatty acid synthase subunit alpha [Includes: Acyl carrier; 3-oxoacyl-[acyl-carrier-protein] reductase (Beta-ketoacyl reductase); 3-oxoacyl-[acyl-carrier-protein] synthase (Beta-ketoacyl synthase)] >gi|456443|gb|AAA34345.1| fatty acid synthase alpha subunit (1885 aa)
Score = 96, Expect = 1.7e-02, Identities = 38/114 (33%), Positives = 56/114 (49%)
  Q:     4 KMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRF-LASRWALKEATFKAINEFHK---IFFINIEFIKNDNNS------------YTCTTFKNVKVSISYDGNQVFATAI 117
           K   T+NK +  +G+DV  +      ++ FI+R  T NE    L   N   P+      W+ KEA FKA+    K      I+IE  ++ N +                  KNV +SIS+D  Q  A A+
  S:  1756 KALSTLNKSSKGVGVDVELLSAINIDNETFIERNFTGNEVEYCL---NTAHPQASFTGTWSAKEAVFKALGVESKGAGASLIDIEITRDVNGAPKVILHGEAKKAAAKAGVKNVNISISHDDFQATAVAL 1882
>gi|196124973|ref|ZP_03116722.1| 4'-phosphopantetheinyl transferase [Clostridium difficile ATCC 43255] (126 aa)
Score = 96, Expect = 1.7e-02, Identities = 37/104 (35%), Positives = 63/104 (60%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKNDNNSYTCTTFKN------------VKVSISYDGNQVFATAI 117
           F+IG+D+ +ID     V+K+++F++++ TD E   +     N K   +A  +A KEA  K+I    ++F F +IE ++N+    T  T+ N            +KVSIS+  +   A AI
  S:     4 FDIGVDIIEIDRIRKAVDKNNRFLEKIFTDREIEYF--NSKNFKAESIAGNFAAKEAISKSIGTGIRVFNFKDIEVLRNEMGKPTVKTYNNLAKMCIDYNVLEIKVSISHSKDYAIANAI 121
>gi|94989167|ref|YP_597268.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS9429] >gi|94993057|ref|YP_601156.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS2096] >gi|123257720|sp|Q1JA49|ACPS_STRPB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|123258140|sp|Q1JK99|ACPS_STRPC Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|94542675|gb|ABF32724.1| holo-(acyl-carrier protein) synthase [Streptococcus pyogenes MGAS9429] >gi|94546565|gb|ABF36612.1| holo-synthase [Streptococcus pyogenes MGAS2096] (118 aa)
Score = 96, Expect = 1.7e-02, Identities = 33/101 (32%), Positives = 56/101 (55%)
  Q:    17 GID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID   ++ I+    ++ +F +++LT+ E   +       +  +LA RW+ KEA  KAI     ++ F +IE + +       T + FK N  +SIS+ GN V A+ I
  S:     6 GIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFVKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVI 113
>gi|167937093|ref|ZP_02524168.1| Holo- [Bacillus cereus AH1134] (119 aa)
Score = 96, Expect = 1.8e-02, Identities = 27/98 (27%), Positives = 53/98 (54%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           ++ +I+  ++   KF++R+LT+NE N  +++  +    F+A R+A KEA  KA+      ++ F++IE   ++       T     V +S   ++ FA A
  S:    11 ELNRIEKMLDGKLKFMERILTENERNVAMELKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVKNDERGKPILITSTEYIVHLSISHSKEFAVA 110
>gi|15988400|pdb|1FTE|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 1) >gi|15988401|pdb|1FTE|B Chain B, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 1) >gi|15988402|pdb|1FTE|C Chain C, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 1) >gi|15988403|pdb|1FTF|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 2) >gi|15988404|pdb|1FTF|B Chain B, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 2) >gi|15988405|pdb|1FTF|C Chain C, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (Native 2) >gi|15988406|pdb|1FTH|A Chain A, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (3'5'-Adp Complex) >gi|15988407|pdb|1FTH|B Chain B, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (3'5'-Adp Complex) >gi|15988408|pdb|1FTH|C Chain C, Crystal Structure Of Streptococcus Pneumoniae Acyl Carrier Protein Synthase (3'5'-Adp Complex) (122 aa)
Score = 96, Expect = 2.0e-02, Identities = 31/101 (30%), Positives = 56/101 (55%)
  Q:    17 GIDVTK---IDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +   I+  V + + F KR+LT  E  ++  +    +  +LA RW+ KEA  KA+     K+ F ++E + N+  +  ++   F   + +SIS+    V A+ I
  S:     8 GIDIEELASIESAVTRHEGFAKRVLTALEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVI 115
>gi|152974080|ref|YP_001373597.1| holo-acyl-carrier-protein synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189027318|sp|A7GKE4|ACPS_BACCN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|152022832|gb|ABS20602.1| holo-acyl-carrier-protein synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] (119 aa)
Score = 96, Expect = 2.0e-02, Identities = 36/101 (35%), Positives = 56/101 (55%)
  Q:    16 IGIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVK--VSISYDGNQVFATA 116
           IGID+    +I+  +N    FI+R+LT+ E +   K+       F+A R+A KEA  KA+      ++ F++IE IKND        F N +  V +S   ++ FA A
  S:     5 IGIDIIELNRIEKMINGKLNFIERILTETERDVAAKLKGKRLVEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIE-IKNDQKGKP-VLFTNTEYIVHLSISHSREFAVA 110
>gi|75760681|ref|ZP_00740707.1| Holo-[acyl-carrier protein] synthase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74491831|gb|EAO55021.1| Holo-[acyl-carrier protein] synthase [Bacillus thuringiensis serovar israelensis ATCC 35646] (119 aa)
Score = 95, Expect = 2.2e-02, Identities = 26/98 (26%), Positives = 53/98 (54%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           ++ +I+  ++   KF++R+LT+NE N  +++  +    F+A R+A KEA  KA+      ++ F+++E   ++       T     V +S   ++ FA A
  S:    11 ELNRIEKMLDGKLKFMERILTENERNVAMELKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDVEVKNDERGKPILITSTEYVVHLSISHSKEFAVA 110
>gi|138893879|ref|YP_001124332.1| 4'-phosphopantetheinyl transferase [Geobacillus thermodenitrificans NG80-2] >gi|196250547|ref|ZP_03149237.1| holo-acyl-carrier-protein synthase [Geobacillus sp. G11MC16] >gi|166198200|sp|A4IJT3|ACPS_GEOTN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|134265392|gb|ABO65587.1| Holo-(acyl carrier protein) synthase [Geobacillus thermodenitrificans NG80-2] >gi|196209896|gb|EDY04665.1| holo-acyl-carrier-protein synthase [Geobacillus sp. G11MC16] (129 aa)
Score = 95, Expect = 2.3e-02, Identities = 30/102 (29%), Positives = 55/102 (53%)
  Q:    16 IGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKN---VKVSISYDGNQVFATAI 117
           IGID+    +I   + ++ KF+ R+LT  E  Q+ ++    +  FLA R+A KEA  KA+       + F +IE + ++    +    ++   + +SIS+  +   A  I
  S:     5 IGIDIVELERIQSLLERNRKFLDRILTPREREQFDQLAPARQVEFLAGRFAAKEAYAKALGTGIGRHVSFQDIEIVSDEYGKPSIAARRDGEVIHLSISHSRDYAIAQVI 114
>gi|19746745|ref|NP_607881.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS8232] >gi|21911100|ref|NP_665368.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS315] >gi|28895215|ref|NP_801565.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes SSI-1] >gi|50914871|ref|YP_060843.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS10394] >gi|56808268|ref|ZP_00366036.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Streptococcus pyogenes M49 591] >gi|94991110|ref|YP_599210.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS10270] >gi|94994988|ref|YP_603086.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS10750] >gi|139473189|ref|YP_001127904.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes str. Manfredo] >gi|166198236|sp|Q1JF93|ACPS_STRPD Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198237|sp|Q1J544|ACPS_STRPF Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198238|sp|A2RCT2|ACPS_STRPG Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54036695|sp|P63474|ACPS_STRP8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|54040679|sp|P63473|ACPS_STRP3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59797666|sp|Q5XAA3|ACPS_STRP6 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|19748974|gb|AAL98380.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes MGAS8232] >gi|21905310|gb|AAM80171.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes MGAS315] >gi|28810461|dbj|BAC63398.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes SSI-1] >gi|50903945|gb|AAT87660.1| Holo-[acyl-carrier protein] synthase [Streptococcus pyogenes MGAS10394] >gi|94544618|gb|ABF34666.1| holo-synthase [Streptococcus pyogenes MGAS10270] >gi|94548496|gb|ABF38542.1| holo-synthase [Streptococcus pyogenes MGAS10750] >gi|134271435|emb|CAM29655.1| holo-[acyl-carrier protein] synthase [Streptococcus pyogenes str. Manfredo] (118 aa)
Score = 95, Expect = 2.4e-02, Identities = 33/101 (32%), Positives = 56/101 (55%)
  Q:    17 GID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID   ++ I+    ++ +F +++LT+ E   +       +  +LA RW+ KEA  KAI     ++ F +IE + +       T + FK N  +SIS+ GN V A+ I
  S:     6 GIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVI 113
>gi|56418763|ref|YP_146081.1| 4'-phosphopantetheinyl transferase [Geobacillus kaustophilus HTA426] >gi|61211382|sp|Q5L3G7|ACPS_GEOKA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|56378605|dbj|BAD74513.1| holo-[acyl-carrier protein] synthase [Geobacillus kaustophilus HTA426] (129 aa)
Score = 95, Expect = 2.5e-02, Identities = 31/102 (30%), Positives = 56/102 (54%)
  Q:    16 IGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKN---VKVSISYDGNQVFATAI 117
           IGID+    +I   + +S KF +R+LT  E  Q+ ++    +  FLA R+A KEA  KA+       + F +IE + +++   +    ++   V +SIS+  +   A  +
  S:     5 IGIDIVELERIRSLLERSRKFPERILTPREKAQFGELPPARQAEFLAGRFAAKEAYAKALGTGIGRHLSFQDIEIVSDEHGKPSIAARRDGETVHLSISHSRDYAVAQVV 114
>gi|125717408|ref|YP_001034541.1| 4'-phosphopantetheinyl transferase [Streptococcus sanguinis SK36] >gi|166198240|sp|A3CLD6|ACPS_STRSV Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|125497325|gb|ABN43991.1| Acyl carrier protein synthase, putative [Streptococcus sanguinis SK36] (120 aa)
Score = 95, Expect = 2.5e-02, Identities = 32/101 (31%), Positives = 58/101 (57%)
