>gi|26553489|ref|NP_757423.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma penetrans HF-2] >gi|26453495|dbj|BAC43827.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma penetrans HF-2] (270 aa)
Score = 1247, Expect = 2.1e-135, Identities = 270/270 (100%), Positives = 270/270 (100%)
  Q:     1 MKAKKFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKEE 270
           MKAKKFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKEE
  S:     1 MKAKKFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKEE 270
>gi|13357904|ref|NP_078178.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762385|ref|YP_001752427.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920403|ref|ZP_02691403.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508839|ref|ZP_02690240.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701839|ref|ZP_02554083.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11282620|pir||E82903 1-acyl-sn-glycerol-3-phosphate acyltransferase UU344 [imported] - Ureaplasma urealyticum >gi|6899323|gb|AAF30753.1|AE002131_7 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827962|gb|ACA33224.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902843|gb|EDT49132.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675809|gb|EDT87714.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701133|gb|EDU19415.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] (264 aa)
Score = 313, Expect = 4.1e-27, Identities = 83/251 (33%), Positives = 140/251 (55%)
  Q:     6 FLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-------EKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           FL  L   + +PF   ++ + +  +     +++ DPE + + ER   +  +    ++    KV + G +N+ + KS++++ NHKSN D +V LKA   I        +  FV+KIE+ K+  + F   LI+ I+IDR NLR  +    E+   L++  + L +F EGTR    EF EFKS ALT AY+T   I P VI+ + G        +++ +SN FK + + V FLEPI   +YI  +K+++  K+++ ++  Y
  S:     3 FLKTLLWFVAYPFVALYIIIQMILAAMMANKYKNDPESVSVNERYKKIMGIIDAILYLKNIKVDLIGKENV-SIKSMLYIGNHKSNGDPIVLLKALYQISPH-----NVRFVAKIELKKS-FLKFLFNLIDVIYIDRNNLRQSISTINEQVNALKQDYRGLVIFPEGTRNFNHEFNEFKSGALTAAYNTLSSIQPFVIFNSQGSFEMKNDQKQKLRSNPFKTQHIKVSFLEPIHSFNYININKDILMRKIQSNIKKNY 253
>gi|171920855|ref|ZP_02932020.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178883|ref|ZP_02964656.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024261|ref|ZP_02996957.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039415|ref|ZP_02998183.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 8] >gi|188518602|ref|ZP_03004054.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524514|ref|ZP_03004509.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530901|ref|ZP_03005180.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568577|ref|ZP_03005374.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 2] >gi|188592387|ref|ZP_03005761.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 10] >gi|195868015|ref|ZP_03080010.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903059|gb|EDT49348.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209139|gb|EDU06182.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018924|gb|EDU56964.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997788|gb|EDU66885.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659582|gb|EDX52962.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660307|gb|EDX53569.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (264 aa)
Score = 306, Expect = 2.8e-26, Identities = 78/243 (32%), Positives = 137/243 (56%)
  Q:    14 LGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-------EKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           + +PF   ++ + +  +    K+++ DPE + + +R   + ++    ++    KV + G +N+ + KS++++ NHKSN D LV LKA   I        +  FV+KIE+ K+  + F   LI+ I+IDR NLR  +    E+   L++  + L +F EGTR    EF EFKS  LT AY+T   I P VI+ + G        +++ ++N FK + + V FLEPI   +YI  +K+++  +++  ++  Y
  S:    11 VAYPFVALYIIVQMILAAIMAKKYKNDPEAVNVNDRYKKIMAIIDAVLYLKNIKVDLIGKENV-SIKSMLYIGNHKSNGDPLVLLKALYQISPH-----NVRFVAKIELQKS-FLKFLFNLIDVIYIDRNNLRQAISTIDEQVNALKQTYRGLVIFPEGTRNFSHEFNEFKSGTLTAAYNTLSSIQPFVIFNSQGSFESKDDKKQKLRNNPFKTQHIKVSFLEPIHSFNYINVNKDILMRRIQTNIKKNY 253
>gi|12045066|ref|NP_072877.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Mycoplasma genitalium G37] >gi|2498788|sp|Q49402|PLSC_MYCGE Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) >gi|3844812|gb|AAC71431.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Mycoplasma genitalium G37] >gi|166078614|gb|ABY79232.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [synthetic Mycoplasma genitalium JCVI-1.0] (268 aa)
Score = 262, Expect = 3.3e-21, Identities = 82/229 (35%), Positives = 121/229 (52%)
  Q:     5 KFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVE------KEH---KSNIFKYKEVTVEFLEPIKY 233
           +F+ +    L  P    +  LS  +     K ++  P       R   VY L S  ++    KV     K IP  K V+ V NHKSN D LV +KAF  +K   P     TFV+KIE+  T       KLI+ +FIDR+N+R      + +++L+++G  ++ VF EGTRI  ++ GEFK  AL  AY+ F  I+PV I G+LG        KEH   KS+ ++ K +  + + PI +
  S:    10 RFIIRFLQILSLPVVFPYFLLSFLACLITSKNYESLPYNYPPEIRFKKVYRLVSMWLYIKGIKVVTVNDKIIP-KKPVLVVANHKSNLDPLVLIKAFGRLKNSPPL----TFVAKIELKDTVLFKLM-KLIDCVFIDRKNIRQIANALETQQQLIRQG-TAIAVFAEGTRILSNDIGEFKPGALKVAYNAFVPILPVSIVGSLGKMESNKRLKEHGVKKSSNYEVKVIFNKLINPISF 240
>gi|148377984|ref|YP_001256860.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Mycoplasma agalactiae PG2] >gi|148292030|emb|CAL59422.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Mycoplasma agalactiae PG2] (246 aa)
Score = 259, Expect = 7.3e-21, Identities = 71/221 (32%), Positives = 120/221 (54%)
  Q:    35 KRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFD-VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT---LGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           +++++DP      +R +++   A   ++    K+ ++G  NIP   +V+  PNHKSN D VLV     K  KE+      PTF++KIE+SK + +     LI+TI++DR N RD ++   E    ++K      +F EGTR+ +DE G+FK+ A   A S +  IVPV I  +   L V++       K  ++ V FL  +K   +I     +++E +K+ ++ A
  S:    25 RKYRKDPTFYHPQQRNDWLLKKARFFLWLYGVKLVVEGYDNIPKG-AVILAPNHKSNIDPVLVLCALRKQTKEENVRNKIPTFLAKIELSKKRTIRNLLSLIDTIYVDRDNPRDGIKKINEFGAFVKKNSTCGVIFPEGTRVVEDELGDFKAGAFKVAVSNYLPIVPVAISDSRDGLNVKR------MKSIKIKVTFLPALKPASFITMEPVVIAENVKSMIKGA 242
>gi|13508038|ref|NP_109987.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma pneumoniae M129] >gi|2498789|sp|P75479|PLSC_MYCPN Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) >gi|1674233|gb|AAB96185.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma pneumoniae M129] (266 aa)
Score = 257, Expect = 1.2e-20, Identities = 80/234 (34%), Positives = 126/234 (53%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK-------EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           SS    K ++  PE      R   VY L S  ++    KV I   +N+P  K+V+ V NHKSN D L+ +KAF   +   P     TF++KIE+  T       KLI+ +FIDR+NLR      +++++++++G  +L VF EGTR+   + GEFKS AL  AY+ F  IVP+ I G++G   E K  + K +       ++ V F  PI   ++ Q   + V+  +  ++   Y +  +D
  S:    34 SSLISAKNYESIPENYPPEIRFKKVYRLVSLFLYIKGVKVVIVNPENVP-KKAVLVVANHKSNLDPLILIKAFGKTEGVPPL----TFIAKIELQDTWLFKIM-KLIDCVFIDRKNLRQMAASLEQQQQIIRQG-TALCVFPEGTRVLSRQIGEFKSGALKVAYNAFVPIVPLTIVGSMG-HMESKKRLQKAQVERDRGYKIQVIFNTPINPINFNQIDSQNVANNVWREISQTYAQYCQD 266
>gi|31544608|ref|NP_853186.1| hypothetical protein MGA_0039 [Mycoplasma gallisepticum R] >gi|31541453|gb|AAP56754.1| PlsC [Mycoplasma gallisepticum R] (276 aa)
Score = 249, Expect = 1.2e-19, Identities = 72/210 (34%), Positives = 113/210 (53%)
  Q:    49 RQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEK---------EHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLK 258
           R   VY LA + +F    K++IK +  IP  K V+F+ NHKSN D  V +     +K+    I + TFV+K E+ K K +G    LI+ IFIDR +++   +    E ELL+    S+ VF EGTR+   + GEFK  A+  AY  FC IVP  ++ T G  +         +      +  ++ +EFL+P+K  DY ++    +   ++  ++  Y K
  S:    57 RFKTVYILACRVIFFKGVKIEIKNADLIP-KKPVLFIGNHKSNIDPFVMIWLANHLKD----ITELTFVAKAEL-KNKSIGKIMSLIDVIFIDRNSIKQTAKATLNEIELLKN--TSVCVFAEGTRVFSHQLGEFKPGAIKAAYKAFCPIVPFSLFNTQGRMETISDRDRPVQPGFQKARTNKIYIEFLKPLKPIDYSRSESTFIINIIRELIQQTYQK 267
>gi|66880199|ref|ZP_00405183.1| COG0204: 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma genitalium G-37] (195 aa)
Score = 245, Expect = 3.1e-19, Identities = 68/160 (42%), Positives = 98/160 (61%)
  Q:    74 KNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVE------KEH---KSNIFKYKEVTVEFLEPIKY 233
           K IP  K V+ V NHKSN D LV +KAF  +K   P     TFV+KIE+  T       KLI+ +FIDR+N+R      + +++L+++G  ++ VF EGTRI  ++ GEFK  AL  AY+ F  I+PV I G+LG        KEH   KS+ ++ K +  + + PI +
  S:     6 KIIP-KKPVLVVANHKSNLDPLVLIKAFGRLKNSPPL----TFVAKIELKDTVLFKLM-KLIDCVFIDRKNIRQIANALETQQQLIRQG-TAIAVFAEGTRILSNDIGEFKPGALKVAYNAFVPILPVSIVGSLGKMESNKRLKEHGVKKSSNYEVKVIFNKLINPISF 167
>gi|160894450|ref|ZP_02075226.1| hypothetical protein CLOL250_02002 [Clostridium sp. L2-50] >gi|156863761|gb|EDO57192.1| hypothetical protein CLOL250_02002 [Clostridium sp. L2-50] (245 aa)
Score = 231, Expect = 1.2e-17, Identities = 72/249 (28%), Positives = 111/249 (44%)
  Q:    10 LGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLK 258
           LG    FP+ ++   L+ +   K Y             + Q  V       +F T  K  I G +NIP ++ VMFV NH+S FD+L    A  M            F+SK  I     +      I   ++DR +L+  +    +  ++++ G  S+ +F EGTR K DE   FK  A   A    C I+PV I GT    + +K N     +V +EFLEP+  +      ++ V + +  K++AA LK
  S:    12 LGIIFCFPYHLYLKQLAKKDQDKAY------------IKAQKLVKGFFGVVMFLTGCKRTIIGKENIPTDQPVMFVGNHRSYFDILSCHNAIDM---------PLGFMSKDNIKDIPLLYKYMDDIGCTYLDRTDLKKGLETILQTADIIKSG-HSMMIFPEGTRNKGDELLPFKDGAFKIAQKAGCLIIPVAICGTDKCMEANKHNFLHSSKVVIEFLEPVDIRGLKPKERKEVLDAIPGKIQAARLK 238
>gi|168139000|ref|ZP_02582229.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus G9842] (239 aa)
Score = 225, Expect = 6.1e-17, Identities = 72/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  +DY
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMAPKEKDNAVYKTTNWFGKKMVRVAGGTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLKAIKDGIELLKNG-HSIVIFPEGTRSKGGEVGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKPAHATVTISKPITPEDY 217
>gi|30020329|ref|NP_831960.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus ATCC 14579] >gi|29895880|gb|AAP09161.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus ATCC 14579] (239 aa)
Score = 225, Expect = 6.1e-17, Identities = 72/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  +DY
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMAPKEKDNAVYKTTNWFGKKMVRVAGGAVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLQAIKDGIELLKNG-HSIVIFPEGTRSKGGEVGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKPAHATVTISKPITPEDY 217
>gi|196042315|ref|ZP_03109592.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus NVH0597-99] >gi|196026860|gb|EDX65490.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus NVH0597-99] (239 aa)
Score = 222, Expect = 1.4e-16, Identities = 71/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  ++Y
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMSPQEKDNAVYKTTNWFGKKMVRVAGGTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLQAIKDGIELLKNG-HSIVIFPEGTRSKGGEIGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKRARATVTISKPITPEEY 217
>gi|47570569|ref|ZP_00241189.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus G9241] >gi|47552759|gb|EAL11190.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus G9241] (239 aa)
Score = 222, Expect = 1.7e-16, Identities = 71/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  ++Y
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMSPQEKDNAVYKTTNWFGKKMVRVAGGTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLQAIKDGIELLKNG-HSIVIFPEGTRSKGGEVGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKRARATVTISKPITPEEY 217
>gi|30262254|ref|NP_844631.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Bacillus anthracis str. Ames] >gi|47527537|ref|YP_018886.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49185097|ref|YP_028349.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Bacillus anthracis str. Sterne] >gi|49477567|ref|YP_036355.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65319547|ref|ZP_00392506.1| COG0204: 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus anthracis str. A2012] >gi|118477672|ref|YP_894823.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|166992858|ref|ZP_02259318.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus AH820] >gi|167632784|ref|ZP_02391110.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus anthracis str. A0442] >gi|196033924|ref|ZP_03101335.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus W] >gi|196046899|ref|ZP_03114120.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus 03BB108] >gi|30256885|gb|AAP26117.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Bacillus anthracis str. Ames] >gi|47502685|gb|AAT31361.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Bacillus anthracis str. 'Ames Ancestor'] >gi|49179024|gb|AAT54400.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Bacillus anthracis str. Sterne] >gi|49329123|gb|AAT59769.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118416897|gb|ABK85316.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|167531596|gb|EDR94261.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus anthracis str. A0442] >gi|195993604|gb|EDX57561.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus W] >gi|196022274|gb|EDX60960.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus 03BB108] (239 aa)
Score = 222, Expect = 1.7e-16, Identities = 71/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  ++Y
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMSPQEKDNAVYKTTNWFGKKMVRVAGGTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLQAIKDGIELLKNG-HSIVIFPEGTRSKGGEIGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKSARATVTISKPITPEEY 217
>gi|42781334|ref|NP_978581.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus ATCC 10987] >gi|42737256|gb|AAS41189.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Bacillus cereus ATCC 10987] (239 aa)
Score = 221, Expect = 1.7e-16, Identities = 71/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  ++Y
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMSPQEKDNAVYKTTNWFGKKMVRVAGGTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLQAIKDGIELLKNG-HSIVIFPEGTRSKGGEIGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKRARATVTISKPITPEEY 217
>gi|52143213|ref|YP_083616.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus E33L] >gi|51976682|gb|AAU18232.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus E33L] (239 aa)
Score = 221, Expect = 2.2e-16, Identities = 71/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  ++Y
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMSPQEKDNAVYKTTNWFGKKMVRIAGGTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLQAIKDGIELLKNG-HSIVIFPEGTRSKGGEVGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKSAHATVTISKPITPEEY 217
>gi|168163986|ref|ZP_02599219.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus H3081.97] (239 aa)
Score = 220, Expect = 2.6e-16, Identities = 71/219 (32%), Positives = 109/219 (49%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           F +F+L L + +   +  R +     +   E+ N VY        K V      V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E GEFK+ +   A  +   I+PV + GT  +  E   N  K    TV   +PI  ++Y
  S:     6 FKIFYLILIVIAITPRMWRLKRQVNTMSPQEKDNAVYKTTNWFGKKMVRGAGGTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLQAIKDGIELLKNG-HSIVIFPEGTRSKGGEVGEFKAGSFHLAVKSGVAILPVTLDGTYKM-FEANGNRMKRARATVTISKPITPEEY 217
>gi|163940034|ref|YP_001644918.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163862231|gb|ABY43290.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus weihenstephanensis KBAB4] (239 aa)
Score = 220, Expect = 2.7e-16, Identities = 70/232 (30%), Positives = 116/232 (50%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           F +F+L L + +   +  R +     +   E+ + VY        K V  T + V++KG +N+P +K V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR + R  ++  ++  ELL+ G  S+ +F EGTR K  E G+FK+ +   A  +   I+PV + GT  +  E   N  K    T+   +PI  ++Y     + +++  K
  S:     6 FKIFYLILIVIAITPRLWRIKRKANAMSPQEKDSVVYKTTNWFGKKMVRVTGSTVEVKGLENVPKDKPVLVVSNHQSNMDIPVLLGYL-----NKP----IGFVSKAEIKKFPVVPTWMELMNCVFMDRSDRRQSLKAIKDGIELLKSG-HSIVIFPEGTRSKGGEIGDFKAGSFHLAVKSGVSILPVTLDGTYKM-FEANGNRMKPAHATLTISKPITPEEYASMDAKELTQHTK 230
>gi|172056651|ref|YP_001813111.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Exiguobacterium sibiricum 255-15] >gi|171989172|gb|ACB60094.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Exiguobacterium sibiricum 255-15] (232 aa)
Score = 219, Expect = 3.5e-16, Identities = 62/195 (31%), Positives = 103/195 (52%)
  Q:    50 QNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELV 244
           Q   ++ A+  +     KV++ G ++IPA++ V+F+ NH+ NFDV + L      K  +P+     F+SKIE++K   V     L+  + IDR++ R  ++  +   + ++ G QS+ +F EGTR K     EFK+ + T A S+   +VP+ I G+  V +E  +   +   V V  L+PI      Q  KELV
  S:    38 QKVAHAWANSLLRLAGVKVRMTGQEHIPADQPVVFIANHQGNFDVPILLG-----KIDKPK----AFISKIEVNKIPIVNVWMNLMGCVMIDRKDRRQSLKAIRAGIDTIKDG-QSMIIFPEGTRSKGGPVAEFKAGSFTLATSSGALVVPIAISGSYRVMEE--TGRIRPATVDVTILKPIDPTSMSQ--KELV 218
>gi|152975430|ref|YP_001374947.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024182|gb|ABS21952.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] (241 aa)
Score = 219, Expect = 3.9e-16, Identities = 63/171 (36%), Positives = 93/171 (54%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           + V++KG +N+P ++ V+ V NH+SN D+ V L         +P      FVSK EI K   V    +L+N +F+DR N R  ++  +E  E L+KG  SL +F EGTR K  E GEFK+ +   A  +   I+PV I GT  + +E+  N  K   VT+   +PI  + Y
  S:    60 STVEVKGLENVPKDQPVLVVSNHQSNMDIPVLLGYLN-----KP----IGFVSKAEIKKIPIVPAWMELMNCVFMDRSNRRQSLQAIKEGIERLKKG-HSLVIFPEGTRSKGGEIGEFKAGSFHLAIKSGVAILPVTIEGTYKMFEEN-GNRLKPAHVTLTISKPITPEQY 219
>gi|187605080|ref|ZP_02991283.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Exiguobacterium sp. AT1b] >gi|187482920|gb|EDU20921.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Exiguobacterium sp. AT1b] (233 aa)
Score = 211, Expect = 3.0e-15, Identities = 72/215 (33%), Positives = 107/215 (49%)
  Q:    50 QNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPN 264
           Q+  Y  A   +      V++ G   IP ++ V++V NH+ NFDV + L A      KRP+     F+SKIE+ K   +    +L+  IFIDR + R  ++  +   E +Q G QS+ VF EGTR K     EFK+ +LT A S+  +IVPV I G+  + +    N      V V FL  I   D       L ++++ A +EAA  +  E  N
  S:    38 QDIAYKWAQFLLKIAGANVRVHGQDQIP-DEPVVYVSNHQGNFDVPIMLTA-----TKRPK----AFISKIEVQKFPIIPRWMELMGCIFIDRSDRRQSIQAIRSGVETIQSG-QSMIVFPEGTRSKGGPMKEFKAGSLTLATSSGAKIVPVAIQGSYKLLE--AKNRITPATVDVTFLPAIDPAD-------LPNKEIAATVEAAIRQQLEGEN 232
>gi|150019836|ref|YP_001312090.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149906301|gb|ABR37134.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium beijerinckii NCIMB 8052] (240 aa)
Score = 210, Expect = 3.3e-15, Identities = 54/151 (35%), Positives = 80/151 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNI 217
           K+ + G  N+P +++V+FV NH+SNFD+ + L    + K          F++K E+ K   +    K IN IF+DR NLR       E   LL+ G  S+ +F EGTR K     EFKS +   A  + C IVP+ I GT  + +E+ + I
  S:    59 KINVIGLDNLPKDQTVLFVSNHQSNFDIPLLLSCIDIPK---------GFIAKKELEKLPLISTWMKYINCIFMDRDNLRKSAESIVEGVNLLKSG-YSMVIFPEGTRSKGKSVDEFKSGSFKLATKSKCPIVPLTINGTYKLMEENNNAI 199
>gi|182418686|ref|ZP_02949962.1| probable 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium butyricum 5521] >gi|182377463|gb|EDT75018.1| probable 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium butyricum 5521] (188 aa)
Score = 207, Expect = 7.6e-15, Identities = 60/176 (34%), Positives = 91/176 (51%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE 242
           K+ + G +NIP +++V+F+ NH+SNFD+ + + +  + K          F++K E+ K   +    K IN IF+DR NLR       E  +LL+ G  S+ +F EGTR K     +FK+ +   A  + C IVPV I GT  + + +K N  K   V +    PI   D    SKE
  S:     7 KITVIGEENIPKDQTVLFIANHQSNFDIPLIMSSINVPK---------GFIAKKELEKWPMISTWMKYINCIFMDRSNLRKSAEAIVEGAKLLKNG-YSMVIFPEGTRSKGGPVEDFKAGSFKLATKSKCPIVPVTIDGTYKLLEANK-NWIKADNVRLIIHPPI---DVTSLSKE 168
>gi|188590683|ref|YP_001922620.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum E3 str. Alaska E43] >gi|188500964|gb|ACD54100.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum E3 str. Alaska E43] (239 aa)
Score = 205, Expect = 1.4e-14, Identities = 59/211 (27%), Positives = 109/211 (51%)
  Q:    46 LTERQNYVYSLASK----AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           L E+  +++ + SK     +     +V + G  NIP  ++++F+ NH+SNFD+ + + +  + K          F++K E+     +    K IN +F+DR+NLR       +   +L+ G  S+ +F EGTR K  E G+FK+ +   A  + C IVP+ I GT  + ++  +N  K   V +    PI  KD  +  ++ +  K+++ + + Y
  S:    34 LKEKTEFIHKVTSKWARFVMKACGARVNVIGLDNIPKGETILFISNHQSNFDIPLLMSSIDVPK---------GFIAKKELETLPFISTWMKYINCVFMDRKNLRKSAEAIVQGINILKTG-YSMVIFPEGTRSKGKEIGDFKAGSFKLALKSKCVIVPLTINGTYKLLEQ--TNRIKPANVELVVHAPIYTKDLTKEEQDELPNKVRSIVCSKY 236
>gi|15828585|ref|NP_325945.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma pulmonis UAB CTIP] >gi|14089527|emb|CAC13287.1| 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE (1-AGP ACYLTRANSFERASE) (1-AGPAT) (LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE) (LPAAT) [Mycoplasma pulmonis] (255 aa)
Score = 205, Expect = 1.4e-14, Identities = 65/227 (28%), Positives = 117/227 (51%)
  Q:    32 KKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEI-LDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLK 258
           KK +++++ PE L   +R  YV  L++K +     +V++KG +NI    +++ V NH +N D L  + AF+   +   ++  + +FV+KIE+ K K    A +LI  +FIDR  +R      +   + L++ ++   ++ EGTR    E GEFKS A   A   +  I+PV I  +            K   +    L+P+ + +   T    +++ +K K+E+AY+K
  S:    23 KKARKFRKKPESLKKYDRYGYVNKLSNKVLKLMNIEVEVKGYENIIKAPAIV-VSNHANNIDSLALMSAFENKSDDIDKVEKEMSFVAKIELKKNKVYSAAMELIECLFIDRTKIRQSWDKMKVFGDFLKENKKYGVIYAEGTRTTTGELGEFKSGAFKVAQKFWLPIIPVTINNSFDAVNFKDKTKRKITVIIHPALKPVNFGNLDSTK---LAQLVKNKIESAYIK 246
>gi|163762118|ref|ZP_02169184.1| Xenobiotic-transporting ATPase [Bacillus selenitireducens MLS10] >gi|160357745|gb|EDP84392.1| Xenobiotic-transporting ATPase [Bacillus selenitireducens MLS10] (256 aa)
Score = 203, Expect = 2.4e-14, Identities = 60/204 (29%), Positives = 100/204 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKEE 270
           KV + G ++IP  + V+FV NH+ NFD+ V L                 F+SKIE+ K   +      ++ +F+DR++ R  V+      E L+ G  SL +F EGTR K     EFK+ +   A  +   I+PV I GT  +  E K+N     EV++ F EP++   + + S   +++  + ++ A        P+ +E+ E
  S:    59 KVHVHGIEHIPKEEPVLFVSNHQGNFDIPVILSNVPR---------KTGFISKIEVMKLPLIRSWMTHLDCVFLDRKDSRQAVKSISAGAESLKNG-HSLVIFPEGTRSKGRPVQEFKTGSFKLATKSGVPIIPVTIEGTHAM-MESKNNRITPGEVSITFGEPLRIHQHEKMSMAELADATRQRIIAQLRNEAYRPSETEERE 251
>gi|187935305|ref|YP_001887641.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum B str. Eklund 17B] >gi|187723458|gb|ACD24679.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum B str. Eklund 17B] (239 aa)
Score = 203, Expect = 2.6e-14, Identities = 57/211 (27%), Positives = 109/211 (51%)
  Q:    46 LTERQNYVYSLASK----AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           L E+  +++ + SK     +     ++ + G  NIP  ++++F+ NH+SNFD+ + + +  + K          F++K E+     +    K IN +F+DR+NLR       +   +L+ G  S+ +F EGTR K  E G+FK+ +   A  + C I+P+ I GT  + ++  +N  K   V +    PI  KD  +  ++ +  K+++ + + Y
  S:    34 LKEKTEFIHKVTSKWARFVMKACGARINVIGLDNIPKGETILFISNHQSNFDIPLLMSSIDVPK---------GFIAKKELETLPFISTWMKYINCVFMDRKNLRKSAEAIVQGINILKTG-YSMVIFPEGTRSKGKEIGDFKAGSFKLALKSKCVIIPLTINGTYKLLEQ--TNRIKPANVELVVHAPIYTKDLTKEEQDELPNKVRSIVCSKY 236
>gi|71894121|ref|YP_278229.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma synoviae 53] (245 aa)
Score = 196, Expect = 1.5e-13, Identities = 74/234 (31%), Positives = 110/234 (47%)
  Q:    16 FPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKM-IKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           F    FF  L +R   K YK    +PE      R NY+  L  K +      +++ G +NI      + VPNHKS  D +V + A K   +E+  E    TF+SK E SK   +  A  LI+ + I R +LR+           ++  +    +F EGTR+K +  GEFKS A   A S +  I+P  I  +        SN  K  +VTV FL P+K + ++    E +S ++K
  S:     8 FALPWFFRVLKIRKMAKNYK---SNPETYSEKFRYNYLLKLCEKILRIYNIDLEVIGYENIEKGYGFI-VPNHKSGIDPIVLIAALKNPSQEEGAENKFATFISKEEQSKI--LIKAMSLIDVVLIKRNDLRNSYEGLINFGNYVKNKKVYGVIFPEGTRVKGEALGEFKSGAFKIAKSNYLPIIPCAISNS---ADAFNSNRKKRLKVTVSFLSPLKPQSFMILENEAISNRVK 233
>gi|154484248|ref|ZP_02026696.1| hypothetical protein EUBVEN_01960 [Eubacterium ventriosum ATCC 27560] >gi|149734725|gb|EDM50642.1| hypothetical protein EUBVEN_01960 [Eubacterium ventriosum ATCC 27560] (238 aa)
Score = 195, Expect = 1.8e-13, Identities = 61/203 (30%), Positives = 107/203 (52%)
  Q:    62 FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPT-FVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPN 264
           F +  K+++ G +NIP N++ +FV NH S FD++V            P ++ PT +++K E+ K   + +  + +N IF+DR++ R+ ++      ++++ G  S+ +F EGTR K  + GEFK      A  +   +VPV I GT  + + H   I K  +V V F +PI   D  +  ++L+  K       AY ++K+  N
  S:    53 FLSGVKLEVNGKENIP-NQACLFVANHISFFDIVV----------TYPLMISPTGYIAKKELEKVPFLSWIMRFVNCIFLDRKDPRNGLKAVLSAADMIKSG-ISVFLFPEGTRSKTGKMGEFKDGGFKIATKSKAPVVPVGITGTNDILENHFPFI-KSGKVIVSFGKPIYTTDMDRAEQKLLPGK-------AYEQVKKLSN 236
>gi|144574961|gb|AAZ43518.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma synoviae 53] (252 aa)
Score = 195, Expect = 1.8e-13, Identities = 74/234 (31%), Positives = 110/234 (47%)
  Q:    16 FPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKM-IKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           F    FF  L +R   K YK    +PE      R NY+  L  K +      +++ G +NI      + VPNHKS  D +V + A K   +E+  E    TF+SK E SK   +  A  LI+ + I R +LR+           ++  +    +F EGTR+K +  GEFKS A   A S +  I+P  I  +        SN  K  +VTV FL P+K + ++    E +S ++K
  S:    15 FALPWFFRVLKIRKMAKNYK---SNPETYSEKFRYNYLLKLCEKILRIYNIDLEVIGYENIEKGYGFI-VPNHKSGIDPIVLIAALKNPSQEEGAENKFATFISKEEQSKI--LIKAMSLIDVVLIKRNDLRNSYEGLINFGNYVKNKKVYGVIFPEGTRVKGEALGEFKSGAFKIAKSNYLPIIPCAISNS---ADAFNSNRKKRLKVTVSFLSPLKPQSFMILENEAISNRVK 240
>gi|50365200|ref|YP_053625.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mesoplasma florum L1] >gi|50363756|gb|AAT75741.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mesoplasma florum L1] (374 aa)
Score = 195, Expect = 1.8e-13, Identities = 68/227 (29%), Positives = 119/227 (52%)
  Q:    23 LWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI--------KYKDYIQTSKELVSEKMK 249
           +W  +R +KK  K+  + P         N+V   A + ++ +   VK +G +N   ++ V+  PNH+SNFD  V L A      ++P      F++K E+ + K+ G   +L++ I +DR+N R  +   +E K+L+    +SL +F EGTR    + GEF+ AAL  A      +VPV I  +  V  + +    K+ E+ V F +PI        K +D  + +++++ E M+
  S:    99 MWNMMRKAKKISKKNLKSPGYFSEEYCYNFVKKAAKRILYVSDITVKCEGIENW-LDRGVILAPNHQSNFDP-VALVALNNFYLQQPL----AFIAKKELWEDKKFGRFVRLMDCIPLDRKNPRSALEAFKEGKQLVVDFRRSLAIFPEGTRSHSQQVGEFQPAALKVAQMANAPVVPVTIINSYQVFSKDRP---KHIEIKVVFGKPIMPLKHISLKTEDLTKNTRKVIIENME 324
>gi|149179668|ref|ZP_01858173.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Bacillus sp. SG-1] >gi|148851860|gb|EDL66005.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Bacillus sp. SG-1] (231 aa)
Score = 194, Expect = 2.6e-13, Identities = 61/185 (32%), Positives = 90/185 (48%)
  Q:    64 TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKM 248
           T T V + G  NIP    V+FV NH+ +FD+ V L   +     +P      F+SKIE+ K   +     ++N +F+DR N R  V   +E    L+ G  SL VF E TR K      FK+ A   A      +VP+ I+GT  + + +K N  K   V V  L P+ + DY    K++ + +M
  S:    46 TGTTVDVHGRNNIPEG-PVLFVSNHEGDFDIPVLLGYIE-----KPF----GFMSKIEVKKLPIISHWMDILNCVFVDRNNKRKSVLSLRECISKLKDG-HSLVVFPEDTRNKGQGINIFKTGAFRIALEAGVPVVPIYIHGTADILENNK-NGLKPASVEVNILPPVMHGDY----KDMTASEM 214
>gi|118444805|ref|YP_878650.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Clostridium novyi NT] >gi|118135261|gb|ABK62305.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Clostridium novyi NT] (235 aa)
Score = 194, Expect = 2.9e-13, Identities = 57/185 (30%), Positives = 100/185 (54%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           VK +G +NIP +++  F+ NH+ +FD++  L         +P      F++K E+ K   + +  K +  +F+DRQN+R+ ++   +  E ++ G QS+ +F EGTR K    GEFK  +L  A      IVP+ + GT  + +E+   I K  EV +   EPI  ++  +  ++ +SE +K K+
  S:    59 VKAEGLENIP-DEACCFIANHQGDFDIVTILATID-----KPM----GFIAKKEMEKLPIISWWMKQMQCVFMDRQNVREALKSINQGSENMKNG-QSMVIFPEGTRSKSSTMGEFKKGSLKMATKAKVPIVPITLDGTYKIFEENNGKI-KSGEVNLVVGEPIYLENLSREDQKNISEIVKNKI 231
>gi|15894252|ref|NP_347601.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium acetobutylicum ATCC 824] >gi|15023870|gb|AAK78941.1|AE007612_1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium acetobutylicum ATCC 824] (241 aa)
Score = 191, Expect = 6.1e-13, Identities = 71/243 (29%), Positives = 118/243 (48%)
  Q:    20 VFFLWLSLRSS----KKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAF-KMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++F++  +R++    K  Y R +  PE          +++ A   +     KV +KG +NIP +  V F+ NH+SN D L  +    K I           F++K EI K K V    K+++ +FIDR ++R  +    E  + L+KG  S+ +F EGTR K    GEFK  +L  A      +VP+ I G   + ++ K  + +   V +  LEP+   D  +  K  +S+ +  K+      IK+D
  S:     8 IYFVFYMIRTTFFKIKLSYIR-RNAPEQEYEAAVHKVIFNWAKTMLRVIGVKVNVKGMENIPKDTCV-FISNHQSNVDFLAIMGTIDKQIG----------FIAKKEILKIKIVSSWMKMMHCVFIDRNDIRKSLMAINEGVDNLKKG-YSMAIFPEGTRSKSSNMGEFKKGSLKLATKANAVVVPIAIDGGYRLFEDVKGKL-RPGVVNMSILEPLNIADLDKEQKMNLSDILHKKISEELKLIKQD 241
>gi|167748376|ref|ZP_02420503.1| hypothetical protein ANACAC_03120 [Anaerostipes caccae DSM 14662] >gi|167652368|gb|EDR96497.1| hypothetical protein ANACAC_03120 [Anaerostipes caccae DSM 14662] (245 aa)
Score = 191, Expect = 6.7e-13, Identities = 56/178 (31%), Positives = 91/178 (51%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYI--QTSKEL 243
           TKV + G +NIP + +V++V NH S +D+L    A        P      F +K E+ K   +      IN +F+DR+N+++ ++   +  E L+ G  S+ +F EGTR + ++   FK  +L PA      ++P+ I GT  + + +K    K  EV + F  PI Y D +  Q  K L
  S:    58 TKVIVDGRENIPEDTAVLYVGNHSSYYDILCSYVA-------TPH--GAGFFAKNEMGKIPCLSHWMTFINCLFLDRKNIKEGMKTINKGTEYLKNG-FSMVIFPEGTRSQDEDPHTFKEGSLRPALKAKVPVIPMAISGTADILENNKKYTVKPTEVHITFGRPI-YPDQLDRQAQKHL 226
>gi|167768430|ref|ZP_02440483.1| hypothetical protein CLOSS21_02989 [Clostridium sp. SS2/1] >gi|167709954|gb|EDS20533.1| hypothetical protein CLOSS21_02989 [Clostridium sp. SS2/1] (244 aa)
Score = 190, Expect = 8.5e-13, Identities = 51/177 (28%), Positives = 93/177 (52%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE 242
           TK+ + G +NIP + +V++V NH S +D+L    A +             F +K E+ K   +    + IN +F+DR+N++  +    E  +LL+ G  S+ +F EGTR + ++  EFK  +L PA      ++P+ I GT  + + ++    K   V + F +PI Y D ++ +++
  S:    58 TKLIVDGQENIPEDGAVLYVGNHSSYYDILCSYVATER---------GMGFFAKKEMEKIPCLSHWMRFINCLFLDRKNIKAGLATMNEGTKLLKDG-FSIAIFPEGTRSQDEDPHEFKEGSLRPALKAGVPVIPMAISGTADILENNRRFQVKPTTVHITFGQPI-YPDQLERAEK 223
>gi|77918258|ref|YP_356073.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Pelobacter carbinolicus DSM 2380] >gi|77544341|gb|ABA87903.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Pelobacter carbinolicus DSM 2380] (235 aa)
Score = 188, Expect = 1.4e-12, Identities = 52/188 (27%), Positives = 91/188 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEA 254
           ++ ++G +N+PA  +V+F+PNH+SNFD+L    A    ++ R       +++K E+      G   +    I +DR N +  V   +   E +  G  S+ +F EGTR       EFK+ + T A      IVP+ I G+  V  +H S   +   VTV  + P+   D     +  + ++++  +EA
  S:    51 RLVVEGRENLPAEGAVVFMPNHQSNFDILALFAALS--RQFR-------WLAKEELFHIPLFGLTMRRAGYIPVDRSNRKKSVESMRHAIERISDG-TSVVIFPEGTRSPDGHLKEFKAGSFTLAIQAQVPIVPIAITGSRDVMPKH-SRWIRGGRVTVTIMPPVSTADRAVKERNELMQEVRGPIEA 227
>gi|168186420|ref|ZP_02621055.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum C str. Eklund] >gi|169295493|gb|EDS77626.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum C str. Eklund] (235 aa)
Score = 187, Expect = 1.9e-12, Identities = 55/187 (29%), Positives = 100/187 (53%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEA 254
           V  KG + IP +++  F+ NH+ +FD++  L         +P      F++K E+ K   + +  K +  +F+DRQN+R+ ++   +  E ++ G QS+ +F EGTR K    GEFK  +L  A      IVP+ + GT  + +++   I K  EV +   EPI  ++  +  ++ +SE +K+K+ +
  S:    59 VNTKGLEKIP-DEACCFIANHQGDFDIVTILATID-----KPM----GFIAKKEMEKLPIISWWMKQMQCVFMDRQNVREALKSINQGSENMKNG-QSMVIFPEGTRSKSSTIGEFKKGSLKMATKAKVPIVPITLDGTYKIYEDNNGKI-KGGEVKLVVGEPIYLENLSREDQKNISEIVKSKIAS 233
>gi|153953597|ref|YP_001394362.1| acyltransferase [Clostridium kluyveri DSM 555] >gi|146346478|gb|EDK33014.1| Predicted acyltransferase [Clostridium kluyveri DSM 555] (241 aa)
Score = 186, Expect = 2.4e-12, Identities = 73/229 (31%), Positives = 121/229 (52%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYV-YSLASKAVFC---TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPT--FVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSE 246
           + +FFL++     KK   +  +  +     E QNY+  SL   A F       K+++KG +NIP +   +FV NH+   D+ + + +           +D T  F++K EI K K + +  K I  +FIDR+++R+ ++   +  ++L+ G  S+ +F EGTR K    GEFK  +L  A      IVP+ I G+  + + +K +I K  EV V   +PI Y D +  SKE +S+
  S:     8 YFIFFLYMIYSLGKKS--KLNKIRKTKNEEEAQNYINISLKKWADFILKLIGAKIELKGVENIPKS-PCLFVSNHQGFLDIPIIVHS-----------VDRTVGFIAKKEIIKFKLIAYWMKQIKCVFIDRESIRESMKSINKAIQILKSG-HSMVIFPEGTRSKGPRIGEFKKGSLKLALKAKVPIVPIAIDGSYKLREGNKYSIVKSAEVKVTICKPI-YTDRL--SKEELSD 224
