>gi|26553488|ref|NP_757422.1| hypothetical protein MYPE360 [Mycoplasma penetrans HF-2] >gi|26453494|dbj|BAC43826.1| hypothetical protein [Mycoplasma penetrans HF-2] (88 aa)
Score = 362, Expect = 2.4e-33, Identities = 88/88 (100%), Positives = 88/88 (100%)
  Q:     1 MNLIAMIGTVDKVRRDDQTSIVTLKVEKPFFDSTNENDFFDTIDVNVNSALFSQDLSLINSGVLLGLKGRLRNDNQSLKVVAEKIQIF 88
           MNLIAMIGTVDKVRRDDQTSIVTLKVEKPFFDSTNENDFFDTIDVNVNSALFSQDLSLINSGVLLGLKGRLRNDNQSLKVVAEKIQIF
  S:     1 MNLIAMIGTVDKVRRDDQTSIVTLKVEKPFFDSTNENDFFDTIDVNVNSALFSQDLSLINSGVLLGLKGRLRNDNQSLKVVAEKIQIF 88