  Q:    17 GIDVTK---IDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID+ +   I+    K+ +F K++LT+ E +++ ++    K  FLA RWA KEA  KA      K+ F ++E + +   +  ++ + F   V +S+S+    V A+ I
  S:     6 GIDIEELVAIERAYLKNARFAKKVLTEAELSRFEELSGKRKIEFLAGRWAAKEAFSKAWGTGIGKLRFQDLEILNDRQGAPYFSRSPFTGKVWISLSHAAGLVTASVI 113
>gi|85059761|ref|YP_455463.1| 4'-phosphopantetheinyl transferase [Sodalis glossinidius str. 'morsitans'] >gi|123519064|sp|Q2NS17|ACPS_SODGM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|84780281|dbj|BAE75058.1| holo-(acyl-carrier protein) synthase [Sodalis glossinidius str. 'morsitans'] (126 aa)
Score = 94, Expect = 2.7e-02, Identities = 21/55 (38%), Positives = 39/55 (70%)
  Q:    18 IDVTKIDYFVNKS-DKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +++ +I+  V++S D+  +R+L+ +E+ QY +  +N   RFLA R+A+KEA  KA+
  S:    11 VEIGRIEAVVSRSGDRLARRILSPDEWRQYQQ--HNQLVRFLAKRFAVKEAASKAL 64
>gi|168144351|ref|ZP_02587580.1| Holo- [Bacillus cereus G9842] (119 aa)
Score = 94, Expect = 3.3e-02, Identities = 27/98 (27%), Positives = 52/98 (53%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           ++ +I+  ++   KF++R+LT NE N  +++  +    F+A R+A KEA  KA+      ++ F++IE   ++       T     V +S   ++ FA A
  S:    11 ELNRIEKMLDGKLKFMERILTKNERNVAMELKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVKNDERGKPILITSTEYVVHLSISHSKEFAVA 110
>gi|59712690|ref|YP_205466.1| 4'-phosphopantetheinyl transferase [Vibrio fischeri ES114] >gi|75431524|sp|Q5E318|ACPS_VIBF1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|59480791|gb|AAW86578.1| holo-(acyl-carrier-protein) synthase [Vibrio fischeri ES114] (126 aa)
Score = 94, Expect = 3.3e-02, Identities = 34/103 (33%), Positives = 56/103 (54%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK-------------NVKVSISYDGNQVFATAIY 118
           +G D+ +I+          D F +R+L+ +E+ +Y ++    K RFLA R+A KEA  KA+     H + F +   I ND N     T               N+ ++IS + +   AT I+
  S:     6 LGTDIAEIERVEKALSRSGDAFAERILSQSEFEKYQELKQ--KGRFLAKRFAAKEAASKALGTGIAHGVTFHDFT-ISNDENGKPMLTLSGKALELSKKSDIANIHLTISDERHYAVATVIF 124
>gi|15675638|ref|NP_269812.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes M1 GAS] >gi|71911346|ref|YP_282896.1| 4'-phosphopantetheinyl transferase [Streptococcus pyogenes MGAS5005] >gi|20137444|sp|Q99Y97|ACPS_STRP1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|13622848|gb|AAK34533.1| putative holo-(acyl carrier protein) synthase [Streptococcus pyogenes M1 GAS] >gi|71854128|gb|AAZ52151.1| holo-[acyl-carrier protein] synthase [Streptococcus pyogenes MGAS5005] (118 aa)
Score = 94, Expect = 3.4e-02, Identities = 33/101 (32%), Positives = 56/101 (55%)
  Q:    17 GID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           GID   ++ I+    ++ +F +++LT+ E   +       +  +LA RW+ KEA  KAI     ++ F +IE + +       T + FK N  +SIS+ GN V A+ I
  S:     6 GIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLNYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVI 113
>gi|124520609|ref|ZP_01695737.1| Phosphopantethiene-protein transferase [Bacillus coagulans 36D1] >gi|124497470|gb|EAY45029.1| Phosphopantethiene-protein transferase [Bacillus coagulans 36D1] (116 aa)
Score = 94, Expect = 3.4e-02, Identities = 32/102 (31%), Positives = 50/102 (49%)
  Q:    16 IGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNS--YTCTTFKNVKVSISYDGNQVFATAI 117
           IGID+    +I     +  +F  R+LT  E  ++ K+    K  FLA R+A KEA  KA        + F  IE  K++N    ++     +  +SI++     FA  I
  S:     5 IGIDIVELERIKKLYERQPRFPGRILTKAEQQKFCKLTEKRKIEFLAGRFAAKEAYSKAFGTGIGGALSFQEIEIAKDENGRPYFSKPAEPHAHLSITHSREYAFAQVI 113
>gi|20137474|sp|Q9FCV3|ACPS_LACRE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) (117 aa)
Score = 93, Expect = 3.9e-02, Identities = 36/104 (34%), Positives = 53/104 (50%)
  Q:    14 FNIGIDVTKIDYF--VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTT--FKNV-KVSISYDGNQVFATAI 117
           + IGID+T ID F  ++    FIK++LTD E  +           FLA  +++KE+  KA       K+ F +IE   +DN     +   F  V  VSIS+  + V    I
  S:     3 YGIGIDITNIDRFKALHNPTSFIKKVLTDKEQAELAGKSGQRAYEFLAGHFSVKESYSKAYGTGLGKKLNFQDIEVEYDDNGRPVISNHPFAGVAHVSISHSKHHVVTQVI 113
>gi|68465599|ref|XP_723161.1| fatty acid synthase alpha subunit, C terminal fragment [Candida albicans SC5314] >gi|68465892|ref|XP_723014.1| fatty acid synthase alpha subunit, C terminal fragment [Candida albicans SC5314] >gi|46445026|gb|EAL04297.1| fatty acid synthase alpha subunit, C terminal fragment [Candida albicans SC5314] >gi|46445182|gb|EAL04452.1| fatty acid synthase alpha subunit, C terminal fragment [Candida albicans SC5314] (905 aa)
Score = 93, Expect = 4.1e-02, Identities = 37/114 (32%), Positives = 56/114 (49%)
  Q:     4 KMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRF-LASRWALKEATFKAINEFHK---IFFINIEFIKNDNNS------------YTCTTFKNVKVSISYDGNQVFATAI 117
           K   ++NK +  +G+DV  +      ++ FI+R  T NE    L   N   P+      W+ KEA FKA+    K      I+IE  ++ N +                  KNV +SIS+D  Q  A A+
  S:   776 KALSSLNKSSKGVGVDVELLSAINIDNETFIERNFTGNEVEYCL---NTAHPQASFTGTWSAKEAVFKALGVESKGAGASLIDIEITRDVNGAPKVILHGEAKKAAAKAGVKNVNISISHDDFQATAVAL 902
>gi|24380197|ref|NP_722152.1| 4'-phosphopantetheinyl transferase [Streptococcus mutans UA159] >gi|29427724|sp|Q8DSF3|ACPS_STRMU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|24378202|gb|AAN59458.1|AE015010_7 putative acyl carrier protein synthase; AcpS [Streptococcus mutans UA159] (119 aa)
Score = 93, Expect = 4.1e-02, Identities = 29/99 (29%), Positives = 51/99 (51%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS--YTCTTFK-NVKVSISYDGNQVFATAI 117
           D+  +     +S +F  ++LT  E   +  +    +  +LA RWA KEA  KA       + F ++E + N+  +  +T + F  N+ +SIS+  N V A+ I
  S:    11 DIAAVQRAHERSSRFASKVLTFKELEIFTSLKGRRQVEYLAGRWAAKEAFSKAYGSGIGSLRFQDLEILANNKGAPIFTKSPFSGNIFISISHSKNYVEASVI 113
>gi|126132280|ref|XP_001382665.1| holo-(acyl-carrier protein) synthase [Pichia stipitis CBS 6054] >gi|126094490|gb|ABN64636.1| holo-(acyl-carrier protein) synthase [Pichia stipitis CBS 6054] (136 aa)
Score = 93, Expect = 4.2e-02, Identities = 36/102 (35%), Positives = 58/102 (56%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLT-----DNEYNQYLKI-DNNLKPRFLASRWALKEATFKAIN-EFHKIFFINIEFIKND--------NNSYTCTTFKNVKVSISYDGNQVFATAI 117
           IG+DV   D F   V++  +F+ +L        +E  ++ +I D   K +FLA  WA KEA FK ++    K F     F K          N++Y  +  +   +SIS+D N + A+A+
  S:    13 IGVDVVNTDRFRRLVSRDPRFLAKLTARILHPQHELPEFFRISDAENKVKFLAGSWASKEAVFKTLDISSQKQFQFKHWFRKYSEQGKPHICNDNYPQSEQEEFLLSISHDSNVLVASAL 132
>gi|168185664|ref|ZP_02620299.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum C str. Eklund] >gi|169296207|gb|EDS78340.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum C str. Eklund] (138 aa)
Score = 93, Expect = 4.2e-02, Identities = 28/74 (37%), Positives = 44/74 (59%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKND 89
           IG D+ +ID     + ++  F+ +L T  E  +YL I   ++P F+A ++A KEA  KA+   F K  F +IE  KN+
  S:     5 IGTDIVEIDRINRAIERTPNFVSKLFTTTEI-KYL-ISRKMRPEFVAGKFAAKEAVAKALGTGFRKFRFRDIEINKNE 80
>gi|87118653|ref|ZP_01074552.1| holo-(acyl-carrier protein) synthase [Marinomonas sp. MED121] >gi|86166287|gb|EAQ67553.1| holo-(acyl-carrier protein) synthase [Marinomonas sp. MED121] (142 aa)
Score = 93, Expect = 4.3e-02, Identities = 25/72 (34%), Positives = 44/72 (61%)
  Q:     1 VNYKMEKTINKPNFNIGIDVTKI----DYFVNKSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAI 72
           +N+ + + +N     IG D+ +I    D      D+F+KRLLT  E ++Y +I + ++   ++A R+A KEA  KA+
  S:     5 INFLLSEWVNMI-LGIGTDIVEIPRIKDSVKRLGDRFLKRLLTQKELDRYYEIKHEDVAMAYVAKRFAAKEAVAKAL 80
>gi|154151282|ref|YP_001404900.1| holo-acyl-carrier-protein synthase [Candidatus Methanoregula boonei 6A8] >gi|153999834|gb|ABS56257.1| holo-acyl-carrier-protein synthase [Candidatus Methanoregula boonei 6A8] (151 aa)
Score = 93, Expect = 4.5e-02, Identities = 34/107 (31%), Positives = 56/107 (52%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDN---EYNQYLKIDNNLKPRFLASRWALKEATFKAINEFH--KIFFINIEFIKNDN-------NSYTCTTFKNVKVSISYDGNQVFATAIYL 119
           +  IG D+ +I  F N  D+ +   L  N   E  +Y    +   P  LA+R+A KEA  KAI+  +  +IF+ +IE + N+        N+  C     +K+S+S+      A  I +
  S:    32 DIGIGTDIEEIRRFENFRDRAVAAFLEKNFTREEREYCLSKDAPAPH-LAARFAGKEAIIKAISSLNIPRIFYPDIEILNNERGVPCVRINTEHCEKL-CIKLSLSHSSGMALAFCIII 148
>gi|163789885|ref|ZP_02184321.1| 4'-phosphopantetheinyl transferase [Carnobacterium sp. AT7] >gi|159874825|gb|EDP68893.1| 4'-phosphopantetheinyl transferase [Carnobacterium sp. AT7] (116 aa)
Score = 92, Expect = 5.0e-02, Identities = 35/102 (34%), Positives = 53/102 (51%)
  Q:    16 IGIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNS---YTCTTFKNVKVSISYDGNQVFATAI 117
           IG+D+   T+I     K + F  R+LT  E   + ++  N +  FLA R+A KEA  KA+     K+ F +IE I ++        C    NV +SI++    V A  I
  S:     5 IGLDIAEITRIKEAYLKRETFSSRVLTPAEMEIFSRLKGNRQMEFLAGRYAAKEAFSKAMGTGIGKLGFQDIEIIPDNYGKPVVEKCPFQGNVFLSITHTDTIVAAQII 113
>gi|159128092|gb|EDP53207.1| fatty acid synthase alpha subunit FasA, putative [Aspergillus fumigatus A1163] (1857 aa)
Score = 92, Expect = 5.2e-02, Identities = 35/113 (30%), Positives = 59/113 (52%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCTT------------FKNVKVSISYDGNQVFATAI 117
           + K   + N  IG+DV  ID    +++ FI+R  T +E  +Y +  ++ +  F A RW+ KEA FK++    K       +IE + + + +                  K V VSIS+  +Q  A A+
  S:  1729 LAKAHAEDNSRIGVDVENIDAVNIENETFIERNFTASE-QEYCRKASSPQSSF-AGRWSAKEAVFKSLGVCSKGAGAPLKDIEILSDTSGAPVVNLHGAAAEAARQAGVKQVSVSISHSDSQAVAVAV 1854
>gi|70986490|ref|XP_748738.1| fatty acid synthase alpha subunit FasA [Aspergillus fumigatus Af293] >gi|66846367|gb|EAL86700.1| fatty acid synthase alpha subunit FasA [Aspergillus fumigatus Af293] (1857 aa)