>gi|193216438|ref|YP_001999680.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma arthritidis 158L3-1] >gi|193001761|gb|ACF06976.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma arthritidis 158L3-1] (265 aa)
Score = 185, Expect = 3.2e-12, Identities = 52/181 (28%), Positives = 88/181 (48%)
  Q:    23 LWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           LW++  + K K  R  + PE    TER     +  +K +      +K++G  N+P N   + VPNH + FD L+   A   +           F++K E+++ K +   A+L++T ++D    R+ + V  E    ++  +    VF EGTR +  + GEF++ A   A S +  IVPV I
  S:    14 LWITYLTLKTKASRNIKMPEYYTKTERNKICQTKFAKILKYFGITLKVEGFDNVP-NSPCLIVPNHSTYFDALIMTVALSNLGNGEKVSKRVNFIAKSEVARKKSIQKIAQLLDTYYLDFSKPRELLSVLFEFGNAVKANKTCGVVFAEGTRSRDGKLGEFQTGAFKLAQSCYLPIVPVTI 193
>gi|167730384|emb|CAO81296.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) (plsC) [Candidatus Cloacamonas acidaminovorans] (239 aa)
Score = 182, Expect = 6.1e-12, Identities = 57/199 (28%), Positives = 96/199 (48%)
  Q:    57 ASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           A   V  T +KV + G +N+P++ ++ FV NH+  FD+ V L             +   FV+K E+ +   +    + I   FIDR+N R  ++  Q+  EL++KG   + +F EGTR + D+ G F   +L         IVP+ I G+  + +  K        V ++ L PIK  D I   K+ +S  + +++  A
  S:    50 AKMVVLSTGSKVVVTGKENLPSSVNICFVSNHQGLFDIPVILGFLG---------VHTGFVAKRELFRIPVLSQWMREIPCTFIDRRNPRKAIQTFQKSAELIKKG-NPMVIFPEGTRSRSDKIGNFHLGSLKLPIMAEATIVPLAIKGSWRIYEIDKR--IHPATVYLKILPPIKPTDDIYKDKQKLSTHLHSQISQA 236
>gi|193624742|ref|XP_001950878.1| PREDICTED: similar to 1-acyl-sn-glycerol-3-phosphate acyltransferase [Acyrthosiphon pisum] (254 aa)
Score = 180, Expect = 1.2e-11, Identities = 59/190 (31%), Positives = 83/190 (43%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLK 258
           ++KG +NI  N   + + NH+S  D+LV       + E  P +   T +SK EI      G A+ L  TIFIDR N     R   +  E ++  +  L +F EGTR    E   FK  A   A S  C I PVV+     V  +H    F      +  L PI  +   +     + EK +  M+ AY K
  S:    61 EMKGKENIVQNSGCVVLINHQSCLDLLV-------LSEIYPVMEKCTVISKKEIFYFWPFGLASWLWGTIFIDRLNAESAQRTLNKTGEAIRHKQAKLCMFPEGTRHGGPELLNFKKGAFHVAISAQCPIQPVVVTQYFFV--DHGKRTFDPGHAVITILPPISTEGMTKEDLPGLIEKSRTAMQEAYTK 241
>gi|160942786|ref|ZP_02090027.1| hypothetical protein FAEPRAM212_00263 [Faecalibacterium prausnitzii M21/2] >gi|158445951|gb|EDP22954.1| hypothetical protein FAEPRAM212_00263 [Faecalibacterium prausnitzii M21/2] (242 aa)
Score = 177, Expect = 2.3e-11, Identities = 53/192 (27%), Positives = 95/192 (49%)
  Q:    64 TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE--FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           T   + + G +NIP ++  +FV NH+S +D+ + L       EK   IL     +K E+ K   +    KL+  +F+ R ++R  VR   +   +++ G +S  +F EGTR K +E   GEFK+ A   A  T   +VPV + G   +  E   N  +   V ++ + PI+     +  ++ + + ++  + AA
  S:    58 TGVSLSVDGLENIPKDRPCVFVANHRSYYDIPLLLAGL----EKPHGIL-----AKEELEKIPLLNRWMKLLGCVFVQRDDVRASVRALNDATAIVEGG-RSFVIFPEGTRYKGEEGGAGEFKAGAFRIAVKTGAPVVPVAVTGARAL-FETNGNRCRPGSVRIKIMSPIQTAGMSKAEQKQLPDAVRQSILAA 240
>gi|167748620|ref|ZP_02420747.1| hypothetical protein ANACAC_03393 [Anaerostipes caccae DSM 14662] >gi|167651934|gb|EDR96063.1| hypothetical protein ANACAC_03393 [Anaerostipes caccae DSM 14662] (235 aa)
Score = 177, Expect = 2.6e-11, Identities = 66/238 (27%), Positives = 110/238 (46%)
  Q:    18 FCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKA----FKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           F V F+W+ L        ++ E+     L     ++ S A+K    T   +++ G +NIP     +F PNH+  +DVL   +A    F ++ +K  E+ D  F+ ++         FA   +    IDR ++R  ++V     E +++G   L +F EGTR K  +E    K  +   A    C IVPV +           SN  K   V V FL+P+ Y DY       ++E++K +++ A
  S:    13 FLVPFMWIKLCYYASHVDKYPEEKRFAML----KFITSRANKGGNVT---IEVHGEENIPEKDGFIFYPNHQGLYDVLAVAEACPRPFSVVAKK--EVADIQFLKQV---------FAC--MKAYMIDRDDIRQSMQVILSVAEEVKRGRNYL-IFAEGTRSKNGNEVQTLKGGSFKAAVKAKCPIVPVALVDAF---LPFDSNTIKPVTVQVHFLKPLYYDDYKHMKTTEIAEQVKERIQKA 231
>gi|154503040|ref|ZP_02040100.1| hypothetical protein RUMGNA_00862 [Ruminococcus gnavus ATCC 29149] >gi|153796281|gb|EDN78701.1| hypothetical protein RUMGNA_00862 [Ruminococcus gnavus ATCC 29149] (243 aa)
Score = 173, Expect = 8.2e-11, Identities = 57/213 (26%), Positives = 102/213 (47%)
  Q:    41 PELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKA----FKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           PE   L E   ++  +  +A      K++  G++N+P     MF PNH+  +DVL  L A    F ++ +K  E+ D  F+ ++              ++   IDR+++R  ++V  +  + +Q G+  L +F EGTR K  ++ G FK  +   A    C IVPV +  +    K   +       V V FLEP+ Y++Y       ++E +  +++
  S:    29 PENYTLEEHVKFLKWIVFRANKGGNVKIEEHGAENLPKENGFMFFPNHQGMYDVLAILDACPYPFSVVAKK--EVKDVPFLKQV-----------FSCMHAYMIDREDIRQSMQVIIDVSKEVQNGKNYL-IFAEGTRSKNGNQIGSFKGGSFKAATKAKCPIVPVALIDSF---KPFDTKTISQVTVQVHFLEPLYYEEYKNMKTTEIAEIVHDRIQ 229
>gi|30688731|ref|NP_194787.2| ATS2 (EMBRYO DEFECTIVE 1995); 1-acylglycerol-3-phosphate O-acyltransferase/ acyltransferase [Arabidopsis thaliana] >gi|81170963|sp|Q8GXU8|LPAT1_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplast precursor (Lysophosphatidyl acyltransferase 1) (Protein EMBRYO DEFECTIVE 1995) >gi|26451112|dbj|BAC42660.1| unknown protein [Arabidopsis thaliana] (356 aa)
Score = 172, Expect = 8.5e-11, Identities = 52/182 (28%), Positives = 84/182 (46%)
  Q:    50 QNYVYSLASKAVFCTFTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
            +++  L +      F K+ I+G +N+P++ +  ++V NH+S  D+   L   K  K          F+SK  I     +G+A  ++  + + R + R  V   +   ELL+KG  S+  F EGTR K    G FK  A T A  T   +VP+ + GT  +       I  +  V V   +PI
  S:   163 HHFIAKLWASISIYPFYKINIEGLENLPSSDTPAVYVSNHQSFLDIYTLLSLGKSFK----------FISKTGIFVIPIIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELLKKG-ASVFFFPEGTRSKDGRLGSFKKGAFTVAAKTGVAVVPITLMGTGKIMPTGSEGILNHGNVRVIIHKPI 334
>gi|167759590|ref|ZP_02431717.1| hypothetical protein CLOSCI_01947 [Clostridium scindens ATCC 35704] >gi|167662817|gb|EDS06947.1| hypothetical protein CLOSCI_01947 [Clostridium scindens ATCC 35704] (238 aa)
Score = 171, Expect = 1.1e-10, Identities = 51/186 (27%), Positives = 92/186 (49%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           + + G +NIP     MF PNH+  +DVL  L+A       RP     + V+K E++  + +      +    +DR+++R  +++  +  + ++ G   L +F EGTR K  +E  EFK  +   A    C IVPV +  +    K   +N      V V FL+P++Y+DY     + ++  +K +++
  S:    56 IDVHGRENIPDKDGFMFFPNHQGLYDVLAILEAC-----TRPF----SVVAKKEVANIQFLKQVFACMKAYMLDREDVRQAMQIIIDVSKEVEHGRNYL-IFAEGTRSKNGNEVQEFKGGSFKAATKAKCPIVPVALIDSF---KPFDTNTISPVTVQVHFLKPLRYEDYKDMKTKDIAALVKERIQ 229
>gi|110004419|emb|CAK98757.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase protein [Spiroplasma citri] (261 aa)
Score = 171, Expect = 1.2e-10, Identities = 63/222 (28%), Positives = 106/222 (47%)
  Q:    28 RSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           RS  KK KR   DP ++    R +++       ++    K+ +    N   +K  + + NH+SN D  + L A     +  P      F++K E+   +       LI+ +F+DR+N R  + V +E  +L+ +  +++ VF EGTR +  E GEF + +   A      I+PV I  +  +  KE K    KY  V V F +PIK   ++  S EL++  +K
  S:    22 RSISKKIKR---DPNIVSEEYRYHWLQKRTRYMLWVHDVKIIVHDCDNW-IDKGCLMIANHQSNVDPAI-LFALNDFNKTAP----CAFIAKKELQNNRTFRNFLTLIDVLFLDRENPRQALEVIKEANDLI-RVPRTMVVFPEGTRSRSQEMGEFHAGSFKIAQKAHVSIIPVSIVNSYPIFNKEFKKRGKKY--VHVVFHKPIKPDTFMTKSTELIANNVK 232
>gi|7269959|emb|CAB79776.1| putative protein [Arabidopsis thaliana] >gi|22531243|gb|AAM97125.1| putative protein [Arabidopsis thaliana] >gi|30023656|gb|AAP13361.1| At4g30580 [Arabidopsis thaliana] (212 aa)
Score = 171, Expect = 1.2e-10, Identities = 52/182 (28%), Positives = 84/182 (46%)
  Q:    50 QNYVYSLASKAVFCTFTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
            +++  L +      F K+ I+G +N+P++ +  ++V NH+S  D+   L   K  K          F+SK  I     +G+A  ++  + + R + R  V   +   ELL+KG  S+  F EGTR K    G FK  A T A  T   +VP+ + GT  +       I  +  V V   +PI
  S:    19 HHFIAKLWASISIYPFYKINIEGLENLPSSDTPAVYVSNHQSFLDIYTLLSLGKSFK----------FISKTGIFVIPIIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELLKKG-ASVFFFPEGTRSKDGRLGSFKKGAFTVAAKTGVAVVPITLMGTGKIMPTGSEGILNHGNVRVIIHKPI 190
>gi|83319707|ref|YP_424382.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283593|gb|ABC01525.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (317 aa)
Score = 170, Expect = 1.4e-10, Identities = 63/226 (27%), Positives = 115/226 (50%)
  Q:    17 PFCVFFLWLSLRSSK----KKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE 242
           P+ + F+WL L   K    K  ++ ++ P+      R N+V    SK ++     +K++G +N   +K V+   NH+SN D ++ L A     +++P      F++K E+  +K+     +L++ I ++R++ R  +   +E K+L+   ++SL +F EGTR    +   F++A+L  A  +   I+PV I  +  V  E +    K  EV V F +PI    +I    E
  S:    35 PWKMLFMWLPLLHIKFKAAKIVRKNKKQPDRYPEEYRYNWVKKAVSKLLYVLDVNIKVEGIENW-MDKGVILAANHQSNIDPVI-LFAINDFSKQQPL----AFIAKEELWTSKKFKNFVRLVDCIPLNRKSPRSALEAFKEAKDLVVDYKRSLVIFPEGTRSHSQQMNSFQAASLKVAQMSHAPIIPVSIINSYLVFAEKRP---KKVEVKVVFGKPILPSKHISLKTE 255
>gi|168177762|ref|ZP_02612426.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum NCTC 2916] >gi|182670493|gb|EDT82467.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum NCTC 2916] (240 aa)
Score = 170, Expect = 1.6e-10, Identities = 72/246 (29%), Positives = 114/246 (46%)
  Q:     4 KKFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           K F+F LG      F  + L   LR  K KY + + + E +     ++ V   A+  V     KV  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K K + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR K +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI   +  +  +  +S+ +K
  S:     2 KSFIFYLG------FGFYMLLSLLRIIKLKYLKRKGNKEEIDRYINKS-VLGWANFIVNGIGIKVNKKGLENVP-DGPCLFVGNHQGLLDVPVIVSSLDRYV---------GFVAKKEMLKLKILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSKGENLGEFKKGSMKLGIKAGVPIVPIAINGTYNVLEANGRKI-KAADVDLIICPPIYPNELSKEEQNNLSQTIK 228
>gi|145223151|ref|YP_001133829.1| HAD family hydrolase [Mycobacterium gilvum PYR-GCK] >gi|145215637|gb|ABP45041.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium gilvum PYR-GCK] (570 aa)
Score = 170, Expect = 1.6e-10, Identities = 57/188 (30%), Positives = 90/188 (47%)
  Q:    51 NYVYSLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           N+  S+  + +  T    +++ G +N+ A +  +F+ NH++  D L+   A ++I E      D T V K E+     VG   K+++  FIDR + +  V   ++ +EL +KG  S+ +  EGTR+   E GEFK      A S    IVP+VI     V     S+ F    V V    PI   D+ Q
  S:   286 NFFTSMFGRTLLDTIGINLQVLGRENLTAQRPAVFIFNHRNQADPLI---AGRLINE------DFTTVGKKELENDPIVGTIGKILDAAFIDRDDPKKAVEGLKKVEELARKG-LSILIAPEGTRLDTTEVGEFKKGPFRIAMSVNIPIVPIVIRNA-EVIAARDSSTFNPGLVDVVVYPPIPVDDWTQ 463
>gi|18071412|gb|AAL58271.1|AC068923_13 putative lysophosphatidic acid acyltransferase [Oryza sativa (japonica cultivar-group)] >gi|125532507|gb|EAY79072.1| hypothetical protein OsI_033031 [Oryza sativa (indica cultivar-group)] >gi|125575275|gb|EAZ16559.1| hypothetical protein OsJ_030768 [Oryza sativa (japonica cultivar-group)] (344 aa)
Score = 170, Expect = 1.6e-10, Identities = 54/200 (27%), Positives = 92/200 (46%)
  Q:    50 QNYVYSLASKAVFCTFTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           Q+Y+  + +      F K+ ++G +N+P N S  ++V NH+S  D+   L   +  K          F+SK  I     +G+A  L+  I + R + R  +   +   +L++KG  S+  F EGTR K  + G FK  A + A  T   ++P+ + GT  +       I     V +    PI+  D    +++L SE  K
  S:   145 QHYIAKIWATLTISMFYKLDVEGMENLPPNSSPAVYVANHQSFLDIYTLLTLGRCFK----------FISKTSIFMFPIIGWAMYLLGVIPLRRMDSRSQLDCLKRCVDLVKKG-ASVFFFPEGTRSKDGKLGAFKRGAFSVATKTGAPVIPITLLGTGKLMPSGMEGILNSGSVKLIIHHPIEGND----AEKLCSEARK 330
>gi|115482728|ref|NP_001064957.1| Os10g0497100 [Oryza sativa (japonica cultivar-group)] >gi|78708851|gb|ABB47826.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplast precursor, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|113639566|dbj|BAF26871.1| Os10g0497100 [Oryza sativa (japonica cultivar-group)] (332 aa)
Score = 170, Expect = 1.6e-10, Identities = 54/200 (27%), Positives = 92/200 (46%)
  Q:    50 QNYVYSLASKAVFCTFTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           Q+Y+  + +      F K+ ++G +N+P N S  ++V NH+S  D+   L   +  K          F+SK  I     +G+A  L+  I + R + R  +   +   +L++KG  S+  F EGTR K  + G FK  A + A  T   ++P+ + GT  +       I     V +    PI+  D    +++L SE  K
  S:   133 QHYIAKIWATLTISMFYKLDVEGMENLPPNSSPAVYVANHQSFLDIYTLLTLGRCFK----------FISKTSIFMFPIIGWAMYLLGVIPLRRMDSRSQLDCLKRCVDLVKKG-ASVFFFPEGTRSKDGKLGAFKRGAFSVATKTGAPVIPITLLGTGKLMPSGMEGILNSGSVKLIIHHPIEGND----AEKLCSEARK 318
>gi|195156249|ref|XP_002019013.1| GL25650 [Drosophila persimilis] >gi|194115166|gb|EDW37209.1| GL25650 [Drosophila persimilis] (271 aa)
Score = 170, Expect = 1.7e-10, Identities = 54/195 (27%), Positives = 93/195 (47%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++++G +N+ A    + + NH+S  D  VL YL          P I   T V+K EI      GF A L  T++I+R    D +   Q+E + +Q+    L +F EGTR  KD    FK  +   A  + C I PVVI     ++ E K+  F+     ++ L  +  + Y +   + + +  ++ M+  Y K+ ++
  S:    76 MEVRGLENVRAGHGSVVIMNHQSALDLCVLSYL---------WPVIGRGTVVAKKEILYLPFFGFGAWLWGTLYINRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDTLLPFKKGSFHIALQSKCPIQPVVISKYAFMDDEKKT--FRPGHALIQILPEVSTEKYEKDDMQQLIDNCRSIMQTEYTKLSKE 261
>gi|160936844|ref|ZP_02084209.1| hypothetical protein CLOBOL_01733 [Clostridium bolteae ATCC BAA-613] >gi|158440225|gb|EDP17971.1| hypothetical protein CLOBOL_01733 [Clostridium bolteae ATCC BAA-613] (250 aa)
Score = 170, Expect = 1.7e-10, Identities = 56/181 (30%), Positives = 100/181 (55%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLV-YLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGE---FKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           +++G +NIP++++V++V NH+S FD+LV Y+    +            FV+K E+ K   +    + +N +F+DR ++++ ++   E  E ++ G  S+ +F EGTR +  E  +   F   +L  A  + C ++PV I GT  + ++H   + K   V + + EPI    YI   KEL +EK K
  S:    60 EVQGLENIPSDRAVLYVGNHRSYFDILVGYMTVPGLTG----------FVAKKEMLKIPLLRTWMQRVNCLFLDRVDIKEGLKTILEGIEKVKSG-VSIWIFPEGTRNENQELTQLLPFHEGSLKIAQKSGCPVIPVAITGTAEIFEQHLPFV-KPSHVCIRYGEPI----YI---KELPAEKRK 225
>gi|188159261|ref|ZP_02998652.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (312 aa)
Score = 169, Expect = 2.1e-10, Identities = 64/226 (28%), Positives = 114/226 (50%)
  Q:    17 PFCVFFLWLSLRSSK----KKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE 242
           P+ + F+WL L   K    K  ++ ++ P+      R N+V    SK ++     +K++G +N   +K V+   NH+SN D  + L A     +++P      F++K E+  +K+     +LI+ I ++R++ R  +   +E K+L+   ++SL +F EGTR    +   F++A+L  A  +   I+PV I  +  V  E +    K  EV V F +PI    +I    E
  S:    30 PWKMLFMWLPLLHIKFKAAKIVRKNKKQPDRYTEEYRYNWVKKAVSKLLYVLDVNIKVEGIENW-IDKGVILAANHQSNIDPAI-LFAINDFSKQQPL----AFIAKEELWTSKKFKNFVRLIDCIPLNRKSPRSALEAFKEAKDLIVDYKRSLVIFPEGTRSHSQQMNSFQAASLKVAQMSHAPIIPVSIINSYQVFAEKRP---KKVEVKVVFGKPISPNKHISLKTE 250
>gi|78221584|ref|YP_383331.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter metallireducens GS-15] >gi|78192839|gb|ABB30606.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter metallireducens GS-15] (234 aa)
Score = 169, Expect = 2.2e-10, Identities = 51/187 (27%), Positives = 87/187 (46%)
  Q:    45 GLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           GL  R    +S A   +     ++++ G++ +PA + V+F+ NH+ NFD+LV  +A        P     ++++K E+ +    G A +    I +DR + R  +R      + ++ G  S+ VF EGTR        FK      A      IVP  I G++ V   +  N+ +  E++V F  PI
  S:    33 GLAHRCALAWSRA--GLILAGVRLRVSGAEQVPAGEPVIFMGNHQGNFDILVLSRAV-------PRRF--SWLAKEELFRIPLFGSAMRRAGYIPVDRSDGRKALRSLDAAAKRIRAG-ASVIVFPEGTRTVDGSLLPFKKGGFILAERAGVPIVPFTINGSMRVNPRNTCNLVRGAEISVRFGAPI 207
>gi|125987007|ref|XP_001357266.1| GA14576-PA [Drosophila pseudoobscura] >gi|54645597|gb|EAL34335.1| GA14576-PA [Drosophila pseudoobscura] (271 aa)
Score = 169, Expect = 2.2e-10, Identities = 54/195 (27%), Positives = 93/195 (47%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++++G +N+ A    + + NH+S  D  VL YL          P I   T V+K EI      GF A L  T++I+R    D +   Q+E + +Q+    L +F EGTR  KD    FK  +   A  + C I PVVI     ++ E K+  F+     ++ L  +  + Y +   + + +  ++ M+  Y K+ ++
  S:    76 MEVRGLENVRAGHGSVVIMNHQSALDLCVLSYL---------WPVIGRGTVVAKKEILYLPFFGFGAWLWGTLYINRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDTLLPFKKGSFHIALQSKCPIQPVVISKYAFMDDEKKT--FRPGHALIQILPEVSTEKYEKDEMQQLIDDCRSIMQTEYTKLSKE 261
>gi|42561107|ref|NP_975558.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492604|emb|CAE77200.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (315 aa)
Score = 168, Expect = 2.6e-10, Identities = 64/226 (28%), Positives = 114/226 (50%)
  Q:    17 PFCVFFLWLSLRSSK----KKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE 242
           P+ + F+WL L   K    K  ++ ++ P+      R N+V    SK ++     +K++G +N   +K V+   NH+SN D  + L A     +++P      F++K E+  +K+     +LI+ I ++R++ R  +   +E K+L+   ++SL +F EGTR    +   F++A+L  A  +   I+PV I  +  V  E +    K  EV V F +PI    +I    E
  S:    33 PWKMLFMWLPLLHIKFKAAKIVRKNKKQPDRYTEEYRYNWVKKAVSKLLYVLDVNIKVEGIENW-IDKGVILAANHQSNIDPAI-LFAINDFSKQQPL----AFIAKEELWTSKKFKNFVRLIDCIPLNRKSPRSALEAFKEAKDLVVDYKRSLVIFPEGTRSHSQQMNSFQAASLKVAQMSHAPIIPVSIINSYQVFAEKRP---KKVEVKVVFGKPISPNKHISLKTE 253
>gi|187777508|ref|ZP_02993981.1| hypothetical protein CLOSPO_01099 [Clostridium sporogenes ATCC 15579] >gi|187774436|gb|EDU38238.1| hypothetical protein CLOSPO_01099 [Clostridium sporogenes ATCC 15579] (241 aa)
Score = 166, Expect = 4.5e-10, Identities = 73/257 (28%), Positives = 122/257 (47%)
  Q:     4 KKFLFKLGHSLGFPFCVFFLWLSL-RSSKKKYKRWQEDPELLGLTERQNY----VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           K F+  LG +       F++ LSL R  K KY + + + E     E + Y    V   A+  V     ++  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K + + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR + +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI  K+  +  +  +SE +K  ++    K++
  S:     2 KSFILYLGFA-------FYMMLSLLRIIKLKYLKRKGNKE-----EIEKYINKSVLGWANFIVKGIGIRINKKGLENVP-DGPCLFVGNHQGLLDVPVIVSSLDRYV---------GFVAKKEMLKLRILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSRGENLGEFKKGSMKLGIKAGVPIVPIAINGTYKVREANGGKI-KAADVDLIVCPPIYPKELSKEEQNNLSETIKEIIQKELEKVR 239
>gi|170755655|ref|YP_001780070.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum B1 str. Okra] >gi|169120867|gb|ACA44703.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum B1 str. Okra] (240 aa)
Score = 165, Expect = 6.0e-10, Identities = 68/228 (29%), Positives = 106/228 (46%)
  Q:     4 KKFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           K F+F LG      F  + L   LR  K KY + + + E +     ++ V   A+  V     K+  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K K + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR + +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI
  S:     2 KSFIFYLG------FGFYMLLSLLRIIKLKYLKRKGNKEEIDRYINKSVV-GWANFIVNGIGIKINKKGLENVP-DGPCLFVGNHQGLLDVPVVVSSLDRYV---------GFVAKKEMLKLKILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSRGENLGEFKKGSMKLGIKAGVPIVPIAINGTYNVLEANGRKI-KAADVDLIICPPI 210
>gi|195116749|ref|XP_002002914.1| GI17635 [Drosophila mojavensis] >gi|193913489|gb|EDW12356.1| GI17635 [Drosophila mojavensis] (271 aa)
Score = 165, Expect = 6.4e-10, Identities = 54/195 (27%), Positives = 91/195 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++++G +N+      + + NH+S  D  VL YL          P I  PT V+K EI      G  A L  T++I+R    D +   Q+E   +++    + VF EGTR  KD    FK  +   A  + C I PVV+      ++E KS  F+     ++ L  I  + Y +   + + E  ++ M+  Y ++ +D
  S:    76 MEVRGVENVRREHGSVVLMNHQSALDLCVLAYL---------WPVIGRPTVVAKKEILYMPFFGVGAWLWGTLYINRSRKSDSINSLQKEAIAIRERNCKILVFPEGTRNSKDSLLPFKKGSFHIALQSKCTIQPVVVSKYSFYDEEKKS--FRPGHAIIQILPEISTEGYEKEDMDKLIELCRSTMQQEYTRLSKD 261
>gi|28210290|ref|NP_781234.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium tetani E88] >gi|28202726|gb|AAO35171.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium tetani E88] (242 aa)
Score = 165, Expect = 6.6e-10, Identities = 56/165 (33%), Positives = 98/165 (59%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           +++I+G +N+P  +S ++V NH+S FD+ V L   +     +P      F+SK EI K K +    ++I+ +FIDR+N+R+ V+   +  + L++G  S+ +F EGTR K+ + G+FK  ++  A  +   +VPVVI GT  + + +K+N  K  +V +   EPI
  S:    63 ELEIEGLENLP-KESCLYVANHQSLFDIPVLLAGIR-----KPM----GFISKKEIKKVKIISEWMEMIHCVFIDRENIRESVKAINKGIDNLKQG-YSMVIFPEGTRNKEGKIGDFKQGSMKLALKSGVPVVPVVIDGTYKIREGNKNNKIKPGKVRLIIKEPI 216
>gi|153940408|ref|YP_001389787.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum F str. Langeland] >gi|152936304|gb|ABS41802.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum F str. Langeland] (240 aa)
Score = 165, Expect = 6.8e-10, Identities = 68/228 (29%), Positives = 106/228 (46%)
  Q:     4 KKFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           K F+F LG      F  + L   LR  K KY + + + E +     ++ V   A+  V     K+  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K K + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR + +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI
  S:     2 KSFIFYLG------FGFYMLLSLLRIIKLKYLKRKGNKEEIDRYINKSVV-GWANFIVNGIGIKINKKGLENVP-DGPCLFVGNHQGLLDVPVVVSSLDKYV---------GFVAKKEMLKLKILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSRGENLGEFKKGSMKLGIKAGVPIVPIAINGTYNVLEANGRKI-KAADVDLIICPPI 210
>gi|146743233|gb|ABQ42862.1| LPAAT [Brassica juncea] (332 aa)
Score = 164, Expect = 7.8e-10, Identities = 56/218 (25%), Positives = 95/218 (43%)
  Q:    14 LGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           +G PF + F          +Y+R           +  +++  L +      F K  I+G +N+P++ +  ++V NH+S  D+   L   +  K          F+SK  I     +G+A  ++  + + R + R  V   +   EL++KG  S+  F EGTR K    G FK  A T A  T   +VP+ + GT  +       I  + +V V   +PI
  S:   133 IGHPFVLLF---------DRYRR-----------KFHHFIAKLWASISIYPFYKTDIQGLENLPSSDTPCVYVSNHQSFLDIYTLLSLGQSYK----------FISKTGIFVIPVIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELVKKG-ASVFFFPEGTRSKDGRLGPFKKGAFTIAAKTGVPVVPITLMGTGEIMPTGSEGILNHGDVRVIIHKPI 320
>gi|83287828|sp|Q9LLY4|LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplast precursor >gi|8163563|gb|AAF73736.1|AF111161_1 lysophosphatidic acid acyltransferase [Brassica napus] (344 aa)
Score = 164, Expect = 7.8e-10, Identities = 56/218 (25%), Positives = 95/218 (43%)
  Q:    14 LGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           +G PF + F          +Y+R           +  +++  L +      F K  I+G +N+P++ +  ++V NH+S  D+   L   +  K          F+SK  I     +G+A  ++  + + R + R  V   +   EL++KG  S+  F EGTR K    G FK  A T A  T   +VP+ + GT  +       I  + +V V   +PI
  S:   133 IGHPFVLLF---------DRYRR-----------KFHHFIAKLWASISIYPFYKTDIQGLENLPSSDTPCVYVSNHQSFLDIYTLLSLGQSYK----------FISKTGIFVIPVIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELVKKG-ASVFFFPEGTRSKDGRLGPFKKGAFTIAAKTGVPVVPITLMGTGKIMPTGSEGILNHGDVRVIIHKPI 320
>gi|170031327|ref|XP_001843537.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Culex quinquefasciatus] >gi|167869797|gb|EDS33180.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Culex quinquefasciatus] (338 aa)
Score = 163, Expect = 9.7e-10, Identities = 54/185 (29%), Positives = 91/185 (49%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           +++G+  +  +++ + V NH+S+ D+L     + ++++        T ++K E+  T   G AA L   I+IDR+N      V  +  ++L++    L VF EGTR   +E   FK  A   A S+   I+PVV Y +     + K+ I     V V  LEPI+       +K L +E + A ME
  S:    80 ELRGADILSRDEAYVIVSNHQSSLDILGMFDFWHVMQK-------CTVIAKKELLYTGPFGVAAWLAGLIYIDRKNPAKAHSVMNDCTDMLKEKRIKLWVFPEGTRRNTNEIHAFKKGAFHVAVSSQLPIMPVV-YSSYSTFLDDKAKILNNGHVIVTTLEPIE-------TKGLTTEDIPALME 249
>gi|157113017|ref|XP_001657726.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aedes aegypti] >gi|108883696|gb|EAT47921.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aedes aegypti] (398 aa)
Score = 162, Expect = 1.3e-09, Identities = 51/168 (30%), Positives = 82/168 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYK 234
           K +++G+  +  +++ + V NH+S+ D+L     + ++ +        T ++K E+  T   G AA L   IFIDR+N         E  ++L++    L VF EGTR   +E   FK  A   A  +   I+PVV Y + G   + K+ I     V V  LEPI+ K
  S:   151 KWELRGADILSRDEAYVIVANHQSSLDILGMFDFWHVMNK-------CTVIAKKELLYTGPFGVAAWLSGLIFIDRKNAEKAHVAMNECTDMLKEKRIKLWVFPEGTRRNTNEIHPFKKGAFHTAVRSQLPIMPVV-YSSYGSFLDDKAKILNNGHVIVTTLEPIETK 310
>gi|160901674|ref|YP_001567255.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Petrotoga mobilis SJ95] >gi|160359318|gb|ABX30932.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Petrotoga mobilis SJ95] (258 aa)
Score = 162, Expect = 1.3e-09, Identities = 62/206 (30%), Positives = 104/206 (50%)
  Q:    50 QNYVYSLASKAVFCTF----TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIF-KYKEVTVEFLEPIKYKDYIQTS------KELVSEKMKAKMEAA 255
           Q Y+  + S     TF    +K+ + G +NIP     + V NH+S FD+ + L            I    F++K E+S    +G   K + +IFIDR N +      ++  ++ Q GE  +T+F EGTR    + GEFK  AL   +    +++PV I GT+ + K  K ++F K   V +   EP++ K +          K ++SE + ++ + A
  S:    49 QEYIRKVVSWFGKVTFKFLNSKISVHGEENIPQQGPYVVVANHQSLFDIPLILGY----------IYPTAFIAKKELSMIPILGNFIKRLGSIFIDRNNSKSGAIALKKFAKISQSGE-IITIFPEGTRSLDGQVGEFKKGALLIPFRYNIKLLPVTIDGTIKMSK--KGSVFIKPSNVNLFIHEPVEPKLFASEGELRECLKSIISENITSEPQLA 252
>gi|195438449|ref|XP_002067149.1| GK24838 [Drosophila willistoni] >gi|194163234|gb|EDW78135.1| GK24838 [Drosophila willistoni] (271 aa)
Score = 162, Expect = 1.4e-09, Identities = 53/195 (27%), Positives = 91/195 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++++G +N+  N   + + NH+S  D  VL YL          P I   T V+K EI      G  A L  T++I+R    D +   Q+E + +Q+    L +F EGTR  KD    FK  +   A  + C I PV+I     ++ + K+  F+     ++ L  I    Y +   + + +  +  M+A Y K+ ++
  S:    76 MEVRGLENVRTNHGSVILMNHQSALDLCVLSYL---------WPVIGRATVVAKKEILYLPFFGIGAWLWGTLYINRSRKSDSINSLQKEAKAIQQRNCKLLLFPEGTRNSKDTLLPFKKGSFHIAMQSKCPIQPVIISKYAFMDDDKKT--FRPGHALIQILPEIPTDKYEKDDMDKLIDDCRNIMQAEYTKLTKE 261
>gi|160878391|ref|YP_001557359.1| phospholipid/glycerol acyltransferase [Clostridium phytofermentans ISDg] >gi|160427057|gb|ABX40620.1| phospholipid/glycerol acyltransferase [Clostridium phytofermentans ISDg] (237 aa)
Score = 162, Expect = 1.5e-09, Identities = 51/191 (26%), Positives = 89/191 (46%)
  Q:    72 GSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           G +N+P     +  PNH+  FD L +L+       +RP +     V K E+     +    KL+    IDR+++R  + V +     ++ GE +  +F EGTR K  ++ GEFK  +   A +  C IVPV +       K   +N  K   V + +L+P+ Y DY       ++E ++  ++    K  ++
  S:    59 GLENLPKEDGYILFPNHQGLFDALAFLET-----HERPFVT----VMKKEVKDIFFLRDVIKLLQAEIIDREDIRQSMTVIKNMTTRVKGGE-NFVIFAEGTRSKNGNQIGEFKGGSFKSAMNARCPIVPVALIDAF---KAFDTNSIKKITVQIHYLKPLYYDDYKGMKSTEIAELVENMIKETIAKFAQE 237
>gi|15644441|ref|NP_229493.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Thermotoga maritima MSB8] >gi|4982269|gb|AAD36760.1|AE001809_12 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Thermotoga maritima MSB8] (247 aa)
Score = 161, Expect = 1.6e-09, Identities = 47/154 (30%), Positives = 78/154 (50%)
  Q:    53 VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           +     +A    F+ V ++GS+NIP +++ + V NH+S  D+ + L            +    F++K E+ K   V +  + +N +F+DR+N R  VR  +E  E L+ G  +  VF EGTR    +   FK  +L  A  T   ++PV I+GT
  S:    49 IEKFGKRAFTWLFSDVVVEGSENIPKDRNFIVVANHQSLMDIPLILGF----------VATGAFIAKEELRKIPGVNWYIRYLNGVFLDRKNPRRAVRALREAIEKLKNG-VTFIVFPEGTRSPDGKVLSFKKDSLMIAVKTGVPVLPVSIWGT 191
>gi|160881905|ref|YP_001560873.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium phytofermentans ISDg] >gi|160430571|gb|ABX44134.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium phytofermentans ISDg] (243 aa)
Score = 161, Expect = 1.8e-09, Identities = 48/184 (26%), Positives = 89/184 (48%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           TKVK+ G +N+P+ ++V++  NH+   D+ V       +           FV+K E+ K   + +  + +N +F+DR+N R+ ++      E ++KG  S+ +  EGTR  ++E   FK  +   A  T C I+PV I  +  V  E +    K   V + +  PI   D  +  ++ +   ++
  S:    56 TKVKVLGRENVPSKEAVLYTANHRGLADIAVAYVTLPTLT---------GFVAKKEMGKIPVMSWWMRNLNCLFLDRENPREGLKTILTGVENIRKG-YSMFIMPEGTRNHEEEMLPFKEGSFKMAEKTGCAIIPVAITNSDAV-FERQFPWVKKATVVIHYGNPIYPNDLPKEERKFIGNHVR 228
>gi|114331923|ref|YP_748145.1| phospholipid/glycerol acyltransferase [Nitrosomonas eutropha C91] >gi|114308937|gb|ABI60180.1| lyso-ornithine lipid acyltransferase [Nitrosomonas eutropha C91] (265 aa)
Score = 161, Expect = 1.9e-09, Identities = 63/213 (29%), Positives = 103/213 (48%)
  Q:    47 TERQNYVYSLASKAVFCTFTKVKIKGSKNIPA--NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV--------------VIYGTLGVEKEHKSNIFKYKEVTVE--FLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI 259
           T RQN++    ++  F     VK+    ++PA   + V+FV NH S  D++V L  + +            FV+K EIS    +G+  +   T+FI+R+   D +RVNQ+   +L+ G  S+ +F EG     D    F ++ L P  +    + P+              V+Y T+ + +     I    E+  E  F+ PI   D  +  +EL     KA  +A  LKI
  S:    37 TARQNHMICKWAQK-FLHILNVKLSSGGSLPACNQQGVLFVANHTSWLDIIVILALYPV-----------RFVAKAEISTWPVLGWLCRSAGTLFIERKKRGDTLRVNQKIDGMLKAG-CSVAIFPEGATCNGDVLLHFHASLLQPVVTAKALLCPIAIRYSNRDGSRNTSVVYVTVTILQSLML-ILNEPEIQAELNFMSPIPGDD--KNRRELARLAEKAIAQALSLKI 251
>gi|168181285|ref|ZP_02615949.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum Bf] >gi|182675507|gb|EDT87468.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum Bf] (240 aa)
Score = 160, Expect = 2.4e-09, Identities = 52/165 (31%), Positives = 81/165 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           K+  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K K + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR + +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI
  S:    58 KINKKGLENVP-DGPCLFVGNHQGLLDVPVIVSSLDRYV---------GFVAKKEMLKLKILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSRGENLGEFKKGSMKLGIKAGVPIVPIAINGTYNVLEANGRKI-KAADVDLIICPPI 210
>gi|17861834|gb|AAL39394.1| GM02347p [Drosophila melanogaster] (271 aa)
Score = 159, Expect = 2.8e-09, Identities = 56/203 (27%), Positives = 95/203 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI-KEDPNWSEKEE 270
           ++++G +N+  +   + + NH+S  D  VL YL          P I   T VSK E+      G  A L  T++IDR    D +   Q+E + +Q+    L +F EGTR  KD    FK  +   A      + PVVI     ++ E K+  F+     +  L  +  + Y +   +L+ ++ ++ M+  Y K+ KE    S K++
  S:    76 MEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYL---------WPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVISKYTFMDDEKKT--FRPGHALIHILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSKEGQALSSKKQ 270
>gi|170761845|ref|YP_001785756.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum A3 str. Loch Maree] >gi|169408834|gb|ACA57245.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum A3 str. Loch Maree] (240 aa)
Score = 159, Expect = 3.3e-09, Identities = 52/165 (31%), Positives = 81/165 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           K+  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K K + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR + +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI
  S:    58 KMNKKGLENVP-DGPCLFVGNHQGLLDVPVIVSSLDRYV---------GFVAKKEMLKLKILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSRGENLGEFKKGSMKLGIKAGVPIVPIAINGTYNVLEANGKKI-KAADVDLIICPPI 210
>gi|153932553|ref|YP_001382800.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|153934628|ref|YP_001386367.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum A str. Hall] >gi|152928597|gb|ABS34097.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|152930542|gb|ABS36041.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum A str. Hall] (240 aa)
Score = 159, Expect = 3.3e-09, Identities = 52/165 (31%), Positives = 81/165 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           K+  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K K + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR + +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI
  S:    58 KINKKGLENVP-DGPCLFVGNHQGLLDVPVIVSSLDRYV---------GFVAKKEMLKLKILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSRGENLGEFKKGSMKLGIKAGVPIVPIAIDGTYNVLEANGKKI-KAADVDLIICPPI 210
>gi|158521892|ref|YP_001529762.1| 1-acylglycerol-3-phosphate O-acyltransferase [Desulfococcus oleovorans Hxd3] >gi|158510718|gb|ABW67685.1| 1-acylglycerol-3-phosphate O-acyltransferase [Desulfococcus oleovorans Hxd3] (246 aa)
Score = 159, Expect = 3.4e-09, Identities = 52/205 (25%), Positives = 91/205 (44%)
  Q:    64 TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEK 268
           T T+   +G +NI  ++S + + NH+S+FD+L  +             L   ++ K EI K    G+A      IFIDR N +  +    +  + L  G   L  F EGTR       EFK      A      I+PV + G+  V  +H+  +++  ++ V   +PI+  DY   + + + +K +  + + +     DP +  K
  S:    56 TGTRTTARGKENIDKSRSYIIISNHQSHFDILAIVVRLG---------LQYRWIIKKEIRKVPLFGYALHASRNIFIDRSNRQSAISSINDGVDRLPPGVGVL-FFAEGTRSPDGAIQEFKKGGFVTAVEKGLPILPVTVNGSRKVLPKHRL-VYRSGKIEVVVAKPIETTDYTPETIDALIKKTRDTIISNF-----DPGYPRK 244
>gi|120405029|ref|YP_954858.1| HAD family hydrolase [Mycobacterium vanbaalenii PYR-1] >gi|119957847|gb|ABM14852.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium vanbaalenii PYR-1] (525 aa)
Score = 159, Expect = 3.5e-09, Identities = 60/219 (27%), Positives = 101/219 (46%)
  Q:    51 NYVYSLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKE 269
           N+  S+  + +  T    +++ G +N+ A +  +F+ NH++  D L+   A +++ +      + T V K E+     VG   K+++  FIDR + +  V    + +EL +KG  S+ +  EGTR+   E G FK      A S    IVP+VI     V     S+ F    V V    PI   D+   ++E +SE++    E   L I    +W   E
  S:   276 NFFTSMFGRTLLNTVGINLQVLGKENLTAQRPAVFIFNHRNQADPLI---AGRLVND------NFTSVGKKELENDPIVGTMGKIMDAAFIDRDDPQKAVEGLHKVEELARKG-LSILIAPEGTRLDTTEVGPFKKGPFRIAMSVGIPIVPIVIRNA-EVIAARDSSTFNPGTVDVVVYPPIPVDDW---TRENLSERID---EVRQLYIDTLKDWPHDE 478