Score = 92, Expect = 5.2e-02, Identities = 35/113 (30%), Positives = 59/113 (52%)
  Q:     5 MEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCTT------------FKNVKVSISYDGNQVFATAI 117
           + K   + N  IG+DV  ID    +++ FI+R  T +E  +Y +  ++ +  F A RW+ KEA FK++    K       +IE + + + +                  K V VSIS+  +Q  A A+
  S:  1729 LAKAHAEDNSRIGVDVENIDAVNIENETFIERNFTASE-QEYCRKASSPQSSF-AGRWSAKEAVFKSLGVCSKGAGAPLKDIEILSDTSGAPVVNLHGAAAEAARQAGVKQVSVSISHSDSQAVAVAV 1854
>gi|194683226|emb|CAR43907.1| holo-[acyl-carrier protein] synthase [Proteus mirabilis HI4320] (126 aa)
Score = 92, Expect = 5.3e-02, Identities = 21/55 (38%), Positives = 40/55 (72%)
  Q:    18 IDVTKIDYFVNKS-DKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKAI 72
           +++++I+  + +S ++  +R+LTDNE+  Y    ++ +P RFLA R+A+KEA  KA+
  S:    11 VEISRIEEIIGRSGERLARRILTDNEWIIY---QSHKQPVRFLAKRFAVKEAAAKAL 64
>gi|156932894|ref|YP_001436810.1| 4'-phosphopantetheinyl transferase [Enterobacter sakazakii ATCC BAA-894] >gi|166198199|sp|A7MH03|ACPS_ENTS8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|156531148|gb|ABU75974.1| hypothetical protein ESA_00696 [Enterobacter sakazakii ATCC BAA-894] (126 aa)
Score = 92, Expect = 5.6e-02, Identities = 22/54 (40%), Positives = 38/54 (70%)
  Q:    18 IDVTKIDYFVNKS-DKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKA 71
           +++ +I+  +++S D+  KR+L+ NE+ QY     + +P RFLA R+A+KEA  KA
  S:    11 VEIDRIEAVISRSGDRLAKRVLSANEWAQY---QAHQQPVRFLAKRFAVKEAAAKA 63
>gi|89099492|ref|ZP_01172368.1| 4'-phosphopantetheinyl transferase [Bacillus sp. NRRL B-14911] >gi|89085878|gb|EAR65003.1| 4'-phosphopantetheinyl transferase [Bacillus sp. NRRL B-14911] (125 aa)
Score = 92, Expect = 5.6e-02, Identities = 21/56 (37%), Positives = 35/56 (62%)
  Q:    16 IGIDVTKIDYFVNKSD--KFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           IGID+ +I+     ++  KF +R+LT+ E  +Y+ +    +  F+A R+A KEA  KA
  S:     8 IGIDIVEIERISRMANRAKFSERILTEGELAKYITLSEKRQLEFIAGRFAAKEAFSKA 65
>gi|168714974|ref|ZP_02747251.1| 4'-phosphopantetheinyl transferase [Clostridium difficile QCD-63q42] (126 aa)
Score = 92, Expect = 5.8e-02, Identities = 36/104 (34%), Positives = 62/104 (59%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKNDNNSYTCTTFKN------------VKVSISYDGNQVFATAI 117
           F+IG+D+ +ID     V+K+++F++++ TD E   +     N K   +A  +A KEA  K+I    ++F F +IE ++N+       T+ N            +KVSIS+  +   A AI
  S:     4 FDIGVDIIEIDRIRKAVDKNNRFLEKIFTDREIEYF--NSKNFKAESIAGNFAAKEAISKSIGTGIRVFNFKDIEVLRNEMGKPIVKTYNNLAKMCIDYNVLEIKVSISHSKDYAIANAI 121
>gi|163728751|ref|ZP_02136234.1| 4'-phosphopantetheinyl transferase [Vibrio fischeri MJ11] >gi|161398230|gb|EDQ22516.1| 4'-phosphopantetheinyl transferase [Vibrio fischeri MJ11] (126 aa)
Score = 92, Expect = 5.9e-02, Identities = 34/103 (33%), Positives = 55/103 (53%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK-------------NVKVSISYDGNQVFATAIY 118
           +G D+ +I+          D F +R+L+ +E+  Y ++    K RFLA R+A KEA  KA+     H + F +   I ND N     T               N+ ++IS + +   AT I+
  S:     6 LGTDIAEIERVEKALSRSGDAFAERILSQSEFEIYQELKQ--KGRFLAKRFAAKEAASKALGTGIAHGVTFHDFT-ISNDENGKPMLTLSGKALELSQKSHIANIHLTISDERHYAVATVIF 124
>gi|149194579|ref|ZP_01871675.1| Phosphopantethiene-protein transferase [Caminibacter mediatlanticus TB-2] >gi|149135323|gb|EDM23803.1| Phosphopantethiene-protein transferase [Caminibacter mediatlanticus TB-2] (113 aa)
Score = 92, Expect = 5.9e-02, Identities = 42/104 (40%), Positives = 54/104 (51%)
  Q:    16 IGIDVTKIDYFVNKSDKF----IKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDN-----NSYTCTTF--KNVKVSISYDGNQVFATAIYL 119
           IGID+ KI       +KF    + R LT NE N  LK      P  +A  WA KEA  KAI      +  F++IE +KN+      +  T   F  K   +SIS+DG    A  I L
  S:     2 IGIDIVKISRVEKLIEKFGYKALDRFLTQNEQN-ILK-----SPSSIAGFWAAKEAFSKAIGTGIGKECSFLDIEILKNEKGKPYFSPKTIQKFNLKKADLSISHDGGFAIAAVIIL 112
>gi|9798536|emb|CAC03496.1| hypothetical protein [Lactobacillus reuteri] (137 aa)
Score = 91, Expect = 6.0e-02, Identities = 40/110 (36%), Positives = 57/110 (51%)
  Q:     8 TINKPN------FNIGIDVTKIDYF--VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTT--FKNV-KVSISYDGNQVFATAI 117
           TIN  N      + IGID+T ID F  ++    FIK++LTD E  +           FLA  +++KE+  KA       K+ F +IE   +DN     +   F  V  VSIS+  + V    I
  S:    11 TINDDNGRIHMIYGIGIDITNIDRFKALHNPTSFIKKVLTDKEQAELAGKSGQRAYEFLAGHFSVKESYSKAYGTGLGKKLNFQDIEVEYDDNGRPVISNHPFAGVAHVSISHSKHHVVTQVI 133
>gi|145952620|ref|ZP_01801629.1| hypothetical protein CdifQ_04003996 [Clostridium difficile QCD-32g58] >gi|168697755|ref|ZP_02730032.1| 4'-phosphopantetheinyl transferase [Clostridium difficile QCD-37x79] >gi|168726390|ref|ZP_02758667.1| 4'-phosphopantetheinyl transferase [Clostridium difficile QCD-76w55] >gi|168730164|ref|ZP_02762441.1| 4'-phosphopantetheinyl transferase [Clostridium difficile QCD-97b34] >gi|196162327|ref|ZP_03122888.1| 4'-phosphopantetheinyl transferase [Clostridium difficile CIP 107932] (126 aa)
Score = 91, Expect = 6.5e-02, Identities = 36/104 (34%), Positives = 62/104 (59%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKNDNNSYTCTTFKN------------VKVSISYDGNQVFATAI 117
           F+IG+D+ +ID     V+K+++F++++ TD E   +     N K   +A  +A KEA  K+I    ++F F +IE ++N+       T+ N            +KVSIS+  +   A AI
  S:     4 FDIGVDIIEIDRIRKAVDKNNRFLEKIFTDREIEYF--NSKNFKAESIAGNFAAKEAISKSIGTGIRLFNFKDIEVLRNEMGKPIVKTYNNLAKMCIDYNVLEIKVSISHSKDYAIANAI 121
>gi|169350454|ref|ZP_02867392.1| hypothetical protein CLOSPI_01222 [Clostridium spiroforme DSM 1552] >gi|169292774|gb|EDS74907.1| hypothetical protein CLOSPI_01222 [Clostridium spiroforme DSM 1552] (110 aa)
Score = 91, Expect = 6.7e-02, Identities = 32/102 (31%), Positives = 50/102 (49%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYL-KIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           IG D+  ++   +  D+F  ++LT  E+  Y  K  +  K  FL  R+A KEA FKA+    K+   N   I ND N      + N  +SI+++ +   A  I
  S:     5 IGCDIVDLNRLNDCLDEFACKILTFKEFEIYRNKKTDKQKREFLGGRFAGKEAFFKAVGIEEKLVSFNDVEILNDTNGKPFLNYVNSYISIAHENDYAIAYVI 107
>gi|172058813|ref|YP_001815273.1| holo-acyl-carrier-protein synthase [Exiguobacterium sibiricum 255-15] >gi|171991334|gb|ACB62256.1| holo-acyl-carrier-protein synthase [Exiguobacterium sibiricum 255-15] (128 aa)
Score = 91, Expect = 7.3e-02, Identities = 19/58 (32%), Positives = 36/58 (62%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           F IG+D+ +++     + +  + +KR+LT  E N++  + +  +  +LA R+A KEA  KA
  S:     3 FGIGLDLVELEQIRQTLERQPRIVKRVLTAEEQNRFYTLSDKRQLEYLAGRFAAKEAFVKA 63
>gi|149388856|gb|EAZ62811.2| Fatty acid synthase subunit alpha Includes: Acyl carrier 3-oxoacyl-[acyl-carrier-protein] reductase (Beta-ketoacyl reductase) 3-oxoacyl-[acyl-carrier-protein] synthase (Beta-ketoacyl synthase) [Pichia stipitis CBS 6054] (1880 aa)
Score = 91, Expect = 7.4e-02, Identities = 34/114 (29%), Positives = 58/114 (50%)
  Q:     4 KMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI---NEFHKIFFINIEFIKNDNN------------SYTCTTFKNVKVSISYDGNQVFATAI 117
           K   T+NK +  +G+DV  +     +++ F++R  T  E     K  ++         W+ KEA FKA+   ++      I+IE +++ N             + +    KNV VSIS+D  Q  A A+
  S:  1751 KALSTLNKSSKGVGVDVELLSAINLENETFVERNFTAAEVAYCTK--SSFPQASFTGTWSAKEAVFKALGVKSQGAGASLIDIEIVRDGNGAPKVVLNGTAKAAASKAGVKNVSVSISHDDFQATAVAL 1877
>gi|126275364|ref|XP_001386834.1| Fatty acid synthase subunit alpha Includes: Acyl carrier 3-oxoacyl-[acyl-carrier-protein] reductase (Beta-ketoacyl reductase) 3-oxoacyl-[acyl-carrier-protein] synthase (Beta-ketoacyl synthase) [Pichia stipitis CBS 6054] (1880 aa)
Score = 91, Expect = 7.4e-02, Identities = 34/114 (29%), Positives = 58/114 (50%)
  Q:     4 KMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI---NEFHKIFFINIEFIKNDNN------------SYTCTTFKNVKVSISYDGNQVFATAI 117
           K   T+NK +  +G+DV  +     +++ F++R  T  E     K  ++         W+ KEA FKA+   ++      I+IE +++ N             + +    KNV VSIS+D  Q  A A+
  S:  1751 KALSTLNKSSKGVGVDVELLSAINLENETFVERNFTAAEVAYCTK--SSFPQASFTGTWSAKEAVFKALGVKSQGAGASLIDIEIVRDGNGAPKVVLNGTAKAAASKAGVKNVSVSISHDDFQATAVAL 1877
>gi|157060221|dbj|BAF79876.1| fatty acid synthase alpha subunit [Pichia angusta] (1878 aa)
Score = 90, Expect = 8.1e-02, Identities = 35/102 (34%), Positives = 54/102 (52%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTC------------TTFKNVKVSISYDGNQVFATAI 117
           +G+DV  +     +++ F++R  TD E  QY    +  +  F A  W+ KEA FK++    K       NIE I++ N + +                K +KVSIS+D  Q  A AI
  S:  1761 VGVDVELLSAVNIENETFLERNFTDTEI-QYCTSSSCPRASF-AGTWSAKEAVFKSLGVKSKGAGASMKNIEIIRDINGAPSVRLHGEAGVAASDQGVKAIKVSISHDDIQSIAVAI 1875
>gi|90961337|ref|YP_535253.1| Holo-[acyl-carrier protein] synthase [Lactobacillus salivarius UCC118] >gi|122993089|sp|Q1WV15|ACPS_LACS1 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|90820531|gb|ABD99170.1| Holo-[acyl-carrier protein] synthase [Lactobacillus salivarius UCC118] (135 aa)
Score = 90, Expect = 8.1e-02, Identities = 38/99 (38%), Positives = 50/99 (50%)
  Q:    19 DVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFK-------NVKVSISYDGNQVFATAI 117
           ++ KI     K + F KR+LT NE   + K   N K  FLA R++ KEA  KA       K+ F +IE I NDN +      K         K+SIS+ G  V    I
  S:    11 EIRKIQKAQEKRESFAKRILTVNELAIFEKYKGNRKYEFLAGRFSAKEAFSKAYGTGIGKKVGFQDIE-ILNDNQTGRPEIVKFPGDNKLQAKISISHSGEYVVTEVI 117
>gi|171683421|ref|XP_001906653.1| unnamed protein product [Podospora anserina] >gi|170941670|emb|CAP67324.1| unnamed protein product [Podospora anserina] (1871 aa)
Score = 90, Expect = 8.9e-02, Identities = 20/66 (30%), Positives = 30/66 (45%)
  Q:     7 KTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKAI 72