>gi|39998206|ref|NP_954157.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Geobacter sulfurreducens PCA] >gi|39985152|gb|AAR36507.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Geobacter sulfurreducens PCA] (234 aa)
Score = 158, Expect = 3.6e-09, Identities = 44/165 (26%), Positives = 77/165 (46%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           ++ + G++N+PA + V+F+ NH+ NFD+LV  +A        P     ++++K E+ +    G A +    I +DR + R  +R      + ++ G  S+ VF EGTR        FK      A      I+P  I G++ V   +   + +   + V F  PI
  S:    53 RLDVSGTENVPAGEPVIFMGNHQGNFDILVLSRAI-------PRRF--SWLAKEELFRIPLFGAAMQRAGYIPVDRSDGRKALRSLDAAAKRIRAG-ASVIVFPEGTRTADGSLLPFKKGGFVLAERAGVPIIPFTINGSMQVNPRNTVKLVRGARIAVRFGTPI 207
>gi|153854246|ref|ZP_01995545.1| hypothetical protein DORLON_01539 [Dorea longicatena DSM 13814] >gi|149753021|gb|EDM62952.1| hypothetical protein DORLON_01539 [Dorea longicatena DSM 13814] (236 aa)
Score = 158, Expect = 3.6e-09, Identities = 51/186 (27%), Positives = 90/186 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           +K+ G +NIP +   MF PNH+  +DVL  ++A       RP     + V+K E++    +    + +    IDR+++R  ++V       ++ G+  L +F EGTR KK ++  EFK  +   A    C IVPV +           S   +  +V V FL+P+ Y +Y       ++  +K +++
  S:    56 IKVYGQENIPDDNGFMFYPNHQGLYDVLAIMEAC-----PRPF----SVVAKKEVANVPFLKQVFECMKAYMIDREDVRQSLQVIVNVSNDVKAGKNFL-IFPEGTRSKKGNQVQEFKGGSFKAATRAKCPIVPVALVNCF---VPFDSKTTEQVDVQVHFLKPLLYDEYKDMKTTEIAAIVKERIQ 229
>gi|24582854|ref|NP_609231.2| fu12 CG17608-PA, isoform A [Drosophila melanogaster] >gi|24582856|ref|NP_723398.1| fu12 CG17608-PB, isoform B [Drosophila melanogaster] >gi|195339249|ref|XP_002036232.1| GM12902 [Drosophila sechellia] >gi|195577629|ref|XP_002078671.1| GD22398 [Drosophila simulans] >gi|4688678|emb|CAB41432.1| 1-acylglycerol-3-phosphate O-acyltransferase [Drosophila melanogaster] >gi|10728673|gb|AAF52680.2| CG17608-PB, isoform B [Drosophila melanogaster] >gi|22945961|gb|AAN10670.1| CG17608-PA, isoform A [Drosophila melanogaster] >gi|25012689|gb|AAN71439.1| RE57703p [Drosophila melanogaster] >gi|194130112|gb|EDW52155.1| GM12902 [Drosophila sechellia] >gi|194190680|gb|EDX04256.1| GD22398 [Drosophila simulans] (271 aa)
Score = 158, Expect = 4.0e-09, Identities = 56/203 (27%), Positives = 95/203 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI-KEDPNWSEKEE 270
           ++++G +N+  +   + + NH+S  D  VL YL          P I   T VSK E+      G  A L  T++IDR    D +   Q+E + +Q+    L +F EGTR  KD    FK  +   A      + PVVI     ++ E K+  F+     +  L  +  + Y +   +L+ ++ ++ M+  Y K+ KE    S K++
  S:    76 MEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYL---------WPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYIDRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVISKYSFMDDEKKT--FRPGHALIHILPEVSTEKYKREDVQLLIDECQSIMQTEYTKLSKEGQALSSKKQ 270
>gi|148378419|ref|YP_001252960.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|148287903|emb|CAL81969.1| probable acyltransferase [Clostridium botulinum A str. ATCC 3502] (240 aa)
Score = 158, Expect = 4.0e-09, Identities = 52/165 (31%), Positives = 81/165 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           K+  KG +N+P +   +FV NH+   DV V + +               FV+K E+ K K + +  K +  +F+DRQN+R  V+   E  E L+ G  S+ +F EGTR + +  GEFK  ++         IVP+ I GT  V + +   I K  +V +    PI
  S:    58 KINKKGLENVP-DGPCLFVGNHQGLLDVPVIVSSLDRYV---------GFVAKKEMLKLKILTYWMKEMKCVFMDRQNVRAAVKTINEGVENLKNG-YSMLIFPEGTRSRGENLGEFKKGSMKLGIKAGVPIVPIAIDGTYNVLEANGKKI-KAADVDLIICPPI 210
>gi|170288931|ref|YP_001739169.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermotoga sp. RQ2] >gi|170176434|gb|ACB09486.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermotoga sp. RQ2] (247 aa)
Score = 157, Expect = 4.8e-09, Identities = 46/154 (29%), Positives = 78/154 (50%)
  Q:    53 VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           +     +A    F+ V ++G++NIP +++ + V NH+S  D+ + L            +    F++K E+ K   V +  + +N +F+DR+N R  VR  +E  E L+ G  +  VF EGTR    +   FK  +L  A  T   ++PV I+GT
  S:    49 IEKFGKRAFTWLFSDVVVEGNENIPKDRNFIVVANHQSLMDIPLILGF----------VATGAFIAKEELRKIPGVNWYIRYLNGVFLDRKNPRRAVRALREAIEKLKNG-VTFIVFPEGTRSPDGKVLPFKKDSLMIAVKTGVPVLPVSIWGT 191
>gi|194858564|ref|XP_001969204.1| GG24070 [Drosophila erecta] >gi|190661071|gb|EDV58263.1| GG24070 [Drosophila erecta] (271 aa)
Score = 157, Expect = 5.4e-09, Identities = 53/203 (26%), Positives = 95/203 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKEE 270
           ++++G +N+  +   + + NH+S  D  VL YL          P I   T VSK E+      G  A L  T++I+R    D +   Q+E + +Q+    L +F EGTR  KD    FK  +   A      + PVVI     ++ E K+  F+     +  L  +  + Y +   +L+ ++ ++ M+A Y K+ ++   S  ++
  S:    76 MEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYL---------WPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYINRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVISKYSFMDDEKKT--FRPGHALIHILPEVSTEKYQKEDVQLLIDECQSIMQAEYTKLSKEGQASSSKK 269
>gi|148270123|ref|YP_001244583.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermotoga petrophila RKU-1] >gi|147735667|gb|ABQ47007.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermotoga petrophila RKU-1] (247 aa)
Score = 157, Expect = 5.4e-09, Identities = 46/154 (29%), Positives = 78/154 (50%)
  Q:    53 VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           +     +A    F+ V ++GS+NIP +++ + V NH+S  D+ + L            +    F++K E+ K   V +  + +N +F+DR+N R  V+  +E  E L+ G  +  VF EGTR    +   FK  +L  A  T   ++PV I+GT
  S:    49 IEKFGKRAFTWLFSDVVVEGSENIPKDRNFIVVANHQSLMDIPLILGF----------VATGAFIAKEELRKIPGVNWYIRYLNGVFLDRKNPRRAVKALREAIEKLKNG-VTFIVFPEGTRSPDGKVLPFKKDSLMIAVKTGVPVLPVSIWGT 191
>gi|158522510|ref|YP_001530380.1| 1-acylglycerol-3-phosphate O-acyltransferase [Desulfococcus oleovorans Hxd3] >gi|158511336|gb|ABW68303.1| 1-acylglycerol-3-phosphate O-acyltransferase [Desulfococcus oleovorans Hxd3] (244 aa)
Score = 157, Expect = 5.8e-09, Identities = 50/185 (27%), Positives = 84/185 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           V + G + IP   S + V NH+S  D+LV    F   K          +VSKIE+ K   +G+   L   I + R +    +++  + ++ L +G  S+  F EGTR    +   FK  A   A      I+P+ I GT     +   N   + ++ V  L+ I Y ++   S E  +E ++A++
  S:    62 VTVSGREKIPRKGSRVIVSNHQSQLDILVCFTLFFHYK----------WVSKIEMFKVPFIGWNMTLNRYIRLRRGDKESILQMLADAEKALNQG-SSVFFFPEGTRSWDGQVKAFKPGAFHLAKKLKKPILPIAINGTTHALPKKSMNFHGWHKIQVTILDEIPYAEFADLSDEQTAEMVRARI 235
>gi|47459313|ref|YP_016175.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma mobile 163K] >gi|47458643|gb|AAT27964.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycoplasma mobile 163K] (339 aa)
Score = 156, Expect = 6.1e-09, Identities = 69/244 (28%), Positives = 110/244 (45%)
  Q:    27 LRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMI-KEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLK---IKEDPNWSEKEE 270
           +R+SKK  K    D   + L  R +Y+   A   +     KV++ G +NI    + + V NH  N D    + A K   ++K      PTF+ K E+   K        I++ +IDR + R       +  E  +K      VF  GTR K D  G FKSA+   A   F  I+PV I  +L     +K+   + + + V F +PIK  +      E +S ++   +E+ + K    +E   + EKE+
  S:    22 IRNSKKHVK----DKTKISLQYRNDYLLKKAEALLRDFNIKVQVFGYENIVDKGNTLIVSNHADNIDGFAMIVALKKTNQDKNINNRIPTFLVKAELKADKFSRSILDWIDSFYIDRDSPRQSANAINDLIEYSKKHRTYPVVFPSGTRSKDDTIGTFKSASFKIAKKGFFNILPVTINNSLNGFNWNKT---ETQVIEVHFHKPIKANEIANLDTEAISNRVYKIIESKFKKPEITEEIKKYWEKEQ 262
>gi|126436201|ref|YP_001071892.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. JLS] >gi|126236001|gb|ABN99401.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. JLS] (561 aa)
Score = 156, Expect = 6.6e-09, Identities = 53/186 (28%), Positives = 88/186 (47%)
  Q:    51 NYVYSLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           N+  S  S+ +  T    + + G +N+ A +  +F+ NH++  D L+   A ++++       D T V K E+     +G   K+++  FIDR + +  V   ++ +EL  KG  S+ +  EGTR+   E GEFK      A S    IVP+VI     V     S+ F    V +    PI  +D+
  S:   289 NFFTSTWSRLLLTTAGINLNVLGRENLTAQRPAVFIFNHRNQADPLI---AGRLVET------DFTTVGKKELENDPLIGTIGKVMDAAFIDRDDPKAAVEGLRKVEELAGKG-LSILIAPEGTRLDTTEVGEFKKGPFRIAMSARIPIVPIVIRNA-EVVAARDSSTFNPGTVDIAVYPPIPTEDW 464
>gi|108800585|ref|YP_640782.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. MCS] >gi|119869724|ref|YP_939676.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. KMS] >gi|108771004|gb|ABG09726.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. MCS] >gi|119695813|gb|ABL92886.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium sp. KMS] (561 aa)
Score = 156, Expect = 6.8e-09, Identities = 53/186 (28%), Positives = 88/186 (47%)
  Q:    51 NYVYSLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           N+  S  S+ +  T    + + G +N+ A +  +F+ NH++  D L+   A ++++       D T V K E+     +G   K+++  FIDR + +  V   ++ +EL  KG  S+ +  EGTR+   E GEFK      A S    IVP+VI     V     S+ F    V +    PI  +D+
  S:   289 NFFTSTWSRLLLTTAGINLNVLGRENLTAQRPAVFIFNHRNQADPLI---AGRLVET------DFTAVGKKELENDPLIGTIGKVMDAAFIDRDDPKAAVEGLRKVEELAGKG-LSILIAPEGTRLDTTEVGEFKKGPFRIAMSARIPIVPIVIRNA-EVVAARDSSTFNPGTVDIAVYPPIPTEDW 464
>gi|23098324|ref|NP_691790.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Oceanobacillus iheyensis HTE831] >gi|22776550|dbj|BAC12825.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Oceanobacillus iheyensis HTE831] (239 aa)
Score = 156, Expect = 7.8e-09, Identities = 66/219 (30%), Positives = 110/219 (50%)
  Q:    32 KKYKRWQEDPELLGLT-ERQNYVYS----LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKA 250
           +K K W +     GL  E+Q+ +++    ++ KA+  T T V ++G + +P+   V+FV NH+  FD+L +L   +     RP      F++K EI K   +    + ++ +FIDR + R  ++  Q+  + L+ G  S+ +F EGTR K  E   FK+ +   A  +   IVPV I GT  + +E    I K   + +   +PI    Y         EKMK+
  S:    23 QKVKNWADT----GLAVEKQDEIFATPKIVSQKAIAKTGTDVNVEGLQKVPSG-PVLFVANHQGIFDILAFLGYLE-----RP----VGFIAKKEIKKIPIISTWMEFVHCVFIDRTDRRQSMKAIQQGIKNLENG-NSMLIFPEGTRSKGREVSSFKAGSFRLATKSNVPIVPVSIDGTYQMLEEDGGRI-KKSSIQIVIDDPIMPAQY---------EKMKS 221
>gi|166032882|ref|ZP_02235711.1| hypothetical protein DORFOR_02603 [Dorea formicigenerans ATCC 27755] >gi|166027239|gb|EDR45996.1| hypothetical protein DORFOR_02603 [Dorea formicigenerans ATCC 27755] (236 aa)
Score = 155, Expect = 9.8e-09, Identities = 51/182 (28%), Positives = 87/182 (47%)
  Q:    72 GSKNIPANKSVMFVPNHKSNFDVLVYL----KAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           G +NIP     MF PNH+  +DVL  +    K F ++ +K  E+ +  F+ ++            K +    +DR ++R  ++V       ++ G   L +F EGTR K  +E  EFK  +   A    C IVPV +  +    K   +N      V V FL+P+ Y DY       ++E ++++++
  S:    60 GLENIPEENGFMFFPNHQGLYDVLALVDVCPKPFSVVAKK--EVENVPFLKQV-----------FKCMKAYMMDRNDIRQSLQVIVNVTNEVKNGRNYL-IFPEGTRSKMGNEMLEFKGGSFKAATKAKCPIVPVALIDSF---KPFDTNSIAPVTVQVHFLKPLYYDDYKDMKTNDIAELVRSQIQ 229
>gi|154491715|ref|ZP_02031341.1| hypothetical protein PARMER_01326 [Parabacteroides merdae ATCC 43184] >gi|154087956|gb|EDN87001.1| hypothetical protein PARMER_01326 [Parabacteroides merdae ATCC 43184] (245 aa)
Score = 154, Expect = 1.0e-08, Identities = 50/154 (32%), Positives = 72/154 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDV-LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK 221
           VK+KG +NI   KS +FV NH+  FD+ L+Y   F  +  K        +V K  I+K   VG A +    IF+D    +   R   E +  L+ G  S+ VF EG+R    +   FK  A   A     QIVP+ + G   V      N+ ++K
  S:    61 VKVKGRENIDRKKSYVFVANHQGAFDIFLIY--GFLGVPIK--------WVMKAGIAKIPFVGAACRAAGFIFVDNSTPKAAARSVLEAERSLKNG-ASVVVFPEGSRTYNGKMIRFKKGAYQMAADQHLQIVPITLNGPFDVLPIGSLNVHRHK 204
>gi|195473072|ref|XP_002088820.1| GE10971 [Drosophila yakuba] >gi|194174921|gb|EDW88532.1| GE10971 [Drosophila yakuba] (271 aa)
Score = 154, Expect = 1.1e-08, Identities = 55/203 (27%), Positives = 95/203 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI-KEDPNWSEKEE 270
           ++++G +N+  +   + + NH+S  D  VL YL          P I   T VSK E+      G  A L  T++I+R    D +   Q+E + +Q+    L +F EGTR  KD    FK  +   A      + PVVI     ++ E K+  F+     +  L  +  + Y +   +L+ ++ ++ M+  Y K+ KE    S K++
  S:    76 MEVRGLENVRKDHGAVVIMNHQSAVDLCVLAYL---------WPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYINRSRKTDSINSLQKEAKAIQERNCKLLLFPEGTRNSKDSLLPFKKGSFHIALQGKSPVQPVVISKYSFMDDEKKT--FRPGHAIIHILPEVSTEKYKREDVQLLVDECQSIMQTEYTKLSKEGQALSSKKQ 270
>gi|78356183|ref|YP_387632.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218588|gb|ABB37937.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Desulfovibrio desulfuricans G20] (251 aa)
Score = 152, Expect = 2.0e-08, Identities = 46/179 (25%), Positives = 84/179 (46%)
  Q:    82 VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE-FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           V+FV NH+SNFD+ + ++A +           P F++K  +      G   K    I + R + R  VR  +   E    G +SL +F EGTR +  +  G F++     A      +VP+V+ G+  +    +  +   ++V +  L P+    Y +  K + S+ ++  ME AY +++
  S:    72 VLFVANHQSNFDIPLVMRAVRDWY--------PAFMAKQSLLDIPFFGTCLKAGGHIGVQRGDARKAVRSMKAAVETAASG-RSLIIFPEGTRNRNPQTLGAFRAGCAVIAQRAGLPVVPLVLEGSADLLPSGRLMLGSRRDVYLRALPPVDPASYSKDEKNIFSDTLRDSMEIAYQEMR 242
>gi|168206323|ref|ZP_02632328.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens E str. JGS1987] >gi|170662195|gb|EDT14878.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens E str. JGS1987] (242 aa)
Score = 152, Expect = 2.2e-08, Identities = 66/210 (31%), Positives = 104/210 (49%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           S  KK  + +E+ +L    ER  Y+Y   S+ +  TF K     V ++G +NIP +  V+FV NH+SN D+ V + +       RP+     F++K E+ K   +     L   IFIDR++ +  +    +  + L++G  S+ VF EGTR +  + GEFK+ +   A      IVP+ I GT           +K  E    F++P K   YI 
  S:    21 SDIKKINKMEEEGKL---EERDEYIYQ-CSRRIAHTFLKDAGIEVNVEGLENIP-DGPVLFVCNHQSNMDIPVIMYSID-----RPK----GFIAKKELEKMPILKDWIILSKAIFIDREHPKKAMAGIIQGIKQLKEG-YSMVVFPEGTRSQCSKMGEFKAGSFKLATKPKVPIVPLTIDGT-----------YKIMEGNHYFIKPGKVNLYIH 209
>gi|168216806|ref|ZP_02642431.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens NCTC 8239] >gi|182381005|gb|EDT78484.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens NCTC 8239] (242 aa)
Score = 152, Expect = 2.3e-08, Identities = 67/214 (31%), Positives = 104/214 (48%)
  Q:    25 LSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           L+L  S    K+  +  E   L ER  Y+Y   S+ +  TF K     V ++G +NIP +  V+FV NH+SN D+ V + +       RP+     F++K E+ K   +     L   IFIDR++ +  +    +  + L++G  S+ VF EGTR +  + GEFK+ +   A      IVP+ I GT           +K  E    F++P K   YI 
  S:    14 LTLIKSLSDIKKINKMEEEGKLEERDEYIYQ-CSRRIAHTFLKDAGIEVNVEGLENIP-DGPVLFVCNHQSNMDIPVIMYSID-----RPK----GFIAKKELEKMPILKDWIILSKAIFIDREHPKKAMAGIIQGIKQLKEG-YSMVVFPEGTRSQCSKMGEFKAGSFKLATKPKVPIVPLTIDGT-----------YKIMEGNHYFIKPGKVNLYIH 209
>gi|110798958|ref|YP_696109.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens ATCC 13124] >gi|110673605|gb|ABG82592.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens ATCC 13124] (242 aa)
Score = 151, Expect = 2.3e-08, Identities = 66/210 (31%), Positives = 104/210 (49%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           S  KK  + +E+ +L    ER  Y+Y   S+ +  TF K     V ++G +NIP +  V+FV NH+SN D+ V + +       RP+     F++K E+ K   +     L   IFIDR++ +  +    +  + L++G  S+ VF EGTR +  + GEFK+ +   A      IVP+ I GT           +K  E    F++P K   YI 
  S:    21 SDIKKINKMEEEGKL---EERDEYIYQ-CSRRIAHTFLKDAGIEVNVEGLENIP-DGPVLFVCNHQSNMDIPVIMYSIN-----RPK----GFIAKKELEKMPILKDWIILSKAIFIDREHPKKAMAGIIQGIKQLKEG-YSMVVFPEGTRSQCSKMGEFKAGSFKLATKPKVPIVPLTIDGT-----------YKIMEGNHYFIKPGKVNLYIH 209
>gi|168210010|ref|ZP_02635635.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|182626438|ref|ZP_02954190.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens D str. JGS1721] >gi|170711852|gb|EDT24034.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|177908235|gb|EDT70793.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens D str. JGS1721] (242 aa)
Score = 151, Expect = 2.5e-08, Identities = 66/210 (31%), Positives = 104/210 (49%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           S  KK  + +E+ +L    ER  Y+Y   S+ +  TF K     V ++G +NIP +  V+FV NH+SN D+ V + +       RP+     F++K E+ K   +     L   IFIDR++ +  +    +  + L++G  S+ VF EGTR +  + GEFK+ +   A      IVP+ I GT           +K  E    F++P K   YI 
  S:    21 SDIKKINKMEEEGKL---EERDEYIYQ-CSRRIAHTFLKDAGIEVNVEGLENIP-DGPVLFVCNHQSNMDIPVIMYSID-----RPK----GFIAKKELEKMPILKDWIILSKAIFIDREHPKKAMAGIIQGIKQLKEG-YSMVVFPEGTRSQCSKMGEFKAGSFKLATKPKVPIVPLTIDGT-----------YKIMEGNHYFIKPGKVNLYIH 209
>gi|157343180|emb|CAO66669.1| unnamed protein product [Vitis vinifera] (332 aa)
Score = 151, Expect = 2.5e-08, Identities = 49/171 (28%), Positives = 80/171 (46%)
  Q:    65 FTKVKIKGSKNIPA-NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKD 235
           F K++ +G  N+P  +   ++V NH+S  D+   L   +  K          F+SK  I     +G+A  ++ TI + R + R  +   +   +L++KG  S+  F EGTR K  + G FK  A + A  T   +VP+V+ GT  +       I     V V   +PI+  D
  S:   152 FYKIEFEGLDNLPGPDTPAVYVSNHQSFLDIYTLLTLGRSFK----------FISKTGIFLFPIIGWAMFMMGTIPLKRMDSRSQLDCLKRCMDLIKKG-ASVFFFPEGTRSKDGKLGSFKKGAFSIAVKTRVPVVPIVLIGTGKIMPPGMEGIVNPGSVKVVIHKPIEGND 312
>gi|147794337|emb|CAN75999.1| hypothetical protein [Vitis vinifera] (214 aa)
Score = 151, Expect = 2.5e-08, Identities = 49/171 (28%), Positives = 80/171 (46%)
  Q:    65 FTKVKIKGSKNIPA-NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKD 235
           F K++ +G  N+P  +   ++V NH+S  D+   L   +  K          F+SK  I     +G+A  ++ TI + R + R  +   +   +L++KG  S+  F EGTR K  + G FK  A + A  T   +VP+V+ GT  +       I     V V   +PI+  D
  S:    34 FYKIEFEGLDNLPGPDTPAVYVSNHQSFLDIYTLLTLGRSFK----------FISKTGIFLFPIIGWAMFMMGTIPLKRMDSRSQLDCLKRCMDLIKKG-ASVFFFPEGTRSKDGKLGSFKKGAFSIAVKTRVPVVPIVLIGTGKIMPPGMEGIVNPGSVKVVIHKPIEGND 194
>gi|195030394|ref|XP_001988053.1| GH10772 [Drosophila grimshawi] >gi|193904053|gb|EDW02920.1| GH10772 [Drosophila grimshawi] (271 aa)
Score = 151, Expect = 2.5e-08, Identities = 49/195 (25%), Positives = 90/195 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++++G++N+ +    + + NH+S  D+        M+    P I   T VSK EI      G  A L  T+FI+R    D +   Q+E   +++    + VF EGTR  KD    FK  +   A  + C I PVV+      ++  K+N F+     ++ L  I    Y +   + + E  ++ M+  + ++ ++
  S:    76 MEVRGTENVKSEHGSVVLMNHQSALDLC-------MLGHLWPVIGRATVVSKREILYIPFFGVGAWLWGTLFINRSRKTDSINSLQKEAIAIKELNCKILVFPEGTRNSKDTLLPFKKGSFHIALQSKCTIQPVVMSKYEFYDE--KTNGFRPGHAIIQILPEISTDGYKKEDMDKLIEHCRSVMQEEFTRLTKE 261
>gi|18310400|ref|NP_562334.1| hypothetical protein CPE1418 [Clostridium perfringens str. 13] >gi|168214432|ref|ZP_02640057.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens CPE str. F4969] >gi|18145080|dbj|BAB81124.1| conserved hypothetical protein [Clostridium perfringens str. 13] >gi|170714072|gb|EDT26254.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens CPE str. F4969] (242 aa)
Score = 151, Expect = 2.6e-08, Identities = 66/210 (31%), Positives = 104/210 (49%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           S  KK  + +E+ +L    ER  Y+Y   S+ +  TF K     V ++G +NIP +  V+FV NH+SN D+ V + +       RP+     F++K E+ K   +     L   IFIDR++ +  +    +  + L++G  S+ VF EGTR +  + GEFK+ +   A      IVP+ I GT           +K  E    F++P K   YI 
  S:    21 SDIKKINKMEEEGKL---EERDEYIYQ-CSRRIAHTFLKDAGIEVNVEGLENIP-DGPVLFVCNHQSNMDIPVIMYSID-----RPK----GFIAKKELEKMPILKDWIILSKAIFIDREHPKKAMAGIIQGIKQLKEG-YSMVVFPEGTRSQCSKMGEFKAGSFKLATKPKVPIVPLTIDGT-----------YKIMEGNHYFIKPGKVNLYIH 209
>gi|110802398|ref|YP_698726.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Clostridium perfringens SM101] >gi|110682899|gb|ABG86269.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Clostridium perfringens SM101] (242 aa)
Score = 151, Expect = 2.7e-08, Identities = 66/210 (31%), Positives = 104/210 (49%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           S  KK  + +E+ +L    ER  Y+Y   S+ +  TF K     V ++G +NIP +  V+FV NH+SN D+ V + +       RP+     F++K E+ K   +     L   IFIDR++ +  +    +  + L++G  S+ VF EGTR +  + GEFK+ +   A      IVP+ I GT           +K  E    F++P K   YI 
  S:    21 SDIKKINKMEEEGKL---EERDEYIYQ-CSRRIAHTFLKDAGIEVNVEGLENIP-DGPVLFVCNHQSNMDIPVIMYSID-----RPK----GFIAKKELEKMPILKDWIILSKAIFIDREHPKKAMAGIIQGIKQLKEG-YSMVVFPEGTRSQCSKMGEFKAGSFKLATKPKVPIVPLTIDGT-----------YKIMEGNHYFIKPGKVNLYIH 209
>gi|195397913|ref|XP_002057572.1| GJ18200 [Drosophila virilis] >gi|194141226|gb|EDW57645.1| GJ18200 [Drosophila virilis] (271 aa)
Score = 151, Expect = 2.8e-08, Identities = 49/195 (25%), Positives = 89/195 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++++G +N+      + + NH+S  D+ V    +       P I   T V+K EI      G  A L  T++I+R    D +   Q+E   +++    + VF EGTR  K+    FK  +   A  + C I PVV+      +++ KS  F+   V ++ L  I    Y + + E + E  +  M+  Y ++ ++
  S:    76 MEVRGVENVKKEHGSVVLMNHQSALDLCVLAHLW-------PVIGRATVVAKKEILYMPFFGVGAWLWGTLYINRSRKSDSINSLQKEAIAIRERNCKILVFPEGTRNSKETLLPFKKGSFHIALQSKCTIQPVVVSKYSFFDEKKKS--FRPGHVVIQILPEISTDGYEKENMEKLIEHCRTTMQQEYTRMSKE 261
>gi|158301320|ref|XP_321034.4| AGAP002021-PA [Anopheles gambiae str. PEST] >gi|157012414|gb|EAA01231.4| AGAP002021-PA [Anopheles gambiae str. PEST] (317 aa)
Score = 151, Expect = 2.9e-08, Identities = 60/207 (28%), Positives = 98/207 (47%)
  Q:    55 SLASKAVFCTFT------KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY-IQTSKELVSEKMKAKMEAAYLKIKE 261
           +LASK  FC         K +++G++++ A+++++ V NH+S+ D+L     + ++ +        T ++K E+      G AA L   IFIDR++ +       E  ++L +    L VF EGTR   +E   FK  A   A      I+PVV Y +     + K+ +     V V  L PI+ K   I    EL+     A +E      KE
  S:    62 TLASK--FCRLASPIISLKWEVRGAEHMGADRAMVMVANHQSSLDILGMFDFWHLMDK-------CTVIAKRELFFAWPFGLAAWLSGLIFIDRRHAQRAQTAMNESTKMLIEKRTKLWVFPEGTRRITNEIHPFKKGAFHVAVRAQLPILPVV-YSSYHTFLDTKNKVMNPGHVIVTALPPIETKGLTIDDIPELIERTRNAMIETFKATTKE 265
>gi|169347262|ref|ZP_02866201.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens C str. JGS1495] >gi|169296658|gb|EDS78789.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens C str. JGS1495] (242 aa)
Score = 151, Expect = 2.9e-08, Identities = 66/210 (31%), Positives = 104/210 (49%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           S  KK  + +E+ +L    ER  Y+Y   S+ +  TF K     V ++G +NIP +  V+FV NH+SN D+ V + +       RP+     F++K E+ K   +     L   IFIDR++ +  +    +  + L++G  S+ VF EGTR +  + GEFK+ +   A      IVP+ I GT           +K  E    F++P K   YI 
  S:    21 SDIKKINKMEEEGKL---EERDEYIYQ-CSRRIAHTFLKDAGIEVNVEGLENIP-DGPVLFVCNHQSNMDIPVIMYSID-----RPK----GFIAKKELEKMPILKDWIILSKAIFIDRKHPKKAMAGIIQGIKQLKEG-YSMVVFPEGTRSQCSKMGEFKAGSFKLATKPKVPIVPLTIDGT-----------YKIMEGNHYFIKPGKVNLYIH 209
>gi|153003153|ref|YP_001377478.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter sp. Fw109-5] >gi|152026726|gb|ABS24494.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter sp. Fw109-5] (257 aa)
Score = 150, Expect = 3.0e-08, Identities = 45/167 (26%), Positives = 74/167 (44%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           I G + +P   + + V NH S  D+LV    F+  K          +VSK EI +   VG+   L + + + R +      +    +  L +G   + +F EGTR +    G FK  A   A    C ++P+V+ GT     +H   + +     VE LEP+  +D+
  S:    63 IHGRERLPWKGAAVLVANHLSLLDILVVYGLFRPFK----------WVSKAEIFRVPFVGWNLWLNDYVAVKRGDRESIREMMDRCRAHLARG-SPVMLFPEGTRSRDGRLGPFKDGAFRLAIEAGCPVIPLVVSGTGDALPKHGLVLRQRMRARVEVLEPLHPEDF 218
>gi|50308007|ref|XP_454004.1| unnamed protein product [Kluyveromyces lactis] >gi|49643139|emb|CAG99091.1| unnamed protein product [Kluyveromyces lactis NRRL Y-1140] (315 aa)
Score = 150, Expect = 3.1e-08, Identities = 46/153 (30%), Positives = 76/153 (49%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKD 235
           +F+ NH+S  D+L+  + F       P     T  +K +I     +G+   L  T+F+DR +    ++V  +    L+K +++L +F EGTR    K E   FK  A   A     QI+PVV+  T  +    +S +F    +TV+ LEPI  ++
  S:    77 IFISNHQSELDILMLGRTFP------PGC---TVTAKKQIKWVPLLGWFMSLSGTLFLDRSSREKAIKVLNDSLANLKKDKRALWIFPEGTRSYSTKLELSAFKKGAFHLAQQGKIQIIPVVVSNTSSIYHP-RSGVFNRGTITVKVLEPISTEN 221
>gi|162448800|ref|YP_001611167.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Sorangium cellulosum 'So ce 56'] >gi|161159382|emb|CAN90687.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Sorangium cellulosum 'So ce 56'] (281 aa)
Score = 150, Expect = 3.7e-08, Identities = 41/136 (30%), Positives = 67/136 (49%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV-VIYGTLGVEKEHKSNIF 218
           +FV NH+S  D+++ L  F           + T VS+ +++    +G AA+ + T+F+DR + R    V Q     L+ G + + V+ EGT    DE   F++   T A     +IVPV ++YG  G E  +    F
  S:   103 LFVMNHRSALDIMITLAFF-----------EATVVSRADLAGWPVIGMAARRVGTLFVDRSSKRSGSAVVQAMSSALKSG-RGVMVYPEGTTFSGDEVRPFRAGGFTAACRVGAEIVPVGLVYG--GAESSYVDESF 225
>gi|118100014|ref|XP_001233846.1| PREDICTED: similar to MGC82195 protein [Gallus gallus] (272 aa)
Score = 149, Expect = 4.0e-08, Identities = 56/203 (27%), Positives = 89/203 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKE 269
           K+ +KG +N+   K  + V NH+++ DV+V ++   MI    P    P  + K EI      G A      +FIDR+   + + V  E    ++K    + +F EGTR        FK  A   A      IVPVVI  Y +   +KE +   F     T++ L P++           ++E+++  M  AY +I    N    E
  S:    80 KIVVKGKENLRTKKPCVLVLNHQNSLDVMVIMQ---MI----PNRCVP--IGKKEILYMGPFGLACWFSGIVFIDRKKREESIAVLTEMAHTMRKDNFHVLIFPEGTRNHSGSMLPFKRGAFQLAVRAQVPIVPVVISSYNSFYSQKEKR---FTSGTSTIQILPPVETVGLSSDDVPKLTEQVRDSMMNAYQRISGMTNGGSHE 272
>gi|191164895|ref|ZP_03026749.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter sp. M21] >gi|190993996|gb|EDV69470.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter sp. M21] (231 aa)
Score = 149, Expect = 4.3e-08, Identities = 49/187 (26%), Positives = 86/187 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTS-KELVSEKMKAKME 253
           ++++ G  ++P    V+++ NH+ NFD+     A        P +   ++V+K E+ K    G A +    I +DR   R   +  ++  E +  G  S+ +F EGTR +      FK  A   A      IVP  I G+ G+   ++  + +   ++V F  PI+ K   +    E V E + AK+E
  S:    53 RLEVNGLNHVPTEGPVIYMGNHQGNFDIFALTLAV-------PRLF--SWVAKEELFKVPVFGAAMRRAGYIPLDRSGGRKAFKSMKQAAERIASG-ASVVIFPEGTRTQDGSLLPFKRGAFMLAGMAGVPIVPFTINGSRGINPRNRLEL-RPGTISVSFGAPIEVKRGAEGELMEQVREAIAAKLE 229
>gi|158520145|ref|YP_001528015.1| 1-acylglycerol-3-phosphate O-acyltransferase [Desulfococcus oleovorans Hxd3] >gi|158508971|gb|ABW65938.1| 1-acylglycerol-3-phosphate O-acyltransferase [Desulfococcus oleovorans Hxd3] (240 aa)
Score = 148, Expect = 5.2e-08, Identities = 53/188 (28%), Positives = 84/188 (44%)
  Q:    65 FTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN----LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           F KV++ G +++ AN+S +F+ NH S+ D    +          P  L   FV K  +S+    G AA++   IFIDR N    L    R   E KE +     S   F EGTR +      FK   +  A      IVP+ I  +  +  +HK  I     + V    P++   Y +  K+ + E +++ +
  S:    55 FIKVQVDGREHLQANRSYVFMSNHASHLDPPAVVLGL-------PHTL--RFVGKRSLSRIPVFGLAARMAKMIFIDRDNSAGSLETLNRSIAELKEGI-----SAYFFAEGTRSEDGSLKAFKKGGVMLALKARLPIVPIAITNSHNLLAKHKLRITP-GTIRVIISPPMETTGYTEEKKDDLLEAVRSAI 231
>gi|154503511|ref|ZP_02040571.1| hypothetical protein RUMGNA_01335 [Ruminococcus gnavus ATCC 29149] >gi|153795611|gb|EDN78031.1| hypothetical protein RUMGNA_01335 [Ruminococcus gnavus ATCC 29149] (244 aa)
Score = 148, Expect = 6.3e-08, Identities = 50/171 (29%), Positives = 87/171 (50%)
  Q:    72 GSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE 242
           G +NIP ++ V+F+ NH+S FD+L       +   + P +    +V+K E+ K   +    + +  +F+DR+N ++ ++   +  + +++G  S+ +F EGTR K +E     FK  A   A  T C IVP+ +  T  + +     I K   V VE+  PI  KD     K+
  S:    63 GFENIP-DEPVLFIGNHRSFFDIL-------LTYSRCPRLTG--YVAKKEMEKIPLLSTWMRFVYCLFLDRENPKEGLKTILQAIDYVKQG-ISICIFPEGTRNKGEELSMLPFKEGAFKIAAKTGCAIVPISMNNTAAIFENQFPRI-KKVNVVVEYGTPIYPKDLAPEDKK 223
>gi|157130839|ref|XP_001662024.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aedes aegypti] >gi|108871755|gb|EAT35980.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aedes aegypti] (280 aa)
Score = 148, Expect = 6.4e-08, Identities = 49/188 (26%), Positives = 84/188 (44%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           +I+G +NI      + + NH+S  D+++  +  +  +   P       V K E+      G A+ L+  +FIDR+N+     V + E   +Q+    L +F EGTR  KD    FK  +   A  +   I  +++  YG L    +HK   F    V ++ L  I  K   +     + EK +  M+A +
  S:    89 EIRGKENINVKNGGVALINHQSAIDIVMLSRLLREFRNIVP-------VVKKELFYALPFGIASYLVGVVFIDRKNITSAKDVMKREAVAIQRDNLKLAIFPEGTRHDKDTLLPFKKGSFHVAIDSQSIIQSIIVSKYGFL----DHKKKRFGRGRVIIKILPEISTKGMTKDDINSLVEKCQTTMQAEF 267
>gi|21233432|ref|NP_639349.1| acyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66770396|ref|YP_245158.1| acyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|188993598|ref|YP_001905608.1| 1-acylglycerol-3-phosphate O-acyltransferase [Xanthomonas campestris pv. campestris] >gi|21115275|gb|AAM43231.1| acyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575728|gb|AAY51138.1| acyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|167735358|emb|CAP53572.1| 1-acylglycerol-3-phosphate O-acyltransferase [Xanthomonas campestris pv. campestris] (249 aa)
Score = 146, Expect = 1.0e-07, Identities = 43/139 (30%), Positives = 68/139 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           KV ++G + +  +K+ +FV NH+S  D+     A        P  L   F+ K E+ K   V + A+    +F+DR + R    V ++   LL+ G+Q L +F EGTR +      FK+  L  A     Q+VPV + G
  S:    66 KVIVEGRERVDWSKNYLFVSNHQSIIDICALFYAL-------PVPL--RFLLKEEMLKVPFVNWYARATGMLFLDRDSRRAGAMVRRQAAALLRNGQQ-LCLFPEGTRSRTGALLPFKAGLLQAAIDAGVQVVPVAVDG 194
>gi|149027956|gb|EDL83407.1| 1-acylglycerol-3-phosphate O-acyltransferase 1, isoform CRA_b [Rattus norvegicus] (307 aa)
Score = 146, Expect = 1.0e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+++ P  +  + V NH+S+ D+L  ++         P+   P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:   103 RVEVRGAQHFPPTQPYVVVSNHQSSLDLLGMMEVL-------PDRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTIFREISTD 288
>gi|47058950|ref|NP_997623.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 [Rattus norvegicus] >gi|46237582|emb|CAE83961.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Rattus norvegicus] >gi|55249755|gb|AAH85852.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 [Rattus norvegicus] >gi|149027954|gb|EDL83405.1| 1-acylglycerol-3-phosphate O-acyltransferase 1, isoform CRA_a [Rattus norvegicus] >gi|149027955|gb|EDL83406.1| 1-acylglycerol-3-phosphate O-acyltransferase 1, isoform CRA_a [Rattus norvegicus] (284 aa)
Score = 146, Expect = 1.0e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+++ P  +  + V NH+S+ D+L  ++         P+   P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    80 RVEVRGAQHFPPTQPYVVVSNHQSSLDLLGMMEVL-------PDRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTIFREISTD 265
>gi|110639075|ref|YP_679284.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Cytophaga hutchinsonii ATCC 33406] >gi|110281756|gb|ABG59942.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Cytophaga hutchinsonii ATCC 33406] (222 aa)
Score = 146, Expect = 1.1e-07, Identities = 54/188 (28%), Positives = 89/188 (47%)
  Q:    67 KVKIKGSKNIPANKS-VMFVPNHKSNFDV--LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEA 254
           K+ +KG ++IPA K   + V NH+S  D+  L Y+  F +            FV+K EI+K   +G+   ++  IFIDR +    ++       L+++G+  +T F EGTR   ++ G FK+     A     +I+PV I G   +       I K   VTV    PI        ++    E++K ++E 
  S:    44 KLTVKGLEHIPAEKKPYIVVSNHQSVIDIPILFYVLPFNVY-----------FVAKKEIAKVPFIGWYMYMMGMIFIDRGSRDKALQSMINAGTLIREGKSVMT-FPEGTRSLNEKIGVFKAGTFVMAEKAGVEILPVKISGAGKIWPSGGFTI-KRGPVTVSIGAPISTAGLNDQTRAKFIEEVKGRVEG 221
>gi|153807955|ref|ZP_01960623.1| hypothetical protein BACCAC_02241 [Bacteroides caccae ATCC 43185] >gi|149129564|gb|EDM20778.1| hypothetical protein BACCAC_02241 [Bacteroides caccae ATCC 43185] (252 aa)
Score = 145, Expect = 1.4e-07, Identities = 59/200 (29%), Positives = 91/200 (45%)
  Q:    61 VFCTF--TKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVY---LKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           + C F    VKI+G + +    S +FVPNH+ +FD+ L+Y    + FK + +K              + K   VG A +    IF+DR   +  +   Q+ K  L+ G  SL VF EG R      G FK  A   A      +VPV I G+  +       I +++ + +   +PI  K      K +  E +KA M  AY  ++
  S:    51 LICLFLLIPVKIRGREKLHGKTSYIFVPNHQGSFDIFLIYGFIGRNFKWMMKK-------------SLRKLPFVGKACESAGHIFVDRSGPKKVLETIQQAKASLKDG-VSLVVFPEGARTFTGHMGYFKKGAFQLADDLQLAVVPVTIDGSFEILPRTGKWIHRHRMI-LTIHDPIPPK-----GKGM--ENIKATMAEAYTAVE 234
>gi|150016615|ref|YP_001308869.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149903080|gb|ABR33913.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium beijerinckii NCIMB 8052] (233 aa)
Score = 145, Expect = 1.4e-07, Identities = 61/232 (26%), Positives = 111/232 (47%)
  Q:    18 FCVFFLWLSLRSSKKKY-KRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI-YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           +  + LW+ ++  K  +  R Q D        +  Y++S  +  +     ++ + G++NIP  + V FV NH S  D+++ L     + +K        F++K E+ KT  +G+  K    + +DR N R  +    E  E ++ G  S+ +F EGTR K+ + G+FK  +L  A  +   IVPV I   +   E   K   FK  ++ V F + I  K+  +  +  ++E ++
  S:     8 YVFYMLWVRIKGVKHTFILRTQGDESAEEYVRKTAYLWSKFTLKIIGI--ELDVTGTENIPEEQCV-FVGNHSSILDIIILLYT---VNKKM------GFIAKRELLKTPILGYWLKKSKCVPLDRSNTRAAIASINEAIENIKNG-SSMVIFPEGTRNKEGKVGQFKKGSLKLATKSQAMIVPVSIDRASRAFEDTRK---FKPTKIKVVFGKTIDTKNLSKEEEYNLAENIR 225
>gi|163814796|ref|ZP_02206185.1| hypothetical protein COPEUT_00947 [Coprococcus eutactus ATCC 27759] >gi|158450431|gb|EDP27426.1| hypothetical protein COPEUT_00947 [Coprococcus eutactus ATCC 27759] (149 aa)
Score = 144, Expect = 1.6e-07, Identities = 42/142 (29%), Positives = 69/142 (48%)
  Q:   117 VSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLK 258
           +SK  I K   + +  K I   F+DR +L+  +    +  ++++ G  S+ VF EG R   +E   FK  A   A    C IVPV I GT  + + +K N  +  +V +EFL+PI         ++ V E +   ++ A +K
  S:     1 MSKDGILKVPILPWYMKDIGCTFLDRSDLKKGLETIMQSADIVKSG-HSMMVFPEGHRNDGEELLPFKDGAYKIAQKAGCPIVPVSICGTDNIMEANKHNFIRSHKVVIEFLDPIDINGMKPKERKEVLETIPGLIQKARVK 141
>gi|21674846|ref|NP_662911.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium tepidum TLS] >gi|21648067|gb|AAM73253.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium tepidum TLS] (232 aa)
Score = 144, Expect = 1.6e-07, Identities = 51/183 (27%), Positives = 90/183 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT--LGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           +VK++G +N   NK+ + V NH    D+ + L + K         L+  FV+K E+ K    G A K    +FI R   R+ ++   +  + L+ G +S+ +F EGTR K  +   FK  A   A      ++PV I G+  +  +K  K N    + +  + +EP K +  ++ S  ++SE ++
  S:    54 EVKVEGEENYNPNKNYLVVSNHAGMADIPLILGSMK---------LNLRFVAKEELGKIPVFGPALKSAGYVFIKRGQNREALQSMLKAADTLKAG-RSIHIFPEGTRSKTGKILPFKRGAFIIAEKAKVPVLPVTIVGSNLITPKKSLKINHGTVRLIIGKPIEPAKAEALMKESYSVISENLE 228
>gi|150004792|ref|YP_001299536.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacteroides vulgatus ATCC 8482] >gi|149933216|gb|ABR39914.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacteroides vulgatus ATCC 8482] (252 aa)
Score = 144, Expect = 1.6e-07, Identities = 57/202 (28%), Positives = 90/202 (44%)
  Q:    61 VFC--TFTKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVYL---KAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +FC      VK+ G   +    S +FV NH+ +FD+ L+Y    + FK + +K              + K   VG A +    IF+D+   +  +   +  + +LQ G  SL VF EG R      G FK  A   A      +VP+ I G+  +          +  +T+   +PI    Y Q+      E +KA ME AY +I++D
  S:    51 LFCYVLLIPVKVVGHPEVLKKTSYVFVANHQGSFDIFLIYGFLGRNFKWMMKK-------------SLRKMPFVGKACEAAGHIFVDKSGPKKVIETIEHARHVLQDG-TSLVVFPEGARTFTGHMGYFKKGAFQLADDLQLPVVPLTIIGSFNI-LPRTGGFVSWHPMTLVVHKPI----YPQSQG---MENIKATMEEAYREIEKD 236
>gi|168334234|ref|ZP_02692435.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Epulopiscium sp. 'N.t. morphotype B'] (246 aa)
Score = 144, Expect = 1.7e-07, Identities = 52/237 (21%), Positives = 114/237 (48%)
  Q:    20 VFFLWLSLRSSKKKYKRWQEDPELLGLTERQNY-------VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHK-SNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           +FF+      + K   +++ D + L +  ++ Y       + S     +  + +++ + G +N+P  +  ++V NH+  +D +               I DP  F+ K E+ K   +     +I +I++ R + R  +   ++    L K  QSL ++ EGTR K  + GEFKS +   A+++   I+P+ I  T  + + +K  N  K   + V   +PI+     +  ++L+ ++++  ++  +
  S:     8 LFFMVYHFIINTKDRNKYRVDNQQLDVETQKIYSEKIYRIMQSFCRGMIKASGSEIVVMGKENLPTQRGNLYVSNHRGFYDPMSIAAV----------IDDPCIFIGKDEVKKMPIISTWFDVIGSIYMIRDDPRQALESIKKGTAAL-KNHQSLVIYPEGTRSKTGQLGEFKSGSFKLAFNSGATIIPIAIKNTECIFENNKLPNKIKSTTIYVNIGKPIEVTHLSRQEQKLLPKQVEQYVQELF 242
>gi|91092284|ref|XP_968475.1| PREDICTED: similar to CG3812 CG3812-PA [Tribolium castaneum] (276 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/193 (25%), Positives = 90/193 (46%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++G +++  +++ + V NH+S+ D+L     +       P +   T V+K E+      G AA L   IFI R N      +  +  E ++K +  L VF EGTR    +   FK  A   A S+   I+PVV      ++K++K   F + +V V  L PI  ++      + + E+ +  M   + ++ ++
  S:    81 LRGREHLEKDQACIIVSNHQSSIDILGMFDVW-------PVMDKCTVVAKKELFYAWPFGLAAWLCGLIFIPRMNSDKARVLMNDAAEEIKKDKIKLWVFPEGTRRNTGQIHPFKKGAFHIAISSKLPILPVVFSQYYFLDKQNKR--FDHGKVIVTALPPIPTENLSHDDLDELMERTRNAMSTTFHEVNKE 264
>gi|119624011|gb|EAX03606.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_c [Homo sapiens] (287 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    87 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 272
>gi|114606622|ref|XP_001163672.1| PREDICTED: hypothetical protein LOC462582 isoform 1 [Pan troglodytes] (343 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 268
>gi|109070574|ref|XP_001114529.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 2 [Macaca mulatta] >gi|109070576|ref|XP_001114553.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 3 [Macaca mulatta] >gi|109070578|ref|XP_001114575.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 4 [Macaca mulatta] >gi|109070580|ref|XP_001114591.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 5 [Macaca mulatta] >gi|109070582|ref|XP_001114612.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 6 [Macaca mulatta] >gi|109070584|ref|XP_001114638.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 7 [Macaca mulatta] >gi|109070586|ref|XP_001114674.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 9 [Macaca mulatta] >gi|109070588|ref|XP_001114709.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 11 [Macaca mulatta] >gi|109070590|ref|XP_001114661.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 8 [Macaca mulatta] (283 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 268
>gi|2852623|gb|AAC19153.1| unknown [Homo sapiens] (244 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    44 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 229
>gi|1841552|gb|AAB47493.1| LPAAT [Homo sapiens] (275 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    75 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 260
>gi|5453718|ref|NP_006402.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 [Homo sapiens] >gi|15100175|ref|NP_116130.2| 1-acylglycerol-3-phosphate O-acyltransferase 1 [Homo sapiens] >gi|114606624|ref|XP_001163776.1| PREDICTED: hypothetical protein LOC462582 isoform 3 [Pan troglodytes] >gi|114606626|ref|XP_518375.2| PREDICTED: hypothetical protein LOC462582 isoform 12 [Pan troglodytes] >gi|114606628|ref|XP_001163855.1| PREDICTED: hypothetical protein LOC462582 isoform 4 [Pan troglodytes] >gi|114606630|ref|XP_001163893.1| PREDICTED: hypothetical protein LOC462582 isoform 5 [Pan troglodytes] >gi|114606632|ref|XP_001163919.1| PREDICTED: hypothetical protein LOC462582 isoform 6 [Pan troglodytes] >gi|114606634|ref|XP_001163961.1| PREDICTED: hypothetical protein LOC462582 isoform 7 [Pan troglodytes] >gi|114606636|ref|XP_001164033.1| PREDICTED: hypothetical protein LOC462582 isoform 9 [Pan troglodytes] >gi|114606638|ref|XP_001164116.1| PREDICTED: hypothetical protein LOC462582 isoform 11 [Pan troglodytes] >gi|114606640|ref|XP_001163995.1| PREDICTED: hypothetical protein LOC462582 isoform 8 [Pan troglodytes] >gi|3914372|sp|Q99943|PLCA_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (1-AGP acyltransferase 1) (1-AGPAT 1) (Lysophosphatidic acid acyltransferase alpha) (LPAAT-alpha) (1-acylglycerol-3-phosphate O-acyltransferase 1) (Protein G15) >gi|2155238|gb|AAB58775.1| lysophosphatidic acid acyltransferase-alpha [Homo sapiens] >gi|2253613|gb|AAB96378.1| putative lysophospholipid acyltransferase [Homo sapiens] >gi|2894090|emb|CAA70758.1| 1-acylglycerol-3-phosphate O-acyltransferase [Homo sapiens] >gi|12803193|gb|AAH02402.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|12804297|gb|AAH03007.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|13279197|gb|AAH04310.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|55961399|emb|CAI17430.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|55962005|emb|CAI18347.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|57209684|emb|CAI41807.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|60552552|gb|AAH90849.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|119624005|gb|EAX03600.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_b [Homo sapiens] >gi|119624006|gb|EAX03601.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_b [Homo sapiens] >gi|119624007|gb|EAX03602.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_b [Homo sapiens] >gi|119624008|gb|EAX03603.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_b [Homo sapiens] >gi|119624009|gb|EAX03604.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_b [Homo sapiens] >gi|119624010|gb|EAX03605.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_b [Homo sapiens] >gi|123209930|emb|CAM26221.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|168983867|emb|CAQ09622.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|168984858|emb|CAQ06593.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] >gi|168985874|emb|CAQ10697.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Homo sapiens] (283 aa)
Score = 144, Expect = 1.8e-07, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 268
>gi|194693422|gb|ACF80795.1| unknown [Zea mays] (244 aa)
Score = 144, Expect = 1.8e-07, Identities = 47/186 (25%), Positives = 82/186 (44%)
  Q:    50 QNYVYSLASKAVFCTFTKVKIKGSKNIPANKSV-MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKD 235
           Q+Y+  + +      F  ++++G +N+P N    ++V NH+S  D+   L   +  K          F+SK  I     +G+A  L+  I + R + R  +   +   +L+ KG  S+  F EGTR +  + G FK  A + A  T   ++ + + GT  +       I     V V    PI+  D
  S:    45 QHYIAKIWATVTISMFYNLEVEGMENLPPNSCPGVYVANHQSFLDIYTLLTLGRCFK----------FISKTSIFMFPIIGWAMYLLGVIPLRRMDSRSQLDCLKRCVDLVGKG-ASVFFFPEGTRSRDGKLGVFKRGAFSVAAKTGAPVIAITLIGTGKLMPSGMEGILNSGSVKVIIHRPIQGND 220
>gi|169351014|ref|ZP_02867952.1| hypothetical protein CLOSPI_01791 [Clostridium spiroforme DSM 1552] >gi|169292076|gb|EDS74209.1| hypothetical protein CLOSPI_01791 [Clostridium spiroforme DSM 1552] (240 aa)
Score = 143, Expect = 2.1e-07, Identities = 55/221 (24%), Positives = 92/221 (41%)
  Q:    33 KYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           KYK  +  P    L ER  +++ + S        ++K  G +N+P     +  PNH+  +D L   +  +              + K E++    V    K++  + +DR+N+RD  RV       +  G Q+  VF EGTR K  +   EFK      A      IVPV +   +   K   +N  K     + +L P+ Y DY       +++ +  K+E
  S:    25 KYKHIENYP----LEERYGFIHGVVSTISKKARVELKCYGLENLPKQSGYLLAPNHQGLYDPLAIFQTHEAPIRA---------IVKKELTSVILVKDVIKMLEYVPLDRKNVRDGARVINYVSNEVANG-QNFFVFPEGTRSKDGNNILEFKGGTFKIATKAKAPIVPVAL---IDCYKVFDNNTIKKTTAQIHYLPPLYYNDYKDMHTNEIAKIVHDKIE 229
>gi|153812027|ref|ZP_01964695.1| hypothetical protein RUMOBE_02420 [Ruminococcus obeum ATCC 29174] >gi|149831926|gb|EDM87012.1| hypothetical protein RUMOBE_02420 [Ruminococcus obeum ATCC 29174] (239 aa)
Score = 143, Expect = 2.4e-07, Identities = 54/198 (27%), Positives = 88/198 (44%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTI---FIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG-EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNW 265
           V+  G +NIP     MF PNH+  +DVL  +               PT  S +   +   V F  ++   +    +DR+++R  ++V  +  + ++ G   L +F EGTR K      EFK  +   A    C IVPV +  T    K   +   +   V V FL+P+ Y +Y       ++ ++K ++E     IKE   W
  S:    56 VQSYGVENIPNENGFMFYPNHQGLYDVLAIVDVC------------PTPFSVVAKKEVGNVPFLKQVFTCMKAYIMDREDIRQSMQVILDVTKEVKAGRNYL-IFAEGTRSKNGNHPLEFKGGSFKAATKARCPIVPVALIDTY---KAFDTGSIEPLTVQVHFLKPMYYDEYKDMKTTEIAAEVKRRVEET---IKEYGGW 238
>gi|160882442|ref|ZP_02063445.1| hypothetical protein BACOVA_00393 [Bacteroides ovatus ATCC 8483] >gi|156112154|gb|EDO13899.1| hypothetical protein BACOVA_00393 [Bacteroides ovatus ATCC 8483] (252 aa)
Score = 143, Expect = 2.5e-07, Identities = 59/200 (29%), Positives = 92/200 (46%)
  Q:    61 VFCTF--TKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVY---LKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           + C F    VKI+G + +    S +FVPNH+ +FD+ L+Y    + FK + +K              + K   VG A +    IF+DR   +  +   ++ K+ L+ G  SL VF EG R      G FK  A   A      +VPV I G+  +       I +++ + +   EPI  K      K +  E +KA M  AY  ++
  S:    51 LICLFLLIPVKIEGREKLHDKTSYIFVPNHQGSFDIFLIYGFIGRNFKWMMKK-------------SLRKLPFVGKACESAGHIFVDRSGPKKVLETIRQAKDSLKDG-VSLVVFPEGARTFTGHMGYFKKGAFQLADDLQLAVVPVTIDGSFEILPRTGKWIHRHRMI-LTIHEPIPPK-----GKGM--ENIKATMAEAYAAVE 234
>gi|160941452|ref|ZP_02088787.1| hypothetical protein CLOBOL_06343 [Clostridium bolteae ATCC BAA-613] >gi|158435598|gb|EDP13365.1| hypothetical protein CLOBOL_06343 [Clostridium bolteae ATCC BAA-613] (243 aa)
Score = 142, Expect = 2.6e-07, Identities = 49/190 (25%), Positives = 84/190 (44%)
  Q:    48 ERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYI 237
           E+  Y+  +  +        V   G+++IP+    +  PNH+  FD+L            RP     + V K E S    V        ++ +DR +++D VR+  E  + ++ G ++  +F EG R +  +E  +FKS     A    C IVPV +  +    +    N  K +EV V ++EPI    Y+
  S:    36 EKYGYISEMVKRINRRGRVTVTATGTEHIPSQDGFILFPNHQGLFDMLALFSTC-----PRP----LSVVIKKEASNWILVKQVLGATKSLAMDRDDIKDQVRIITEVTKRVKSG-RNFVIFAEGHRSRNGNEILDFKSGTFKSAVKAGCPIVPVALVNSF---RPFDMNSLKREEVQVHYMEPILPDQYM 213
>gi|110599477|ref|ZP_01387715.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Geobacter sp. FRC-32] >gi|110549856|gb|EAT63044.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Geobacter sp. FRC-32] (232 aa)
Score = 142, Expect = 2.9e-07, Identities = 43/177 (24%), Positives = 85/177 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI-----KYKDYIQTSKEL 243
           K++++G KN+P    ++F+ NH+ NFD+L    A  +   +R      ++++K E+      G A +    I +DR + R  ++      + ++ G  S+ VF EGTR K      FK      A      I+P  I G++ +   ++  ++    + + F  P+     + KD +Q  +++
  S:    53 KIEVEGLKNVPGEGPLIFMGNHQGNFDIL----ALSLAIPRR-----FSWIAKKELFAIPLFGEAMRRAGYIPLDRSDGRRALKSMNAAADRIRNG-SSVVVFPEGTRTKDGNLLPFKRGGFLLAAKAGVPIIPFTINGSMKINPRNRIELYP-GTLRISFARPVATATGQDKDQVQLMEQV 223
>gi|147225142|emb|CAN13270.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase) [Sus scrofa] (287 aa)
Score = 142, Expect = 3.2e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 268
>gi|73972351|ref|XP_860706.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 3 [Canis familiaris] (289 aa)
Score = 142, Expect = 3.2e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 268
>gi|74136749|ref|NP_001028180.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 [Sus scrofa] >gi|71063981|gb|AAZ22440.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 [Sus scrofa] (287 aa)
Score = 142, Expect = 3.2e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 268
>gi|57094381|ref|XP_532091.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 1 [Canis familiaris] >gi|73972353|ref|XP_860735.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 4 [Canis familiaris] >gi|73972355|ref|XP_860775.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 5 [Canis familiaris] (287 aa)
Score = 142, Expect = 3.2e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 268
>gi|42523329|ref|NP_968709.1| putative lysophosphatidic acid acyltransferase [Bdellovibrio bacteriovorus HD100] >gi|39575535|emb|CAE79702.1| putative lysophosphatidic acid acyltransferase [Bdellovibrio bacteriovorus HD100] (245 aa)
Score = 142, Expect = 3.2e-07, Identities = 52/190 (27%), Positives = 89/190 (46%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLV---YLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHK--SNIFKY-KEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           KV++KG +N P     ++V NH S FD+     +L +F+             F +KIE+      G   +    + I R    +  +V Q  +  ++ GE+   +  EGTR K +  G FKS     A S    IVPVV+ G   +  + +   N   + + +T+E L P+  + Y    + ++ EK++  ME  +
  S:    60 KVEVKGLENRPEG-GFLYVFNHTSFFDIFAMNGWLGSFR-------------FGAKIELFSIPVFGAGMRRAGILPIARNRRDEVFKVYQAAEARIKAGER-FALAPEGTRQKTETLGPFKSGPFIFAISAKAPIVPVVVKGAAAIMSKGQLVPNWGVWSRTITLEVLPPVSTEGYTIEDRPVLQEKVRKMMEPYF 240
>gi|158288213|ref|XP_559898.3| AGAP009415-PA [Anopheles gambiae str. PEST] >gi|157019272|gb|EAL41416.3| AGAP009415-PA [Anopheles gambiae str. PEST] (273 aa)
Score = 141, Expect = 3.6e-07, Identities = 56/193 (29%), Positives = 92/193 (47%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR--VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++G +NI  N   + + NH+S  D++V       + E  P +   T V+K E+      G A  L  T+FIDRQN RD  +  +N+E K + +K +  L  F EGTR   D+   FK      A  +   I PVVI  Y  L    + K+ IF   +  ++ L  +      +     + E+++  M+  Y ++ E+
  S:    79 VRGKENINRNHGGIVLMNHQSALDLIV-------LAELWPIMGRSTVVAKKEVLYMFPFGLACWLWGTLFIDRQN-RDSAKSVINKEAKAINEK-QAKLLFFPEGTRGNGDKLLPFKKGCFHVAVESQAFIQPVVISKYHFL----KSKAKIFNRGQNIIKILPEVSCAGLSKDDIPALMERVQKMMQREYEQLSEE 262
>gi|29345653|ref|NP_809156.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacteroides thetaiotaomicron VPI-5482] >gi|29337545|gb|AAO75350.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacteroides thetaiotaomicron VPI-5482] (275 aa)
Score = 141, Expect = 3.6e-07, Identities = 58/200 (28%), Positives = 91/200 (45%)
  Q:    61 VFCTF--TKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVY---LKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           + C F    VKI G + +    S +FVPNH+ +FD+ L+Y    + FK + +K              + K   VG A +    IF+DR   +  +   ++ K+ L+ G  SL VF EG R      G FK  A   A      +VPV I G+  +       I +++ + +   +PI  K      K +  E +KA M  AY  ++
  S:    74 LICLFLLIPVKIHGREKLHGKTSYIFVPNHQGSFDIFLIYGFIGRNFKWMMKK-------------SLRKIPFVGKACESAGHIFVDRSGPKKVLETIRQAKDSLKDG-VSLVVFPEGARTFTGHMGYFKKGAFQLADDLQLAVVPVTIDGSFEILPRTGKWIHRHRMI-LTIHDPIPPK-----GKGM--ENIKATMAEAYAAVE 257
>gi|148323223|gb|EDK88473.1| long-chain-fatty-acid--CoA ligase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (824 aa)
Score = 141, Expect = 4.0e-07, Identities = 61/201 (30%), Positives = 97/201 (48%)
  Q:    54 YSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK---MKAKMEA 254
           +   S  VF TF +VK+KG + I  +K  +FV NH+S  D  ++  +  +   K+   L      K  I K     F A   N + +D    +D   V Q   +LL+K  +++ ++ EGTR +  +  +FK +    A      I P VI G   +    K    K  ++TVEFL+ IK ++   T  E+V+E    +K K+EA
  S:   632 FKFLSFIVFKTFFRVKVKGKEKIEKDKPTIFVANHQSFLDGFLFNYSVPLKVMKKTYFLATVIHFKSSIMK-----FMADSSNVVLVDMN--KDIAEVMQILAKLLKK-NKNVAIYPEGTRTRDGKMNKFKKSFAIIAKELNVDIQPYVIDGAYDLFPTGK-KFPKPGKITVEFLDKIKVENL--TYDEIVNEAYSVIKNKVEA 824
>gi|164688407|ref|ZP_02212435.1| hypothetical protein CLOBAR_02052 [Clostridium bartlettii DSM 16795] >gi|164602820|gb|EDQ96285.1| hypothetical protein CLOBAR_02052 [Clostridium bartlettii DSM 16795] (256 aa)
Score = 141, Expect = 4.1e-07, Identities = 67/221 (30%), Positives = 111/221 (50%)
  Q:    29 SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYL----KAFKMIKEKRPEILD-PTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEG----TRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYKEVTVEFLEPI---------KYKDYIQTSKELVSEKMK 249
           SS    +++ ++P      E+  ++   ASK++     K+ I G + +P  + V+FV NH S  D  + +    K   ++    P   + P     IE++K+            ++I+R+N R+ V+   +  E +++G QS+ +F EG     +  K    +FK  AL  AY   C IVP+VI  +L   E          K+V VEFLEPI         K  +  +T KE + E+MK
  S:    17 SSLPLIRKFTKNPHKYSSEEKFKFLKDQASKSLDLVNIKLNILGKERVP-KEPVLFVINHSSMLDSFILISSTPKPIGVVIADVPTWRNIPILRHWIELTKS------------VYINRENNREGVKSINKCAENIKEG-QSMAIFPEGDLTWVKDPKSLVSDFKPGALKIAYKAKCPIVPMVIKNSLHTYEGYQPVGKINSKDVEVEFLEPIYDHLKNPKLKTVELAKTIKENMIEEMK 242
>gi|156839271|ref|XP_001643328.1| hypothetical protein Kpol_472p1 [Vanderwaltozyma polyspora DSM 70294] >gi|156113934|gb|EDO15470.1| hypothetical protein Kpol_472p1 [Vanderwaltozyma polyspora DSM 70294] (286 aa)
Score = 141, Expect = 4.2e-07, Identities = 56/195 (28%), Positives = 94/195 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIK----YKDYIQTSKELVSEKM--KAKMEAAYLKIKE 261
           +VK+   KN+  N+  ++V NH+S+ D ++  K F       P     T  +K  +     +G+   L  T+ IDR+N  + +    +  E L K ++SL +F EGTR   +      FK  A   A      IVP+V+  T  ++   + +IF    V V+ L+PI      KD +    E+V  KM  + +    Y +++E
  S:    62 EVKVINEKNLD-NQPCIYVCNHQSSLDAIILGKLFP------PGC---TITAKKSLKYVPILGWFLSLSGTLLIDRKNTAEGIATLNKSLEELVKHKRSLWIFAEGTRSYSESLDMLPFKKGAFHLALQGKIPIVPIVVSNTSNLQN-GRYHIFNRGTVVVKVLDPIPTTKLTKDKVGEFSEMVHNKMLNELRKNVGYSQLEE 253
>gi|189466504|ref|ZP_03015289.1| hypothetical protein BACINT_02879 [Bacteroides intestinalis DSM 17393] >gi|189434768|gb|EDV03753.1| hypothetical protein BACINT_02879 [Bacteroides intestinalis DSM 17393] (250 aa)
Score = 141, Expect = 4.3e-07, Identities = 57/200 (28%), Positives = 90/200 (45%)
  Q:    61 VFCTF--TKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVY---LKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           + C F    VK++G + I  + S +FVPNH+  FD+ L+Y    + FK + +K              + K   VG A +    IF+DR   +  +   ++ K  L+ G  SL VF EG R      G FK  A   A     ++VPV I G+  +       I +++ + +   +PI         K    E +KA M  AY  ++
  S:    51 LICVFLLIPVKVRGREKIHKHTSYVFVPNHQGAFDIFLIYGFLGRNFKWMMKK-------------SLRKLPFVGKACESAGHIFVDRSGPKKVLETIRQAKASLKDG-VSLVVFPEGARTFTGHMGYFKKGAFQLADELQLEVVPVTIDGSFQILPRTGKWIHRHRMI-LTIHDPIP-------PKGQGIENIKATMAEAYAAVE 234
>gi|194223372|ref|XP_001492118.2| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase) [Equus caballus] (287 aa)
Score = 140, Expect = 4.4e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTIFREISTD 268
>gi|196163123|ref|ZP_03123654.1| acyltransferase [Clostridium difficile QCD-23m63] (254 aa)
Score = 140, Expect = 4.5e-07, Identities = 67/228 (29%), Positives = 114/228 (50%)
  Q:    25 LSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRP---EILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEG--TRIKKDE--FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKS-NIFKYKEVTVEFLEPIKYKDYIQTSK---ELVSEKMKAKM 252
           +   SS  +  + +++P+   L E+  ++   A K++     ++ I G + +P  + ++FV NH S  D  +   + +     RP    I D      I I K       AKL+  ++++R+N R+ ++   E  + +  G QS+ VF EG  T IK+      EF+S AL  AY   C IVP+VI  +    + ++         V VEFLEPI   D+I+  +    ++ E +K KM
  S:    13 IGFTSSIPRLIKIKKNPDKFSLKEKFEFMQKQAKKSLDIVNIELNIIGKETLP-KEPLLFVVNHSSMLDSFILTASVE-----RPIGCVIADEPVWRNIPIFKE-----WAKLLRCVYVNRKNNREGIKSIAEASQNILTG-QSMAVFPEGDLTWIKEPNSLVSEFRSGALKIAYKAKCPIVPLVIKNSKDTYEGYQPIGKINSVPVEVEFLEPI--YDHIENPRLKSSVLGENIKNKM 237
>gi|145620480|ref|ZP_01776510.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter bemidjiensis Bem] >gi|144943229|gb|EDJ78324.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter bemidjiensis Bem] >gi|197089695|gb|ACH40966.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter bemidjiensis Bem] (231 aa)
Score = 140, Expect = 5.4e-07, Identities = 48/187 (25%), Positives = 86/187 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTS-KELVSEKMKAKME 253
           ++++ G  ++P    V+++ NH+ NFD+     A        P +   ++V+K E+ K    G A +    I +DR   R  ++  ++  E +  G  S+ +F EGTR +      FK  A   A      IVP  I G+  +   ++  + +   ++V F  PI+ K   +    E V E + AK+E
  S:    53 RLEVNGLNHVPPEGPVIYMGNHQGNFDIFALTLAV-------PRLF--SWVAKEELFKVPVFGAAMRRAGYIPLDRSGGRKALKSMKQAAERIASG-ASVVIFPEGTRTQDGLLLPFKRGAFMLAGMAGVPIVPFTINGSRAINPRNQLEL-RPGTISVTFGAPIEVKRGAEGELMEQVREAIAAKLE 229
>gi|41386737|ref|NP_803484.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Bos taurus] >gi|75054445|sp|Q95JH2|PLCA_BOVIN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (1-AGP acyltransferase 1) (1-AGPAT 1) (Lysophosphatidic acid acyltransferase alpha) (LPAAT-alpha) (1-acylglycerol-3-phosphate O-acyltransferase 1) >gi|14579219|gb|AAK69168.1|AF281677_1 lysophosphatidic acid acyltransferase [Bos taurus] >gi|94534976|gb|AAI16000.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Bos taurus] (287 aa)
Score = 139, Expect = 5.6e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLKPDDVPALADRVRHSMLTVFREISTD 268
>gi|154148369|ref|YP_001406407.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Campylobacter hominis ATCC BAA-381] >gi|153804378|gb|ABS51385.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Campylobacter hominis ATCC BAA-381] (248 aa)
Score = 139, Expect = 5.9e-07, Identities = 51/180 (28%), Positives = 90/180 (50%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHK--SNIFKYKEVTVEFLEPIKYKDYIQTSKELVSE 246
           K++I G+ +  AN   M + NH+S  D++V  +  K          + ++++K EI++   +G    L   I IDR N RD VRV  E K+ ++   + + +F EGTR K D+  +F++ A         ++ PVV+ GT  +   H   +N F   +V    L     KD+++ ++  + E
  S:    49 KIEIIGTPDENAN---MVILNHQSIIDIVVMEEIHKA---------NLSWIAKKEIARIPIIGKIITLPKMIAIDRSNPRDLVRVLHEVKDRIEN-NRVIAMFPEGTRRKGDKLLKFQTGAKVITEKLKLKVQPVVLLGTREILDSHNFCANFFGNVKVVYLPLVDTTDKDWLEKTRSKMQE 217
>gi|57619253|ref|NP_001009746.1| lyosphosphatidic acid acyltransferase [Ovis aries] >gi|75054444|sp|Q95JH0|PLCA_SHEEP 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (1-AGP acyltransferase 1) (1-AGPAT 1) (Lysophosphatidic acid acyltransferase alpha) (LPAAT-alpha) (1-acylglycerol-3-phosphate O-acyltransferase 1) >gi|14279974|gb|AAK58831.1|AF285099_1 lyosphosphatidic acid acyltransferase [Ovis aries] (287 aa)
Score = 139, Expect = 6.1e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGHCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLKPDDVPALADRVRHSMLTVFREISTD 268
>gi|14279976|gb|AAK58832.1|AF285100_1 lysophosphatidic acid acyltransfesrase [Bos taurus] (287 aa)
Score = 139, Expect = 6.2e-07, Identities = 49/196 (25%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+  +         ++++++  M   + +I  D
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPVPTEGLRPDDVPALADRVRHSMLTVFREISTD 268
>gi|126309726|ref|XP_001376541.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 [Monodelphis domestica] (287 aa)
Score = 139, Expect = 6.3e-07, Identities = 48/196 (24%), Positives = 85/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +++++G+ N P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L      + VF EGTR        FK  A   A      I+P+V+  Y     +KE +   F      V  L P+  +     +   ++++++  M   + +I  D
  S:    83 RLEVRGAHNFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGPAGIACWLAGVIFIDRKRTGDAISVMAEAAQTLLSQNVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYCKKERR---FNSGTCQVRVLPPVATEGLTPDNVPDLADRIRHSMLTVFREISTD 268
>gi|170036023|ref|XP_001845865.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase beta [Culex quinquefasciatus] >gi|167878556|gb|EDS41939.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase beta [Culex quinquefasciatus] (273 aa)
Score = 139, Expect = 6.4e-07, Identities = 50/202 (24%), Positives = 86/202 (42%)
  Q:    55 SLASKAVFCTFTK-----VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           +L S  V C F +      +I+G++NI      + + NH+S  D+++  +  +  +   P       V K E+      G  + L+  +FIDR+N      V   E   + +    L +F EGTR  KD    FK  +   A  +   + PVV+     +  +HK   F    V V  L  I  +   +     + E  ++ M+A +
  S:    63 ALISGIVACEFIRWLGVEYEIRGTENINVKNGGVVLLNHQSAIDIVLLSRLLRDFRNIVP-------VVKKELFYAFPFGIGSYLVGVVFIDRKNTASAKDVMNRESIAINRDNLKLAIFPEGTRHDKDTLLPFKKGSFHVAIDSQSIVQPVVVSKYRFI--DHKRKRFGRGRVIVNILPEISMQGKTKEDLNALVEHCQSTMQAEF 260
>gi|189241684|ref|XP_969169.2| PREDICTED: similar to fu12 CG17608-PA [Tribolium castaneum] (202 aa)
Score = 139, Expect = 6.7e-07, Identities = 52/180 (28%), Positives = 87/180 (48%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY-IQTSKELVSEKMK 249
           ++G +NI  +   + + NH+S  D+L+       + E  P + + T +SK EI   +  G AA L  TIFIDR           +  E ++  +  + +F EGTR  K+    FK  A   A ++ C I PVV+  Y  LG   +H+   F    + ++ L  I  + Y ++  +EL+ +  K
  S:    12 LEGHENIVKDSGCVILMNHQSMLDLLI-------LAELWPAMDNCTVISKKEILYFQPFGLAAWLWGTIFIDRVKKEHAQAAVNKTGETIRTRKARVLMFPEGTRNSKETLLPFKKGAFHVALASKCPIQPVVVNRYRFLG---KHR---FDDGHLRIKILPAISTEGYTVENMQELMDKTYK 181
>gi|163725584|ref|ZP_02133106.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Desulfatibacillum alkenivorans AK-01] >gi|161401226|gb|EDQ25472.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Desulfatibacillum alkenivorans AK-01] (242 aa)
Score = 139, Expect = 7.2e-07, Identities = 44/143 (30%), Positives = 63/143 (44%)
  Q:    64 TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           T  +VKI G +NI   +S +   NH+S +D+ V               +D  +V K E+     +G A   +  IFIDR +    +      KE +  G  S+  F EGTR +  +   FK  A T A      I+PV I GT
  S:    57 TPMRVKILGRENIDPKQSYVICANHQSQYDIFVLYGQLG---------IDFKWVMKAELRSVPFLGAACARLGHIFIDRSDTEKALASINAAKEKIVNG-TSVLFFPEGTRSRDGKLLRFKKGAFTFALDLGLPILPVTIVGT 189
>gi|21244816|ref|NP_644398.1| acyltransferase [Xanthomonas axonopodis pv. citri str. 306] >gi|21110517|gb|AAM38934.1| acyltransferase [Xanthomonas axonopodis pv. citri str. 306] (249 aa)
Score = 139, Expect = 7.2e-07, Identities = 42/138 (30%), Positives = 67/138 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           V ++G + +  +K+ +FV NH+S  D+     A        P  L   F+ K E+ K   V + A     +F+DR + R    V ++   LL++G+Q L +F EGTR +      FK+  L  A     Q+VPV + G
  S:    67 VIVEGRERVDWSKNYLFVSNHQSIIDICALFHAL-------PVPL--RFLLKQEMRKVPFVNWYAHAAGMLFLDRDSRRAGALVRRQAAALLREGKQ-LCLFPEGTRSRTGALLPFKAGLLQAAIDAGVQVVPVALDG 194
>gi|30248626|ref|NP_840696.1| phospholipid/glycerol acyltransferase [Nitrosomonas europaea ATCC 19718] >gi|30180221|emb|CAD84523.1| Phospholipid and glycerol acyltransferase (from 'motifs_6.msf') [Nitrosomonas europaea ATCC 19718] (267 aa)
Score = 138, Expect = 8.3e-07, Identities = 48/157 (30%), Positives = 76/157 (48%)
  Q:    47 TERQNYVY-SLASKAVFCTFTKVKIKGSKNIP--ANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           T RQN +  + A K  F    KVK+     +P    + V+FV NH S  D++V L  + +            FV+K EI     +G   +   T+FI+R+   D +R+NQ+   +L+ G +S+ +F EGT    D    F ++ L  A +    + PV I
  S:    37 TARQNRMACNWAQK--FLRILKVKLCPGGVLPVCGRQGVVFVANHISWLDIMVILAVYPV-----------HFVAKAEIGTWPILGQLCRNAGTLFIEREKRGDTLRINQQISSILKDG-RSVVIFPEGTTGDGDVLQHFHASLLQSAVTAETLLYPVAI 182
>gi|53714435|ref|YP_100427.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacteroides fragilis YCH46] >gi|60682453|ref|YP_212597.1| putative phospholipids biosynthesis-related protein [Bacteroides fragilis NCTC 9343] >gi|52217300|dbj|BAD49893.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Bacteroides fragilis YCH46] >gi|60493887|emb|CAH08678.1| putative phospholipids biosynthesis-related protein [Bacteroides fragilis NCTC 9343] (282 aa)
Score = 138, Expect = 8.4e-07, Identities = 56/200 (28%), Positives = 90/200 (45%)
  Q:    61 VFCTF--TKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVY---LKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           + C F    VK+ G + +    S +FVPNH+ +FD+ L+Y    + FK + +K              + K   VG A +    IF+DR   +  +   ++ K+ L+ G  SL VF EG R      G FK  A   A      +VPV I G+  +       I +++ + +   +PI         K   ++ MKA M  AY  ++
  S:    81 LICLFLLIPVKVHGREKLHERTSYIFVPNHQGSFDIFLIYGFLGRNFKWMMKK-------------SLRKIPFVGKACESAGHIFVDRSGPKKVLETIRQAKDSLKDG-VSLVVFPEGARSFTGHMGYFKKGAFQLADDLQLAVVPVTIDGSFEILPRTGKWIHRHRMI-LTIHDPIP-------PKGQGADNMKATMAEAYTAVE 264
>gi|153811618|ref|ZP_01964286.1| hypothetical protein RUMOBE_02010 [Ruminococcus obeum ATCC 29174] >gi|149832359|gb|EDM87444.1| hypothetical protein RUMOBE_02010 [Ruminococcus obeum ATCC 29174] (246 aa)
Score = 138, Expect = 8.5e-07, Identities = 45/170 (26%), Positives = 89/170 (52%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIK-KDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKD 235
           TKV I G +N+P +  V+++ NH+S FD+++          + P  +   +++K E+ +   +    + ++ +F+DR++++  ++      E ++ G  S+ +F EGTR K KDE     F   +   A  + C I+P+ +  T  + + H   I K   V +E+ +PI  K+
  S:    57 TKVTIIGEENVPKDTPVLYIGNHRSYFDIVLSY-------SRCP--IRTGYIAKKEMERYPLLSNWMRYLHCLFLDRKDIKQGLKTILTAIEKIKSG-ISICIFPEGTRNKNKDELELLPFHEGSFKIASKSGCAIIPMAMNNTAEIFEAHMPKI-KSTHVVLEYGKPIYVKE 218
>gi|194763999|ref|XP_001964119.1| GF21388 [Drosophila ananassae] >gi|190619044|gb|EDV34568.1| GF21388 [Drosophila ananassae] (331 aa)
Score = 138, Expect = 8.8e-07, Identities = 45/188 (23%), Positives = 82/188 (43%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR           E    +++    L VF EGTR    E   FK  A   A      I+PVV + + G     K  I     + +  L P+  +   +   +++ E+++ +M   +
  S:    79 ELRGKEHLAKDQACIIVANHQSSLDVLGMFDIWHVMNK-------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNEVNRKIKRQRIKLWVFPEGTRRNTGELHPFKKGAFHMAIDQQIPILPVV-FSSYGTFLNDKKKILNAGRIVITTLPPVSTEGLTKDDIDVLMERVRVQMTETF 258
>gi|146298730|ref|YP_001193321.1| phospholipid/glycerol acyltransferase [Flavobacterium johnsoniae UW101] >gi|146153148|gb|ABQ04002.1| phospholipid/glycerol acyltransferase [Flavobacterium johnsoniae UW101] (248 aa)
Score = 138, Expect = 9.1e-07, Identities = 42/138 (30%), Positives = 70/138 (50%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEI-SKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTP--AYSTFCQIVPVVI 203
           T  K+ G + IP+   ++FV NH+S +D++  +  F+    K        FVSK E+ S    V F  +   ++ IDR++ +  + V +   E ++K  +S  +F EGTR K  +  EF  + L     Y+    +VPV I
  S:    60 TTYKVTGVETIPSGVPIIFVANHQSMYDIVAMIWYFRRFHCK--------FVSKKELGSGIPSVSFNLRHGGSVLIDRKDPKQAIPVIKGLSEYIEKNTRSAVIFPEGTRSKTGKPKEFAQSGLKILCKYAPSAYVVPVSI 192
>gi|148266406|ref|YP_001233112.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter uraniireducens Rf4] >gi|146399906|gb|ABQ28539.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter uraniireducens Rf4] (232 aa)
Score = 138, Expect = 9.5e-07, Identities = 43/177 (24%), Positives = 79/177 (44%)
  Q:    60 AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
            +F    KV++ G + IP +  V+++ NH+ NFD+L    A  +   +R      ++++K E+ +    G A      I +DR + R  ++        ++ G  S+ VF EGTR        FK      A      IVP  I G++ +   ++  ++    +++ F EP+    Y
  S:    46 GLFFAGIKVRVDGVEKIPTDGPVIYMGNHQGNFDIL----ALSLAIPRR-----FSWIAKEELFRVPLFGSAMHRAGYIPLDRSDGRRALKSMNAAAARIRSG-SSVVVFPEGTRTADGNLLPFKRGGFLLAVKAGVPIVPFTINGSMRINPRNRLELYP-GILSITFAEPVTTATY 211
>gi|126699329|ref|YP_001088226.1| acyltransferase [Clostridium difficile 630] >gi|196124619|ref|ZP_03116368.1| acyltransferase [Clostridium difficile ATCC 43255] >gi|115250766|emb|CAJ68590.1| probable acyltransferase [Clostridium difficile 630] (254 aa)
Score = 137, Expect = 9.9e-07, Identities = 66/228 (28%), Positives = 114/228 (50%)
  Q:    25 LSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRP---EILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEG--TRIKKDE--FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKS-NIFKYKEVTVEFLEPIKYKDYIQTSK---ELVSEKMKAKM 252
           +   SS  +  + +++P+   L E+  ++   A K++     ++ I G + +P  + ++FV NH S  D  +   + +     RP    I D      I I K       AKL+  ++++R+N R+ ++   +  + +  G QS+ VF EG  T IK+      EF+S AL  AY   C IVP+VI  +    + ++         V VEFLEPI   D+I+  +    ++ E +K KM