           + +   N  +G+D+  I      SD F+ R  T+ E            P +  A RW+ KEA FKA+
  S:  1742 RALETANTQVGMDIEDIKSINTNSDTFLDRNFTEAEMKYCFSSSTGRSPQKAFAGRWSAKEAVFKAL 1808
>gi|42561108|ref|NP_975559.1| holo-[acyl-carrier-protein] synthase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|188159260|ref|ZP_02998651.1| holo-[acyl-carrier-protein] synthase [Mycoplasma mycoides subsp. mycoides LC str. GM12] >gi|61211517|sp|Q6MT35|ACPS_MYCMS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|42492605|emb|CAE77201.1| holo-[acyl-carrier-protein] synthase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (110 aa)
Score = 90, Expect = 9.3e-02, Identities = 29/103 (28%), Positives = 53/103 (51%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           N+GID+ + +  +    +FI ++L+ NE   +       K  FLA RWA+KEA  K +++   +  I+IE++ N          +N+ +SIS++       A+
  S:     4 NVGIDIVE-NKRIKLKKEFIIKVLSTNEIQTFNTKTKKQKKEFLAGRWAVKEAIIKTLDQAISMNKIDIEYV-NQKPVIQNKELQNILISISHEKKYAIGIAL 104
>gi|94502131|ref|ZP_01308632.1| 4'-phosphopantetheinyl transferase [Oceanobacter sp. RED65] >gi|94425733|gb|EAT10740.1| 4'-phosphopantetheinyl transferase [Oceanobacter sp. RED65] (127 aa)
Score = 89, Expect = 1.0e-01, Identities = 26/96 (27%), Positives = 54/96 (56%)
  Q:    16 IGIDVTKID----YFVNKSDKFIKRLLTDNEYNQ-YLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQ 111
           IG D+ +I+     +  + +K + R+LT +E  + Y  I+++++  +LA RW  KEA  KA+       + F +IE   +++ +      K+ ++ ++  G Q
  S:     5 IGTDIVEIERIYQVYQRQGEKLVNRVLTPSEQERFYSMINDDVRMAYLAKRWCAKEAVSKAMGTGIAKGLGFQDIEVTNSESGAPQVILSKSAQIKLNALGAQ 107
>gi|152980533|ref|YP_001353064.1| holo-[acyl-carrier protein] synthase [Janthinobacterium sp. Marseille] >gi|189027331|sp|A6SXR7|ACPS_JANMA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|151280610|gb|ABR89020.1| holo-[acyl-carrier protein] synthase [Janthinobacterium sp. Marseille] (130 aa)
Score = 89, Expect = 1.1e-01, Identities = 24/59 (40%), Positives = 35/59 (59%)
  Q:    14 FNIGIDVTKIDYFV----NKSDKFIKRLLTDNEYNQYLKIDNNLKPR---FLASRWALKEATFKAI 72
           + IG D+ KID          D+F +R+L   E  +Y +    ++ R   FLA+R+A KEA  KAI
  S:     3 YGIGTDIIKIDRIAAALGRHGDRFAERILGKEELEKYHRRKAKVEARGLRFLATRFAAKEAFSKAI 68
>gi|37527212|ref|NP_930556.1| 4'-phosphopantetheinyl transferase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|59797834|sp|Q7N1X9|ACPS_PHOLL Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|36786646|emb|CAE15710.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) [Photorhabdus luminescens subsp. laumondii TTO1] (126 aa)
Score = 89, Expect = 1.1e-01, Identities = 22/55 (40%), Positives = 38/55 (69%)
  Q:    18 IDVTKIDYFVNKS-DKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKAI 72
           +++ +I+  V +S ++  KR+L++ E+ QY     + KP RFLA R+A+KEA  KA+
  S:    11 VEIARIEGVVERSGERLAKRILSELEWEQY---QQHEKPVRFLAKRFAVKEAAAKAL 64
>gi|196164033|ref|ZP_03124564.1| 4'-phosphopantetheinyl transferase [Clostridium difficile QCD-23m63] (126 aa)
Score = 89, Expect = 1.1e-01, Identities = 35/104 (33%), Positives = 61/104 (58%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKNDNNSYTCTTFKN------------VKVSISYDGNQVFATAI 117
           F+IG+D+ +ID     + K+++F++++ TD E   +     N K   +A  +A KEA  K+I    ++F F +IE ++N+       T+ N            +KVSIS+  +   A AI
  S:     4 FDIGVDIIEIDRIRKAIEKNNRFLEKIFTDREIEYF--NSKNFKAESIAGNFAAKEAISKSIGTGIRVFNFKDIEVLRNEMGKPIVKTYNNLAKMCIDYNVLEIKVSISHSKDYAIANAI 121
>gi|169829736|ref|YP_001699894.1| Holo-[acyl-carrier-protein] synthase [Lysinibacillus sphaericus C3-41] >gi|168994224|gb|ACA41764.1| Holo-[acyl-carrier-protein] synthase [Lysinibacillus sphaericus C3-41] (139 aa)
Score = 89, Expect = 1.1e-01, Identities = 23/57 (40%), Positives = 33/57 (57%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           IG+D+ +ID     + ++DKF  R+LT  E   +       K  FLA R+A KEA  KA+
  S:    27 IGLDIVEIDRIEKAMKRTDKFKDRILTTREKILFDSYSETRKVEFLAGRFAAKEAFSKAM 86
>gi|116511663|ref|YP_808879.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactococcus lactis subsp. cremoris SK11] >gi|125624500|ref|YP_001032983.1| holo-[acyl-carrier protein] synthase [Lactococcus lactis subsp. cremoris MG1363] >gi|123125696|sp|Q030B5|ACPS_LACLS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|166198203|sp|A2RLV5|ACPS_LACLM Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116107317|gb|ABJ72457.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactococcus lactis subsp. cremoris SK11] >gi|124493308|emb|CAL98278.1| holo-[acyl-carrier protein] synthase [Lactococcus lactis subsp. cremoris MG1363] (119 aa)
Score = 89, Expect = 1.2e-01, Identities = 28/76 (36%), Positives = 44/76 (57%)
  Q:    14 FNIGID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNL-KPRFLASRWALKEATFKAINE-FHKIFFINIEFIKND 89
           F  G+D   +++I   + +S++F++++LT  E  +Y    +   K  FLA RWA KEA  KA    F K   ++   IKND
  S:     3 FGTGVDNVELSRIQKALTRSERFVEQVLTTMELEKYNNFQSTARKTEFLAGRWAAKEAFSKAYGTGFGKALGMHDLEIKND 83
>gi|126701089|ref|YP_001089986.1| 4'-phosphopantetheinyl transferase [Clostridium difficile 630] >gi|115252526|emb|CAJ70369.1| holo-[acyl-carrier protein] synthase [Clostridium difficile 630] (126 aa)
Score = 89, Expect = 1.2e-01, Identities = 35/104 (33%), Positives = 62/104 (59%)
  Q:    14 FNIGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKNDNNSYTCTTFKN------------VKVSISYDGNQVFATAI 117
           F+IG+D+ +ID     V+K+++F++++ TD E   +     N K   +A  +A KEA  K+I    ++F F +IE ++++       T+ N            +KVSIS+  +   A AI
  S:     4 FDIGVDIIEIDRIRKAVDKNNRFLEKIFTDREIEYF--NSKNFKAESIAGNFAAKEAISKSIGTGIRVFNFKDIEVLRDEMGKPIVKTYNNLAKMCIDYNVLEIKVSISHSKDYAIANAI 121
>gi|160947410|ref|ZP_02094577.1| hypothetical protein PEPMIC_01344 [Peptostreptococcus micros ATCC 33270] >gi|158446544|gb|EDP23539.1| hypothetical protein PEPMIC_01344 [Peptostreptococcus micros ATCC 33270] (407 aa)
Score = 89, Expect = 1.2e-01, Identities = 31/73 (42%), Positives = 41/73 (56%)
  Q:    16 IGIDVTKIDYFVNKS--DKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKN 88
           IGID+  I  F N    DKF+KR  T+ E +  LK  N  +   +A  ++LKEA  KAI   F  I  I++E I N
  S:     2 IGIDICSISRFSNMKNLDKFLKRYFTNEEIDYILKTGN--RDETIAGIFSLKEAFVKAIGTGFGNISPIDVEIIHN 75
>gi|167756923|ref|ZP_02429050.1| hypothetical protein CLORAM_02472 [Clostridium ramosum DSM 1402] >gi|167703098|gb|EDS17677.1| hypothetical protein CLORAM_02472 [Clostridium ramosum DSM 1402] (111 aa)
Score = 89, Expect = 1.3e-01, Identities = 32/102 (31%), Positives = 52/102 (50%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPR--FLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           IG D+  ++     ++ F+ +LLT NE+    K  N+LK +  FL  R+A KEA FKA    H +   +   I ND N      + N  +SI+++ +   A  +
  S:     5 IGCDIVDLNRLNLDNECFVLKLLTKNEF-LIFKNKNSLKQKKEFLGGRFAAKEAFFKAHGIEHGMLSFHDIEILNDKNGKPKINYPNTFISIAHENDYAIAYVV 107
>gi|21674747|ref|NP_662812.1| holo-(acyl-carrier-protein) synthase [Chlorobium tepidum TLS] >gi|25089542|sp|Q8KB56|ACPS_CHLTE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|21647959|gb|AAM73154.1| holo-(acyl-carrier-protein) synthase [Chlorobium tepidum TLS] (117 aa)
Score = 89, Expect = 1.3e-01, Identities = 34/103 (33%), Positives = 54/103 (52%)
  Q:    16 IGIDVTKIDYFVNKSDKF----IKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-------FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAIY 118
           IG+D+ +I    +  D+F    +K++LT  E  Q L   + +    LA R+A KEA  KA+         +H I  +N E  K   + Y  +    V +SIS+D     A A++
  S:     3 IGVDIVEIARIRSSYDRFGEAFMKKILTSAEMAQCLSKPDPVAS--LAGRFAAKEAVSKALGTGIAKGLTWHSIEVLNDETGKPCVSVYAPSFSGRVSISISHDRYSAVAMALF 114
>gi|15672825|ref|NP_266999.1| acyl carrier protein synthase [Lactococcus lactis subsp. lactis Il1403] >gi|13878322|sp|Q9CH95|ACPS_LACLA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|12723769|gb|AAK04941.1|AE006318_4 acyl carrier protein synthase [Lactococcus lactis subsp. lactis Il1403] (119 aa)
Score = 89, Expect = 1.3e-01, Identities = 28/76 (36%), Positives = 44/76 (57%)
  Q:    14 FNIGID---VTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNL-KPRFLASRWALKEATFKAINE-FHKIFFINIEFIKND 89
           F  G+D   +++I   + +S++F++++LT  E  +Y    +   K  FLA RWA KEA  KA    F K   ++   IKND
  S:     3 FGTGVDNVELSRIQKALTRSERFVEQVLTAVELEKYNSFQSTARKTEFLAGRWAAKEAFSKAYGTGFGKALGMHDLEIKND 83
>gi|145228299|ref|XP_001388458.1| hypothetical protein An01g00060 [Aspergillus niger] >gi|134054544|emb|CAK36857.1| unnamed protein product [Aspergillus niger] (1862 aa)
Score = 88, Expect = 1.3e-01, Identities = 35/102 (34%), Positives = 54/102 (52%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCTTF-------------KNVKVSISYDGNQVFATAI 117
           +G+DV  I+ F  +++ FI+R  T +E  +Y +   + +  F A RW+ KEA FKA+    K       +IE I +D+                     K V VSIS+   Q  A A+
  S:  1745 VGVDVENIESFNIENETFIERNFTASE-QEYCQKAASPRSSF-AGRWSAKEAVFKALGVSSKGAGAPLKDIE-ISSDSTGAPVVNLHGAAAEAAKQAGVKQVSVSISHSDTQAVAVAV 1859
>gi|82702883|ref|YP_412449.1| phosphopantethiene-protein transferase domain-contain protein [Nitrosospira multiformis ATCC 25196] >gi|123544320|sp|Q2Y864|ACPS_NITMU Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|82410948|gb|ABB75057.1| phosphopantethiene/protein transferase domain [Nitrosospira multiformis ATCC 25196] (125 aa)
Score = 88, Expect = 1.3e-01, Identities = 25/58 (43%), Positives = 39/58 (67%)
  Q:    14 FNIGIDV---TKIDYFVNK-SDKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKA 71
           + IG D+   ++I   + K  ++F +RLLTD E+ +Y K   +++P  FLA R+A KEA  KA
  S:     3 YGIGTDLVETSRITRLLEKYGERFARRLLTDEEWPEYAK---SMQPAMFLAKRFAAKEALAKA 62
>gi|84390108|ref|ZP_00991370.1| 4'-phosphopantetheinyl transferase [Vibrio splendidus 12B01] >gi|84376762|gb|EAP93637.1| 4'-phosphopantetheinyl transferase [Vibrio splendidus 12B01] (126 aa)