  S:    13 IGFTSSIPRLIKIKKNPDKFSLKEKFEFMQKQAKKSLDIVNIELNIIGKETLP-KEPLLFVVNHSSMLDSFILTASVE-----RPIGCVIADEPVWRNIPIFKE-----WAKLLRCVYVNRKNNREGIKSIAQASQNILTG-QSMAVFPEGDLTWIKEPNSLVSEFRSGALKIAYKAKCPIVPLVIKNSKDTYEGYQPIGKINSVPVEVEFLEPI--YDHIENPRLKSSVLGENIKNKM 237
>gi|168715180|ref|ZP_02747457.1| probable acyltransferase [Clostridium difficile QCD-63q42] (254 aa)
Score = 137, Expect = 1.0e-06, Identities = 66/228 (28%), Positives = 114/228 (50%)
  Q:    25 LSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRP---EILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEG--TRIKKDE--FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKS-NIFKYKEVTVEFLEPIKYKDYIQTSK---ELVSEKMKAKM 252
           +   SS  +  + +++P+   L E+  ++   A K++     ++ I G + +P  + ++FV NH S  D  +   + +     RP    I D      I I K       AKL+  ++++R+N R+ ++   +  + +  G QS+ VF EG  T IK+      EF+S AL  AY   C IVP+VI  +    + ++         V VEFLEPI   D+I+  +    ++ E +K KM
  S:    13 IGFTSSIPRLIKIKKNPDKFSLKEKFEFMQKQAKKSLDIVNIELNIIGKETLP-KEPLLFVVNHSSMLDSFILTASVE-----RPIGCVIADEPVWRNIPIFKE-----WAKLLRCVYVNRKNNREGIKSITQASQNILTG-QSMAVFPEGDLTWIKEPNSLVSEFRSGALKIAYKAKCPIVPLVIKNSKDTYEGYQPIGKINSVPVEVEFLEPI--YDHIENPRLKSSVLGENIKNKM 237
>gi|160889000|ref|ZP_02070003.1| hypothetical protein BACUNI_01420 [Bacteroides uniformis ATCC 8492] >gi|156861467|gb|EDO54898.1| hypothetical protein BACUNI_01420 [Bacteroides uniformis ATCC 8492] (252 aa)
Score = 137, Expect = 1.1e-06, Identities = 54/193 (27%), Positives = 87/193 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDV-LVYL---KAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           V++ G + I    S +FVPNH+  FD+ L+Y    + FK + +K              + K   VG A +    IF+DR + +  +   ++ +  L+ G  SL VF EG R      G FK  A   A     ++VPV I G+  +       I +++ + +   EPI         K   +E +KA M  AY  ++
  S:    60 VEVHGREKIHKRTSYVFVPNHQGAFDIFLIYGFLGRNFKWMMKK-------------SLRKIPFVGKACESAGHIFVDRSSPKKVLATMRQAESSLKDG-VSLVVFPEGARTFTGHMGYFKRGAFQLADELQLEVVPVTIDGSFEILPRTGKWIHRHRMI-LTIHEPIP-------PKGKGAENIKASMNEAYAAVE 234
>gi|118467149|ref|YP_879498.1| acyltransferase family protein [Mycobacterium avium 104] >gi|118168436|gb|ABK69333.1| acyltransferase family protein [Mycobacterium avium 104] (261 aa)
Score = 137, Expect = 1.1e-06, Identities = 51/197 (25%), Positives = 94/197 (47%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           TK   +G +NIPA+   +   NH S  D L  L A   ++E+        F+ K E++  K V +  K    I +DR++  D   V  +    +++GE  + +  E T  +  E  EFK+ A   A +    IVP++++G   +  K+H   +F+ K  +TV    P+  +     + E ++  ++  M A   +++E+
  S:    22 TKFTYQGLENIPAHGGALLAQNHTSYLDWLPTLMA---VRERHRRAY---FMIKAEMADVKAVNYVIKHARLIPVDRRSGHDAFDVAVQR---MREGEL-IGMHPEATISRSFELREFKTGAARMALAAQVPIVPIIVWGAHRIWPKDHPKKVFRNKVPITVAAGRPLPPRG----TPEQLNAALREAMNALLYRVQEE 206
>gi|78049743|ref|YP_365918.1| putative xanthomonadin biosynthesis ayltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78038173|emb|CAJ25918.1| putative xanthomonadin biosynthesis ayltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] (249 aa)
Score = 137, Expect = 1.1e-06, Identities = 41/138 (29%), Positives = 67/138 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           V ++G + +  +K+ +F  NH+S  D+     A        P  L   F+ K E+ K   V + A+    +F+DR + R    V ++   LL++G+Q L +F EGTR +      FK+  L  A     Q+VPV + G
  S:    67 VIVEGRERVDWSKNYLFASNHQSIIDICALFHAL-------PVPL--RFLLKEEMRKVPFVNWYARAAGMLFLDRDSRRAGALVRRQAAALLREGKQ-LCLFPEGTRSRTGALLPFKAGLLQAAIDAGVQVVPVALDG 194
>gi|119358315|ref|YP_912959.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium phaeobacteroides DSM 266] >gi|119355664|gb|ABL66535.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium phaeobacteroides DSM 266] (236 aa)
Score = 136, Expect = 1.3e-06, Identities = 46/150 (30%), Positives = 68/150 (45%)
  Q:    72 GSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK 221
           GS+N  AN+  + + NH    D+ + L   K         L+  FV+K E+ K    G+A K    I I R   RD ++   +  E L+ G +S+ +F EGTR +  E   FK  A   A      I+PV I G+  +  +    I K K
  S:    59 GSENYSANQHYLVISNHAGMADIPLLLGTMK---------LNLRFVAKEELGKIPIFGWALKQAGYIMIRRGQNRDALKSLLDAAETLKNG-RSIHIFPEGTRSETGEMLPFKRGAFLVAQKGGAPILPVTIIGSHLITPKKSLKIHKGK 198
>gi|166710285|ref|ZP_02241492.1| putative acetyl transferase [Xanthomonas oryzae pv. oryzicola BLS256] (249 aa)
Score = 136, Expect = 1.3e-06, Identities = 42/138 (30%), Positives = 67/138 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           V ++G + +  +K+ +FV NH+S  D+     A        P  L   F+ K E+ K   V + A+    +F+DR + R    V ++   LL++G+Q L +F EGTR +      FK   L  A     Q+VPV + G
  S:    67 VIVEGRERVDWSKNYLFVSNHQSIIDICALFYAL-------PVPL--RFLLKEEMLKVPFVNWYARATGMLFLDRDSRRAGALVRRQAAALLRQGKQ-LCLFPEGTRSRTGALLPFKVGLLQAAIDAGVQVVPVALDG 194
>gi|41406305|ref|NP_959141.1| hypothetical protein MAP0207 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41394653|gb|AAS02524.1| hypothetical protein MAP_0207 [Mycobacterium avium subsp. paratuberculosis K-10] (261 aa)
Score = 136, Expect = 1.5e-06, Identities = 51/197 (25%), Positives = 93/197 (47%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           TK   +G +NIPA    +   NH S  D L  L A   ++E+        F+ K E++  K V +  K    I +DR++  D   V  +    +++GE  + +  E T  +  E  EFK+ A   A +    IVP++++G   +  K+H   +F+ K  +TV    P+  +     + E ++  ++  M A   +++E+
  S:    22 TKFTYQGLENIPAQGGALLAQNHTSYLDWLPTLMA---VRERHRRAY---FMIKAEMADVKAVNYVIKHARLIPVDRRSGHDAFDVAVQR---MREGEL-IGMHPEATISRSFELREFKTGAARMALAAQVPIVPIIVWGAHRIWPKDHPKKVFRNKVPITVAAGRPLPPRG----TPEQLNAALREAMNALLYRVQEE 206
>gi|150865399|ref|XP_001384598.2| hypothetical protein PICST_77657 [Pichia stipitis CBS 6054] >gi|149386655|gb|ABN66569.2| predicted protein [Pichia stipitis CBS 6054] (298 aa)
Score = 136, Expect = 1.5e-06, Identities = 57/217 (26%), Positives = 105/217 (48%)
  Q:    43 LLGLTERQNYVYSLASKAVFCTFT-----KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTF--VSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKEL--VSEKMKAKMEAAYLKI 259
           LL +  +  Y     +KA + + +     K+ +K  K + +N ++ ++ NH+S  D+ V  K F+           P +    K  +     +G+   L  T F+DR       +V       L+K +++L +F EGTR   ++ EF  FK  A   A      IVP+V+  T  +    K   F   E+ +E L P+  ++ + T++++  +S K++  M AAY ++
  S:    42 LLRIVNKIEYSQFTVAKAFYSSLSVALGLKINVKNEKYLSSNPAI-YISNHQSALDIYVLGKIFQ-----------PGYFVTGKKSLKYVPFLGWFMALSGTFFLDRSKSDKARKVLDSALTSLKKQDRALFIFPEGTRSGTEELEFLPFKKGAFHLAKQAGIPIVPIVVSNTSTIFNS-KRKFFNGGEINIEILPPVSTENLV-TNEDVTKLSLKVREDMLAAYQRV 255
>gi|148223820|ref|NP_001090802.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Xenopus tropicalis] >gi|134025358|gb|AAI35227.1| Agpat1 protein [Xenopus tropicalis] (273 aa)
Score = 136, Expect = 1.6e-06, Identities = 50/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           K++++G +N    +  + V NH+S+ D+L  +       E  P    P  ++K E+      G A  L   IFI+R+   D + V  E  E + K +  + VF EGTR        FK  A   A      ++PVV+  Y     +KE K   F   + TV  L  +  K         ++++++  M  A+ ++  +
  S:    78 KIEVRGWENFNIKEPYVVVSNHQSSLDLLGMM-------EILPSRCVP--IAKRELMYAGTAGLACWLAGVIFINRKKTDDAISVMTEAAETMLKEDVRVWVFPEGTRNHSGSLLPFKRGAFHLAVKAQVPVIPVVMSSYKDFYCKKERK---FTTGKCTVRILPGVHTKGLSSDDVPELADRVRGMMLEAFSQMSSE 263
>gi|118470424|ref|YP_888965.1| acyltransferase family protein [Mycobacterium smegmatis str. MC2 155] >gi|118171711|gb|ABK72607.1| acyltransferase family protein [Mycobacterium smegmatis str. MC2 155] (508 aa)
Score = 135, Expect = 1.7e-06, Identities = 51/199 (25%), Positives = 94/199 (47%)
  Q:    51 NYVYSLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           N+  S  S+ +  T    + + G +N+ A +  +F+ NH++  D ++   A  ++++      + T V K E++    VG   ++++  FIDR +    V    + +EL ++G  S+ +  EGTR+     G FK  A   A +    +VP+VI     V     S+ F    V V    PI   D+   + E +SE+++
  S:   276 NFFTSTWSRVLLATTGVNLNVLGEENLTAQRPAVFIFNHRNQVDPII---AGTLVRD------NFTGVGKKELANDPLVGTLGRVMDAAFIDRDDPVKAVEGLHKVEELAREG-ISILIAPEGTRLDTTAVGPFKKGAFRIAMAAGIPVVPIVIRNA-EVIAARDSSTFNPGTVDVAVYPPIPVDDW---TVENLSERIE 461
>gi|145954594|ref|ZP_01803599.1| hypothetical protein CdifQ_04001986 [Clostridium difficile QCD-32g58] >gi|168695784|ref|ZP_02728061.1| probable acyltransferase [Clostridium difficile QCD-37x79] >gi|168724690|ref|ZP_02756967.1| probable acyltransferase [Clostridium difficile QCD-76w55] >gi|168730568|ref|ZP_02762845.1| probable acyltransferase [Clostridium difficile QCD-97b34] >gi|196160409|ref|ZP_03120970.1| acyltransferase [Clostridium difficile CIP 107932] (254 aa)
Score = 135, Expect = 1.8e-06, Identities = 66/228 (28%), Positives = 113/228 (49%)
  Q:    25 LSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRP---EILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEG--TRIKKDE--FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKS-NIFKYKEVTVEFLEPIKYKDYIQTSK---ELVSEKMKAKM 252
           +   SS     + +++P+   L E+  ++   A K++     ++ I G + +P  + ++FV NH S  D  +   + +     RP    I D      I I K       AKL+  ++++R+N R+ ++   +  + +  G QS+ VF EG  T IK+      EF+S AL  AY   C IVP+VI  +    + ++         V VEFLEPI   D+I+  +    ++ E +K KM
  S:    13 IGFTSSIPSLIKIKKNPDKFSLKEKFEFMQKQAKKSLDIVNIELNIIGKETLP-KEPLLFVVNHSSMLDSFILTASVE-----RPIGCVIADEPVWRNIPIFKE-----WAKLLRCVYVNRKNNREGIKSIAQASQNILTG-QSMAVFPEGDLTWIKEPNSLVSEFRSGALKIAYKAKCPIVPLVIKNSKDTYEGYQPIGKINSVPVEVEFLEPI--YDHIENPRLKSSVLGENIKNKM 237
>gi|167763414|ref|ZP_02435541.1| hypothetical protein BACSTE_01788 [Bacteroides stercoris ATCC 43183] >gi|167698708|gb|EDS15287.1| hypothetical protein BACSTE_01788 [Bacteroides stercoris ATCC 43183] (252 aa)
Score = 135, Expect = 1.9e-06, Identities = 54/193 (27%), Positives = 85/193 (44%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDV-LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           VKI G + +    S +FVPNH+ +FD+ L+Y    +  K          ++ K  + K   VG A +    IF+DR + +  +   ++ +  L+ G  SL VF EG R      G FK  A   A      +VPV I G+  +       I +++ + +   EPI         K    E +KA M  AY  ++
  S:    60 VKINGREKLHKRTSYVFVPNHQGSFDIFLIYGFLGRNFK----------WMMKKSLRKIPFVGKACESAGHIFVDRSSPKKVLATMRQAEASLKDG-VSLVVFPEGARTFTGHMGYFKRGAFQLADELQLAVVPVTIDGSFEILPRTGKWIHRHRMI-LTIHEPI-------APKGQGVENIKATMAEAYTAVE 234
>gi|58583941|ref|YP_202957.1| putative acetyl transferase [Xanthomonas oryzae pv. oryzae KACC10331] (258 aa)
Score = 135, Expect = 2.1e-06, Identities = 42/138 (30%), Positives = 67/138 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           V ++G + +  +K+ +FV NH+S  D+     A        P  L   F+ K E+ K   V + A+    +F+DR + R    V ++   LL++G+Q L +F EGTR +      FK   L  A     Q+VPV + G
  S:    76 VIVEGRERVDWSKNYLFVSNHQSIIDICALFYAL-------PVPL--RFLLKEEMLKVPFVNWYARATGMLFLDRDSRRAGALVRRQVAALLRQGKQ-LCLFPEGTRSRTGALLPFKVGLLQAAIDAGVQVVPVALDG 203
>gi|84625725|ref|YP_453097.1| putative acetyl transferase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188574735|ref|YP_001911664.1| acyltransferase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|84369665|dbj|BAE70823.1| putative acetyl transferase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188519187|gb|ACD57132.1| acyltransferase [Xanthomonas oryzae pv. oryzae PXO99A] (249 aa)
Score = 135, Expect = 2.1e-06, Identities = 42/138 (30%), Positives = 67/138 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           V ++G + +  +K+ +FV NH+S  D+     A        P  L   F+ K E+ K   V + A+    +F+DR + R    V ++   LL++G+Q L +F EGTR +      FK   L  A     Q+VPV + G
  S:    67 VIVEGRERVDWSKNYLFVSNHQSIIDICALFYAL-------PVPL--RFLLKEEMLKVPFVNWYARATGMLFLDRDSRRAGALVRRQVAALLRQGKQ-LCLFPEGTRSRTGALLPFKVGLLQAAIDAGVQVVPVALDG 194
>gi|11693120|gb|AAG38841.1| putative acetyl transferase [Xanthomonas oryzae pv. oryzae] (249 aa)
Score = 135, Expect = 2.1e-06, Identities = 42/138 (30%), Positives = 67/138 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           V ++G + +  +K+ +FV NH+S  D+     A        P  L   F+ K E+ K   V + A+    +F+DR + R    V ++   LL++G+Q L +F EGTR +      FK   L  A     Q+VPV + G
  S:    67 VIVEGRERVDWSKNYLFVSNHQSIIDICALFYAL-------PVPL--RFLLKEEMLKVPFVNWYARATGMLFLDRDHRRAGALVRRQVAALLRQGKQ-LCLFPEGTRSRTGALLPFKVGLLQAAIDAGVQVVPVALDG 194
>gi|45199110|ref|NP_986139.1| AFR592Wp [Ashbya gossypii ATCC 10895] >gi|44985185|gb|AAS53963.1| AFR592Wp [Ashbya gossypii ATCC 10895] (319 aa)
Score = 135, Expect = 2.1e-06, Identities = 47/174 (27%), Positives = 78/174 (44%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           + V NH+S  D+L+  +AF       P     T  +K  +     +G+   L  T+F+DR N    ++      E L++  Q+  +F EGTR    E     FK  A   A      ++PVV+  T  V    +  IF    +T + LEPI   +  +   + +   ++AKM+A +
  S:   116 VIVSNHQSELDILLLGRAFP------PGC---TVTAKESLRWVPILGWFMALSGTVFLDRSNRSKSLKSLNASLERLKRNRQAAWIFPEGTRSYTTEMQLLPFKKGAFHLAQQAQIPVIPVVMCNTSTVFNP-RLGIFNRGTITAKVLEPIDTANMTKDDVDKLVSDVQAKMQAEF 281
>gi|150389251|ref|YP_001319300.1| phospholipid/glycerol acyltransferase [Alkaliphilus metalliredigens QYMF] >gi|149949113|gb|ABR47641.1| phospholipid/glycerol acyltransferase [Alkaliphilus metalliredigens QYMF] (239 aa)
Score = 135, Expect = 2.1e-06, Identities = 50/161 (31%), Positives = 82/161 (50%)
  Q:    65 FTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFI-----DRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT-----LGVEKEHKSNIFKYKEVTV 225
           +  + I+G++N+   K+  +F+ NH SN D LV  KA K I        DPTF++ +++S          +I T  I     D++ L+  +++       +++GE SL +F EGTR K     E K      A  T   IVP+ +YGT     +  E +  +  F Y +V +
  S:    33 YANINIEGNENLKEVKTPTIFICNHLSNSDGLVLDKALKEI--------DPTFIAGVKLSNNAFTSIGVNVIKTTNIKPNTADKEGLKKIIKI-------VKQGE-SLLIFPEGTRSKVGSLIEAKKGIFLIARMTGAPIVPIGLYGTEKLLPINKEGDMSAETFNYADVYI 188
>gi|34763672|ref|ZP_00144598.1| Long-chain-fatty-acid--CoA ligase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27886596|gb|EAA23796.1| Long-chain-fatty-acid--CoA ligase [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (628 aa)
Score = 135, Expect = 2.1e-06, Identities = 59/201 (29%), Positives = 96/201 (47%)
  Q:    54 YSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK---MKAKMEA 254
           +   S  +F TF +VK+KG + I  +K  +FV NH+S  D  ++  +  +   K+   L      K  I K     F A   N + +D    +D   V Q   +LL K  +++ ++ EGTR +  +  +FK +    A      + P VI G   +    K  + K  ++TVEFL+ IK ++   T  E+V E    +K K+EA
  S:   436 FKFLSFVLFKTFFRVKVKGKEKIEKDKPTIFVANHQSFLDGFLFNYSVPLKVMKKTYFLATVIHFKSSIMK-----FMADSSNVVLVDMN--KDIAEVMQILAKLL-KENKNIAIYPEGTRTRDGKIDKFKKSFAILAKELNVDVQPYVIDGAYDLFPAGK-KLPKPGKITVEFLDKIKVENL--TYDEIVDEAYTVIKNKIEA 628
>gi|147225140|emb|CAN13268.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase) [Sus scrofa] (252 aa)
Score = 134, Expect = 2.3e-06, Identities = 46/165 (27%), Positives = 73/165 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPV 237
>gi|147225141|emb|CAN13269.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase) [Sus scrofa] (253 aa)
Score = 134, Expect = 2.3e-06, Identities = 46/165 (27%), Positives = 73/165 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           +V+++G+ + P ++  + V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F      V  L P+
  S:    83 RVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGRCQVRVLPPV 237
>gi|183597856|ref|ZP_02959349.1| hypothetical protein PROSTU_01190 [Providencia stuartii ATCC 25827] >gi|188022616|gb|EDU60656.1| hypothetical protein PROSTU_01190 [Providencia stuartii ATCC 25827] (244 aa)
Score = 134, Expect = 2.3e-06, Identities = 51/179 (28%), Positives = 83/179 (46%)
  Q:    83 MFVPNHKSNFDVLVYLKAFK---MIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY----IQTSKELVSEKMKAKMEAAYLKIKE 261
           +++ NH++N+D++      +   +   K+  +L P F            GF   +   I IDR N         +  E ++K + S+ +F EGTR +      FK+ A   A +    IVPV +  T G     K N +    V VE LEPI+ K+Y    ++   E   + MKAK++    +I E
  S:    68 IYIGNHQNNYDMVTMSNGVQPRTVTVGKKSLVLIPFF------------GFLYWITGNILIDRSNRSKAHNTISQVAEQIKKHQISIWMFPEGTRSRGRGLLPFKTGAFHAAIAAGVPIVPVCVSTTQG---RIKLNRWNNGHVIVEMLEPIETKNYSKEQVRELAEYCHDLMKAKIKQLDEEIAE 238
>gi|85374525|ref|YP_458587.1| acetyltransferase [Erythrobacter litoralis HTCC2594] >gi|84787608|gb|ABC63790.1| acetyltransferase [Erythrobacter litoralis HTCC2594] (308 aa)
Score = 134, Expect = 2.3e-06, Identities = 56/188 (29%), Positives = 93/188 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFV-RVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALT----PAYSTFCQIVPVVI-YGTLG-----VEKEHKSNIFKYK-------EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEA 254
           KVK+ G+   P  + V F+ NH S  D+L    A               FV+K E+++   VG+  ++  T+F+ R+N      ++NQ  + L+     S+TVF EGT         FKS+ L+    P      Q  PVV+ YG +      ++ E   N FK         ++ V FL+P   +D+    ++ ++ K +  +EA
  S:    94 KVKVHGT---PLRRDVFFIANHVSWLDILSLAGASGT-----------AFVAKAELAEAPLVGWLCRMNRTVFVKRENRLGVADQINQLREALMDN--WSVTVFPEGTTTDGHSLLPFKSSMLSVLEPPPPGVLVQ--PVVLDYGAVAEWIGWIDNESGVNNFKRVLSRRGTFDLHVHFLDPFSPEDH--RGRKAIAAKAREMIEA 279
>gi|148230190|ref|NP_001087689.1| MGC82195 protein [Xenopus laevis] >gi|51703504|gb|AAH81085.1| MGC82195 protein [Xenopus laevis] (273 aa)
Score = 134, Expect = 2.5e-06, Identities = 50/196 (25%), Positives = 86/196 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           K++++G +N    +  + V NH+S+ D+L  +       E  P    P  ++K E+      G A  L   IFI+R+   D + V  E  + + K +  + VF EGTR        FK  A   A      ++PVV+  Y     +KE K   F   + TV  L  +  K         ++++++  M  A+ +I  +
  S:    78 KIEVRGWENFNIKEPYVVVSNHQSSLDLLGMM-------EILPSRCVP--IAKRELMYAGTAGLACWLAGVIFINRKKTDDAISVMTEAADTMLKEDVRVWVFPEGTRNHSGSLLPFKRGAFHLAVQAQVPVIPVVMSSYKDFYCKKEKK---FTTGKCTVRILPGVHTKGLSSDDVPELADRVRDMMIEAFTQISSE 263
>gi|54022584|ref|YP_116826.1| putative 1-acylglycerol-3-phosphate O-acyltransferase [Nocardia farcinica IFM 10152] >gi|54014092|dbj|BAD55462.1| putative 1-acylglycerol-3-phosphate O-acyltransferase [Nocardia farcinica IFM 10152] (466 aa)
Score = 134, Expect = 2.6e-06, Identities = 49/182 (26%), Positives = 80/182 (43%)
  Q:    55 SLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP--TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           +L ++A   T   +V++ G+ N  + +  +F+ NH+S FDV++            P +L    T + K E+++    G   + +   FIDR +            + L+ G  S+ V  EGTR    E G FK  A   A      ++PVVI    G      S I +   V V  L+PI  + +
  S:   267 ALGTRATLATLGVRVRVSGAHNARSPRPAVFLFNHQSQFDVIIV-----------PYVLGGGVTGIGKKELTRNPVFGPLMRFVGVTFIDRSSTERARAALAPVVDTLRSG-LSIAVAPEGTRSYSPEVGPFKKGAFHIALQAGVPVIPVVIRNA-GDIAWRNSMIARSGTVDVAILDPIDVRHW 438
>gi|85081211|ref|XP_956681.1| hypothetical protein NCU00168 [Neurospora crassa OR74A] >gi|28917754|gb|EAA27445.1| hypothetical protein NCU00168 [Neurospora crassa OR74A] (305 aa)
Score = 134, Expect = 2.7e-06, Identities = 58/189 (30%), Positives = 85/189 (44%)
  Q:    43 LLGLTERQNYVYSLASKAVFCTFTKV--KIKGSKNIPA-NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           LLG  +   +    + K V    T V  KI   KNI    +  +F+ NH++  DVL+    F       P+    T  +K  + KT  +G+   L  +IFIDR +  D           +QK +QS+ +F EGTR   K+ E   FK  A   A      IVPVV+     V    K  +F    + ++ L+PI
  S:    61 LLGHGQSAQWAVGRSFKYVMALTTGVRFKIDDPKNILGKTRPAVFIGNHQTELDVLMLGCMF-------PKYCSVT--AKSSLRKTPFLGWFMSLSGSIFIDRASKTDARAAMAGAANQIQKKQQSVYMFPEGTRSYSKEPELLPFKKGAFHLAVQAQVPIVPVVVANYSHVLNV-KDFVFNAGVIPMKVLDPI 244
>gi|88706265|ref|ZP_01103971.1| conserved hypothetical protein [gamma proteobacterium KT 71] >gi|88699416|gb|EAQ96529.1| conserved hypothetical protein [Congregibacter litoralis KT71] (577 aa)
Score = 133, Expect = 3.2e-06, Identities = 42/169 (24%), Positives = 73/169 (43%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           +++ G +N+   +  +F+ NH+S  DV++  K  +          D   V K EI K   +G   ++   + IDR+N    +   +   + ++   +S+ +  EGTR        FK  A   A      IVPVVI     V  +    +F+   V V+ L P+   D+
  S:   295 LRVNGEENLWKERPAVFIFNHQSKADVVIGAKLLRR---------DMAGVGKQEIRKMPVIGKVLEMGGVVMIDRKNAASAIEAMKPLVDAMRNEGKSVALAPEGTRTVSPNLAPFKKGAFHLAIQAGVPIVPVVIRNAGDVAPK-GDFVFRPATVEVDVLPPVDTSDW 453
>gi|51598300|ref|YP_072488.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Borrelia garinii PBi] >gi|51572871|gb|AAU06896.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Borrelia garinii PBi] (245 aa)
Score = 133, Expect = 3.5e-06, Identities = 36/140 (25%), Positives = 73/140 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +V+ + NH +  D L+++  F          ++P   ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  A+  A  T   I+PV +Y T
  S:    62 KIIVTGSENIPPKGNVIIMGNHIAAMDPLIFIYTF----------VNPFVILAKHSLLRVPFVNLVLIVMGAIFVNRKSIRSAAAAEAKAIKVMREG-RSIGIFPEGTRNRGGDTKVFKKGAIKMALKTGTSILPVTLYNT 191
>gi|195478044|ref|XP_002100388.1| GE17028 [Drosophila yakuba] >gi|194187912|gb|EDX01496.1| GE17028 [Drosophila yakuba] (344 aa)
Score = 132, Expect = 3.7e-06, Identities = 45/184 (24%), Positives = 81/184 (44%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR           +    ++K    L VF EGTR    E   FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   +++ E+++A+M
  S:    79 ELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNK-------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEGTRRNTGELHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNAGRIVITTLPPVSTEGLTKDDIDVLMERVRAQM 254
>gi|153816403|ref|ZP_01969071.1| hypothetical protein RUMTOR_02656 [Ruminococcus torques ATCC 27756] >gi|145846238|gb|EDK23156.1| hypothetical protein RUMTOR_02656 [Ruminococcus torques ATCC 27756] (241 aa)
Score = 132, Expect = 4.0e-06, Identities = 47/186 (25%), Positives = 88/186 (47%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY--IQTSK--ELVSEKMKAKME 253
           +  +G  NIP     MF PNH+  +DVL  +             +  + V+K E++  + +           IDR+++R  ++V     + ++ G ++  +F EGTR +  ++ G FK  +   A    C IVPV +  +    K   +       V V FL P+ Y +Y  ++T++   +V E+++  +E
  S:    56 IAAEGLDNIPKENGFMFFPNHQGMYDVLAIMDVCP---------VPISVVAKKEVANIQFLKQVFACTKAYMIDREDVRQAMQVIMNVAKEVKAG-RNYIIFPEGTRSRNGNKIGTFKGGSFKAATKARCPIVPVALIDSF---KPFDTKSISKVTVQVCFLPPLYYDEYKDMKTTEIAAIVQERIRKTIE 233
>gi|118049556|ref|ZP_01518107.1| phospholipid/glycerol acyltransferase [Comamonas testosteroni KF-1] >gi|118003423|gb|EAV17576.1| phospholipid/glycerol acyltransferase [Comamonas testosteroni KF-1] (271 aa)
Score = 132, Expect = 4.0e-06, Identities = 40/137 (29%), Positives = 74/137 (54%)
  Q:    67 KVKIKGSKNIPAN--KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + +++G +N+PA+  + V+ +  H+S ++         ++    P  L   +V K E+ K    G++   ++ I IDR Q  R F +V ++ K LL +G   + +F EGTR+ + E GE+K+ A   A  T   +VP+ +
  S:    84 RYQVQGMENLPADPKQGVVLLVKHQSTYETF-------LMPAIMPRPL--AYVFKKELLKVPFFGWSIGALDMIHIDRAQRSRAFHKVVEQGKRLLDQGIW-VIMFPEGTRVNRGEVGEYKTGAARLAIMTGAPVVPIAV 213
>gi|2564952|gb|AAB82009.1| lysophatidic acid acyl transferase-alpha [Mus musculus] >gi|148694845|gb|EDL26792.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_a [Mus musculus] >gi|148694846|gb|EDL26793.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_a [Mus musculus] >gi|148694847|gb|EDL26794.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha), isoform CRA_a [Mus musculus] (285 aa)
Score = 132, Expect = 4.1e-06, Identities = 44/196 (22%), Positives = 80/196 (40%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P  +  + V NH+S+ D+L  ++         P+   P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      I+P+V+        + +          V  L P+  +         +++ ++  M   + +I  D
  S:    80 RVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVL-------PDRCVP--IAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGLTPDDVPALADSVRHSMLTIFREISTD 266
>gi|31560790|ref|NP_061350.2| 1-acylglycerol-3-phosphate O-acyltransferase 1 [Mus musculus] >gi|16307127|gb|AAH09651.1| 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Mus musculus] (285 aa)
Score = 132, Expect = 4.1e-06, Identities = 44/196 (22%), Positives = 80/196 (40%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P  +  + V NH+S+ D+L  ++         P+   P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      I+P+V+        + +          V  L P+  +         +++ ++  M   + +I  D
  S:    80 RVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVL-------PDRCVP--IAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGLTPDDVPALADSVRHSMLTIFREISTD 266
>gi|3914363|sp|O35083|PLCA_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (1-AGP acyltransferase 1) (1-AGPAT 1) (Lysophosphatidic acid acyltransferase alpha) (LPAAT-alpha) (1-acylglycerol-3-phosphate O-acyltransferase 1) >gi|2467310|dbj|BAA22599.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mus musculus] (285 aa)
Score = 132, Expect = 4.1e-06, Identities = 44/196 (22%), Positives = 80/196 (40%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +V+++G+ + P  +  + V NH+S+ D+L  ++         P+   P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      I+P+V+        + +          V  L P+  +         +++ ++  M   + +I  D
  S:    80 RVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVL-------PDRCVP--IAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGLTPDDVPALADSVRHSMLTIFREISTD 266
>gi|118464146|ref|YP_880918.1| acyltransferase family protein [Mycobacterium avium 104] >gi|118165433|gb|ABK66330.1| acyltransferase family protein [Mycobacterium avium 104] (583 aa)
Score = 132, Expect = 4.5e-06, Identities = 46/179 (25%), Positives = 83/179 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY-IQTSKELVSE 246
           + + G +N+ A +  +F+ NH++  D ++   A  ++++      +   V K E+ K   +G   KL++ +FIDR +    V      ++  + G  S+ +  EGTR+   E G FK      A +    IVP+VI     V   + S +     V V    PI  +D+ + T  E ++E
  S:   294 LNVIGKENLTAQRPAVFIFNHRNQVDPVI---AGALVRD------NWVAVGKKELEKDPVMGTLGKLLDGVFIDRDDPAAAVETLHTVEDRARNG-LSILIAPEGTRVDTTEVGPFKKGPFRIAMAAGIPIVPIVIRNAELVAARN-STVINPGTVDVAVFPPISVQDWTLDTLPERIAE 462
>gi|26352009|dbj|BAC39641.1| unnamed protein product [Mus musculus] (326 aa)
Score = 131, Expect = 4.8e-06, Identities = 38/137 (27%), Positives = 63/137 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           +V+++G+ + P  +  + V NH+S+ D+L  ++         P+   P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      I+P+V+
  S:    80 RVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVL-------PDRCVP--IAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIIPIVM 207
>gi|41408397|ref|NP_961233.1| hypothetical protein MAP2299c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41396753|gb|AAS04616.1| hypothetical protein MAP_2299c [Mycobacterium avium subsp. paratuberculosis K-10] (357 aa)
Score = 131, Expect = 4.9e-06, Identities = 46/179 (25%), Positives = 83/179 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY-IQTSKELVSE 246
           + + G +N+ A +  +F+ NH++  D ++   A  ++++      +   V K E+ K   +G   KL++ +FIDR +    V      ++  + G  S+ +  EGTR+   E G FK      A +    IVP+VI     V   + S +     V V    PI  +D+ + T  E ++E
  S:    64 LNVIGKENLTAQRPAVFIFNHRNQVDPVI---AGALVRD------NWVAVGKKELEKDPVMGTLGKLLDGVFIDRDDPAAAVETLHTVEDRARNG-LSILIAPEGTRVDTTEVGPFKKGPFRIAMAAGIPIVPIVIRNAELVAARN-STVINPGTVDVAVFPPISVQDWTLDTLPERIAE 232
>gi|194760693|ref|XP_001962572.1| GF14372 [Drosophila ananassae] >gi|190616269|gb|EDV31793.1| GF14372 [Drosophila ananassae] (271 aa)
Score = 131, Expect = 5.0e-06, Identities = 51/195 (26%), Positives = 89/195 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++++G +N+  +   + + NH+S  D  VL YL          P I   T VSK E+      G  A L  T++I+R    D +   Q++ + +Q  +  L +F EGTR  K+    FK  +   A      I PVVI     ++ E K+  F+     +  L  +  + Y +   E + E+ +  M+  Y K+ ++
  S:    76 MEVRGLENVRKDHGSVVIMNHQSAVDLCVLAYL---------WPVIGRATVVSKKEVLYIPFFGIGAWLWGTLYINRSRKADSINSLQKQAKAIQDRQCKLLLFPEGTRNTKETLLPFKKGSFHIALQGKSPIQPVVISKYSFMDDEKKT--FRPGHAIIHILPEVTTEKYEKEEMEKLIEECQTIMQTEYTKLSKE 261
>gi|167575800|ref|ZP_02368674.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Borrelia valaisiana VS116] (245 aa)
Score = 131, Expect = 5.0e-06, Identities = 36/140 (25%), Positives = 73/140 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +V+ + NH +  D L+++  F       P ++    ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  A+  A  T   I+PV +Y T
  S:    62 KIIVTGSENIPQKSNVVIMGNHIAAMDPLIFIYTFN-----NPFVI----LAKHSLLRVPFVNIGLIVMGAIFVNRKSIRSAAAAEAKAIKVMREG-RSIGIFPEGTRNRGGDTKVFKKGAIKMALKTGTSILPVTLYNT 191
>gi|150008935|ref|YP_001303678.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Parabacteroides distasonis ATCC 8503] >gi|149937359|gb|ABR44056.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Parabacteroides distasonis ATCC 8503] (245 aa)
Score = 131, Expect = 5.0e-06, Identities = 49/181 (27%), Positives = 79/181 (43%)
  Q:    62 FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE 242
           +     V +KG ++I   +S +FV NH+  FD+ L+Y   F  +  K        +V K  I+K   VG A +    IF+D    +   R   E +  L+ G  S+ VF EG+R    +   FK  A   A      I+P+ + G   V      N+ +++   V  + P    + I TS +
  S:    55 YLALCPVTVKGREHIDRKQSYVFVANHQGAFDIFLIY--GFLGVPIK--------WVMKAGIAKIPFVGAACRAAGFIFVDNSTPKAAARSVLEAERCLRNG-ASVVVFPEGSRTYTGKMIRFKKGAYQMALDQHLPIIPITLNGPFDVLPIGSLNVHRHRMEMV--IHPAVSTENIDTSHK 223
>gi|195438944|ref|XP_002067392.1| GK16209 [Drosophila willistoni] >gi|194163477|gb|EDW78378.1| GK16209 [Drosophila willistoni] (341 aa)
Score = 131, Expect = 5.0e-06, Identities = 49/188 (26%), Positives = 87/188 (46%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR---QNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR   +  RD +  VN+     ++K    L VF EGTR    E   FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   E++ E+++ +M   +
  S:    79 ELRGKEHLSKDQACIIVANHQSSLDVLGMFDIWHVMNK-------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARDTLNDVNRR----IKKQRIKLWVFPEGTRRNTGELHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNAGRIVITTLPPVSTEGLTKDDIEILMERIRLQMTETF 258
>gi|115376008|ref|ZP_01463255.1| acyl transfer enzyme [Stigmatella aurantiaca DW4/3-1] >gi|115367007|gb|EAU65995.1| acyl transfer enzyme [Stigmatella aurantiaca DW4/3-1] (260 aa)
Score = 131, Expect = 5.0e-06, Identities = 47/184 (25%), Positives = 87/184 (47%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKA 250
           +V+++G +++P   +V+ V NH+S  D+L  +  F   K          FV+K  + +T  VG+  +L+  + + R + R   R+  + +  L++G   L ++ EGT     +   FK  A   A      +VPVV+ GT  V +     +     V V  L PI   + +    E ++E+++A
  S:    66 RVRVEGREHLPPGPAVL-VANHQSASDILAAMGLFHPFK----------FVAKASLFRTPMVGWLMRLMEYVAVVRNHPRALSRMLDDCRRWLERGVPVL-IYPEGTYAPTRKPLPFKRGAFQLAIQARVPVVPVVLEGTTQVLEGDGPWMGPRASVRVRVLPPIPV-EALGDDPEHLAERVRA 236
>gi|125981725|ref|XP_001354866.1| GA17703-PA [Drosophila pseudoobscura] >gi|54643178|gb|EAL31922.1| GA17703-PA [Drosophila pseudoobscura] (318 aa)
Score = 131, Expect = 5.4e-06, Identities = 45/184 (24%), Positives = 81/184 (44%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR        +  +    ++K    L VF EGTR    E   FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   + + E+++A+M
  S:    79 ELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNK-------CTVVAKRELFYVWPFGLAAWLAGLIFIDRVRGEKAREILNDVNRRIKKQRIKLWVFPEGTRRNTGELHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNAGRIVITTLPPVSTEGLTKDDIDPLMERVRAQM 254
>gi|167760754|ref|ZP_02432881.1| hypothetical protein CLOSCI_03139 [Clostridium scindens ATCC 35704] >gi|167661641|gb|EDS05771.1| hypothetical protein CLOSCI_03139 [Clostridium scindens ATCC 35704] (244 aa)
Score = 131, Expect = 5.7e-06, Identities = 46/179 (25%), Positives = 92/179 (51%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSE 246
           V + G +NIP ++ V+F+ NH+S FD+L+     + +           +++K E+ K   +    K +  +F+DR N ++ ++      + ++KG  S+ +F EGTR   +E     F + +   A  T C IVP+ +  T+ + ++    I K   V +E+ +PI  KD  + +++ + +
  S:    59 VTVIGEENIP-DEPVLFIGNHRSYFDILLTYSRCQRLT---------GYIAKKEMLKYPLLRDWMKRLYCLFLDRDNPKEGLKTILTAIDYVKKG-VSICIFPEGTRNDGEELSILPFHNGSFKIAEKTGCAIVPMSMNNTISIFEKQFPRI-KKVHVILEYGKPIYPKDLDKETRKHIGD 227
>gi|170036027|ref|XP_001845867.1| 1-acylglycerol-3-phosphate O-acyltransferase [Culex quinquefasciatus] >gi|167878558|gb|EDS41941.1| 1-acylglycerol-3-phosphate O-acyltransferase [Culex quinquefasciatus] (280 aa)
Score = 131, Expect = 5.7e-06, Identities = 46/194 (23%), Positives = 91/194 (46%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +++ ++ +   K  + + NH+S+ D+L  +  + ++K       D   ++K E+      G A  L    +I+RQN    +R +++ ++ +++KG + + ++ EGTR  +     FK      A      I+PVV      ++   K  +FK   V +  LEPI  K       + + E+ ++ M A Y KI  +
  S:    88 ELRNARVLKEAKGAVVMANHQSSMDILGLMMLWDILK-------DVISIAKKELLYLIPFGPAGWLAGITYINRQNRTSAMRTLDKCKRNMVEKGHK-MYLYPEGTRFPERGMLPFKKGGFHTAIQAGVPIIPVVFSHMYFIDA--KKYMFKPGHVIMSVLEPIPTKGVTADGLDALIERTRSAMLAEYEKISAE 272
>gi|157363192|ref|YP_001469959.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermotoga lettingae TMO] >gi|157313796|gb|ABV32895.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermotoga lettingae TMO] (244 aa)
Score = 131, Expect = 6.0e-06, Identities = 51/198 (25%), Positives = 94/198 (47%)
  Q:    65 FTKVKIKGSKNIPANKSVMFVPNHKSNFDV---LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           F+ V + G +NI    S + V NH+S  D+   L Y+    M+ +K             E++K   V +  K +   F+DR N  +   + +E  + L  G +SL +F EGTR      G+FK+A    A     +I+P+ I+GT+ +    +S       V +    P+  +D+   ++E ++  ++  + A   K+K++
  S:    61 FSSVIVHGEENI--QPSCLVVANHQSLMDIPLILGYVGPMPMVAKK-------------ELAKVPGVNWFVKYMGGYFLDRSNPAEGAHILKELIKTLSSG-KSLLIFPEGTRSVDGSVGKFKTAIFKIAKKVHVKILPISIWGTIFLVPR-RSLFLNPGRVAMLIHPPVNPEDF--PNEEELARTIEETVRAGVEKLKQE 242
>gi|167943849|ref|ZP_02530923.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi Bol26] (250 aa)
Score = 130, Expect = 7.5e-06, Identities = 36/147 (24%), Positives = 77/147 (52%)
  Q:    60 AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           +++ T  K+ + GS+NIP   +V+ + NH +  D L+++  F       P ++    ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    60 SLWLTGIKIIVTGSENIPKKSNVIIMGNHIAAMDPLIFIYTFAC-----PFVI----LAKHSLLRIPFVNIVLIVMGVIFVNRRSIRSAAAAEVKAIKVMREG-RSIGIFPEGTRNRGGDTRVFKKGSIKMALKTGTSILPVTLYNT 196