Score = 88, Expect = 1.5e-01, Identities = 26/72 (36%), Positives = 41/72 (56%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAIN-------EFHKIFFINIEFIK 87
           +G D+ +I+          D F +R+LTD+E+  + ++    K R+LA R+A KEA  KA+         FH     N E+ K
  S:     6 LGTDIAEIERVEKALSRSGDAFAQRILTDSEFEVFQQLKQ--KGRYLAKRFAAKEAASKALGTGIALGVTFHDFEISNDEYGK 86
>gi|189485216|ref|YP_001956157.1| phosphopantetheinyl transferase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287175|dbj|BAG13696.1| phosphopantetheinyl transferase [uncultured Termite group 1 bacterium phylotype Rs-D17] (111 aa)
Score = 88, Expect = 1.5e-01, Identities = 33/103 (32%), Positives = 58/103 (56%)
  Q:    15 NIGIDVTKIDYFVN--KSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKNVK-----VSISYDGNQVFATAI 117
           N+GID+ +++ FV   +  KF++R+    E +  +   N    ++LA+R+A KEA +KA++  +K F I    ++N  +       KN K     +S+S+    V A AI
  S:     2 NVGIDIEEVERFVKYVRDKKFLERIFAKEEISYSIPRKN--VAQYLAARFAAKEAVWKALSTRNKKFTIADISVRNTKDGKPQVYIKNKKYKRIDISLSHTDKYVAAVAI 109
>gi|149241651|ref|XP_001526334.1| fatty acid synthase alpha subunit reductase [Lodderomyces elongisporus NRRL YB-4239] >gi|146450457|gb|EDK44713.1| fatty acid synthase alpha subunit reductase [Lodderomyces elongisporus NRRL YB-4239] (766 aa)
Score = 88, Expect = 1.5e-01, Identities = 35/117 (29%), Positives = 65/117 (55%)
  Q:     4 KMEKTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI---NEFHKIFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAIYLN 120
           K   ++NK +  +G+DV  +     +++ F++R  +  E   Y +  +N +  F  + W+ KEA FKA+   ++      I+I+ +++ N             + T    KN+ +SIS+D  Q  ATAI L+
  S:   637 KALSSLNKSSKGVGVDVELLSSINIENETFLERNYSPEEI-AYCQKSSNPQASFTGT-WSAKEAAFKALGVKSQGGGASLIDIQILRDANGVPKVVLEGAAKEAATKAGVKNISISISHDDFQ--ATAIALS 764
>gi|89075084|ref|ZP_01161525.1| 4'-phosphopantetheinyl transferase [Photobacterium sp. SKA34] >gi|89049171|gb|EAR54736.1| 4'-phosphopantetheinyl transferase [Photobacterium sp. SKA34] (126 aa)
Score = 88, Expect = 1.5e-01, Identities = 21/57 (36%), Positives = 35/57 (61%)
  Q:    16 IGIDVTKID----YFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +G D+ +I+     F    D F +++L+  E  Q+ ++    K RFLA R+A+KEA  KA+
  S:     6 LGTDIAEIERVEKVFARSGDAFAQKILSSFELEQFQQLKQ--KGRFLAKRFAVKEAASKAL 64
>gi|163938240|ref|YP_001643124.1| holo-acyl-carrier-protein synthase [Bacillus weihenstephanensis KBAB4] >gi|163860437|gb|ABY41496.1| holo-acyl-carrier-protein synthase [Bacillus weihenstephanensis KBAB4] (119 aa)
Score = 88, Expect = 1.6e-01, Identities = 30/101 (29%), Positives = 52/101 (51%)
  Q:    16 IGIDV---TKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE--FHKIFFINIEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATA 116
           IGID+    +I+  ++   KF++R+LT+ E      +  +    F+A R+A KEA  KA+      ++ F++IE   +D       T     V +S   ++ FA A
  S:     5 IGIDIIELNRIEKMLDGKLKFMERILTERERGVAEGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPIIITNTEHIVHLSISHSKEFAVA 110
>gi|148381341|ref|YP_001255882.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. ATCC 3502] >gi|153932139|ref|YP_001385718.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. ATCC 19397] >gi|153937698|ref|YP_001389124.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. Hall] >gi|148290825|emb|CAL84960.1| holo-[acyl-carrier protein] synthase [Clostridium botulinum A str. ATCC 3502] >gi|152928183|gb|ABS33683.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. ATCC 19397] >gi|152933612|gb|ABS39111.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A str. Hall] (126 aa)
Score = 88, Expect = 1.7e-01, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKND 89
           + IG D+T   +I+  + ++  FI +L T NE + + K   N K  F+A R+A KEA  KA+    + F F +IE I N+
  S:     3 YGIGTDITEIRRIEKAITRNKNFINKLFTKNEMDLWEK--KNFKLEFIAGRFAAKEAVSKALGTGIRDFNFKDIEIINNE 80
>gi|169860957|ref|XP_001837113.1| predicted protein [Coprinopsis cinerea okayama7#130] >gi|116501835|gb|EAU84730.1| predicted protein [Coprinopsis cinerea okayama7#130] (153 aa)
Score = 87, Expect = 1.8e-01, Identities = 20/57 (35%), Positives = 40/57 (70%)
  Q:    16 IGIDVT---KIDYFVNK--SDKFIKRLLTDNEYNQYLKIDNNLKP----RFLASRWALKEATFKAI 72
           IG+D+    +I   + K  + +F+K++L+  EY+ ++ +  +       R+LA RW++KEA +KA+
  S:     6 IGVDIIHTPRISALLKKRYAGRFVKKILSPAEYSGWVNLSTSGTSGDLVRYLAVRWSVKEAAYKAL 71
>gi|118443197|ref|YP_877344.1| 4'-phosphopantetheinyl transferase [Clostridium novyi NT] >gi|166198195|sp|A0PY92|ACPS_CLONN Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|118133653|gb|ABK60697.1| holo-(acyl-carrier-protein) synthase [Clostridium novyi NT] (138 aa)
Score = 87, Expect = 1.8e-01, Identities = 25/74 (33%), Positives = 42/74 (56%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKND 89
           IG D+ +ID     + ++  FI +L T  E   +  I   ++P F+A ++A KE+  KA+   F K  F +IE  K++
  S:     5 IGTDIVEIDRINKSIERTPNFINKLFTKKEIEYF--ISRKMRPEFIAGKFAAKESVAKALGTGFRKFGFRDIEIDKDE 80
>gi|170759721|ref|YP_001788730.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A3 str. Loch Maree] >gi|169406710|gb|ACA55121.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum A3 str. Loch Maree] (126 aa)
Score = 87, Expect = 1.9e-01, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKND 89
           + IG D+T   +I+  + ++  FI +L T NE + + K   N K  F+A R+A KEA  KA+    + F F +IE I N+
  S:     3 YGIGTDITEIRRIEKAITRNKNFINKLFTKNEMDLWEK--KNFKLEFIAGRFAAKEAVSKALGTGIRDFNFKDIEIINNE 80
>gi|15639814|ref|NP_219264.1| holo-acyl-carrier protein synthase (acpS) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189026052|ref|YP_001933824.1| holo-acyl-carrier protein synthase [Treponema pallidum subsp. pallidum SS14] >gi|7531032|sp|O83800|ACPS_TREPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|3323139|gb|AAC65794.1| holo-acyl-carrier protein synthase (acpS) [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018627|gb|ACD71245.1| holo-acyl-carrier protein synthase [Treponema pallidum subsp. pallidum SS14] (125 aa)
Score = 87, Expect = 1.9e-01, Identities = 20/57 (35%), Positives = 37/57 (64%)
  Q:    16 IGIDVTKIDYFVNKSD--KFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +GID+ +I+ FV+ +   + ++R     E   + K  N+++ +FLA+R+A KEA  KA+
  S:     5 VGIDIVEIERFVSWTHNVRLLRRFFHQEEIVDFFK--NHMRAQFLATRFAAKEAFGKAL 61
>gi|110004589|emb|CAK98926.1| putative holo-acyl-carrier-protein synthase [Spiroplasma citri] (113 aa)
Score = 87, Expect = 1.9e-01, Identities = 34/104 (32%), Positives = 59/104 (56%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAINEFHKIFFINIEF-IKNDNNSY----TCTTFKNVKVSISYDGNQVFATAIY 118
           N+GID+ + +  +  S  FI+++L+  E  QY    N N + +FLA RWA+KEA  K +    K+    +   +K+DNN +    +    + V VS+S++ +     AI+
  S:     4 NVGIDIIQ-NKRIKLSTAFIQKVLSPVEIKQYAAFFNKNAQRQFLAGRWAVKEALIKTLET--KVILNEVTICLKDDNNLHVEGLSLKQNELVHVSLSHERDYSVGFAIF 110
>gi|50547253|ref|XP_501096.1| hypothetical protein [Yarrowia lipolytica] >gi|49646962|emb|CAG83349.1| unnamed protein product [Yarrowia lipolytica CLIB122] (1850 aa)
Score = 87, Expect = 2.0e-01, Identities = 32/103 (31%), Positives = 50/103 (48%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI---NEFHKIFFINIEFIKNDN------------NSYTCTTFKNVKVSISYDGNQVFATAI 117
           N+G+DV  I      +D F+ R  T NE     K  +       A  W+ KEA FK++   ++       +IE  ++ N            ++        VKVSIS+D +Q  A A+
  S:  1733 NVGVDVEAISAINIDNDTFLDRNFTANEQAYCFKAPSPQSS--FAGTWSAKEAVFKSLGVKSQGGGAELKSIEITRDGNGAPVVVLHGAAKDAAASKGISTVKVSISHDDSQAVAVAV 1848
>gi|170756152|ref|YP_001783038.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum B1 str. Okra] >gi|169121364|gb|ACA45200.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum B1 str. Okra] (126 aa)
Score = 87, Expect = 2.1e-01, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKND 89
           + IG D+T   +I+  + ++  FI +L T NE + + K   N K  F+A R+A KEA  KA+    + F F +IE I N+
  S:     3 YGIGTDITEIRRIEKAITRNKNFINKLFTKNEMDLWEK--KNFKLEFIAGRFAAKEAISKALGTGIRDFNFKDIEIINNE 80
>gi|153939870|ref|YP_001392757.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum F str. Langeland] >gi|152935766|gb|ABS41264.1| holo-(acyl-carrier-protein) synthase [Clostridium botulinum F str. Langeland] (126 aa)
Score = 87, Expect = 2.1e-01, Identities = 29/76 (38%), Positives = 45/76 (59%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKND 89
           + IG D+T   +I+  + ++  FI +L T NE + + K   N K  F+A R+A KEA  KA+    + F F +IE I N+
  S:     3 YGIGTDITEIRRIEKAITRNKNFINKLFTKNEMDLWKK--KNFKLEFIAGRFAAKEAISKALGTGIRDFNFKDIEIINNE 80
>gi|23098074|ref|NP_691540.1| holo-(acyl carrier protein) synthase [Oceanobacillus iheyensis HTE831] >gi|29427765|sp|Q8ESK9|ACPS_OCEIH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|22776299|dbj|BAC12575.1| holo-(acyl carrier protein) synthase [Oceanobacillus iheyensis HTE831] (119 aa)
Score = 87, Expect = 2.1e-01, Identities = 25/72 (34%), Positives = 48/72 (66%)
  Q:    18 IDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKND 89
           I++ +++  + ++++FI+R+LT+NE  ++ ++  N K  ++A R+A KEA  KA+     K+ F +IE I ND
  S:    10 IELNRMEALIERNERFIERILTENEQRKFQRLSANRKVEYIAGRFAAKEAFAKAVGTGIGKVSFKDIEIINND 82
>gi|90412090|ref|ZP_01220097.1| 4'-phosphopantetheinyl transferase [Photobacterium profundum 3TCK] >gi|90327068|gb|EAS43447.1| 4'-phosphopantetheinyl transferase [Photobacterium profundum 3TCK] (126 aa)
Score = 86, Expect = 2.3e-01, Identities = 22/57 (38%), Positives = 33/57 (57%)
  Q:    16 IGIDVTKID----YFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +G D+  I+     F    D F +R+L  +E   Y  +   LK R+LA R+A+KEA  KA+
  S:     6 LGTDIADIERVERVFARSGDTFAERILAPSELEIYHSL--KLKARYLAKRFAVKEAASKAL 64
>gi|39938926|ref|NP_950692.1| phosphopantetheinyl transferase [Onion yellows phytoplasma OY-M] >gi|61211527|sp|Q6YQD4|ACPS_ONYPE Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|39722035|dbj|BAD04525.1| phosphopantetheinyl transferase [Onion yellows phytoplasma OY-M] (127 aa)
Score = 86, Expect = 2.3e-01, Identities = 38/103 (36%), Positives = 53/103 (51%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIK-RLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAINEFHKI-----FFINIEFIKNDNNS-----YTCTTFKN-VKVSISYDGNQVFATAI 117
           NIGID+ +I          +  R+L+  E+  Y  I N   +  FLA RWA KEA FKA     KI      + N   + +   +      TCTTF N + +SI++  N   A  I
  S:     3 NIGIDLVEIKKIKKIGKDILAARILSSEEHQIYQIIQNPQSQLTFLAGRWASKEALFKAFQTPQKIDPTCQNYCNWSILNDKKGAPYVKNNTCTTFFNPILISITHTDNYALALVI 118
>gi|169778598|ref|XP_001823764.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83772502|dbj|BAE62631.1| unnamed protein product [Aspergillus oryzae] (1857 aa)
Score = 86, Expect = 2.3e-01, Identities = 35/105 (33%), Positives = 53/105 (50%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCTTF-------------KNVKVSISYDGNQVFATAI 117
           N  +G+DV  ++    +++ FI+R  T  E  QY +   + +  F A RW+ KEA FK++    K       +IE I ND                      K V VSIS+  +Q  A A+
  S:  1737 NSKVGVDVENLESLNIENETFIERNFTAQE-QQYCRKAASPQASF-AGRWSAKEAVFKSLGVSSKGAGAPLKDIE-ITNDATGAPVVNLHGAAAEAARQAGVKQVSVSISHSDSQAVAVAV 1854
>gi|126651488|ref|ZP_01723692.1| hypothetical protein BB14905_07389 [Bacillus sp. B14905] >gi|126591741|gb|EAZ85837.1| hypothetical protein BB14905_07389 [Bacillus sp. B14905] (139 aa)
Score = 86, Expect = 2.3e-01, Identities = 22/57 (38%), Positives = 33/57 (57%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           IG+D+ +ID     + ++DKF  R+L+  E   +       K  FLA R+A KEA  KA+
  S:    27 IGLDIVEIDRIEKAMKRTDKFKDRILSTREKKIFDGYSETRKIEFLAGRFAAKEAFSKAM 86
>gi|50122196|ref|YP_051363.1| 4'-phosphopantetheinyl transferase [Pectobacterium atrosepticum SCRI1043] >gi|59797731|sp|Q6D222|ACPS_ERWCT Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|49612722|emb|CAG76172.1| holo-[acyl-carrier protein] synthase [Erwinia carotovora subsp. atroseptica SCRI1043] (126 aa)
Score = 86, Expect = 2.4e-01, Identities = 20/54 (37%), Positives = 36/54 (66%)
  Q:    18 IDVTKIDYFVNKS-DKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKA 71
           +++ +I+  + +S ++  +R+LTD E+  Y     + +P RFLA R+A+KEA  KA
  S:    11 VEIARIEVVIERSGERLARRILTDAEWAHY---QQHQQPVRFLAKRFAVKEAAAKA 63
>gi|77963378|ref|ZP_00827188.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Yersinia mollaretii ATCC 43969] (126 aa)
Score = 86, Expect = 2.5e-01, Identities = 19/54 (35%), Positives = 36/54 (66%)
  Q:    18 IDVTKIDYFVNKS-DKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           +++++I+  V +S D+  +R+L+ +E+  Y +    +  RFLA R+A+KEA  KA
  S:    11 VEISRIEAVVERSGDRLARRILSPSEWQHYQQHQQPI--RFLAKRFAVKEAAAKA 63
>gi|77958585|ref|ZP_00822616.1| COG0736: Phosphopantetheinyl transferase (holo-ACP synthase) [Yersinia bercovieri ATCC 43970] (126 aa)
Score = 86, Expect = 2.5e-01, Identities = 19/54 (35%), Positives = 36/54 (66%)
  Q:    18 IDVTKIDYFVNKS-DKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           +++++I+  V +S D+  +R+L+ +E+  Y +    +  RFLA R+A+KEA  KA
  S:    11 VEISRIEAVVERSGDRLARRILSPSEWQHYQQHQQPI--RFLAKRFAVKEAAAKA 63
>gi|121711830|ref|XP_001273530.1| fatty acid synthase alpha subunit FasA, putative [Aspergillus clavatus NRRL 1] >gi|119401682|gb|EAW12104.1| fatty acid synthase alpha subunit FasA, putative [Aspergillus clavatus NRRL 1] (1857 aa)
Score = 86, Expect = 2.7e-01, Identities = 33/105 (31%), Positives = 55/105 (52%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCTT------------FKNVKVSISYDGNQVFATAI 117
           N  +G+DV  ID    +++ FI+R  T +E  +Y +   + +  F A RW+ KEA FK++    K       +IE + + + +                  K V VSIS+  +Q  A A+
  S:  1737 NSKVGVDVENIDAVNIENETFIERNFTVSE-QEYCRKAPSPRSSF-AGRWSAKEAVFKSLGVSSKGAGAPLKDIEILTDAHGAPVVNLHGAAAEAAKQAGVKQVSVSISHSDSQAVAVAV 1854
>gi|146387394|pdb|2UV9|A Chain A, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387395|pdb|2UV9|B Chain B, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387396|pdb|2UV9|C Chain C, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387397|pdb|2UV9|D Chain D, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387398|pdb|2UV9|E Chain E, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387399|pdb|2UV9|F Chain F, Crystal Structure Of Fatty Acid Synthase From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387406|pdb|2UVB|A Chain A, Crystal Structure Of Fatty Acid Synthase Complexed With Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387407|pdb|2UVB|B Chain B, Crystal Structure Of Fatty Acid Synthase Complexed With Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387408|pdb|2UVB|C Chain C, Crystal Structure Of Fatty Acid Synthase Complexed With Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387409|pdb|2UVB|D Chain D, Crystal Structure Of Fatty Acid Synthase Complexed With Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387410|pdb|2UVB|E Chain E, Crystal Structure Of Fatty Acid Synthase Complexed With Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|146387411|pdb|2UVB|F Chain F, Crystal Structure Of Fatty Acid Synthase Complexed With Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom Resolution. This File Contains The Alpha Subunits Of The Fatty Acid Synthase. The Entire Crystal Structure Consists Of One Heterododecameric Fatty Acid Synthase And Is Described In Remark 400 >gi|145280541|tpg|DAA05951.1| TPA_exp: fatty acid synthase alpha subunit [Thermomyces lanuginosus] (1878 aa)
Score = 86, Expect = 2.8e-01, Identities = 34/102 (33%), Positives = 49/102 (48%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNS------------YTCTTFKNVKVSISYDGNQVFATAI 117
           +G+DV  +D     +++FI R  T+ E   Y +   N +  F A RW  KEA FK++    K        IE I + N +                  K V VSIS+   Q  A A+
  S:  1761 VGVDVESVDSINIDNEEFISRNFTERE-QAYCRRAPNPRASF-AGRWTAKEAIFKSLGVASKGAGAAMREIEVINDANGAPEVHLHGAAAEAAKQAGVKTVNVSISHGDLQAVAVAV 1875
>gi|70725961|ref|YP_252875.1| holo-ACP synthase [Staphylococcus haemolyticus JCSC1435] >gi|90111952|sp|Q4L7V6|ACPS_STAHJ Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|68446685|dbj|BAE04269.1| holo-ACP synthase [Staphylococcus haemolyticus JCSC1435] (119 aa)
Score = 85, Expect = 3.1e-01, Identities = 25/57 (43%), Positives = 35/57 (61%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAI 72
           IGID+ +ID     F  + DK +KR+LT  E  Q+    +   K  FL+ R+A KEA  KA+
  S:     5 IGIDLIEIDRIKKAFEKQKDKLVKRILTQEEEQQFHSFKSEKRKLEFLSGRFATKEAFSKAL 66
>gi|119474607|ref|XP_001259179.1| fatty acid synthase alpha subunit FasA, putative [Neosartorya fischeri NRRL 181] >gi|119407332|gb|EAW17282.1| fatty acid synthase alpha subunit FasA, putative [Neosartorya fischeri NRRL 181] (1859 aa)
Score = 85, Expect = 3.2e-01, Identities = 33/102 (32%), Positives = 54/102 (52%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCTT------------FKNVKVSISYDGNQVFATAI 117
           IG+DV  ID    +++ FI+R  T +E  +Y +   + +  F A RW+ KEA FK++    K       +IE + + + +                  K V VSIS+  +Q  A A+
  S:  1742 IGVDVENIDAVNIENETFIERNFTASE-QEYCRKAPSPQSSF-AGRWSAKEAVFKSLGVCSKGAGAPLKDIEILSDASGAPVVNLHGAAAEAARQAGVKQVSVSISHSDSQAVAVAV 1856
>gi|88797951|ref|ZP_01113538.1| 4'-phosphopantetheinyl transferase [Reinekea sp. MED297] >gi|88779148|gb|EAR10336.1| 4'-phosphopantetheinyl transferase [Reinekea sp. MED297] (123 aa)
Score = 85, Expect = 3.3e-01, Identities = 23/57 (40%), Positives = 34/57 (59%)
  Q:    16 IGIDVTKIDYFV----NKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           IG D+ +I   +     +S +FI R+LTD E  Q +  +      FLA+R+A KEA  KA+
  S:     4 IGTDIVQISRIIGVYEQQSTRFIARILTDKE--QVVFCERGESMNFLANRFAAKEAVSKAL 62
>gi|116194704|ref|XP_001223164.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] >gi|88179863|gb|EAQ87331.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] (155 aa)
Score = 85, Expect = 3.5e-01, Identities = 32/110 (29%), Positives = 51/110 (46%)
  Q:     7 KTINKPNFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTC------------TTFKNVKVSISYDGNQVFATA 116
           + +   N  +G DV  I     ++D F++R  T  E    +       P +  A RW+ KEA FKA+    +       +IE + + N + +                K+V VSISY  +   A A
  S:    26 RQLENMNTRVGFDVEDISTINVENDTFLERNFTAAEMQHCIGSTTGRPPQKAFAGRWSAKEAVFKALGTSSQGAGAAMKDIEILTDKNGAPSVKLHGAAQEAAEKAGVKSVNVSISYTDSHAAAIA 151
>gi|54310183|ref|YP_131203.1| 4'-phosphopantetheinyl transferase [Photobacterium profundum SS9] >gi|59797767|sp|Q6LMS5|ACPS_PHOPR Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|46914624|emb|CAG21401.1| putative phosphopantetheinyl transferase [Photobacterium profundum SS9] (126 aa)
Score = 85, Expect = 3.5e-01, Identities = 21/54 (38%), Positives = 32/54 (59%)
  Q:    19 DVTKID-YFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           D+ ++D  F    D F +R+L  +E   Y  +   LK R+LA R+A+KEA  KA+
  S:    12 DIERVDKVFARSGDAFAERILAPSELVIYHSL--KLKARYLAKRFAVKEAASKAL 64