>gi|195948093|ref|ZP_03089279.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia garinii PBr] (245 aa)
Score = 130, Expect = 7.5e-06, Identities = 35/140 (25%), Positives = 73/140 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +++ + NH +  D L+++  F          ++P   ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  A+  A  T   I+PV +Y T
  S:    62 KIIVTGSENIPQKSNIIIMGNHIAAMDPLIFIYTF----------VNPFVILAKHSLLRVPFVNLILIVMGAIFVNRKSIRSAAIAEAKAIKVMREG-RSIGIFPEGTRNRGGDTKVFKKGAIKMALKTGTSILPVTLYNT 191
>gi|84387822|ref|ZP_00990837.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio splendidus 12B01] >gi|86147566|ref|ZP_01065876.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio sp. MED222] >gi|84377337|gb|EAP94205.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio splendidus 12B01] >gi|85834605|gb|EAQ52753.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio sp. MED222] (241 aa)
Score = 130, Expect = 7.6e-06, Identities = 49/171 (28%), Positives = 78/171 (45%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY----IQTSKELVSEKMKAKME 253
           ++V NH++++D+      F +     P+++    V K  ++     G    L   I IDR N    V    +    L++ + S+ +F EGTR +      FK+ A   A      I+P+V   T GV    K N +    V VE L PI  +DY    ++    L  E+M AK+E
  S:    68 VYVANHQNSWDL------FTISSAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANRSKAVGTIDQVVTSLKESDVSVWMFPEGTRSRGRGLLPFKTGAFHAAIGAGLPIIPIVCSSTGGV----KLNRWNNGHVIVEMLPPISTEDYDKSNVRQLANLAREQMAAKLE 229
>gi|67539938|ref|XP_663743.1| hypothetical protein AN6139.2 [Aspergillus nidulans FGSC A4] >gi|5002178|gb|AAD37345.1|AF141864_1 AtaAp [Emericella nidulans] >gi|40738735|gb|EAA57925.1| hypothetical protein AN6139.2 [Aspergillus nidulans FGSC A4] (291 aa)
Score = 129, Expect = 8.3e-06, Identities = 50/170 (29%), Positives = 76/170 (44%)
  Q:    62 FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           F T  +  I   K   + +  + + NH+S  DVL       M+ E  P     T  +K  +     +G+   L  T+FIDR N +  V+      E ++   QS+ +F EGTR   +K E   FK  A   A      IVPVV+  Y  +   K+ +   F+   + V+ L PI
  S:    81 FTTGVRFDIVEGKEYLSTRPAVIIGNHQSELDVL-------MLGEIFPPYCSVT--AKKSLRYVPFLGWFMALSRTVFIDRANRQTAVKAFDSAAEEMRSHRQSVFIFAEGTRSYSEKPELLPFKKGAFHLAVKAGVPIVPVVVENYSHILAPKKFR---FEAGSIKVKVLPPI 242
>gi|166032108|ref|ZP_02234937.1| hypothetical protein DORFOR_01811 [Dorea formicigenerans ATCC 27755] >gi|166027831|gb|EDR46588.1| hypothetical protein DORFOR_01811 [Dorea formicigenerans ATCC 27755] (244 aa)
Score = 129, Expect = 8.3e-06, Identities = 45/165 (27%), Positives = 82/165 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           +V + G   +P ++ V++V NH+S FD+L+     + +           FV+K E+     +    K +  +F+DR N+R+ ++      + ++ G  S+ +F EGTR K +E     F + +   A  + C IVPV +  T+ + + H   I K   V +E+  PI
  S:    58 EVTVIGEDRVP-DEPVLYVGNHRSYFDILLTYSRCRDLT---------GFVAKKEMLNYPFLRTWMKRVYCLFLDRDNIREGLKTILTAIDQVKNG-ISVFIFPEGTRNKGEELSLLPFHAGSFKIAEKSGCPIVPVALNNTINIFEGHLPYIRK-THVVLEYCSPI 212
>gi|152979900|ref|YP_001352113.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Janthinobacterium sp. Marseille] >gi|151279977|gb|ABR88387.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Janthinobacterium sp. Marseille] (255 aa)
Score = 129, Expect = 8.8e-06, Identities = 48/158 (30%), Positives = 79/158 (50%)
  Q:    46 LTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           +T R N V+ +    V C   + +IKG +N+P ++ V+ +  H+S ++ +     F +    RP +    FV K E+      G+A  L+  I IDR N +D F +V  + ++ L  G Q + +F EGTRI   E G +K      A  T   +VP+ +
  S:    42 ITSRWN-VFIIWLAKVLCGI-RYEIKGFENLP-DQPVILLSKHQSAWETI-----FLLCNMSRPLV----FVFKKELLYVPFFGWALGLLRMIPIDRNNGKDAFAQVVVQGRKRLADG-QWIIMFPEGTRIPVGERGRYKGGGARLAVETNTVVVPIAL 187
>gi|195131973|ref|XP_002010418.1| GI15913 [Drosophila mojavensis] >gi|193908868|gb|EDW07735.1| GI15913 [Drosophila mojavensis] (323 aa)
Score = 129, Expect = 9.0e-06, Identities = 50/184 (27%), Positives = 86/184 (46%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR---QNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR   +  RD +  VN+  KE   K    L VF EGTR    E   FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   + + E+++++M
  S:    79 ELRGKEHLEKDRACIIVANHQSSLDVLGMFNIWHVMNK-------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARDTLNAVNRRIKEQRIK----LWVFPEGTRRNTGELHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNAGRIVITTLPPVSTEGLTKNDIDQLMERVRSQM 254
>gi|103485689|ref|YP_615250.1| HAD family hydrolase [Sphingopyxis alaskensis RB2256] >gi|98975766|gb|ABF51917.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Sphingopyxis alaskensis RB2256] (518 aa)
Score = 129, Expect = 9.3e-06, Identities = 42/172 (24%), Positives = 81/172 (47%)
  Q:    60 AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           A   T  +++++G +++ +++  +FV NH+S  DV++  K  +          D   V K EI     +G   +   T+F+DR + +  ++  +   + +QK  +S+ +  EGTR    +   FK  A   A      IVP+VI+    V  +++  + +   V V  L P+
  S:   286 ATAITGVELEVEGERHLWSSRPCVFVFNHQSKADVMILAKLIRR---------DMGGVGKKEIRDIPILGKLMEWGGTVFVDRADGKSAIKAMEPLIDAIQKEGKSICIAPEGTRSLTPKLEPFKKGAFHLAMQAGVPIVPIVIHNATDVAPKNEF-VMRPATVRVTVLPPV 447
>gi|37678646|ref|NP_933255.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio vulnificus YJ016] >gi|37197386|dbj|BAC93226.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio vulnificus YJ016] (241 aa)
Score = 129, Expect = 1.0e-05, Identities = 49/178 (27%), Positives = 82/178 (46%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKY----KDYIQTSKELVSEKMKAKMEAAYLKIK 260
           +++ NH++N+D+      F +     P+++    V K  ++     G    L   I IDR N         +    ++  E S+ +F EGTR +      FK+ A   A      I+P+V   T     + K N +    V VE L+PI      K++I+   E+  EKMKAK+E+   ++K
  S:    68 IYIANHQNNWDL------FTVSAAVTPKVVT---VGKKSLAWLPLFGQLYWLTGNILIDRANKTKAKGTIDQVVASMKASEVSVWMFPEGTRSRGRGLMPFKTGAFHAAIGAGVPIIPIVCSST----DQLKLNRWNNGHVIVEMLDPISTEGYGKEHIRELAEICREKMKAKLESLDEEVK 236
>gi|194895791|ref|XP_001978343.1| GG17739 [Drosophila erecta] >gi|190649992|gb|EDV47270.1| GG17739 [Drosophila erecta] (353 aa)
Score = 128, Expect = 1.1e-05, Identities = 44/184 (23%), Positives = 80/184 (43%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR           +    ++K    L VF EGTR    E   FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   +++ E+++ +M
  S:    79 ELRGKEHLGKDQACIIVANHQSSLDVLGMFHIWHVMNK-------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEGTRRNTGELHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNAGRIVITTLPPVSTEGLTKDDIDVLMERVRCQM 254
>gi|89093576|ref|ZP_01166524.1| probable acyltransferase [Oceanospirillum sp. MED92] >gi|89082266|gb|EAR61490.1| probable acyltransferase [Oceanospirillum sp. MED92] (245 aa)
Score = 128, Expect = 1.1e-05, Identities = 53/189 (28%), Positives = 88/189 (46%)
  Q:    14 LGF-PFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSL------TVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVV 202
           LGF P  + +  L L +S     R     +   +  + NY Y    K   C    V I+G +N+P   + + V NH+S ++ L +L+        RP++     V K E+ K    G+A  L++ I IDR   R  +      K+LL +G++ L       +F +GTR+   + G+F       A S    +VP++
  S:    18 LGFYPLTIVYASLCLIASPMLNFR-----QRFAMVTQINYFYIFWLKV--CCGVGVNIQGRENLPKEGAYVVVANHQSEWETL-FLQTLV-----RPQVT----VLKKELLKIPFFGWALGLLDPIAIDRSQRRGAL------KQLLTEGKKRLEDDIPVIIFPQGTRVPVGKMGKFNKGGAMLALSAGVPVVPMI 190
>gi|196194549|gb|EDX89508.1| Acyltransferase domain protein [Alcanivorax sp. DG881] (248 aa)
Score = 128, Expect = 1.1e-05, Identities = 37/143 (25%), Positives = 62/143 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV 209
           +V++ G  ++   +S + V NH S FD+ V               +D  +V K E+ K   +G   + +  +FI+R N    +    E +  L  G  S+  F EGTR +  +   FK  A   A      ++PV + GT  +
  S:    60 RVEVHGRHHLLPGQSYVIVANHLSQFDIFVLYGYLG---------VDFRWVMKHELRKIPVIGICCEKLGHVFINRDNTEAAIASLNEARARLANG-ASVLFFPEGTRSRDGQLKPFKKGAFKMAQDLHIPVLPVTLSGTFDI 192
>gi|91774823|ref|YP_544579.1| lyso-ornithine lipid acyltransferase [Methylobacillus flagellatus KT] >gi|91708810|gb|ABE48738.1| lyso-ornithine lipid acyltransferase [Methylobacillus flagellatus KT] (259 aa)
Score = 128, Expect = 1.2e-05, Identities = 41/136 (30%), Positives = 64/136 (47%)
  Q:    68 VKIKGSKNIPAN--KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           +++    +IP    +SVMFV NH S  D+     A   I+  R       F++K +I     +G+     NT+FIDR+  +D  R+ +   + +  G+  L  F EGT     E   FK + +  A  T   I PV+I
  S:    58 IQVIAKSHIPGEDVRSVMFVANHISWLDIY----ALNSIRTVR-------FIAKSDIRSWPVLGWLVAQANTLFIDREKKQDVSRMVETVAKSIMAGD-CLCYFPEGTTTDGTELRPFKGSLMQAAIDTNTAIRPVLI 183
>gi|171686990|ref|XP_001908436.1| unnamed protein product [Podospora anserina] >gi|170943456|emb|CAP69109.1| unnamed protein product [Podospora anserina] (305 aa)
Score = 128, Expect = 1.2e-05, Identities = 50/168 (29%), Positives = 78/168 (46%)
  Q:    64 TFTKVKIKGSKN-IPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           T  K  I+  KN +   +  +F+  H++  D+L+    F       P+    T  +K ++ K   +G+   L   +FIDR+N +D  +  Q   E + K +QS+ +F EGTR   K+     FK  A   A      IVPVV+     V    K  +FK   V  + L+PI
  S:    84 TGVKFDIEDPKNHLGTVRPAVFIGPHQTEVDLLMLGTMF-------PQYCSVT--AKTQLKKIPFLGWFMTLSGAVFIDRKNSKDARQAMQGAGEQITKRKQSVYMFPEGTRSYTKEPTMLPFKKGAFHLAVQAQVPIVPVVVANYSHV-YSLKDMVFKSGSVPCKVLDPI 244
>gi|157738325|ref|YP_001491009.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PlsC [Arcobacter butzleri RM4018] >gi|157700179|gb|ABV68339.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PlsC [Arcobacter butzleri RM4018] (228 aa)
Score = 128, Expect = 1.2e-05, Identities = 49/176 (27%), Positives = 82/176 (46%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLK 258
           M + NH+S  D++V     + I  +     D  +V+K EI+     G   K    I IDR+N    + +  E K+ L++G + + +F EGTR      GEFK  A   A     ++ PV+++ T  +    K+       V V +LEP++        ++L   KM+ + +A Y K
  S:    62 MIIINHQSLLDIIV----MEYIHSR-----DIAWVAKKEITDLFFFGHIIKAPRMISIDRENKAGLIHLLSETKDRLERG-RPIAMFPEGTRSDGTFIGEFKPGAKMVANKYNLRVQPVIMFNTRNIVNSQKAEAAP-GIVKVVYLEPVQASKETSWYEDL-EVKMRTRFDAEYKK 225
>gi|193213551|ref|YP_001999504.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobaculum parvum NCIB 8327] >gi|193087028|gb|ACF12304.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobaculum parvum NCIB 8327] (237 aa)
Score = 128, Expect = 1.3e-05, Identities = 41/139 (29%), Positives = 66/139 (47%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           V ++G +N   +K+ + V NH    D+ + L A K         L+  FV+K E+ K    G A K    +FI R   R+ ++   +  + L+ G +S+ +F EGTR K  +   FK  A   A      ++PV I G+
  S:    55 VTVEGEENYNPDKNYLVVSNHAGMADIPLILGAIK---------LNLRFVAKEELGKVPIFGHALKSGGYVFIKRGQNREALQSMLKAADTLKAG-RSIHIFPEGTRSKTGDILPFKRGAFIIAEKAKVPVLPVTIVGS 183
>gi|111022612|ref|YP_705584.1| phosphoserine phosphatase (PSP)/ 1-acylglycerol-3-phosphate O-acyltransferase (PlsC) [Rhodococcus sp. RHA1] >gi|110822142|gb|ABG97426.1| probable phosphoserine phosphatase (Psp)/ probable 1-acylglycerol-3-phosphate O-acyltransferase (PlsC) [Rhodococcus sp. RHA1] (479 aa)
Score = 128, Expect = 1.4e-05, Identities = 46/164 (28%), Positives = 72/164 (43%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           V+IKG +N  + +  +F+ NH+S+ D+LV     +          D T V+K E ++  R      L++  +IDR +        +   E LQ G  S+ +  EGTR      G+FK      A      IVP+VI+   G      S +     V V+ L P+
  S:   297 VRIKGKENAWSARPAVFMFNHQSSLDMLVIGSVIRR---------DVTGVAKKEAARDPRFIPVGALLDVAYIDRADSTKARAALRPAVEKLQSG-VSIAIAPEGTRSPTPRLGKFKKGGFHLAMQAGVPIVPIVIHNA-GERMWRNSLVAHPGTVDVDVLAPV 449
>gi|15594383|ref|NP_212171.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi B31] >gi|167933666|ref|ZP_02520741.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi ZS7] >gi|195960648|ref|ZP_03096853.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi 64b] >gi|3914378|sp|Q59188|PLSC_BORBU 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) >gi|2687908|gb|AAC66417.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi B31] (250 aa)
Score = 128, Expect = 1.4e-05, Identities = 35/140 (25%), Positives = 73/140 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +V+ + NH +  D L+++  F       P ++    ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    67 KIIVTGSENIPKKSNVIIMGNHIAAMDPLIFIYTFAC-----PFVI----LAKHSLLRIPFVNIVLIVMGVIFVNRRSIRSAAAAEVKAIKVMREG-RSIGIFPEGTRNRGGDTRVFKKGSIKMALKTGTSILPVTLYNT 196
>gi|195958731|ref|ZP_03094940.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia sp. SV1] (250 aa)
Score = 127, Expect = 1.4e-05, Identities = 35/140 (25%), Positives = 72/140 (51%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +V+ + NH +  D L+++  F       P ++    ++K  + +   V     ++  IF++R+++R          +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    67 KIIVTGSENIPKKSNVIIMGNHIAAMDPLIFIYTFAC-----PFVI----LAKHSLLRIPFVNIVLIVMGVIFVNRRSIRSAASAEVRAIKVMREG-RSIGIFPEGTRNRGGDTRVFKKGSIKMALKTGTSILPVTLYNT 196
>gi|71024687|ref|XP_762573.1| hypothetical protein UM06426.1 [Ustilago maydis 521] >gi|46101966|gb|EAK87199.1| hypothetical protein UM06426.1 [Ustilago maydis 521] (343 aa)
Score = 127, Expect = 1.4e-05, Identities = 45/183 (24%), Positives = 83/183 (45%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           ++G ++  A +  + V NH++  D+L   + F           + + ++K E+     +G    L   +FI+R+NL+D ++  Q+  E +   + SL +F EGTR  +   +   FK  A   A      +VPVV   Y  L   +      F+   + ++ L PI  K         ++EK++  M
  S:    88 VEGEEHFQAARPAVVVGNHQTAMDILYLGRIFPG---------NASIMAKKELQFAPLLGQFMSLSGAVFINRKNLKDSIKAFQQVGETMNNKKLSLWIFPEGTRSGLATPDLLPFKKGAFHLAIQAGVPVVPVVCENYNRLFDSRSR----FESGTIRIKVLAPIPTKHLTAADANELTEKVRQLM 261
>gi|195041643|ref|XP_001991292.1| GH12135 [Drosophila grimshawi] >gi|193901050|gb|EDV99916.1| GH12135 [Drosophila grimshawi] (324 aa)
Score = 127, Expect = 1.5e-05, Identities = 45/184 (24%), Positives = 79/184 (42%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR           E    ++K    L VF EGTR    E   FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   + + E ++++M
  S:    79 ELRGKEHLEKDQACIIVANHQSSLDVLGMFNIWHVMNK-------CTVVAKRELFYVWPFGLAAWLAGLIFIDRVRGEKARETLNEVNRRIKKQRIKLWVFPEGTRRNTGELHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNAGRIVITTLPPVSTEGLTKDDIDTLMENVRSQM 254
>gi|111114860|ref|YP_709478.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Borrelia afzelii PKo] >gi|110890134|gb|ABH01302.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Borrelia afzelii PKo] (245 aa)
Score = 127, Expect = 1.7e-05, Identities = 34/140 (24%), Positives = 73/140 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +++ + NH +  D L+++  F          ++P   ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    62 KIIVTGSENIPQKSNIIIMGNHIAAMDPLIFIYTF----------VNPFVILAKHSLLRVPFVNLVLIVMGAIFVNRKSIRSAAAAEAKAIKVMREG-RSIGIFPEGTRNRGGDTKVFKKGSVKMALKTGTSILPVTLYNT 191
>gi|167942789|ref|ZP_02529863.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Borrelia afzelii ACA-1] (245 aa)
Score = 127, Expect = 1.7e-05, Identities = 34/140 (24%), Positives = 73/140 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +++ + NH +  D L+++  F          ++P   ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    62 KIIVTGSENIPQKSNIIIMGNHIAAMDPLIFIYTF----------VNPFVILAKHSLLRVPFVNLVLIVMGAIFVNRKSIRSAAAAEAKAIKVMREG-RSIGIFPEGTRNRGGDTKVFKKGSVKMALKTGTSILPVTLYNT 191
>gi|189462589|ref|ZP_03011374.1| hypothetical protein BACCOP_03279 [Bacteroides coprocola DSM 17136] >gi|189430750|gb|EDU99734.1| hypothetical protein BACCOP_03279 [Bacteroides coprocola DSM 17136] (251 aa)
Score = 127, Expect = 1.7e-05, Identities = 46/170 (27%), Positives = 75/170 (44%)
  Q:    62 FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDV-LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           F     VK+KG +++    S +FV NH+ +FD+ LVY    +  K          ++ K  + K   VG A +    IF+D+ + R      +  +++LQ G  SL VF EG R        FK  A   A      ++P+ I G+  +       +  +  +T+   EPI
  S:    54 FLFLLPVKVKGHEHLDKKTSYVFVANHQGSFDIFLVYGFLGRNFK----------WMMKKSLRKLPFVGKACESAGFIFVDKSSPRKVYETIKSAEKVLQGG-TSLVVFPEGARTFTGHMANFKKGAFLLADQLQLPVIPLTIDGSFDI-LPRTGKLLHWHPMTLTIHEPI 212
>gi|134093650|ref|YP_001098725.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Herminiimonas arsenicoxydans] >gi|133737553|emb|CAL60596.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Herminiimonas arsenicoxydans] (250 aa)
Score = 127, Expect = 1.7e-05, Identities = 54/187 (28%), Positives = 89/187 (47%)
  Q:    17 PFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           P C  FL   L  +K+ Y           +T R N V+ +    V C   + +IKG +N+P ++ V+ +  H+S ++ +     F + K  RP +    FV K E+      G+A  L+  I IDR + +D F +V  + ++ L  G Q + +F EGTRI   + G +K      A  T   +VP+ +
  S:    26 PIC--FLAAPLPYNKRYY-----------ITSRWN-VFIIWLAKVLCGI-RYQIKGYENLP-DQPVILLSKHQSAWETI-----FLLCKMTRPLV----FVFKKELLYVPFFGWALGLLRMIPIDRSSGKDAFAQVITQGRKRLADG-QWIIMFPEGTRIPVGQTGRYKGGGARLAVETNTVVVPIAL 187
>gi|195962601|ref|ZP_03098806.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Borrelia spielmanii A14S] (245 aa)
Score = 126, Expect = 1.8e-05, Identities = 34/140 (24%), Positives = 73/140 (52%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + GS+NIP   +++ + NH +  D L+++  F          ++P   ++K  + +   V     ++  IF++R+++R       +  +++++G +++ +F EGTR +  +   FK  A+  A  T   I+PV +Y T
  S:    62 KIIVTGSENIPKKSNIIIMGNHIAAMDPLIFIYTF----------VNPFVILAKHSLLRVPFVNLILIVMGAIFVNRRSIRSAAAAEAKAIKVMREG-RTIGIFPEGTRNRGGDTKVFKKGAIKMALKTGTPILPVTLYNT 191
>gi|169783908|ref|XP_001826416.1| hypothetical protein [Aspergillus oryzae RIB40] >gi|83775160|dbj|BAE65283.1| unnamed protein product [Aspergillus oryzae] (292 aa)
Score = 126, Expect = 1.8e-05, Identities = 50/192 (26%), Positives = 86/192 (44%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVS---KIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNI-------FKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           ++G +++ + +  +F+ NH+S  DVL+    F            P + S   K  +     +G+   L  T+FIDR N +  V+      E ++   QS+ +F EGTR   D+ G   FK  A   A      IVPVV         E+ S++       F    + V+ L PI  +       + +++  +  M    L++ E
  S:    90 VEGQEHL-STRPAVFIGNHQSELDVLMLGSIF------------PPYCSVTAKKSLRHVPFLGWFMSLSRTVFIDRANRQTAVKAFDSAAEEMRNHRQSVFIFPEGTRSYSDKPGLLPFKKGAFHLAVKAGVPIVPVV--------SENYSHVLSPRNWRFNAGSIQVKVLPPISTEGLTAADVDALTQSARESMLKTLLEMSE 272
>gi|86134123|ref|ZP_01052705.1| possible transmembrane phospholipid biosynthesis bifunctionnal enzyme PlsC: putative l-3-phosphoserine phosphatase [Tenacibaculum sp. MED152] >gi|85820986|gb|EAQ42133.1| possible transmembrane phospholipid biosynthesis bifunctionnal enzyme PlsC: putative l-3-phosphoserine phosphatase [Polaribacter dokdonensis MED152] (1079 aa)
Score = 126, Expect = 1.9e-05, Identities = 49/182 (26%), Positives = 80/182 (43%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMK 249
           + +K   N+  ++  +F  NH+S+ D  V LK  +          D T ++K E+  T   G   K +  IFIDR N +  +   +    +L+ G  S+ +  EGTR    + G FK  A   A      IVP+VI     +     SNIF    + V  L+P+   ++     E   E+++
  S:   901 INVKNKHNLEDHRPAVFCFNHQSSADFFVILKLLQK---------DVTGIAKKELEFTP-FGPIFKAMGAIFIDRSNKKKALASMKNAANVLKNG-TSVAIAPEGTRSGSKKLGAFKKGAFHLAMKAGVPIVPIVIKNAY-MAMPKGSNIFSPTHIEVVVLDPVDTAEWKPKHIETYIEEVR 1070
>gi|118465016|ref|YP_879497.1| acyltransferase family protein [Mycobacterium avium 104] >gi|118166303|gb|ABK67200.1| acyltransferase family protein [Mycobacterium avium 104] (259 aa)
Score = 126, Expect = 2.1e-05, Identities = 52/200 (26%), Positives = 90/200 (45%)
  Q:    56 LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           LA  AV  T T++   G +NIP     +   NH S  D   +L A   +  +   +    F+ K E+ + K V F  K   TI +DR        V  +    L++GE  + V+ E T  +  E  EFK+ A   A      I+P++++G   +  K+H   + + K  +TV+   P++ ++ I  +   + + M   +  A
  S:    12 LAVLAVKATGTEITYHGEENIPERGGAVVAINHTSYVD---FLPAGLAVHRRGRRL---RFMIKAEMQQVKVVNFLIKHTRTIPVDRGAGAGAYAVAVQR---LREGEL-VGVYPEATISRSFELKEFKTGAARMAIDADVPIIPLIVWGAHRIWTKDHPRTLGRAKIPITVQVGAPLRAREDIAQTDAALRDAMTTLLHQA 203
>gi|163765397|ref|ZP_02172430.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter sp. K] >gi|196170534|gb|ACG71507.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter sp. K] (244 aa)
Score = 126, Expect = 2.3e-05, Identities = 40/165 (24%), Positives = 71/165 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           + ++ G + +P N + + V NH S  D+LV    F+  K          +VSK E+ +   VG+   L + + + R +     R+    +  L +G   + +F EGTR +      FK  A   A      ++P+ + GT     +H   + +     V  L+PI
  S:    60 RARVVGREKLPWNGAAVLVANHLSMLDILVLYGLFRPFK----------WVSKAELFRVPFVGWNMWLNDCVPVWRGDRESVRRMMAHCRAHLARG-APVMIFPEGTRSQDGRLQAFKDGAFRLAVDANVPVIPIAVSGTSEALPKHGLVLRQRMRAEVRVLDPI 213
>gi|31793662|ref|NP_856155.1| bifunctionnal putative L-3-phosphoserine phosphatase/1-acyl-SN-glycerol-3-phosphate acyltransferase [Mycobacterium bovis AF2122/97] >gi|121638364|ref|YP_978588.1| putative transmembrane phospholipid biosynthesis bifunctionnal enzyme plsC: putative l-3-phosphoserine phosphatase + 1-acyl-SN-glycerol-3-phosphate acyltransferase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|31619255|emb|CAD97369.1| POSSIBLE TRANSMEMBRANE PHOSPHOLIPID BIOSYNTHESIS BIFUNCTIONNAL ENZYME PLSC: PUTATIVE L-3-PHOSPHOSERINE PHOSPHATASE (O-PHOSPHOSERINE PHOSPHOHYDROLASE) (PSP) (PSPASE) + 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE (1-AGP ACYLTRANSFERASE) (1-AGPAT) (LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE) (LPAAT) [Mycobacterium bovis AF2122/97] >gi|121494012|emb|CAL72489.1| Possible transmembrane phospholipid biosynthesis bifunctionnal enzyme plsC: putative l-3-phosphoserine phosphatase + 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE [Mycobacterium bovis BCG str. Pasteur 1173P2] (580 aa)
Score = 125, Expect = 2.5e-05, Identities = 47/186 (25%), Positives = 83/186 (44%)
  Q:    51 NYVYSLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           N+  S  S+ +  T    + + G +N+ A +  +F+ NH++  D ++   A  ++++      +   V K E++    +G   KL++ +FIDR +    V      +E  + G  S+ +  EGTR+   E G FK      A +    IVP+VI     V   + + I     V V    PI   D+
  S:   295 NFFTSTFSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVI---AGALVRD------NWVGVGKKELASDPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNG-LSIVIAPEGTRLDTTEVGSFKKGPFRIAMAAKIPIVPIVIRNAEIVASRNSTTI-NPGTVDVAVFPPIPVDDW 470
>gi|15609620|ref|NP_216999.1| bifunctionnal putative L-3-phosphoserine phosphatase/1-acyl-SN-glycerol-3-phosphate acyltransferase [Mycobacterium tuberculosis H37Rv] >gi|15842009|ref|NP_337046.1| acyltransferase family protein [Mycobacterium tuberculosis CDC1551] >gi|148662318|ref|YP_001283841.1| bifunctional transmembrane phospholipid biosynthesis enzyme PlsC [Mycobacterium tuberculosis H37Ra] >gi|148823679|ref|YP_001288433.1| bifunctionnal transmembrane phospholipid biosynthesis enzyme plsC: L-3-phosphoserine phosphatase + 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium tuberculosis F11] >gi|167967086|ref|ZP_02549363.1| bifunctionnal transmembrane phospholipid biosynthesis enzyme plsC: L-3-phosphoserine phosphatase + [Mycobacterium tuberculosis H37Ra] >gi|194544667|ref|YP_002079696.1| transmembrane phospholipid biosynthesis bifunctionnal enzyme plsC : L-3-phosphoserine phosphatase + 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium tuberculosis C] >gi|2791523|emb|CAA16060.1| POSSIBLE TRANSMEMBRANE PHOSPHOLIPID BIOSYNTHESIS BIFUNCTIONNAL ENZYME PLSC: PUTATIVE L-3-PHOSPHOSERINE PHOSPHATASE (O-PHOSPHOSERINE PHOSPHOHYDROLASE) (PSP) (PSPASE) + 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE (1-AGP ACYLTRANSFERASE) (1-AGPAT) (LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE) (LPAAT) [Mycobacterium tuberculosis H37Rv] >gi|13882285|gb|AAK46860.1| acyltransferase family protein [Mycobacterium tuberculosis CDC1551] >gi|124601674|gb|EAY60684.1| transmembrane phospholipid biosynthesis bifunctionnal enzyme plsC : L-3-phosphoserine phosphatase + 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium tuberculosis C] >gi|134150769|gb|EBA42814.1| transmembrane phospholipid biosynthesis bifunctionnal enzyme plsC : L-3-phosphoserine phosphatase + 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium tuberculosis str. Haarlem] >gi|148506470|gb|ABQ74279.1| bifunctional transmembrane phospholipid biosynthesis enzyme PlsC [Mycobacterium tuberculosis H37Ra] >gi|148722206|gb|ABR06831.1| bifunctionnal transmembrane phospholipid biosynthesis enzyme plsC: L-3-phosphoserine phosphatase + 1-acyl-sn-glycerol-3-phosphate acyltransferase [Mycobacterium tuberculosis F11] (580 aa)
Score = 125, Expect = 2.5e-05, Identities = 47/186 (25%), Positives = 83/186 (44%)
  Q:    51 NYVYSLASKAVFCTF-TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           N+  S  S+ +  T    + + G +N+ A +  +F+ NH++  D ++   A  ++++      +   V K E++    +G   KL++ +FIDR +    V      +E  + G  S+ +  EGTR+   E G FK      A +    IVP+VI     V   + + I     V V    PI   D+
  S:   295 NFFTSTFSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVI---AGALVRD------NWVGVGKKELASDPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNG-LSIVIAPEGTRLDTTEVGSFKKGPFRIAMAAKIPIVPIVIRNAEIVASRNSTTI-NPGTVDVAVFPPIPVDDW 470
>gi|189485665|ref|YP_001956606.1| 1-acylglycerol-3-phosphate O-acyltransferase [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287624|dbj|BAG14145.1| 1-acylglycerol-3-phosphate O-acyltransferase [uncultured Termite group 1 bacterium phylotype Rs-D17] (180 aa)
Score = 125, Expect = 2.6e-05, Identities = 52/186 (27%), Positives = 88/186 (47%)
  Q:    59 KAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIK------YKDYIQTSKELV 244
           + +F  F +  I+G++NIP +   +  PNH   FD  +   A      KRP      F++K E+      G+  K  N   + R  ++D   V +    LL+ G   L VF EGTR K    G+ ++ A   A +T   ++P  I        E+ + + K+K++ ++F +P+         DYI  SK ++
  S:     3 RIMFSLFYRWHIEGAENIPQSGGAVIAPNHIGFFDSTLTGSAI-----KRP----VHFMAKKELFDIPGFGWIIKQTNAFPVKR-GMQDISAV-RNAFSLLKSG-CLLLVFPEGTRSKDGRIGKARAGAGMIACNTQVPLIPAKI--------ENTNMMLKFKQIKIKFGKPVYPPKDFVKNDYINLSKRVL 174
>gi|148977759|ref|ZP_01814315.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrionales bacterium SWAT-3] >gi|145962973|gb|EDK28243.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrionales bacterium SWAT-3] (241 aa)
Score = 125, Expect = 2.7e-05, Identities = 48/171 (28%), Positives = 77/171 (45%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY----IQTSKELVSEKMKAKME 253
           ++V NH++N+D+      F +     P+++    V K  ++     G    L   I IDR N         +  + L+  + S+ +F EGTR +      FK+ A   A      I+P+V   T GV    K N +    V VE L+PI  + Y    ++    L  E+M AK+E
  S:    68 VYVANHQNNWDL------FTVSSAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANRSKAFGTIDQVVDNLKDSDVSVWMFPEGTRSRGRGLLPFKTGAFHAAIGAGLPIIPIVCSSTGGV----KLNRWNNGHVIVEMLDPINTEGYDKSNVRELANLTREQMAAKLE 229
>gi|163725631|ref|ZP_02133152.1| phospholipid/glycerol acyltransferase [Desulfatibacillum alkenivorans AK-01] >gi|161401067|gb|EDQ25314.1| phospholipid/glycerol acyltransferase [Desulfatibacillum alkenivorans AK-01] (247 aa)
Score = 125, Expect = 2.7e-05, Identities = 49/186 (26%), Positives = 78/186 (41%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           KV   G + I   K+ +   NH+S  D+LV    F   K          +VSK EI K   +G+   L   I + R + RD +R   E  E       S+  F EGTR    +   FK  A   A      I+P+ + GT     ++  N     E+ V  L+ I Y+++       ++E ++ ++
  S:    61 KVHFLGKEKINPKKTYVVTSNHQSQLDILVCFGLFFHFK----------WVSKAEIFKVPLIGWNMVLNRYIKLIRGD-RDSIRQMMEACEERLGEGSSVFFFPEGTRSATGKVKAFKPGAFVLAKKMKLPILPIAVRGTTHALPKNSMNFHGSHEIFVTVLDEIPYEEFKDMEDGELAEMVRRRI 235
>gi|116618302|ref|YP_818673.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097149|gb|ABJ62300.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (212 aa)
Score = 125, Expect = 2.8e-05, Identities = 57/215 (26%), Positives = 100/215 (46%)
  Q:    51 NYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNL-RDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY--LKIKEDPNW 265
           +++  +A   ++    ++K      IP N + + V  H++ +D + Y  A        P+     F++KIE+ K K + +  K      +DR+N+    +++   E   L+ G++SL +F  G+R   D     KS ++  A      IVP V  G +       S +FK    TV F EPI      + +KE ++ K   +M+AA+  L  + DP W
  S:     5 DFLRGIAVALIWAVTGRIKYMNRDRIPQNDNYVLVGPHRTWWDPVWYAVA------AYPKHF--IFMAKIELFKFKPLAWLIKSAGAFPVDRENVGPSVIKIPVRE---LKDGKRSLIMFPSGSRHSDD----LKSGSILIARMAGKAIVPAVYQGPVKF-----SQLFKRNNTTVNFGEPIIIDRKDRLNKENIA-KYTEQMQAAFQELDAEIDPTW 201
>gi|189499274|ref|YP_001958744.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium phaeobacteroides BS1] >gi|189494715|gb|ACE03263.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium phaeobacteroides BS1] (236 aa)
Score = 125, Expect = 2.8e-05, Identities = 50/192 (26%), Positives = 84/192 (43%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI 259
           V+I G +N   N + + + NH    D+ + L +           L+  FV+K E+ K    G+A K    + I R   R+ ++      E+L+ G +S+ +F EGTR +  +   FK  A   A      I+PV I G+  +  +    I K + V +   EPI+ +           +K +   +AAY  I
  S:    55 VEITGGENYDPNSNYLIMSNHAGMADIPLILGSIH---------LNMRFVAKEELGKIPIFGWAIKRGGYVLIKRGQNREALKSLLMASEVLKTG-RSVHIFPEGTRSETGKILPFKRGAFMIAQKAHAPILPVTIIGSNRITPKKSLRIRKSR-VQIIISEPIEAR----------GKKAQELQDAAYTAI 225
>gi|170036021|ref|XP_001845864.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Culex quinquefasciatus] >gi|167878555|gb|EDS41938.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Culex quinquefasciatus] (273 aa)
Score = 125, Expect = 3.0e-05, Identities = 64/249 (25%), Positives = 109/249 (43%)
  Q:    14 LGFPFCVFFLWLSLRSSKKKYKRW----------QEDPELLGLTERQNYVYSLASKAVFCTFTKV-----KIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEH----KSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           LG  F  FF+ ++L S+ + Y ++             P  L L   ++Y  +L    +   F K      +++G +N+      + + NH+S  D  VL YL          P +   T V+K E+      G A+ L  T+FIDR+N         +E + + + +  +  F EGTR + D    FK  +   A  +   + PVVI       K H    K+ IF      +  L  I      +     + +++   M+A Y  + E+
  S:     9 LGLAFMAFFI-ITLSSTARYYFKFFCFVVLSVVCAVGPVPLMLLRPRDYRNALLPAYLCTKFGKALGASFEVRGKENVNRQHGGVVLMNHQSALDLVVLAYL---------WPIVGRATVVAKREVLYMFPFGLASWLWGTLFIDRRNQSSAKTAINKESKAINEKQAKILFFPEGTRGEGDNLLPFKKGSFHVAIESQGIVQPVVI------SKYHFLNSKAKIFNRGHNIIHILPEISCAGMTKEDIPALMDRVHDLMQAEYEALSEE 262
>gi|149495147|ref|XP_001518709.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha) [Ornithorhynchus anatinus] (326 aa)
Score = 124, Expect = 3.2e-05, Identities = 46/162 (28%), Positives = 71/162 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFL 228
           +++++GS N P ++  + V NH+S+ D+L  ++         P    P  ++  E+      G A  L   IFI R+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   E  VE L
  S:   147 RLEVRGSDNFPPSQPYVVVSNHQSSLDLLGMMEVL-------PGRCVP--IAMRELLWAGPAGLACWLAGVIFIHRKRTGDAISVMAEAAQTLLSEDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYRDFYSKKERR---FTTGERRVELL 298
>gi|118102824|ref|XP_418063.2| PREDICTED: similar to MGC82195 protein [Gallus gallus] (458 aa)
Score = 124, Expect = 3.3e-05, Identities = 37/137 (27%), Positives = 66/137 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           K+K+ G++++   +  + V NH+++ D++  ++         P+   P  ++K E+     VG+A  L   IFIDRQ   D + V  +  + +Q+    + +F EGTR +      FK  A   A      I P+VI
  S:    77 KIKVLGAEHLNLKEPYVIVCNHQASLDLMGMVEVI-------PKRCVP--IAKKELLYMGTVGWACWLSGMIFIDRQRTGDAIDVISQTAKTIQRENLQVWIFPEGTRNQSRSMLPFKRGAFHLAVQAQVPIFPIVI 204
>gi|170017345|ref|YP_001728264.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Leuconostoc citreum KM20] >gi|169804202|gb|ACA82820.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Leuconostoc citreum KM20] (211 aa)
Score = 124, Expect = 3.5e-05, Identities = 58/215 (26%), Positives = 99/215 (46%)
  Q:    51 NYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY--LKIKEDPNW 265
           +++  +A   V+    ++K      IP + + + V  H++ +D + Y  A       +P I    F++KIE+ K K + +  K      +DR N+   V +    +E L+ G +SL +F  G+R   D     KS  L  A  +   IVP V  G +         +FK    T+ F EPI      + +KE ++ K   K++AA+  L  + +PNW
  S:     5 DFLRIIAVGIVWAVTGRIKYMNKDRIPTDDNYILVGPHRTWWDPVWYAIA----AYPKPFI----FMAKIELFKFKPLAWLIKSAGAFPVDRNNVGPSV-IKTPVRE-LKSGNRSLIMFPSGSRHSDD----LKSGTLVIAKMSGKAIVPAVYQGPVTF-----GQLFKRNNTTINFGEPIVIDRKDKLNKENIT-KYTVKIQAAFDQLDAEVNPNW 201
>gi|152998238|ref|YP_001343073.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Marinomonas sp. MWYL1] >gi|150839162|gb|ABR73138.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Marinomonas sp. MWYL1] (250 aa)
Score = 124, Expect = 3.7e-05, Identities = 44/142 (30%), Positives = 67/142 (47%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVV 202
           +FC   KV+I G +NI  N+ V+ V NH+S ++  V       +          + V K E+      G+  +++  I IDR Q      ++  + KE L  G +S+ +F EGTRI  +E   F   A   A S    I+PVV
  S:    60 IFCG-VKVEIIGLENINKNRPVVLVANHQSEWETYVLQVLMAPV----------STVLKKELLSVPFFGWGLRMVQPIAIDRSQRTNALKQIISQGKERLDDG-RSVLIFPEGTRIAPNEEQAFNKGAAMLATSAGVPILPVV 190
>gi|23956162|ref|NP_080488.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 [Mus musculus] >gi|68052744|sp|Q8K3K7|PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (1-AGP acyltransferase 2) (1-AGPAT 2) (Lysophosphatidic acid acyltransferase beta) (LPAAT-beta) (1-acylglycerol-3-phosphate O-acyltransferase 2) >gi|21309661|gb|AAL62337.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 [Mus musculus] >gi|116138899|gb|AAI25531.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Mus musculus] >gi|122890034|emb|CAM14400.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Mus musculus] >gi|148676377|gb|EDL08324.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), isoform CRA_a [Mus musculus] >gi|187953711|gb|AAI37841.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Mus musculus] (278 aa)