>gi|171920899|ref|ZP_02696188.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178926|ref|ZP_02555054.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188023992|ref|ZP_02569492.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039578|ref|ZP_02528722.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 8] >gi|188518238|ref|ZP_02555910.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524401|ref|ZP_02558180.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530960|ref|ZP_02546877.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188569196|ref|ZP_02829662.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 2] >gi|188592835|ref|ZP_02694998.2| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 10] >gi|195867883|ref|ZP_03079882.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903115|gb|EDT49404.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209189|gb|EDU06232.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019017|gb|EDU57057.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998168|gb|EDU67265.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659847|gb|EDX53227.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660460|gb|EDX53718.1| holo-(acyl-carrier-protein) synthase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (118 aa)
Score = 85, Expect = 3.8e-01, Identities = 36/103 (34%), Positives = 54/103 (52%)
  Q:    17 GIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTF-KNVKVSISYDGNQVFATAIYL 119
           GID+ + +     +  F KR+L D+E   YL++++   K R+LAS +A KEA  KA    +    I I   KN+   Y      K + +SISY  N V A+ + L
  S:     6 GIDIIEWNREELNNPSFAKRILVDDELKYYLQLNSLKEKNRYLASIFASKEAVMKAFKLKYGYNDILILKTKNERQVYLNKILIKELVLSISYTENYVVASVVGL 110
>gi|153803084|ref|ZP_01957670.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-3] >gi|124121366|gb|EAY40109.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-3] >gi|150422429|gb|EDN14388.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae AM-19226] (126 aa)
Score = 84, Expect = 4.1e-01, Identities = 21/57 (36%), Positives = 34/57 (59%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +G D+ +I+          + F +R+LTD+E  Q+    +  + RFLA R+A KEA  KA+
  S:     5 LGTDIAEIERVEKALARSGENFARRILTDSELEQFHA--SKQQGRFLAKRFAAKEAASKAL 63
>gi|121728975|ref|ZP_01681979.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae V52] >gi|147675265|ref|YP_001217959.1| 4'-phosphopantetheinyl transferase [Vibrio cholerae O395] >gi|172047580|sp|A5F5H4|ACPS_VIBC3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|121628741|gb|EAX61208.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae V52] >gi|146317148|gb|ABQ21687.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae O395] (126 aa)
Score = 84, Expect = 4.1e-01, Identities = 21/57 (36%), Positives = 34/57 (59%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +G D+ +I+          + F +R+LTD+E  Q+    +  + RFLA R+A KEA  KA+
  S:     5 LGTDIAEIERVEKALARSGENFARRILTDSELEQFHA--SKQQGRFLAKRFAAKEAASKAL 63
>gi|15642453|ref|NP_232086.1| 4'-phosphopantetheinyl transferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121590990|ref|ZP_01678309.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 2740-80] >gi|153214508|ref|ZP_01949417.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 1587] >gi|153222469|ref|ZP_01953203.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MAK 757] >gi|153819823|ref|ZP_01972490.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae NCTC 8457] >gi|153826900|ref|ZP_01979567.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-2] >gi|153830870|ref|ZP_01983537.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 623-39] >gi|194531115|ref|YP_002066630.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MO10] >gi|20137515|sp|Q9KPB6|ACPS_VIBCH Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|9657035|gb|AAF95599.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121547167|gb|EAX57296.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 2740-80] >gi|124115310|gb|EAY34130.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 1587] >gi|124118906|gb|EAY37649.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MAK 757] >gi|125617475|gb|EAZ46039.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MO10] >gi|125621214|gb|EAZ49555.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae V51] >gi|126509642|gb|EAZ72236.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae NCTC 8457] >gi|148873639|gb|EDL71774.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae 623-39] >gi|149739263|gb|EDM53525.1| holo-(acyl-carrier-protein) synthase [Vibrio cholerae MZO-2] (126 aa)
Score = 84, Expect = 4.1e-01, Identities = 21/57 (36%), Positives = 34/57 (59%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +G D+ +I+          + F +R+LTD+E  Q+    +  + RFLA R+A KEA  KA+
  S:     5 LGTDIAEIERVEKALARSGENFARRILTDSELEQFHA--SKQQGRFLAKRFAAKEAASKAL 63
>gi|81429226|ref|YP_396227.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) (4'-phosphopantetheine transferase AcpS) [Lactobacillus sakei subsp. sakei 23K] >gi|90111940|sp|Q38V63|ACPS_LACSS Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|78610869|emb|CAI55921.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) (4'-phosphopantetheine transferase AcpS) [Lactobacillus sakei subsp. sakei 23K] (117 aa)
Score = 84, Expect = 4.1e-01, Identities = 21/56 (37%), Positives = 33/56 (58%)
  Q:    16 IGIDVTKIDYF---VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           +GID+ +ID F     K+ +F +++LT  E+  +          FLA R+A+KEA  KA
  S:     5 LGIDLAEIDRFEKAQEKNSRFAEKVLTATEFELFSHYTGRRALEFLAGRFAVKEAFSKA 63
>gi|145542370|ref|XP_001456872.1| hypothetical protein GSPATT00022647001 [Paramecium tetraurelia strain d4-2] >gi|124424686|emb|CAK89475.1| unnamed protein product [Paramecium tetraurelia] (129 aa)
Score = 84, Expect = 4.7e-01, Identities = 34/93 (36%), Positives = 57/93 (61%)
  Q:    16 IGIDVTKIDYFVN-----KSDKFIKRLLTDNEYNQYL-KIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIK----------NDNNSYTCTTFKN---VKVSISYD 108
           IG+D+      +N      +++F+ ++L  +E  Q+  K    L+ +FLASRWA+KEA  KA + F ++ F  +E  +          N N  Y    F N   ++VSIS++
  S:     7 IGVDIVNNQRMLNIIKAQYAERFLVKVLHPSEIEQFKGKSTIQLQQQFLASRWAVKEALVKA-SSFKELVFPEVEICRKHDKPNIVLHNTNLEYFKKNFGNDYEIQVSISHE 117
>gi|6325025|ref|NP_015093.1| Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities; phosphorylated; Fas2p [Saccharomyces cerevisiae] >gi|20981695|sp|P19097|FAS2_YEAST Fatty acid synthase subunit alpha [Includes: Acyl carrier; 3-oxoacyl-[acyl-carrier-protein] reductase (Beta-ketoacyl reductase); 3-oxoacyl-[acyl-carrier-protein] synthase (Beta-ketoacyl synthase)] >gi|196049652|pdb|2VKZ|A Chain A, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid Synthase Type I Multienzyme Complex >gi|196049653|pdb|2VKZ|B Chain B, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid Synthase Type I Multienzyme Complex >gi|196049654|pdb|2VKZ|C Chain C, Structure Of The Cerulenin-Inhibited Fungal Fatty Acid Synthase Type I Multienzyme Complex >gi|854531|emb|CAA54218.1| fatty-acid synthase [Saccharomyces cerevisiae] >gi|1181257|emb|CAA64256.1| fatty acid synthase alpha chain [Saccharomyces cerevisiae] >gi|1370478|emb|CAA97948.1| FAS2 [Saccharomyces cerevisiae] (1887 aa)
Score = 84, Expect = 5.0e-01, Identities = 34/105 (32%), Positives = 54/105 (51%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAIN----------EFHKIFFIN-----IEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           N  +G+DV  I     ++D FI+R  T  E  +Y     +++  F A  W+ KEA FK++           +  +I  +N     +E   N   +       +VKVSIS+D  Q  A A+
  S:  1766 NGGVGVDVELITSINVENDTFIERNFTPQEI-EYCSAQPSVQSSF-AGTWSAKEAVFKSLGVKSLGGGAALKDIEIVRVNKNAPAVELHGNAKKAAEEAGVTDVKVSISHDDLQAVAVAV 1883
>gi|151942570|gb|EDN60916.1| fatty acid synthase alpha subunit [Saccharomyces cerevisiae YJM789] >gi|190407733|gb|EDV10998.1| fatty acid synthase alpha subunit [Saccharomyces cerevisiae RM11-1a] (1887 aa)
Score = 83, Expect = 5.1e-01, Identities = 34/105 (32%), Positives = 54/105 (51%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAIN----------EFHKIFFIN-----IEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           N  +G+DV  I     ++D FI+R  T  E  +Y     +++  F A  W+ KEA FK++           +  +I  +N     +E   N   +       +VKVSIS+D  Q  A A+
  S:  1766 NGGVGVDVELITSINVENDTFIERNFTPQEI-EYCNAQPSVQSSF-AGTWSAKEAVFKSLGVKSLGGGAALKDIEIVRVNKNAPAVELHGNAKKAAEEAGVTDVKVSISHDDLQAVAVAV 1883
>gi|13357954|ref|NP_078228.1| holo-acyl carrier protein synthase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762431|ref|YP_001752476.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920477|ref|ZP_02690346.2| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508629|ref|ZP_02689191.2| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701738|ref|ZP_02553919.2| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|189027354|sp|B1AJ32|ACPS_UREP2 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|20137541|sp|Q9PQ97|ACPS_UREPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|11356865|pir||G82895 holo-acyl carrier protein synthase UU393 [imported] - Ureaplasma urealyticum >gi|6899379|gb|AAF30803.1|AE002137_2 holo-acyl carrier protein synthase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168828008|gb|ACA33270.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902935|gb|EDT49224.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676088|gb|EDT87993.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701008|gb|EDU19290.1| holo-(acyl-carrier-protein) synthase [Ureaplasma parvum serovar 6 str. ATCC 27818] (115 aa)
Score = 83, Expect = 5.3e-01, Identities = 33/103 (32%), Positives = 54/103 (52%)
  Q:    17 GIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNL-KPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTF-KNVKVSISYDGNQVFATAIYL 119
           GID+ + +     +  F KR+L DNE   Y +++++  K R+LAS +A KEA  KA+   +    I I   +N    Y      K +++SISY    + A+ + L
  S:     6 GIDIIEWNREELNNPLFAKRILIDNELEYYFQLNSSREKKRYLASVFACKEAVMKALKLKYGYGDILILKTENQRQVYLNKILIKELELSISYTETYIVASVVGL 110
>gi|116495992|ref|YP_807726.1| phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus casei ATCC 334] >gi|191639472|ref|YP_001988638.1| Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4-phosphopantetheinyl transferase acpS) [Lactobacillus casei] >gi|122262608|sp|Q034T8|ACPS_LACC3 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116106142|gb|ABJ71284.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Lactobacillus casei ATCC 334] >gi|190713774|emb|CAQ67780.1| Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4-phosphopantetheinyl transferase acpS) [Lactobacillus casei BL23] (124 aa)
Score = 83, Expect = 5.3e-01, Identities = 30/104 (28%), Positives = 49/104 (47%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKNDNNSYTCTTFK---NVKVSISYDGNQVFATAI 117
           + IG+DVT   +I     K+  F  ++LT  E   Y ++D      +L+ R++ KE+  KA      K+   ++E + N+      T         VSIS+    VF   I
  S:     3 YGIGVDVTDLARIQAAQEKNSGFAVKILTPTELANYQQLDGRRAVEYLSGRFSAKESYSKAFGTGLGKVALQDVEILNNELGKPILTKHPFSGQAFVSISHSETLVFTEVI 113
>gi|171502|gb|AAA34601.1| alpha-subunit of fatty acid synthase (1894 aa)
Score = 83, Expect = 5.5e-01, Identities = 34/105 (32%), Positives = 54/105 (51%)
  Q:    13 NFNIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAIN----------EFHKIFFIN-----IEFIKNDNNSYTCTTFKNVKVSISYDGNQVFATAI 117
           N  +G+DV  I     ++D FI+R  T  E  +Y     +++  F A  W+ KEA FK++           +  +I  +N     +E   N   +       +VKVSIS+D  Q  A A+
  S:  1773 NGGVGVDVELITSINVENDTFIERNFTPQEI-EYCSAQPSVQSSF-AGTWSAKEAVFKSLGVKSLGGGAALKDIEIVRVNKNAPAVELHGNAKKAAEEAGVTDVKVSISHDDLQAVAVAV 1890
>gi|86146355|ref|ZP_01064679.1| 4'-phosphopantetheinyl transferase [Vibrio sp. MED222] >gi|85835834|gb|EAQ53968.1| 4'-phosphopantetheinyl transferase [Vibrio sp. MED222] (126 aa)
Score = 83, Expect = 5.5e-01, Identities = 20/57 (35%), Positives = 35/57 (61%)
  Q:    16 IGIDVTKIDY----FVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           +G D+ +I+          + F +R+LTD+E+  + ++    K R+LA R+A KEA  KA+
  S:     6 LGTDIAEIERVEKALSRSGEAFAQRILTDSEFEVFQQLKQ--KGRYLAKRFAAKEAASKAL 64
>gi|50287053|ref|XP_445956.1| unnamed protein product [Candida glabrata] >gi|49525262|emb|CAG58875.1| unnamed protein product [Candida glabrata] (1883 aa)
Score = 83, Expect = 5.9e-01, Identities = 35/103 (33%), Positives = 52/103 (50%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHK---IFFINIEFIKNDNNSYTCT------------TFKNVKVSISYDGNQVFATAI 117
           N+G+DV  I      ++ FI+R  T  E  +Y     + +  F A  W+ KEA FK++    +        IE +++ N   T T            + K V VSIS+D  Q  A AI
  S:  1765 NVGVDVELIASINIDNETFIERNFTSEEV-KYCSSQPSAQSSF-AGTWSAKEAVFKSLGVKSRGAGAPMKEIEILRDVNGKPTVTLHGEAKKLAQKESIKAVSVSISHDDFQSIAVAI 1880
>gi|146296072|ref|YP_001179843.1| holo-acyl-carrier-protein synthase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166198186|sp|A4XIB7|ACPS_CALS8 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|145409648|gb|ABP66652.1| holo-acyl-carrier-protein synthase [Caldicellulosiruptor saccharolyticus DSM 8903] (123 aa)
Score = 83, Expect = 6.5e-01, Identities = 37/104 (35%), Positives = 57/104 (54%)
  Q:    14 FNIGIDVTKIDYFVN--KSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNN----------SYTCTTFK--NVKVSISYDGNQVFATAI 117
           FNIGID+ +++ F N  + D F+KR+ T  E  +Y++   N     +A  +A KEA  KA++      F +IE  K+ N              C   K  N+ +SIS+  +   A AI
  S:     3 FNIGIDIVEVERFKNIKRFDSFLKRVFTQKEL-EYIR-SKNFNMLTIAGYFAAKEAVAKALSTGIVFGFKDIEIQKDTNGCPKVKLYNRAKEICENLKITNIVLSISHQNSVAVACAI 118
>gi|85057603|ref|YP_456519.1| holo-[acyl-carrier-protein] synthase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789708|gb|ABC65440.1| holo-[acyl-carrier-protein] synthase [Aster yellows witches'-broom phytoplasma AYWB] (126 aa)
Score = 82, Expect = 7.2e-01, Identities = 37/103 (35%), Positives = 52/103 (50%)
  Q:    15 NIGIDVTKIDYFVNKSDKFIK-RLLTDNEYNQYLKIDNNLKP-RFLASRWALKEATFKAINEFHKI-----FFINIEFIKNDNNS-----YTCTTFKN-VKVSISYDGNQVFATAI 117
           NIGID+ +I          +  R+L+  E+  Y  I N      FLA RWA KEA FKA  +  KI      + N   + + N +      TC TF N + +SI++  N      I
  S:     5 NIGIDLVEIKKIKKIGKDILAARILSSEEHQIYQTIPNTQSQLTFLAGRWASKEALFKAFQKPSKINPTCQNYCNWSILNDKNGAPYVKNNTCDTFSNPILISITHTDNYALTLVI 120
>gi|15893780|ref|NP_347129.1| 4'-phosphopantetheinyl transferase [Clostridium acetobutylicum ATCC 824] >gi|20137419|sp|Q97LR5|ACPS_CLOAB Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|15023349|gb|AAK78469.1|AE007563_9 Holo-acyl-carrier protein synthase [Clostridium acetobutylicum ATCC 824] (124 aa)
Score = 82, Expect = 7.2e-01, Identities = 27/74 (36%), Positives = 44/74 (59%)
  Q:    16 IGIDVTKIDYFVNKSD---KFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKND 89
           +G+D+ +I+   N  D   KFI++L +  E   Y+K +   K +++A R++ KEA  KA+   F    F NIE  K+D
  S:     5 VGVDIIEINRVKNAIDRNYKFIEKLFSRREI-AYIKAEKT-KAQYIAGRFSAKEAVSKALGTGFRGFSFKNIEIHKDD 80
>gi|69248307|ref|ZP_00604709.1| Phosphopantethiene-protein transferase [Enterococcus faecium DO] >gi|68194451|gb|EAN08952.1| Phosphopantethiene-protein transferase [Enterococcus faecium DO] (78 aa)
Score = 82, Expect = 7.2e-01, Identities = 21/56 (37%), Positives = 31/56 (55%)
  Q:    16 IGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           IGID     +I   + +  KFI R+LT +E   +  +  + +  FL  R+A KEA  KA
  S:     5 IGIDAVELPRITRLIEEKPKFIARILTSDEMKLFQSLPFHRQVEFLGGRYACKEAFSKA 63
>gi|168181948|ref|ZP_02616612.1| holo- synthase [Clostridium botulinum Bf] >gi|182674784|gb|EDT86745.1| holo- synthase [Clostridium botulinum Bf] (126 aa)
Score = 82, Expect = 7.3e-01, Identities = 28/76 (36%), Positives = 45/76 (59%)
  Q:    14 FNIGIDVT---KIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKND 89
           + IG D+T   +I+  + ++  FI +L T NE + + K   N K  F+A R+A KEA  KA+    + F F +IE I ++
  S:     3 YGIGTDITEIRRIEKAITRNKNFINKLFTKNEMDLWEK--KNFKLEFIAGRFAAKEAISKALGTGIRDFNFKDIEIINDE 80
>gi|157363132|ref|YP_001469899.1| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Thermotoga lettingae TMO] >gi|157313736|gb|ABV32835.1| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Thermotoga lettingae TMO] (268 aa)
Score = 82, Expect = 7.3e-01, Identities = 31/73 (42%), Positives = 40/73 (54%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIF-FINIEFIKN 88
           IGIDV KID          KR+L   E  ++  I +  K  +LA+R+A KEA FKAI    K + F +IE I N
  S:     5 IGIDVVKIDRV---ELSLSKRILGPLEQLEFESIKD--KKTYLAARFAAKEAFFKAIGTGVKNYSFTDIEIIHN 73
>gi|76798708|ref|ZP_00780929.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase)(4'-phosphopantetheinyl transferase acpS) [Streptococcus agalactiae 18RS21] >gi|76585933|gb|EAO62470.1| Holo-[acyl-carrier protein] synthase (Holo-ACP synthase)(4'-phosphopantetheinyl transferase acpS) [Streptococcus agalactiae 18RS21] (82 aa)
Score = 82, Expect = 7.5e-01, Identities = 25/72 (34%), Positives = 41/72 (56%)
  Q:    17 GIDVTKIDYFVN---KSDKFIKRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKAINE-FHKIFFINIEFIKN 88
           GID+ +I+       ++ +F +R+LT+ E   +  I N   +  FL  RWA KEA  KA+     K+ F +IE + +
  S:     6 GIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSD 82
>gi|116493288|ref|YP_805023.1| phosphopantetheinyl transferase (holo-ACP synthase) [Pediococcus pentosaceus ATCC 25745] >gi|122265248|sp|Q03DZ1|ACPS_PEDPA Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) >gi|116103438|gb|ABJ68581.1| Phosphopantetheinyl transferase (holo-ACP synthase) [Pediococcus pentosaceus ATCC 25745] (118 aa)
Score = 82, Expect = 7.6e-01, Identities = 20/58 (34%), Positives = 35/58 (60%)
  Q:    14 FNIGIDVTKIDYF--VNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKA 71
           + IGID+T ID F  ++    FI+++LT  E++++          FLA  +++KE+  KA
  S:     3 YGIGIDITNIDRFKTLHNPATFIQKVLTPTEFDEFEAKKGQRAYEFLAGHFSVKESYSKA 62
>gi|65319672|ref|ZP_00392631.1| COG2091: Phosphopantetheinyl transferase [Bacillus anthracis str. A2012] (249 aa)
Score = 82, Expect = 8.2e-01, Identities = 27/85 (31%), Positives = 42/85 (49%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKN 100
           +G+DV +++  V+   K  + +LTD E  Q +K+ N  K     + W  KEA  KA  E   I  ++I  I   N+S     FK+
  S:   122 VGVDVEQMNPNVDXM-KMAEXVLTDIEKAQVMKLPNEQKIEGFLTYWTRKEAVLKATGEGLMISPVDIT-ISAPNDSPNLLVFKD 204
>gi|194246688|ref|YP_002004327.1| Holo-[acyl-carrier-protein] synthase [Candidatus Phytoplasma mali] >gi|193807045|emb|CAP18481.1| Holo-[acyl-carrier-protein] synthase [Candidatus Phytoplasma mali] (117 aa)
Score = 82, Expect = 8.3e-01, Identities = 32/83 (38%), Positives = 45/83 (54%)
  Q:    35 KRLLTDNEYNQYLKIDN-NLKPRFLASRWALKEATFKA--INEFHKIFFINIEFIKNDNNSYTCTTF--KNVKVSISYDGNQVFATAI 117
           KR+L+  EYN +L I N   K  F+A RWA+KEA FK    ++  KI F +   + N+           KN+ +SIS+      A AI
  S:    26 KRILSPEEYNIFLNIKNIKRKLSFVAGRWAVKEAIFKTAYTSKNKKINFCSYTILNNELGKPYVKNLDTKNIMISISHSEKYAIALAI 113
>gi|171910536|ref|ZP_02926006.1| 4'-phosphopantetheinyl transferase sfp [Verrucomicrobium spinosum DSM 4136] (277 aa)
Score = 81, Expect = 9.1e-01, Identities = 19/57 (33%), Positives = 33/57 (57%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAI 72
           IG+DV +ID     SD+ ++   T++E+  +  +   L+ R  A  W +KEA+ KA+
  S:   162 IGVDVEEIDEH-EPSDEHLEIAFTEDEHLAWSCLPAELRRRAFAEAWTIKEASLKAM 217
>gi|52143104|ref|YP_083725.1| 4'-phosphopantetheinyl transferase [Bacillus cereus E33L] >gi|51976573|gb|AAU18123.1| 4'-phosphopantetheinyl transferase [Bacillus cereus E33L] (249 aa)
Score = 81, Expect = 9.3e-01, Identities = 27/85 (31%), Positives = 42/85 (49%)
  Q:    16 IGIDVTKIDYFVNKSDKFIKRLLTDNEYNQYLKIDNNLKPRFLASRWALKEATFKAINEFHKIFFINIEFIKNDNNSYTCTTFKN 100
           +G+DV +++  V+   K    +LTD+E  Q +K+ N  K     + W  KEA  KA  E   I  ++I  I   N+S     FK+
  S:   122 VGVDVEQMNPNVDVM-KMADGVLTDSEKAQVMKLPNEQKIEGFLTYWTRKEAVLKATGEGLMISPVDIT-ISAPNDSPNLLVFKD 204