Score = 124, Expect = 3.7e-05, Identities = 49/212 (23%), Positives = 86/212 (40%)
  Q:    52 YVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           YVY L          + ++ G K +  +   + + NH+S  D++  ++    I  KR        ++K E+  T  VG    L    FI+RQ  R  + V  +  +L+ K    + ++ EGTR    +   FK  A   A      I+PVV Y +       K+ +F    + V+ L+ +            + +     M A +L+I + P
  S:    72 YVYGL----------RFEVSGQKKLEVDGPCVIISNHQSILDMMGLME----ILPKRC-----VQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVV-YSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIP 263
>gi|153892110|ref|ZP_02013058.1| phospholipid/glycerol acyltransferase [Opitutaceae bacterium TAV2] >gi|151581818|gb|EDN45423.1| phospholipid/glycerol acyltransferase [Opitutaceae bacterium TAV2] (278 aa)
Score = 124, Expect = 3.8e-05, Identities = 38/119 (31%), Positives = 56/119 (47%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           + V NH    D+LV       +   RP I    FV+K E+     +G+ A +  T+F+DR    D  RV +E  E L  G  S+ VF+EGT         FK++ L PA      ++P+
  S:    72 LMVCNHLGYLDILV-------LAADRPVI----FVAKSEVRGWPVLGWLAGMAGTLFVDRARRGDVARVAEEMTEALAGG-VSVAVFLEGTSSDGSRVLSFKTSLLEPAIRRRWLVLPM 178
>gi|27364135|ref|NP_759663.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio vulnificus CMCP6] >gi|27360253|gb|AAO09190.1|AE016799_88 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio vulnificus CMCP6] (241 aa)
Score = 124, Expect = 3.8e-05, Identities = 48/178 (26%), Positives = 81/178 (45%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKY----KDYIQTSKELVSEKMKAKMEAAYLKIK 260
           +++ NH++N+D+      F +     P+++    V K  ++     G    L   I IDR N         +    ++  E S+ +F EGTR +      FK+ A   A      I+P+V   T     + K N +    V VE L+PI      K++I+   E+   KMKAK+E+   ++K
  S:    68 IYIANHQNNWDL------FTVSAAVTPKVVT---VGKKSLAWLPLFGQLYWLTGNILIDRANKTKAKGTIDQVVASMKASEVSVWMFPEGTRSRGRGLMPFKTGAFHAAIGAGVPIIPIVCSST----DQLKLNRWNNGHVIVEMLDPISTEGYGKEHIRELAEICRAKMKAKLESLDEEVK 236
>gi|78187830|ref|YP_375873.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Pelodictyon luteolum DSM 273] >gi|78167732|gb|ABB24830.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Pelodictyon luteolum DSM 273] (231 aa)
Score = 124, Expect = 3.8e-05, Identities = 45/181 (24%), Positives = 87/181 (48%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY------IQTSKELVSEKM 248
           V+++G +N  A  S + V NH    D+ + L + K         L+  FV+K E+ +    G+A K    + I R   R+ ++      E+++ G +S+ +F EGTR    +   FK  A   A     +++PV I G+  +  +    I + K V +   +P++  D+      +Q S++ ++  +
  S:    55 VEVEGEENYRAGGSYLVVSNHAGMADIPLLLGSMK---------LNLRFVAKEELGRIPVFGWALKNGGYVMIKRGQNREALKSLLAASEVIKSG-RSVHIFPEGTRSATGKLLPFKRGAFLVAEKAKAEVLPVTIIGSHIITPKKSLAIHRGK-VRLIIGKPLRTTDFPNVETLMQASRDAIAANL 230
>gi|154173980|ref|YP_001408302.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Campylobacter curvus 525.92] >gi|153793032|gb|EAU00545.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Campylobacter curvus 525.92] (225 aa)
Score = 123, Expect = 4.1e-05, Identities = 59/252 (23%), Positives = 110/252 (43%)
  Q:     2 KAKKFLFKLGHSLGFPFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           K K   F +   +     + F+WL  + +++  + W +   L G                   F  +K+ G     AN   M + NH+S  D++V       ++E  P+ L   +++K +I     +G   KL   I ++R+N    V++ ++ ++ +  G + L +F EGTR +      FK  A   A     ++ P+V+ G+  ++ ++ S  FK  E+ V  L      D + TS +   E  +AKM+
  S:     5 KIKAVYFAVEFIISVILVIIFMWLFPKKNRRIRQIWAKSQRLFG-------------------FYSIKVTGEFRDEAN---MILINHQSMLDIVV-------LEEIHPKNL--CWIAKKQIDDLPIIGNIIKLPKMISVERENKHSLVKLVKDAEDRVNNG-RVLAIFPEGTRSQTHTLLPFKGGAKIVANKLNLKVQPIVLVGSDIMDVKNFS--FKNGEIKVFCL------DLVDTSDKDWLENTRAKMQ 216
>gi|110834778|ref|YP_693637.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Alcanivorax borkumensis SK2] >gi|110647889|emb|CAL17365.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Alcanivorax borkumensis SK2] (249 aa)
Score = 123, Expect = 4.2e-05, Identities = 36/143 (25%), Positives = 63/143 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV 209
           +V++ G  ++   +S + V NH S FD+ V               +D  +V K E+ K   +G  ++ +  IFI+R +    V      +  L  G  S+  F EGTR +  +   FK  A   A +    ++P+ + GT  +
  S:    61 RVEVDGRHHLQPGQSYVIVANHLSQFDIFVLYGYLG---------IDFRWVMKHELRKVPIIGICSEKLGHIFINRSDTEAAVASLNNARARLANG-ASVLFFPEGTRSRDGQLKPFKKGAFKMAQALQLPVLPITLSGTFDI 193
>gi|24641612|ref|NP_572828.1| CG3812 CG3812-PA, isoform A [Drosophila melanogaster] >gi|24641614|ref|NP_727641.1| CG3812 CG3812-PB, isoform B [Drosophila melanogaster] >gi|7292807|gb|AAF48201.1| CG3812-PA, isoform A [Drosophila melanogaster] >gi|21428594|gb|AAM49957.1| LD44987p [Drosophila melanogaster] >gi|22832162|gb|AAN09316.1| CG3812-PB, isoform B [Drosophila melanogaster] (343 aa)
Score = 123, Expect = 4.3e-05, Identities = 43/184 (23%), Positives = 80/184 (43%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR           +    ++K    L VF EGTR        FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   +++ E+++++M
  S:    82 ELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNK-------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEGTRRNTGALHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNSGRIVITTLPPVSTEGLTKDDIDVLMERVRSQM 257
>gi|151572833|gb|EDN38487.1| acetyltransferase protein [Francisella tularensis subsp. novicida GA99-3548] (246 aa)
Score = 123, Expect = 4.4e-05, Identities = 40/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP N   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-NYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|134301187|ref|YP_001121155.1| acetyltransferase protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|187930968|ref|YP_001890952.1| acyltransferase [Francisella tularensis subsp. mediasiatica FSC147] >gi|134048964|gb|ABO46035.1| acetyltransferase protein [Francisella tularensis subsp. tularensis WY96-3418] >gi|151569618|gb|EDN35272.1| hypothetical protein FTBG_01434 [Francisella tularensis subsp. tularensis FSC033] >gi|187711877|gb|ACD30174.1| acyltransferase [Francisella tularensis subsp. mediasiatica FSC147] (246 aa)
Score = 123, Expect = 4.6e-05, Identities = 40/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP N   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-NYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|188532596|ref|YP_001906393.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Erwinia tasmaniensis] >gi|188027638|emb|CAO95488.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Erwinia tasmaniensis] (245 aa)
Score = 123, Expect = 4.7e-05, Identities = 52/186 (27%), Positives = 85/186 (45%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVS--KIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYI-QTSKELVS---EKMKAKMEA 254
           K  G++N P   + +++ NH++NFD++               I+ PT V+  K  +      G    L   + IDR+N         E     +K + S  +F EGTR +      FK+ A   A +    I+PVV+  T G   + K N  K     VE L P+  + +  Q+ ++L +   E M AK++A
  S:    57 KPAGAENYP---NAIYICNHQNNFDMVT-----------AAAIVQPTTVTVGKTSLLWVPFFGLLYWLTGNLLIDRENRTKAHGTIGELVAQFKKKKISFWMFPEGTRSRGRGLLPFKTGAFHAAVAAGVPIIPVVVSNTHG---KIKLNRLKNGLAIVEMLPPVDTQAFADQSVRKLATHCRELMSAKLDA 231
>gi|164688253|ref|ZP_02212281.1| hypothetical protein CLOBAR_01898 [Clostridium bartlettii DSM 16795] >gi|164602666|gb|EDQ96131.1| hypothetical protein CLOBAR_01898 [Clostridium bartlettii DSM 16795] (196 aa)
Score = 123, Expect = 4.7e-05, Identities = 53/183 (28%), Positives = 88/183 (48%)
  Q:    64 TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN--LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSE 246
           TF K ++ G++NIP+  +++   NHKSN D +    A   + +KR      T ++K E+ K K +      +  I I+RQN  L    R+ +       K + +L +F EGTR K D+F   K+     A     +IVP  IY +  +          +K   + F +PI  ++Y +  ++L SE
  S:    11 TFFKFEVIGTENIPSEGNLIIAANHKSNLDPIFVASA---VDKKRKM----TAIAKEELFKNKILAKILNKVEIIPINRQNPGLGTIKRILK-----YIKNDYALVMFPEGTRSKTDDFNNAKAGLSLFATKAKAEIVPCTIYSSYKL----------FKPAKIYFGKPISLEEYYK--QKLTSE 171
>gi|120437534|ref|YP_863220.1| phospholipid/glycerol acyltransferase [Gramella forsetii KT0803] >gi|117579684|emb|CAL68153.1| phospholipid/glycerol acyltransferase [Gramella forsetii KT0803] (243 aa)
Score = 123, Expect = 4.8e-05, Identities = 42/167 (25%), Positives = 77/167 (46%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQ--IVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIK 232
           T   ++   +IP NK+ +FV NH+  +D+   +  F+           P FVSK E+ +    + F  +   ++ IDR N R+ +       + L++ ++S  +F EGTR +     EF+   +   +    +  +VP+ I  +  + K     I     V ++  EPIK
  S:    60 TTFSVENEHDIPVNKTCIFVANHQGMYDIPPIIWYFRK--------HHPKFVSKKELGRGIPSISFNLRHGGSVLIDRNNRRESLIKMGNFGDYLKETKRSAVIFPEGTRSRTGAAKEFRKNGMMMLFKKMPEAVVVPITINNSWKLFKHGNFPIDLGVNVNLKTHEPIK 221
>gi|56708757|ref|YP_170653.1| acetyltransferase protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110671229|ref|YP_667786.1| acetyltransferase protein [Francisella tularensis subsp. tularensis FSC198] >gi|54112657|gb|AAV28962.1| NT02FT0363 [synthetic construct] >gi|56605249|emb|CAG46395.1| Acetyltransferase protein [Francisella tularensis subsp. tularensis SCHU S4] >gi|110321562|emb|CAL09778.1| Acetyltransferase protein [Francisella tularensis subsp. tularensis FSC 198] (246 aa)
Score = 123, Expect = 4.9e-05, Identities = 40/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP N   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-NYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|158288209|ref|XP_310084.4| AGAP009407-PA [Anopheles gambiae str. PEST] >gi|157019270|gb|EAA05789.4| AGAP009407-PA [Anopheles gambiae str. PEST] (300 aa)
Score = 123, Expect = 5.0e-05, Identities = 47/210 (22%), Positives = 96/210 (45%)
  Q:    53 VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           V + ASK +  T+   +++ ++ +   K  + + NH+S+ D+L  +  + ++++  P       ++K+E+      G  A L    +I+R+N    ++  +  K +L +    + ++ EGTR  +     FK  A   A      IVPVV      ++   K +IF    V ++ LEPI      +   + + E+ +  M A Y ++  +
  S:    76 VIARASKLLGITW---ELRNAQILRQAKGAIVLTNHQSSMDILGMMILWDILRKVVP-------IAKLELLFLFPFGPTAWLAGVQYINRKNRPSAMKSFERCKRMLTEDGAKMYIYPEGTRYPERGMLPFKKGAFHTAIEAQVPIVPVVFSHMYFIQS--KRHIFDDGHVIIDTLEPIPTAGLTKADLDQLIERTRTAMLARYEELNRE 273
>gi|154274129|ref|XP_001537916.1| hypothetical protein HCAG_07338 [Ajellomyces capsulatus NAm1] >gi|150415524|gb|EDN10877.1| hypothetical protein HCAG_07338 [Ajellomyces capsulatus NAm1] (301 aa)
Score = 123, Expect = 5.0e-05, Identities = 46/191 (24%), Positives = 87/191 (45%)
  Q:    62 FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVS---KIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE--FGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
            CT ++ ++       + +  +F+ NH++  DVL+    F            P + S   K  +S+   +G+   L  T+FIDR N    ++      + +++ +QS+ +F EGTR    +     FK  A   A      IVP+V   Y  L   K+ +   F+   + V+ L P+  K+   +  + +++K +  M
  S:    81 LCTGSRFEVVSGAEHLSTRPAVFISNHQTELDVLLLGAIF------------PPYCSVTAKKSLSRVPVLGWFMTLSGTVFIDRANRETALKAFDGAADQMRREKQSVFIFPEGTRSYSADPVLLPFKKGAFHLAIKAGVDIVPIVAENYAHLLDAKKLR---FEAGTIRVKVLPPLSTKNLQSSDVDELTKKARESM 263
>gi|116058884|emb|CAL54591.1| putative lysophosphatidic acid acyltransferas (ISS) [Ostreococcus tauri] (239 aa)
Score = 123, Expect = 5.0e-05, Identities = 49/184 (26%), Positives = 81/184 (44%)
  Q:    65 FTKVKIKGSKNIP-ANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG---TLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKM 248
           F  +++ G +N+P A  + ++V NH S  D+      + M   +RP      FVSK        VG++  L   I + R   R  + V +  +E+L  G  S+  F EGTR    +   FK  A + A      +VPV I G    +   KE+  N    K +    ++     D  + S+ ++ E +
  S:    59 FFPIEVVGRENLPSATTAAVYVANHASFMDI------YSMFHLRRPF----KFVSKTSNFLIPVVGWSMYLTGHIPLKRMERRSQLEVLKTCREMLADG-GSVLFFPEGTRSADGKMQAFKKGAFSVAAKENVPVVPVTIVGAHEAMASGKEYALNAGGIKVIVHPPIQSTDADDLCKRSEAIIKESL 235
>gi|115314044|ref|YP_762767.1| acyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|115128943|gb|ABI82130.1| acyltransferase [Francisella tularensis subsp. holarctica OSU18] (246 aa)
Score = 123, Expect = 5.2e-05, Identities = 40/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP N   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-NYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|89255527|ref|YP_512888.1| acetyltransferase protein [Francisella tularensis subsp. holarctica] >gi|167010303|ref|ZP_02275234.1| Acetyltransferase protein [Francisella tularensis subsp. holarctica FSC200] >gi|89143358|emb|CAJ78528.1| Acetyltransferase protein [Francisella tularensis subsp. holarctica LVS] >gi|134252781|gb|EBA51875.1| acetyltransferase [Francisella tularensis subsp. holarctica 257] (246 aa)
Score = 123, Expect = 5.2e-05, Identities = 40/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP N   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-NYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|39941738|ref|XP_360406.1| hypothetical protein MGG_11040 [Magnaporthe grisea 70-15] >gi|145023249|gb|EDK06718.1| hypothetical protein MGG_11040 [Magnaporthe grisea 70-15] (303 aa)
Score = 122, Expect = 5.3e-05, Identities = 60/208 (28%), Positives = 92/208 (44%)
  Q:    56 LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE--FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEH----KSNIFKYKEVTVEFLEPIKY-------------KDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           LA+  V  TF  +  KG  +   N+  + V NH++  DVL+    F       PE    T  +K  + +T  +G+   L  TIFIDR+N  D  +        ++   Q++ +F EGTR    E     FK  A   A      IVP V+         H    K  +F   ++ V+ L+PI               K Y    +EL++   KA+ E   +    +P
  S:    78 LAATGV--TFEIIDPKGHLSKEENRPAVLVGNHQTELDVLMLGCLF-------PEHCSVT--AKASLRRTPFLGWFMSLSGTIFIDRKNSADARQAMSGAVNQIRTKRQTVYMFPEGTRSYTREPILLPFKKGAFHLAVQAQVPIVPCVV-----ANYSHVLWIKGLVFNAGKIPVKVLDPIPTTGMTAADVDGLCKKTYDLMHQELITLTSKARGEPVTVPSSMNP 288
>gi|46124529|ref|XP_386818.1| hypothetical protein FG06642.1 [Gibberella zeae PH-1] (303 aa)
Score = 122, Expect = 5.3e-05, Identities = 49/169 (28%), Positives = 81/169 (47%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYK--------DYIQTSKELVSEKM 248
           +  +FV NH++  DVL+  + F       P+    T  +K  + K   +G+   L  +IFIDR+N +D     +     +Q   QS+ +F EGTR   K+     FK  A   A      IVP V+     V    K+  F   ++ V+ L+PI  K        +  +T++EL+  ++
  S:   100 RPAVFVGNHQTELDVLMLGRMF-------PKYCSVT--AKASLKKVPFLGWFMSLSGSIFIDRKNSKDARDAMKGAASEIQSKRQSVYMFPEGTRSYAKEPMLLPFKKGAFHLAVEAGVPIVPCVVANYSHVLYP-KTFTFNSGKIPVKVLKPIPTKGLTAADVEELTRTTRELMLNEL 268
>gi|29655213|ref|NP_820905.1| acyltransferase family protein [Coxiella burnetii RSA 493] >gi|29542485|gb|AAO91419.1| acyltransferase family protein [Coxiella burnetii RSA 493] (853 aa)
Score = 122, Expect = 5.4e-05, Identities = 56/196 (28%), Positives = 89/196 (45%)
  Q:    65 FTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQ--SLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           F+ + IKG +NI + + +++V NH S  D ++                D  F+ K E+ KT  +    K ++ + +DR    DF + + + K + Q  EQ  S+ +F EGT     +   FK  A   A      I PV I   +G  K  ++N F  K      LE I +K  I  SKE   E M+ + ++ +L  K
  S:   657 FSPISIKGKENI-SGQPMIYVANHGSFIDSVILAGVLPA---------DTNFIGKKELLKTPVIKSFVKQLDLVTVDRM---DFSKSHSDVKRIEQTLEQGRSVLIFPEGTFSYATDVRPFKLGAFKIAAELGKPICPVAI---VGARKILRANQFLVKPAK---LEVIIFKPLIPESKEW-EEVMRLRKQSRFLIAK 834
>gi|156551340|ref|XP_001602186.1| PREDICTED: similar to CG3812-PA [Nasonia vitripennis] (256 aa)
Score = 122, Expect = 5.4e-05, Identities = 34/134 (25%), Positives = 68/134 (50%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVV 202
           +I+G + +  +++ + V NH+S FD +  ++ + ++++          V+K  +      G +A L  TIFID++N + + R+ ++     ++ +  + +F EGTR  +    EFK  A   A      I+PVV
  S:    27 EIRGREQLALDRACIIVANHQSAFDFMGMIRVWPIMRK-------CALVAKKLLFYGWPTGLSAWLSGTIFIDKKNWQKYGRILEDAIRAYKEQKVKVWIFPEGTRYHEGGIHEFKRGAFYMAIKLQLPILPVV 153
>gi|170741560|ref|YP_001770215.1| phospholipid/glycerol acyltransferase [Methylobacterium sp. 4-46] >gi|168195834|gb|ACA17781.1| phospholipid/glycerol acyltransferase [Methylobacterium sp. 4-46] (298 aa)
Score = 122, Expect = 5.8e-05, Identities = 37/131 (28%), Positives = 65/131 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQ 197
           +V++ G+   P  ++ + + NH S  D+LV L A + +          +FV+K EI+    +GF A++  T+FIDR   R    VN E    L  GE ++ +F EGT    +    F+++ +  A +   +
  S:    60 RVRVSGTPPAPG-EATLVLANHISWLDILV-LGALRPL----------SFVAKSEIAGWPVIGFMARMQRTVFIDRARKRHTAVVNTELSRRLSAGE-TVVLFAEGTTGDGNRLLPFRTSLVGAARAALTE 177
>gi|186471740|ref|YP_001863058.1| AMP-dependent synthetase and ligase [Burkholderia phymatum STM815] >gi|184198049|gb|ACC76012.1| AMP-dependent synthetase and ligase [Burkholderia phymatum STM815] (962 aa)
Score = 122, Expect = 5.8e-05, Identities = 45/159 (28%), Positives = 75/159 (47%)
  Q:    51 NYVYSLASKAVFCTF----TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQ--SLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV 209
           N  + +AS+A   T       + ++G       +  ++V NH S  D LV L AF       P  L    V+K E+++   +G   + I   F++R    D+ R+  +E+EL ++     SL  F E T ++     +F+  A   A ++   I+PV I GT  V
  S:   744 NRNWKIASRAARLTLRLAGISLTVRGGALFDTAQPAIYVANHASYLDGLVLLAAF-------PVPLG--VVAKRELARAPLLGCFLRAIGVRFVERV---DYRRMADDERELAKQAMSGTSLLFFPEATFVRSAGLRQFRLGAFVTACASHRPIIPVAIAGTRAV 896
>gi|168526238|ref|ZP_02719877.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi 118a] >gi|168579874|ref|ZP_02723862.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi 72a] >gi|195955259|ref|ZP_03093952.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi CA-11.2a] (250 aa)
Score = 122, Expect = 6.6e-05, Identities = 34/140 (24%), Positives = 72/140 (51%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + G +NIP   +V+ + NH +  D L+++  F       P ++    ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    67 KIIVTGYENIPKKSNVIIMGNHIAAMDPLIFIYTFAC-----PFVI----LAKHSLLRIPFVNIVLIVMGVIFVNRRSIRSAAAAEVKAIKVMREG-RSIGIFPEGTRNRGGDTRVFKKGSIKMALKTGTSILPVTLYNT 196
>gi|167931866|ref|ZP_02518953.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi 156a] >gi|168692545|ref|ZP_02725337.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi 94a] >gi|195941777|ref|ZP_03087159.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi 80a] >gi|195951333|ref|ZP_03092430.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi 29805] (250 aa)
Score = 122, Expect = 6.6e-05, Identities = 34/140 (24%), Positives = 72/140 (51%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + G +NIP   +V+ + NH +  D L+++  F       P ++    ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    67 KIIVTGYENIPKKSNVIIMGNHIAAMDPLIFIYTFAC-----PFVI----LAKHSLLRIPFVNIVLIVMGVIFVNRRSIRSAAAAEVKAIKVMREG-RSIGIFPEGTRNRGGDTRVFKKGSIKMALKTGTSILPVTLYNT 196
>gi|161830319|ref|YP_001597743.1| acyltransferase family protein [Coxiella burnetii RSA 331] >gi|161762186|gb|ABX77828.1| acyltransferase family protein [Coxiella burnetii RSA 331] (852 aa)
Score = 122, Expect = 6.8e-05, Identities = 56/196 (28%), Positives = 89/196 (45%)
  Q:    65 FTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQ--SLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           F+ + IKG +NI + + +++V NH S  D ++                D  F+ K E+ KT  +    K ++ + +DR    DF + + + K + Q  EQ  S+ +F EGT     +   FK  A   A      I PV I   +G  K  ++N F  K      LE I +K  I  SKE   E M+ + ++ +L  K
  S:   656 FSPISIKGKENI-SGQPMIYVANHGSFIDSVILAGVLPA---------DTNFIGKKELLKTPVIKSFVKQLDLVTVDRM---DFSKSHSDVKRIEQTLEQGRSVLIFPEGTFSYATDVRPFKLGAFKIAAELGKPICPVAI---VGARKILRANQFLVKPAK---LEVIIFKPLIPESKEW-EEVMRLRKQSRFLIAK 833
>gi|195352706|ref|XP_002042852.1| GM11583 [Drosophila sechellia] >gi|194126899|gb|EDW48942.1| GM11583 [Drosophila sechellia] (344 aa)
Score = 121, Expect = 7.1e-05, Identities = 42/184 (22%), Positives = 80/184 (43%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S+ DVL     + ++ +        T V+K E+      G AA L   IFIDR           +    ++K    L VF EGTR        FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   +++ ++++++M
  S:    82 ELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNK-------CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEGTRRNTGALHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNSGRIVITTLPPVSTEGLTKDDIDVLMDRVRSQM 257
>gi|169656478|ref|YP_001427530.2| acetyltransferase protein [Francisella tularensis subsp. holarctica FTNF002-00] >gi|164551546|gb|ABU60574.2| acetyltransferase protein [Francisella tularensis subsp. holarctica FTNF002-00] (246 aa)
Score = 121, Expect = 7.3e-05, Identities = 39/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           +KI G +NIP N   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 IKIDGKENIP-NYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|15677857|ref|NP_275025.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria meningitidis MC58] >gi|7227295|gb|AAF42355.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Neisseria meningitidis MC58] (247 aa)
Score = 121, Expect = 7.5e-05, Identities = 49/159 (30%), Positives = 82/159 (51%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQE--EKELLQKGEQS-LTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK-EVTV 225
           K +I G++NIP ++  +    H+S ++ L     F       P++    +V+K E+ K    G+  KL+ TI IDR N R+    N++  ++ L++K E   +T+F EGTR+   + G++K      A      IVPV +      E   K++  KY  E+TV
  S:    56 KYRIIGAENIP-DRPAVICAKHQSGWETLALQDIFP------PQV----YVAKRELFKIPFFGWGLKLVKTIGIDRNNRRE---ANEQLIKQGLVRKNEGYWITIFPEGTRLAPGKRGKYKLGGARMAKMFEMDIVPVALNSG---EFWPKNSFLKYPGEITV 201
>gi|108763614|ref|YP_633717.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase family protein [Myxococcus xanthus DK 1622] >gi|108467494|gb|ABF92679.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase family protein [Myxococcus xanthus DK 1622] (245 aa)
Score = 121, Expect = 7.7e-05, Identities = 39/135 (28%), Positives = 63/135 (46%)
  Q:    72 GSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQ-NLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           G +N+P +  V+FV NH+S++D LV     +  K  R       +V+K E+ +    G A +    I ++R     D  R+++    L ++   S+  F EGTR        FK  A T A      +VP+ + GT
  S:    60 GVENVPTDTHVVFVSNHQSHYDALVNFAHIR--KHTR-------YVAKAELFRIPVFGPALRRAGNIPVERTGGAGDRARLSEAVTALRER--VSVLFFAEGTRSTDGRLRPFKKGAATLAIQAGVPVVPLAVSGT 184
>gi|119192914|ref|XP_001247063.1| hypothetical protein CIMG_00834 [Coccidioides immitis RS] >gi|90305849|gb|EAS35480.1| hypothetical protein CIMG_00834 [Coccidioides immitis RS] (298 aa)
Score = 121, Expect = 7.9e-05, Identities = 47/183 (25%), Positives = 82/183 (44%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVS---KIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE--FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK----EVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           ++G +++ + +  +F+ NH++  DVL+    F            P + S   K  +     +G+   L  T+FIDR N +  ++      E ++K  QS+ +F EGTR    E     FK  A   A      IVP+V+         H  NI K +    ++ ++ L PI  K       + ++ K +  M
  S:    90 VEGKQHL-STRPAVFIGNHQTELDVLMLGAVF------------PPYCSVTAKKSLRNVPFLGWFMALSGTVFIDRANRQTALKAFDGAAEQMRKQRQSVFIFPEGTRSYSSEPCLLPFKKGAFHLAVQAGVDIVPIVVENY-----SHVLNIKKLRFDAGDIKIKVLPPISTKSLTTADVDDLAVKTRESM 263
>gi|157121401|gb|EDO65602.1| acyltransferase [Francisella tularensis subsp. holarctica FSC022] (246 aa)
Score = 121, Expect = 8.1e-05, Identities = 40/134 (29%), Positives = 64/134 (47%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP N   ++V  H+S  +  V+    +          +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-NYPCIYVSKHQSMLETFVFSGLVR----------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|148676378|gb|EDL08325.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), isoform CRA_b [Mus musculus] (226 aa)
Score = 121, Expect = 8.3e-05, Identities = 49/212 (23%), Positives = 86/212 (40%)
  Q:    52 YVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           YVY L          + ++ G K +  +   + + NH+S  D++  ++    I  KR        ++K E+  T  VG    L    FI+RQ  R  + V  +  +L+ K    + ++ EGTR    +   FK  A   A      I+PVV Y +       K+ +F    + V+ L+ +            + +     M A +L+I + P
  S:    20 YVYGL----------RFEVSGQKKLEVDGPCVIISNHQSILDMMGLME----ILPKRC-----VQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVV-YSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIP 211
>gi|34557019|ref|NP_906834.1| putative 1-acyl-SN-glycerol-3-phosphate acyltransferase [Wolinella succinogenes DSM 1740] >gi|34482734|emb|CAE09734.1| PUTATIVE 1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE [Wolinella succinogenes] (229 aa)
Score = 121, Expect = 8.3e-05, Identities = 50/176 (28%), Positives = 89/176 (50%)
  Q:    77 PANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE-FGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNI--FKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           P+ K +M   NH+S  DV ++++A        P+  D  +++K E+ KT   G A K    I I+R++ +  + + +E KE L+K  + L +F EGTR K  E F  FKS A   A      I P+V+ GT  +    K ++   K + + +    P+    + +  +E + ++ K ++
  S:    58 PSAKMIML--NHQSFLDV-IFMEAI------HPK--DLCWIAKKELGKTPLYGHALKAPRMILINREDKKGLLFLLKETKERLEK-NRVLAIFPEGTRSKGGERFLPFKSGAKVLAEKFHLPIQPIVVVGTRSIFDLAKLSVGGGKARFIALPTRSPLSSPSWYEEMREEMQQRYKEEL 224
>gi|151941947|gb|EDN60303.1| 1-acyl-sn-gylcerol-3-phosphate acyltransferase [Saccharomyces cerevisiae YJM789] >gi|190405062|gb|EDV08329.1| hypothetical protein SCRG_00551 [Saccharomyces cerevisiae RM11-1a] (303 aa)
Score = 121, Expect = 8.4e-05, Identities = 51/196 (26%), Positives = 87/196 (44%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           VK+ G +N+ A K  + + NH+S  D+ +  + F       P     T  +K  +     +G+   L  T F+DR   ++ +    +  E ++K +++L VF EGTR    E     FK  A   A      IVPVV+  T  +    K  +F    + V  L+PI  ++  +      +EK++ +M     +I   P
  S:    63 VKVVGEENL-AKKPYIMIANHQSTLDIFMLGRIFP------PGC---TVTAKKSLKYVPFLGWFMALSGTYFLDRSKSQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQGKIPIVPVVVSNTSTLVSP-KYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVDTLKEIGYSP 249
>gi|66564398|ref|XP_624521.1| PREDICTED: similar to CG3812-PA, isoform A [Apis mellifera] (274 aa)
Score = 121, Expect = 8.8e-05, Identities = 50/188 (26%), Positives = 75/188 (39%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           +++G +++   ++ + V NH+S+ DVL     +       P +   T V K EI      G AA     IFIDR N      V       +++ +  L +F EGTR    +   FK  A   A      I+PVV      +  E K   F    V +  L PI  K       E + E  +  M  A+
  S:    80 ELRGKEHLEQERACIIVANHQSSLDVLGMFNIW-------PIMGKCTAVGKKEILYAWPFGLAAWFCGMIFIDRMNSEKAHSVINNAANYIKEKKIKLWIFPEGTRRNTGKIYPFKKGAFHVAIRFQLPILPVVFSSYYFLSSEEKK--FDPGRVIITTLPPISTKGLKTDDTEHLMEITRNIMMEAF 258
>gi|6320151|ref|NP_010231.1| 1-acyl-sn-gylcerol-3-phosphate acyltransferase, catalyzes the acylation of lysophosphatidic acid to form phosphatidic acid, a key intermediate in lipid metabolism; located in lipid particles and endoplasmic reticulum; Slc1p [Saccharomyces cerevisiae] >gi|464422|sp|P33333|PLSC_YEAST Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) >gi|349187|gb|AAA16514.1| acyltransferase >gi|1431047|emb|CAA98614.1| SLC1 [Saccharomyces cerevisiae] (303 aa)
Score = 121, Expect = 8.8e-05, Identities = 51/196 (26%), Positives = 87/196 (44%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           VK+ G +N+ A K  + + NH+S  D+ +  + F       P     T  +K  +     +G+   L  T F+DR   ++ +    +  E ++K +++L VF EGTR    E     FK  A   A      IVPVV+  T  +    K  +F    + V  L+PI  ++  +      +EK++ +M     +I   P
  S:    63 VKVVGEENL-AKKPYIMIANHQSTLDIFMLGRIFP------PGC---TVTAKKSLKYVPFLGWFMALSGTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQGKIPIVPVVVSNTSTLVSP-KYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVDTLKEIGYSP 249
>gi|158288211|ref|XP_310093.4| AGAP009414-PA [Anopheles gambiae str. PEST] >gi|157019271|gb|EAA05763.4| AGAP009414-PA [Anopheles gambiae str. PEST] (286 aa)
Score = 120, Expect = 9.1e-05, Identities = 49/196 (25%), Positives = 86/196 (43%)
  Q:    61 VFCTFTKV-----KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAY 256
           V C F ++     +I+G ++I      + + NH+S  D++       + +  R E  +   V K E+      G A+ L+  +FIDR+N      V + E   + K    L +F EGTR   D    FK  +   A  +   I PV++  Y  L    +HK   F    V ++ +  I  K   +     ++E+ +  M+  +
  S:    76 VACAFIRLFGVEYEIRGQEHINVRNGGVVLLNHQSAIDIVSKYHPSLLSRLLR-EFRNIVPVVKKELFYMLPFGIASYLVGVVFIDRKNTASAKDVMKREAVAITKDHLKLAIFPEGTRHDNDTLLPFKKGSFHVAVDSQSIIQPVIVSKYHFL----DHKRKRFGRGRVIIKIMPEIPTKGMTKADVTELTERCQQLMQTEF 273
>gi|195949290|ref|ZP_03090390.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase (plsC) [Borrelia burgdorferi WI91-23] (250 aa)
Score = 120, Expect = 9.2e-05, Identities = 34/140 (24%), Positives = 72/140 (51%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+ + G +NIP   +V+ + NH +  D L+++  F       P ++    ++K  + +   V     ++  IF++R+++R       +  +++++G +S+ +F EGTR +  +   FK  ++  A  T   I+PV +Y T
  S:    67 KIIVTGYENIPKKSNVIIMGNHIAAMDPLIFIYTFAC-----PFVI----LAKHTLLRIPFVNIVLIVMGVIFVNRRSIRSAAAAEVKAIKVMREG-RSIGIFPEGTRNRGGDTRVFKKGSIKMALKTGTSILPVTLYNT 196
>gi|34499518|ref|NP_903733.1| 1-acylglycerol-3-phosphate O-acyltransferase [Chromobacterium violaceum ATCC 12472] >gi|34105368|gb|AAQ61723.1| 1-acylglycerol-3-phosphate O-acyltransferase [Chromobacterium violaceum ATCC 12472] (271 aa)
Score = 120, Expect = 9.2e-05, Identities = 59/220 (26%), Positives = 99/220 (45%)
  Q:    44 LGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIY-----GTLGVEKEHKSNIFKYK-----------EVTVEFLEPIKYKDYIQTSKELVSEKMKAKM-EAAYLKIKEDP 263
           L   ER       A  A+      +K++G        + + V NH S  D++    A       R       FV+K EI K   +G+ A +  T+FIDR N RD  RVNQ   E +Q G   + VF E T         FK++    A  +   + PV +      G+L  E  +  +I   +           EV + + +P+K  +    ++ L++E+ ++++     L ++E P
  S:    37 LAQAERAVVTRRWAQHALKILGVSIKVQGVNPGFYPPNTLLVANHVSWLDIV----ALNSCTVSR-------FVAKREIRKWPLIGWLAYVAGTLFIDRGNRRDASRVNQILAEAMQNG-GCMAVFPEATTSDGSGLLPFKASLFEAALLSGGTVQPVSLRYQRPDGSLLREAAYIDDISLLQSIGKVLSVPQIEVEISYGQPLKAGEAGLDNRFLLAEQARSEVARGLRLSLEEQP 261
>gi|167456596|ref|ZP_02322814.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417325|gb|EDR84032.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter dehalogenans 2CP-1] (244 aa)
Score = 120, Expect = 9.3e-05, Identities = 39/165 (23%), Positives = 70/165 (42%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           + ++ G + +P N + + V NH S  D+LV    F+  K          +VSK E+ +   VG+   L + + + R +     ++    +  L +G   + +F EGTR        FK  A   A      ++P+ + GT     +H   + +     V  L+PI
  S:    60 RSRVVGREKLPWNGAAVLVANHLSMLDILVLYGVFRPFK----------WVSKAELFRVPFVGWNMWLNDCVPVWRGDRESVRKMMAHCRAHLARG-APVMIFPEGTRSPDGRLQAFKDGAFRLAVDANVPVIPIAVSGTSEALPKHGMVLRQRMRAEVHVLDPI 213
>gi|148360794|ref|YP_001252001.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Legionella pneumophila str. Corby] >gi|148282567|gb|ABQ56655.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Legionella pneumophila str. Corby] (243 aa)
Score = 120, Expect = 9.4e-05, Identities = 44/168 (26%), Positives = 72/168 (42%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK 247
           K+ + + NH S +D+ +  KAF     +         ++K E+SK   +G         FIDR+N    ++  +  ++L++ G   L V  EGTR K  +   FK      A      I+P+ I G   +      NI   ++  +   EPI    Y   +KE + EK
  S:    73 KATILMCNHSSAYDIPLGFKAFPNNSIR--------MLAKRELSKIPLLGKGMAAAEFPFIDRKNRFQAIKDLEFAQQLMESG-IILWVAPEGTRSKDGKLAPFKKGGFITAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAEIHIGEPIDAAQYTIENKEELIEK 231
>gi|163730554|ref|ZP_02138027.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio fischeri MJ11] >gi|161396188|gb|EDQ20484.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio fischeri MJ11] (242 aa)
Score = 120, Expect = 9.5e-05, Identities = 49/195 (25%), Positives = 86/195 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKY----KDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           K++I+  ++  +++  +++ NH++N+D+     A +      P  +    V K  ++     G    +   I IDR N    V    +  E ++K   S+ +F EGTR +      FK+ A   A +    + P+V   T G     K N +    V VE L PI      KD ++    L  E+M  K+E    ++ E
  S:    52 KLEIRVPESAKSSEPSLYIANHQNNWDLFTVSGAIQ------PRTVT---VGKKSLAWMPLFGQLYWITGNILIDRNNRSKAVGTIAQVAENIKKRNVSVWMFPEGTRSRGRGLLPFKTGAFHAAIAADVPVTPIVCSNTQG---NIKLNRWNNGHVIVEILPPISSEGYEKDNVRELANLCREQMITKLEELNKEVAE 238
>gi|56963638|ref|YP_175369.1| 1-acylglycerol-3-phosphate O-acyltransferase [Bacillus clausii KSM-K16] >gi|56909881|dbj|BAD64408.1| 1-acylglycerol-3-phosphate O-acyltransferase [Bacillus clausii KSM-K16] (196 aa)
Score = 120, Expect = 9.5e-05, Identities = 55/172 (31%), Positives = 87/172 (50%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRP-EILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVP-------------VVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI-KYKDYIQ 238
           KV+I G +NIP   +V+   NH SN D  + L A+     KRP   +    + K+ + KT      A  +N    D+Q+LR  +       ++L+ G+  + +F EGTR K  E G+  + A   A  +   +VP              ++YG     +EH++N    KEVT   ++ I K KD+ Q
  S:    20 KVRIYGKENIPDEGAVLLCANHISNNDPPL-LGAYI----KRPVRYMAKKELFKVPVLKTLLRKLGAFPVNRAGGDKQSLRTSL-------DILKSGDM-VGIFPEGTRSKTGEIGKGLTGAGFFALKSTAHVVPCAIIGPYKMRGRVTLVYGKPISMEEHRANRTSAKEVTEIIMDEIQKLKDHYQ 193
>gi|54293542|ref|YP_125957.1| hypothetical protein lpl0594 [Legionella pneumophila str. Lens] >gi|53753374|emb|CAH14827.1| hypothetical protein [Legionella pneumophila str. Lens] (243 aa)
Score = 120, Expect = 9.6e-05, Identities = 44/168 (26%), Positives = 72/168 (42%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK 247
           K+ + + NH S +D+ +  KAF     +         ++K E+SK   +G         FIDR+N    V+  +  ++L++ G   L +  EGTR K  +   FK      A      I+P+ I G   +      NI   ++  +   EPI    Y   +KE + EK
  S:    73 KATILMCNHSSAYDIPLGFKAFPNNSIR--------MLAKRELSKIPLLGKGMAAAEFPFIDRKNRFQAVKDLEFAQQLMESG-IILWIAPEGTRSKDGKLAPFKKGGFISAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAEIHIGEPIDAAQYTIENKEELIEK 231
>gi|86156683|ref|YP_463468.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter dehalogenans 2CP-C] >gi|85773194|gb|ABC80031.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Anaeromyxobacter dehalogenans 2CP-C] (244 aa)
Score = 120, Expect = 9.7e-05, Identities = 39/165 (23%), Positives = 70/165 (42%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           + ++ G + +P N + + V NH S  D+LV    F+  K          +VSK E+ +   VG+   L + + + R +     ++    +  L +G   + +F EGTR        FK  A   A      ++P+ + GT     +H   + +     V  L+PI
  S:    60 RSRVVGREKLPWNGAAVLVANHLSMLDILVLYGVFRPFK----------WVSKAELFRVPFVGWNMWLNDCVPVWRGDRESVRKMMAHCRAHLARG-APVMIFPEGTRSPDGRLQAFKDGAFRLAVDANVPVIPIAVSGTSEALPKHGVVLRQRMRAEVRVLDPI 213
>gi|183983808|ref|YP_001852099.1| bifunctional transmembrane phospholipid biosynthesis enzyme PlsC [Mycobacterium marinum M] >gi|183177134|gb|ACC42244.1| bifunctional transmembrane phospholipid biosynthesis enzyme PlsC [Mycobacterium marinum M] (651 aa)
Score = 120, Expect = 1.0e-04, Identities = 41/169 (24%), Positives = 75/169 (44%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           + + G +N+ A +  +F+ NH++  D ++   A  ++++      +   V K E+     +G   K+++ +FIDR +    V      +E  + G  S+ +  EGTR+   E G FK      A +    IVP+VI     V   + + I     V +    PI   D+
  S:   313 LNVVGKENLTAQRPAVFIFNHRNQVDPVI---AGALVRD------NWVGVGKKELQNDPIMGTLGKVLDGVFIDRDDPASAVETLHTVEERAKNG-LSIVIAPEGTRLDTTEVGPFKKGPFRIAMAAGIPIVPIVIRNAEIVASRNSTTI-NPGTVDIAVFPPIPVDDW 470
>gi|118619011|ref|YP_907343.1| bifunctional transmembrane phospholipid biosynthesis enzyme PlsC [Mycobacterium ulcerans Agy99] >gi|118571121|gb|ABL05872.1| bifunctional transmembrane phospholipid biosynthesis enzyme PlsC [Mycobacterium ulcerans Agy99] (641 aa)
Score = 120, Expect = 1.0e-04, Identities = 41/169 (24%), Positives = 75/169 (44%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           + + G +N+ A +  +F+ NH++  D ++   A  ++++      +   V K E+     +G   K+++ +FIDR +    V      +E  + G  S+ +  EGTR+   E G FK      A +    IVP+VI     V   + + I     V +    PI   D+
  S:   313 LNVVGKENLTAQRPAVFIFNHRNQVDPVI---AGALVRD------NWVGVGKKELQNDPIMGTLGKVLDGVFIDRDDPASAVETLHTVEERAKNG-LSIVIAPEGTRLDTTEVGPFKKGPFRIAMAAGIPIVPIVIRNAEIVASRNSTTI-NPGTVDIAVFPPIPVDDW 470
>gi|134299016|ref|YP_001112512.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Desulfotomaculum reducens MI-1] >gi|134051716|gb|ABO49687.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Desulfotomaculum reducens MI-1] (194 aa)
Score = 120, Expect = 1.0e-04, Identities = 46/173 (26%), Positives = 79/173 (45%)
  Q:    59 KAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           + +   + + KI G  N+P +  V+ V NH SN D LV   A      +R       F++K+E+ K   +    +++    ++R+  R   +  +   E LQ GE  + +F EGTR K  E  + +  A   A  +   I+PV + GT G+          + +V V+  EP+
  S:    11 RYILLIWRRWKIVGRDNLPVSGGVLVVSNHVSNLDPLVVGCALT----RRIH-----FMAKVELFKIPILASLIRMLGAFPVNRE--RSDRKAIRMALEYLQNGE-VVGIFPEGTRSKTGELQKAQIGAAMLAVKSNTPILPVALIGTRGI----------FNKVVVKIGEPL 161
>gi|110759976|ref|XP_001120808.1| PREDICTED: similar to CG3812-PA, isoform A [Apis mellifera] (221 aa)
Score = 120, Expect = 1.1e-04, Identities = 55/215 (25%), Positives = 90/215 (41%)
  Q:    52 YVYSLASKAVFCTFTKV-----KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWS 266
           Y+ ++    V    TK+     +++G   +  N++ + V NH+S  D L   + + ++ +        T ++K EI      G AA L   IFIDR N      V     + ++K    L ++ EGTR        FK  A   A      IVPVV      + K  K   F+   V ++ L  I  K       + + EK +  M  A+ +I  +  +S
  S:     5 YINTIILAMVVAPITKIIGVNWELRGRDILEQNRTYIIVSNHQSLLDFLGMYQIWPIMNK-------CTAIAKREIFYLWPCGLAAWLGRLIFIDRMNSDSARIVLNNATDYIKKNNIKLWIYPEGTRRNTGTIHTFKKGAFHVAIRAQLPIVPVVFSSYYFLSKREKK--FESGRVIIKALPEISTKGLTVDDVDSLLEKTRNIMIDAFNEINREIQFS 215
>gi|15610951|ref|NP_218332.1| acyltransferase [Mycobacterium tuberculosis H37Rv] >gi|15843439|ref|NP_338476.1| acyltransferase family protein [Mycobacterium tuberculosis CDC1551] >gi|31794989|ref|NP_857482.1| putative acyltransferase [Mycobacterium bovis AF2122/97] >gi|121639732|ref|YP_979956.1| putative acyltransferase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148663683|ref|YP_001285206.1| putative acyltransferase [Mycobacterium tuberculosis H37Ra] >gi|148825022|ref|YP_001289776.1| acyltransferase [Mycobacterium tuberculosis F11] >gi|167969930|ref|ZP_02552207.1| hypothetical acyltransferase [Mycobacterium tuberculosis H37Ra] >gi|194542355|ref|YP_002077385.1| hypothetical protein TBCG_03741 [Mycobacterium tuberculosis C] >gi|2224830|emb|CAB10008.1| POSSIBLE ACYLTRANSFERASE [Mycobacterium tuberculosis H37Rv] >gi|13883808|gb|AAK48290.1| acyltransferase family protein [Mycobacterium tuberculosis CDC1551] >gi|31620587|emb|CAD96031.1| PUTATIVE ACYLTRANSFERASE [Mycobacterium bovis AF2122/97] >gi|121495380|emb|CAL73867.1| Putative acyltransferase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124603097|gb|EAY61372.1| hypothetical protein TBCG_03741 [Mycobacterium tuberculosis C] >gi|148507835|gb|ABQ75644.1| putative acyltransferase [Mycobacterium tuberculosis H37Ra] >gi|148723549|gb|ABR08174.1| hypothetical acyltransferase [Mycobacterium tuberculosis F11] (251 aa)
Score = 120, Expect = 1.1e-04, Identities = 53/195 (27%), Positives = 84/195 (43%)
  Q:    56 LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKA 250
           LA   V  T T++   G +N+P     +   NH S  D L    A    + +        F+ K E+ + + V F  +   TI +DR        V  +    L++GE  + V+ E T  +  E   FK+ A   A      IVPVV++G   +  K+H   I + K  VTV+   P++    I+ +   + E M A
  S:    12 LAQLLVLATGTRITYVGEENVPDQGGAVVAINHTSYVDWLPAALAMHRRRRRM------RFMIKAEMQRVRLVNFLIRHTRTIPVDRGAGGSAYAVAVQR---LREGEL-VGVYPEATISRSFELKGFKTGAARMAAEADVPIVPVVVWGAQRIWTKDHPRQIGRAKVPVTVQVGRPLRAAAGIEQTNAALRESMTA 198
>gi|116309785|emb|CAH66825.1| OSIGBa0148A10.2 [Oryza sativa (indica cultivar-group)] (292 aa)
Score = 120, Expect = 1.1e-04, Identities = 47/171 (27%), Positives = 78/171 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTF---VSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           +K++G +N+  N   +F+ NH S  D+ + +             L PT    ++K EI      G    L N + IDR N    +   +E    + K   SL +F EGTR K      FK   +  A  T   IVP+V+ GT    +++   + +   +TV+ L PI+   +++
  S:    98 IKLEGMENL--NTRGIFICNHASPLDIFLVM------------WLAPTGTVGIAKKEIIWYPLFGQLYVLANHLRIDRSNPAAAIESMKEVARAVTKNNLSLILFPEGTRSKTGRLLPFKKGFVHTALQTRLPIVPMVVTGTHLAWRKNSLRV-RPAPLTVKVLPPIETDGWVE 256
>gi|172057816|ref|YP_001814276.1| phospholipid/glycerol acyltransferase [Exiguobacterium sibiricum 255-15] >gi|171990337|gb|ACB61259.1| phospholipid/glycerol acyltransferase [Exiguobacterium sibiricum 255-15] (199 aa)
Score = 119, Expect = 1.2e-04, Identities = 48/158 (30%), Positives = 75/158 (47%)
  Q:    48 ERQNYVYSLASKAVFC---TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKR----PEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           +R  +VY LA   V     T  ++K+ G +NIP++ S++   NH SN+D +  + A    +  R     E+ +   + +I IS  T  VG           DRQ L+  +       ELL   E ++ +F EGTR    EF   +      A  +  QI+P+ I G
  S:     2 KRNEFVYRLARFIVLIIAKTVFRLKVTGKENIPSDGSLLVCANHSSNWDPVFLVSAIPTSRSVRYMAKEELFNIPVLKQIMISAGTYPVGRGQG-------DRQALKRTI-------ELLNSDE-TVGIFPEGTRSAPGEFTSAQPGVGFFALRSPAQILPIAIIG 152
>gi|160896738|ref|YP_001562320.1| phospholipid/glycerol acyltransferase [Delftia acidovorans SPH-1] >gi|160362322|gb|ABX33935.1| phospholipid/glycerol acyltransferase [Delftia acidovorans SPH-1] (246 aa)
Score = 119, Expect = 1.2e-04, Identities = 38/135 (28%), Positives = 72/135 (53%)
  Q:    69 KIKGSKNIPAN--KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           +++G +N+P +  + V+ +  H+S ++         ++    P  L   +V K E+      G++   ++ I IDR++  R F +V ++ K LL +G   + +F EGTRI + E GE+K+ A   A  T   +VP+ +
  S:    61 RVQGMENLPTDPKQGVVLLVKHQSTYETF-------LMPAIMPRPL--AYVFKKELLMVPFFGWSIGSMDMIHIDRKHGSRAFHKVVEQGKRLLGQGTW-VIMFPEGTRIPRGERGEYKTGATRLAIMTGVPVVPIAV 188
>gi|157822109|ref|NP_001101291.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Rattus norvegicus] >gi|149039262|gb|EDL93482.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (predicted) [Rattus norvegicus] (278 aa)
Score = 119, Expect = 1.2e-04, Identities = 48/212 (22%), Positives = 86/212 (40%)
  Q:    52 YVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           YVY L          + ++ G K +  +   + + NH+S  D++  ++    I  KR        ++K E+  T  VG    L    FI+RQ  +  + +  +  +L+ K    + ++ EGTR    +   FK  A   A      I+PVV Y +       K+ +F    + V+ L+ +            + +     M A +L+I E P
  S:    72 YVYGL----------RFEVSGQKKLEVDGPCVIISNHQSILDMMGLME----ILPKRC-----VQIAKRELMFTGPVGLIMYLGGVYFINRQQAKTAMSLMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVV-YSSFSSFYNVKTKLFTSGTIRVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISEIP 263
>gi|90414955|ref|ZP_01222918.1| hypothetical acyltransferase family protein [Photobacterium profundum 3TCK] >gi|90323955|gb|EAS40553.1| hypothetical acyltransferase family protein [Photobacterium profundum 3TCK] (866 aa)
Score = 119, Expect = 1.2e-04, Identities = 42/164 (25%), Positives = 72/164 (43%)
  Q:    43 LLGLTERQNYVYSLASKAV----FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           L+ +   + + +S+A   V      T T+V +KG +N+P N   + V NH S  D L+   A           ++  FV+K E+ K          ++T F++R +++  V  +        +  +SL  F EGT  +     EF   A   A      +VP+ + GT
  S:   650 LVAVVPNKRWCWSIARLGVRLLILFTGTRVTMKGKENLPDNTPCILVANHSSYLDGLIMALAAP---------IECNFVAKAELLKNPFARIFLSRLDTEFVERFDMQKGVN-DARRIAANARNNRSLFFFPEGTLYRMPGLHEFHMGAFIAAVDGALPVVPITLCGT 807
>gi|74316187|ref|YP_313927.1| lyso-ornithine lipid acyltransferase [Thiobacillus denitrificans ATCC 25259] >gi|74055682|gb|AAZ96122.1| phospholipid/glycerol acyltransferase [Thiobacillus denitrificans ATCC 25259] (273 aa)
Score = 119, Expect = 1.2e-04, Identities = 41/129 (31%), Positives = 57/129 (44%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI-YGTLGVEK 211
           + V NH S  D+ +   A ++            FVSK E+ K    G+ A    T+F++R    D  RVN E + L+  G   + VF EGT         F  + L PA    C IVP  + Y TL  E+
  S:    78 LLVCNHVSWLDIYLIYAARRV-----------HFVSKAEVRKWPIAGWLAHKSGTLFLERSRRADTARVNGEMRALMTSGAW-VAVFPEGTTSDGRGLRRFLPSLLQPAVELNCPIVPAALRYRTLHGEQ 195
>gi|68535189|ref|YP_249894.1| hypothetical protein jk0124 [Corynebacterium jeikeium K411] >gi|68262788|emb|CAI36276.1| hypothetical protein [Corynebacterium jeikeium K411] (316 aa)
Score = 119, Expect = 1.2e-04, Identities = 48/213 (22%), Positives = 100/213 (46%)
  Q:    41 PELLGLTERQNYVYSLASKAV------FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFD-----VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKE--VTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           P+  G  E + + Y   +  +      +       + G++NIPA+   M   NH   +D     +  +++  ++++          F++K EI   K VG      + I +DR + +    V+Q  K+L  K    + +F E T  +  E  EF+  A   A+     ++P+ I+G+  V  + +  I++ KE  + +   +P++  +  Q + E + + M  +M+
  S:    15 PKTTGHKEAKEFPYGFPTIGIAKLWFRYMQHLDCAVYGAENIPADGPAMIAVNHTGYWDFTYGGIPAHVRGGRVVR----------FMAKKEIFDVKGVGALMSSYHHIPVDRADGQ--ASVDQAIKQL--KAGDLVGIFPEATISRSFEIKEFRQGAARIAHQAGVPLIPLTIWGSQRVWTKGRKPIWRPKETQLVITVGKPVEVTEDAQATTERLHQTMVEQMD 226
>gi|157130835|ref|XP_001662022.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aedes aegypti] >gi|108871753|gb|EAT35978.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aedes aegypti] (273 aa)
Score = 119, Expect = 1.3e-04, Identities = 54/190 (28%), Positives = 86/190 (45%)
  Q:    14 LGFPFCVFFLWLSLRSSKKKYKRW----------QEDPELLGLTERQNYVYSLASKAVFCTFTKV-----KIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           LG  F  FF+ ++L S+ + Y ++             P  L L   ++Y  +L    +   F K+     +++G +N+      + + NH+S  D  VL YL          P +   T V+K E+      G A  L  T+FI+R+N R        E + + + +  +  F EGTR   D    FK  +   A      I PVVI
  S:     9 LGLAFMAFFI-ITLSSTARYYFKFFCFIILSVVCAVGPVPLMLLRPRDYRNALLPAYLCTKFGKMLGASFEVRGRENVNRQHGGVVLMNHQSALDLVVLAYL---------WPIVGRATVVAKREVLYMFPFGLACWLWGTLFINRKNQRSAKSAINNESKAINEKQAKILFFPEGTRGDGDSLLPFKKGSFHVAIEAQGYIQPVVI 205
>gi|59711009|ref|YP_203785.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio fischeri ES114] >gi|59479110|gb|AAW84897.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio fischeri ES114] (253 aa)
Score = 119, Expect = 1.3e-04, Identities = 49/195 (25%), Positives = 86/195 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKY----KDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           K++I+  ++  +++  +++ NH++N+D+     A +      P  +    V K  ++     G    +   I IDR N    V    +  E ++K   S+ +F EGTR +      FK+ A   A +    + P+V   T G     K N +    V VE L PI      KD ++    L  E+M  K+E    ++ E
  S:    63 KLEIRVPESAKSSEPSLYIANHQNNWDLFTVSGAIQ------PRTVT---VGKKSLAWMPLFGQLYWITGNILIDRNNRSKAVGTIAQVAENIKKRNVSVWMFPEGTRSRGRGLLPFKTGAFHAAIAADVPVTPIVCSNTQG---NIKLNRWNNGHVIVEILPPISSEGYEKDNVRELANLCREQMITKLEELNKEVAE 249
>gi|52840794|ref|YP_094593.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52627905|gb|AAU26646.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (257 aa)
Score = 119, Expect = 1.3e-04, Identities = 43/168 (25%), Positives = 72/168 (42%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK 247
           K+ + + NH S +D+ +  KAF     +         ++K E+SK   +G         FIDR+N    ++  +  ++L++ G   L +  EGTR K  +   FK      A      I+P+ I G   +      NI   ++  +   EPI    Y   +KE + EK
  S:    87 KATILMCNHSSAYDIPLGFKAFPNNSIR--------MLAKRELSKIPLLGKGMAAAEFPFIDRKNRFQAIKDLEFAQQLMESG-IILWIAPEGTRSKDGKLAPFKKGGFITAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAEIHIGEPIDAAQYSIENKEELIEK 245
>gi|54296581|ref|YP_122950.1| hypothetical protein lpp0612 [Legionella pneumophila str. Paris] >gi|53750366|emb|CAH11760.1| hypothetical protein [Legionella pneumophila str. Paris] (243 aa)
Score = 119, Expect = 1.3e-04, Identities = 43/168 (25%), Positives = 72/168 (42%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK 247
           K+ + + NH S +D+ +  KAF     +         ++K E+SK   +G         FIDR+N    ++  +  ++L++ G   L +  EGTR K  +   FK      A      I+P+ I G   +      NI   ++  +   EPI    Y   +KE + EK
  S:    73 KATILMCNHSSAYDIPLGFKAFPNNSIR--------MLAKRELSKIPLLGKGMAAAEFPFIDRKNRFQAIKDLEFAQQLMESG-IILWIAPEGTRSKDGKLAPFKKGGFITAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAEIHIGEPIDAAQYTIENKEELIEK 231
>gi|94265026|ref|ZP_01288795.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [delta proteobacterium MLMS-1] >gi|93454515|gb|EAT04800.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [delta proteobacterium MLMS-1] (252 aa)
Score = 119, Expect = 1.4e-04, Identities = 44/198 (22%), Positives = 86/198 (43%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWS 266
           +I G  N+   +  +FV NH+S FD+ V    F+          D  +++K E+ +   +G+  +    I +DR + R  +       + +  G  S+ +F EGTR    +   FK+  +  A     ++VP+ I GT  +  + +  + +   V +E   PI    Y    K+ ++  ++ ++     K +  P  S
  S:    65 RINGLANLDGKRPYIFVANHQSQFDIFVLQGYFEY---------DFRWLAKKELFQIPLLGWGMRRSGYIPVDRGHGRQALASLGVAAQRIAAG-TSVVIFPEGTRSPDGQLLPFKAGGMVLAIKAGVEVVPMAIAGTHEILPKGRL-LPRPGSVCIEIGRPIASSAYNLKQKQELAALLEKEVRQLLAKAESAPQTS 251
>gi|189426460|ref|YP_001953637.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter lovleyi SZ] >gi|189422719|gb|ACD97117.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Geobacter lovleyi SZ] (234 aa)
Score = 119, Expect = 1.4e-04, Identities = 37/142 (26%), Positives = 66/142 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV 209
           V + G + +P +  ++ + NH SNFD+L     F      RP     ++++K E+      G++ +    I +DR + R  ++ + +E     KG  S+ +F EGTR +  +   FK      A      +VPV I G+  +
  S:    54 VTVSGGEQLP-DGPIIVMSNHASNFDILAMQGYFP-----RPL----SWIAKKELFSIPVFGWSMRRGGYIALDRGDGRKALK-SMDEAAAQIKGGTSVIIFPEGTRTRDGQLLPFKRGGFLLAVKAGVPVVPVSIVGSFAI 184
>gi|194332473|ref|NP_001123741.1| hypothetical protein LOC100170486 [Xenopus (Silurana) tropicalis] >gi|189442485|gb|AAI67406.1| Unknown (protein for MGC:136178) [Xenopus tropicalis] (276 aa)
Score = 119, Expect = 1.4e-04, Identities = 45/197 (22%), Positives = 78/197 (39%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFV--SKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           + ++KG +N   +   + + NH+S  D++  +           EIL    V  +K E+     VG    L   I+I+R+   D   +     + +      + ++ EGTR    +   FK  A   A      I+PVV Y +L      K N+F    V VE L  I      +     ++E+    M   + ++   P
  S:    79 RFEVKGLENFQIDGPCVIISNHQSILDMMGLM-----------EILPDRCVQIAKKELMYAGSVGLITYLGGVIYINRKRTSDAKSIMAAVAQAMISDNLKVWIYPEGTRNNSGDLLPFKKGAFHLALQAQVPIIPVV-YSSLTSFYNQKKNLFTGGTVKVEILPKIDTSGLTENDITDLTERCHQTMRQVFFRLSNKP 265
>gi|117621245|ref|YP_858188.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117562652|gb|ABK39600.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (242 aa)
Score = 119, Expect = 1.4e-04, Identities = 50/203 (24%), Positives = 88/203 (43%)
  Q:    52 YVYSLASKAVFCTFT--KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEA 254
           YV++    AV C     KV++  +  + +    ++V NH+SN+D+      F +    +P ++    V K  +      G    L   + IDR N    +    +  E ++    S+ +F EGTR K      FK+ A   A      +VP+V     G   +   N +   EV +E + P+  K++       +S+  +A+MEA
  S:    36 YVFARMYHAV-CPLIGLKVRVTVADEVKSVGPAVYVCNHQSNYDI------FTVTGAVQPGVVA---VGKKSLLWLPFFGLIFWLSGNVLIDRSNRSRAIGTIGQVVERIKNRGTSIWMFPEGTRSKGRGLLPFKAGAFHTAVQAEVPVVPIVCSSYFG---QIDLNRWDNGEVLLEVMAPVCSKEHGAAGIRDLSDNCRARMEA 227
>gi|68471547|ref|XP_720080.1| potential fatty acyltransferase [Candida albicans SC5314] >gi|68471812|ref|XP_719949.1| potential fatty acyltransferase [Candida albicans SC5314] >gi|46441795|gb|EAL01089.1| potential fatty acyltransferase [Candida albicans SC5314] >gi|46441931|gb|EAL01224.1| potential fatty acyltransferase [Candida albicans SC5314] (293 aa)
Score = 118, Expect = 1.6e-04, Identities = 54/194 (27%), Positives = 84/194 (43%)
  Q:    43 LLGLTERQNYVYSLASKAVFCTFT-----KVKIKGSK---NIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           +L +  +  Y     +KA +   +     K+ IK  K   N+PA    + V NH+S  D+ V  K F+      P     T  SK  +     +G+   L  T F+DR       +V       L+   ++L +F EGTR   ++     FK  A   A      I+PVV+  T  +    K  IF   E+ +E L P+   D+
  S:    37 ILRIVNKAEYAQYAVAKACYYVVSLFLGLKINIKNEKYLQNLPA----IVVANHQSALDIYVLGKVFQ------PGY---TVTSKKSLKYVPFLGWFMALSGTFFLDRSKSASAKKVLDGALTGLKNQGKALFIFPEGTRSATEDLTMLPFKKGAFHLARQAGIPIIPVVVSNTSTIFNS-KRKIFNTGEINIEVLPPVSTSDW 226
>gi|151569704|gb|EDN35358.1| hypothetical protein FTCG_01111 [Francisella tularensis subsp. novicida GA99-3549] (246 aa)
Score = 118, Expect = 1.6e-04, Identities = 39/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP +   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-DYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|50289989|ref|XP_447426.1| hypothetical protein CAGL0I04070g [Candida glabrata CBS138] >gi|49526736|emb|CAG60363.1| unnamed protein product [Candida glabrata] (304 aa)
Score = 118, Expect = 1.6e-04, Identities = 49/181 (27%), Positives = 82/181 (45%)
  Q:    73 SKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           ++++   K  + V NH+S  D+L   + F       P+    T  +K  +     +G+   L  T F+DR N    V       + +++ +++L +F EGTR      +   FK  A   A      IVPVVI  T  +    K N+F    +T + L+PI  KD  +     ++EK++  ME
  S:    67 NEDVLKGKPFIAVSNHQSTLDILFLGRIF-------PQ--GCTVTAKKSLKYVPFLGWFMALSGTYFLDRSNREKSVSTLNRGLQNIREKKRALWIFPEGTRSYSTTPKILPFKKGAFHLAQQGQIPIVPVVISNTSTIMCS-KYNVFNRGCITCKVLDPIPTKDLKKEEVGELAEKVRNMME 239
>gi|118498305|ref|YP_899355.1| acyltransferase [Francisella tularensis subsp. novicida U112] >gi|194323889|ref|ZP_03057664.1| acetyltransferase [Francisella tularensis subsp. novicida FTE] >gi|118424211|gb|ABK90601.1| acyltransferase [Francisella tularensis subsp. novicida U112] >gi|194321786|gb|EDX19269.1| acetyltransferase [Francisella tularensis subsp. novicida FTE] (246 aa)
Score = 118, Expect = 1.7e-04, Identities = 39/134 (29%), Positives = 67/134 (50%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQN-LRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           VKI G +NIP +   ++V  H+S  +  V+   + +++       +  FV K E+ +    G A      I IDR N L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  T   I+PV
  S:    67 VKIDGKENIP-DYPCIYVSKHQSMLETFVF---YGLVR-------NCCFVMKQELLEKPIFGKANTFAEAIGIDRSNGLSAIKKVLEDGKDRVENKNLSIVIFPEGTRVPVGEYPKFHRSAMKLATVTNIPIIPV 190
>gi|15793411|ref|NP_283233.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria meningitidis Z2491] >gi|5051588|gb|AAD38301.1|AF036242_1 lysophosphatidic acid acyltransferase homolog NlaB [Neisseria meningitidis] >gi|121051401|emb|CAM07693.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria meningitidis Z2491] (247 aa)
Score = 118, Expect = 1.7e-04, Identities = 49/159 (30%), Positives = 81/159 (50%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQE--EKELLQKGEQS-LTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK-EVTV 225
           K +I G++NIP ++  +    H+S ++ L     F       P++    +V+K E+ K    G+  KL+ TI IDR N R+    N++  ++ L +K E   +T+F EGTR+   + G++K      A      IVPV +      E   K++  KY  E+TV
  S:    56 KYRIIGAENIP-DRPAVICAKHQSGWETLALQDIFP------PQV----YVAKRELFKIPFFGWGLKLVKTIGIDRNNRRE---ANEQLIKQGLARKNEGYWITIFPEGTRLAPGKRGKYKLGGARMAKMFEMDIVPVALNSG---EFWPKNSFLKYPGEITV 201
>gi|15827636|ref|NP_301899.1| transferase [Mycobacterium leprae TN] >gi|4883443|emb|CAB43152.1| putative acyltransferase [Mycobacterium leprae] >gi|13093187|emb|CAC31626.1| possible transferase [Mycobacterium leprae] (579 aa)
Score = 118, Expect = 1.7e-04, Identities = 49/195 (25%), Positives = 89/195 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           + + G++N+   +  +F+ NH++  D L+   A  +++       +   V+K E++K   +    KL + +FIDR +    V      ++  +KG  S+ +  EGTR+   E G FK      A +    IVP+V +    +     SN      V V  L  I   D+   + + +SE++ A++   YL I  D
  S:   309 LNVIGNENLTMQRPAVFIYNHRNQIDPLI---AGALVRG------NWIAVAKKELAKNPIIRALGKLTDGVFIDRDDPVGAVETLHAVEDRARKG-LSILMAPEGTRLDTTEVGPFKKGPFRIAMAVGIPIVPIV-FRNAEIVAARNSNTINPGMVDVAVLPAIPVDDW---TLDALSERI-AEVRQLYLDILAD 488
>gi|41406304|ref|NP_959140.1| hypothetical protein MAP0206 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41394652|gb|AAS02523.1| hypothetical protein MAP_0206 [Mycobacterium avium subsp. paratuberculosis K-10] (259 aa)
Score = 118, Expect = 1.7e-04, Identities = 49/195 (25%), Positives = 87/195 (44%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           V  T T++   G +NIP     +   NH S  D   +L A   +  +   +    F+ K E+ + K V F  K   TI +DR        V  +    L++GE  + V+ E T  +  E  EFK+ A   A      I+P++++G   +  K+H   + + K  +TV+   P++ ++ I  +   + + M   +  A
  S:    17 VKATGTEITYHGEENIPERGGAVVAINHTSYVD---FLPAGLAVHRRGRRL---RFMIKAEMQQVKVVNFLIKHTRTIPVDRGAGGGAYAVAVQR---LREGEL-VGVYPEATISRSFELKEFKTGAARMAIDAGVPIIPLIVWGAHRIWTKDHPRTLGRAKIPITVQVGAPLRAREDIAQTDAALRDAMTTLLHQA 203
>gi|118150442|ref|NP_001071200.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Danio rerio] >gi|116487654|gb|AAI25930.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Danio rerio] (271 aa)
Score = 118, Expect = 1.8e-04, Identities = 48/193 (24%), Positives = 85/193 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP--TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI 259
           + ++ G +++      + + NH+S+ DVL  +           EIL    T ++K E+     VG    L   +FI+R+   D   V  +  + +   +  L VF EGTR +      FK  A   A      I+P+V   Y    + KE +   FK   +T++ L  I+ K         +S++    M +A+++I
  S:    76 RYQVSGWEHLQTEGPYVIISNHQSSLDVLGMV-----------EILPDRCTMIAKKELIWAGTVGMICWLGGIVFINRKKTSDAKNVMSDAAKTMLTDKIRLWVFPEGTRNQNGGLLPFKKGAFHLAIQAQVPIIPIVFSSYSKFYLRKEKE---FKSGTITLKVLPKIETKGLTADDVTTLSDQAFGVMRSAFMEI 258
>gi|150024166|ref|YP_001294992.1| 1-acylglycerol-3-phosphate O-acyltransferase [Flavobacterium psychrophilum JIP02/86] >gi|149770707|emb|CAL42171.1| 1-acylglycerol-3-phosphate O-acyltransferase [Flavobacterium psychrophilum JIP02/86] (244 aa)
Score = 118, Expect = 1.8e-04, Identities = 38/134 (28%), Positives = 68/134 (50%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVL---VYLKAFKMIKEKRPEILDPTFVSKIEI-SKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTP--AYSTFCQIVPVVI 203
           IK  + IP    ++FV NH+S +D++    +L+AF            P FVSK E+ S    V +  +   ++ IDR++ +  +    +  + ++  ++S  +F EGTR K  E  +F  + L     Y+    +VP+ I
  S:    64 IKNREIIPKGVPIIFVSNHQSLYDIIGIIWFLRAFH-----------PKFVSKKELGSGVPSVSYNLRHGGSVLIDRKDPKQAISTIAQLSKYIEANKRSAVIFPEGTRSKTGEPKKFAESGLKILCKYAPSAHVVPISI 192
>gi|121635693|ref|YP_975938.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria meningitidis FAM18] >gi|120867399|emb|CAM11171.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria meningitidis FAM18] (247 aa)
Score = 118, Expect = 1.9e-04, Identities = 49/159 (30%), Positives = 81/159 (50%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQE--EKELLQKGEQS-LTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK-EVTV 225
           K +I G++NIP ++  +    H+S ++ L     F       P++    +V+K E+ K    G+  KL+ TI IDR N R+    N++  ++ L +K E   +T+F EGTR+   + G++K      A      IVPV +      E   K++  KY  E+TV
  S:    56 KYRIIGAENIP-DRPAVICAKHQSGWETLALQDIFP------PQV----YVAKRELFKIPFFGWGLKLVKTIGIDRNNRRE---ANEQLIKQGLARKNEGYWITIFPEGTRLAPGKRGKYKLGGARMAKMFEMDIVPVALNSG---EFWPKNSFLKYPGEITV 201
>gi|189347808|ref|YP_001944337.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium limicola DSM 245] >gi|189341955|gb|ACD91358.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium limicola DSM 245] (238 aa)
Score = 118, Expect = 1.9e-04, Identities = 43/168 (25%), Positives = 80/168 (47%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT--LGVEKEHKSNIFKYKEVTVEFLEPIKYKD 235
           +++ G  N   +++ + + NH    D+ + L A K         L+  FV+K E+ K    G+A K    + I R   R+ ++      ++L+ G +S+ +F EGTR +  +   FK  A   A      ++PV I G+  +  +K  + N  K K V  + L+P ++ +
  S:    55 IEVTGRDNYRTDRNYLVISNHAGMADIPLLLGAMK---------LNLRFVAKEELGKIPVFGWALKRSGYVMIKRGQNREALKSLLTVADVLKSG-KSVHIFPEGTRSETGKLLPFKRGAFLVAQKGGVPLLPVTIIGSNLITPKKSLRINKGKVKMVIGKPLDPSQFSN 214
>gi|194387740|dbj|BAG61283.1| unnamed protein product [Homo sapiens] (247 aa)
Score = 118, Expect = 1.9e-04, Identities = 46/178 (25%), Positives = 74/178 (41%)
  Q:    85 VPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           V NH+S+ D+L  ++         P    P  ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    65 VSNHQSSLDLLGMMEVL-------PGRCVP--IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 232
>gi|59802370|ref|YP_209082.1| NlaB [Neisseria gonorrhoeae FA 1090] >gi|194100016|ref|YP_002003155.1| NlaB [Neisseria gonorrhoeae NCCP11945] >gi|59719265|gb|AAW90670.1| putative 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria gonorrhoeae FA 1090] >gi|193935306|gb|ACF31130.1| NlaB [Neisseria gonorrhoeae NCCP11945] (247 aa)
Score = 117, Expect = 2.0e-04, Identities = 50/159 (31%), Positives = 82/159 (51%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQE--EKELLQKGEQS-LTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK-EVTV 225
           K +I G+++IP   SV+    H+S ++ L   + F       P++    +V+K E+ K    G+  KL+ TI IDR N R+    N++  ++ L +K E   +T+F EGTR+   + G++K      A      IVPV +      E   K++  KY  E+TV
  S:    56 KYRIIGAEHIPDRPSVI-CAKHQSGWETLALQEIFP------PQV----YVAKRELFKIPFFGWGLKLVKTIGIDRNNRRE---ANEQLIKQGLARKNEGYWITIFPEGTRLAPGKRGKYKLGGARMAKMFEMDIVPVALNSG---EFWPKNSFLKYPGEITV 201
>gi|82701341|ref|YP_410907.1| phospholipid/glycerol acyltransferase [Nitrosospira multiformis ATCC 25196] >gi|82409406|gb|ABB73515.1| lyso-ornithine lipid acyltransferase [Nitrosospira multiformis ATCC 25196] (225 aa)
Score = 117, Expect = 2.1e-04, Identities = 39/136 (28%), Positives = 61/136 (44%)
  Q:    68 VKIKGSKNIPA--NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           V+++    +PA   + VM   NH S  DV      + +I      +    FV+K EI      G+ +  + T+FI+R   RD  R+N    E L  G++ + VF EG          F ++ L PA +    + PV I
  S:    15 VRVRHQGILPAAGTQRVMLAANHVSWLDV------YSII-----SVCPARFVAKSEIRGWPLFGWLSNNVGTLFIERTKRRDTARINDHISEALNNGDR-VAVFPEGGTSDGTVLHHFHASLLQPAVTVSAMLHPVAI 140
>gi|115371878|ref|ZP_01459191.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha [Stigmatella aurantiaca DW4/3-1] >gi|115371113|gb|EAU70035.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha [Stigmatella aurantiaca DW4/3-1] (223 aa)
Score = 117, Expect = 2.1e-04, Identities = 41/163 (25%), Positives = 70/163 (42%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           +++G +N+P   + + V NH+S  D+LV    ++  K          +VSK    +   +G+   L   + + R +     R+  E ++ L +G   L +F EGTR        FK  A   A    C ++PVV+ GT     +H   +       V  L P+
  S:    37 RVEGRENLPWRGAAVLVANHESLGDILVLFGLYRPFK----------WVSKAANFRLPFIGWNMTLNRYVPLVRGDRESVGRMMVECEKWLLRGVPIL-MFPEGTRSPDGNIKAFKDGAFQLAVKLQCPVIPVVLTGTARTLPKHGLKLQTTARCRVRVLPPV 188
>gi|161869169|ref|YP_001598335.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria meningitidis 053442] >gi|161594722|gb|ABX72382.1| 1-acyl-SN-glycerol-3-phosphate acyltransferase [Neisseria meningitidis 053442] (211 aa)
Score = 117, Expect = 2.1e-04, Identities = 49/159 (30%), Positives = 81/159 (50%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQE--EKELLQKGEQS-LTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK-EVTV 225
           K +I G++NIP ++  +    H+S ++ L     F       P++    +V+K E+ K    G+  KL+ TI IDR N R+    N++  ++ L +K E   +T+F EGTR+   + G++K      A      IVPV +      E   K++  KY  E+TV
  S:    20 KYRIIGAENIP-DRPAVICAKHQSGWETLALQDIFP------PQV----YVAKRELFKIPFFGWGLKLVKTIGIDRNNRRE---ANEQLIKQGLARKNEGYWITIFPEGTRLAPGKRGKYKLGGARMAKMFEMDIVPVALNSG---EFWPKNSFLKYPGEITV 165
>gi|78065441|ref|YP_368210.1| lyso-ornithine lipid acyltransferase [Burkholderia sp. 383] >gi|77966186|gb|ABB07566.1| lyso-ornithine lipid acyltransferase [Burkholderia sp. 383] (285 aa)
Score = 117, Expect = 2.2e-04, Identities = 36/125 (28%), Positives = 57/125 (45%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         +   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +RV  E  E L+ G   + VF EGT     E   F +     A S  C + P+ +
  S:    61 DASALVVGNHVSWLDIYT-------VNAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRVMHEMAERLRNG-GLMCVFPEGTTTDGQELLPFHANLFQAAVSAGCAVQPICL 173
>gi|19704457|ref|NP_604019.1| long-chain-fatty-acid--CoA ligase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714723|gb|AAL95318.1| Long-chain-fatty-acid--CoA ligase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (828 aa)
Score = 117, Expect = 2.5e-04, Identities = 51/201 (25%), Positives = 95/201 (47%)
  Q:    53 VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFD--VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIK-----YKDYIQTSKELVSEKMKAKME 253
           ++   S   F TF +VK+KG + I  +K  +FV NH+S  D  +  Y    K++K+         F++ +   K+  + F A   N + +D    +D   V Q   +LL K  +++ ++ EG R +  +  +FK +    A      + P VI G   +    K    +  ++ VEFL+ IK     Y + +  +  ++  K+++  E
  S:   631 IFKFLSFIFFKTFFRVKVKGKEKIEKDKPTIFVANHQSFLDGFLFNYSVPLKVLKKT-------YFLATVIHFKSSIMKFMADSSNVVLVDMN--KDIAEVMQILAKLL-KENKNIAIYPEGLRTRDGKMNKFKKSFAILAKELNIDVQPYVIDGAYDLFPAGK-KFPRPGKIRVEFLDKIKVEKLTYDEIVNEAYSVIKNKIESDTE 827
>gi|194363881|ref|YP_002026491.1| phospholipid/glycerol acyltransferase [Stenotrophomonas maltophilia R551-3] >gi|194346685|gb|ACF49808.1| phospholipid/glycerol acyltransferase [Stenotrophomonas maltophilia R551-3] (263 aa)
Score = 117, Expect = 2.5e-04, Identities = 53/179 (29%), Positives = 83/179 (46%)
  Q:    77 PANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV-VIYG---------TLGVEKEHKSNIFKY-----KEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           P   +V+FV NH S  D+ + L + +M+           FV+K EI+    VG+ A    TIF  R N      V Q   + L+ G +++ VF EG      E G F +     A  T   + PV ++YG           G  +   +N  +      +   V FLEPI  +D     +  ++E  +A++ AA
  S:    80 PLPGAVLFVANHVSWVDISI-LHSQRMMG----------FVAKREIASWPLVGWLAARGQTIFHQRGNTESLGGVMQVMADRLRAG-KAVGVFPEGRTRGGHEVGPFHARIFQAAVETGVPVQPVALVYGAKGDAQTIVAFGPGESFAANFLRLLGEPARHTEVHFLEPIGTQDL--EGRRRIAETSRARIVAA 259
>gi|51013235|gb|AAT92911.1| YDL052C [Saccharomyces cerevisiae] (303 aa)
Score = 117, Expect = 2.5e-04, Identities = 51/196 (26%), Positives = 86/196 (43%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           VK+ G +N+ A K  + + NH+S  D+ +  + F       P     T  +K  +     +G    L  T F+DR   ++ +    +  E ++K +++L VF EGTR    E     FK  A   A      IVPVV+  T  +    K  +F    + V  L+PI  ++  +      +EK++ +M     +I   P
  S:    63 VKVVGEENL-AKKPYIMIANHQSTLDIFMLGRIFP------PGC---TVTAKKSLKYVPFLGRFMALSGTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQGKIPIVPVVVSNTSTLVSP-KYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVDTLKEIGYSP 249
>gi|54301694|ref|YP_131687.1| acyltransferase family protein [Photobacterium profundum SS9] >gi|46915114|emb|CAG21887.1| hypothetical acyltransferase family protein [Photobacterium profundum SS9] (945 aa)
Score = 117, Expect = 2.5e-04, Identities = 42/164 (25%), Positives = 71/164 (43%)
  Q:    43 LLGLTERQNYVYSLASKAV----FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           L+ +   + + +S+A   V      T T+V +KG +N+P N   + V NH S  D L+   A            +  FV+K E+ K          ++T F++R +++  V  +        +  +SL  F EGT  +     EF   A   A      +VP+ + GT
  S:   729 LVAVVPNKRWCWSVARLGVRLLILFTGTRVTMKGKENLPDNTPCILVANHSSYLDGLIMALAAPT---------ECNFVAKAELLKNPFARIFLSRLDTEFVERFDMQKGV-TDARRIAANARNNRSLFFFPEGTLYRMPGLHEFHMGAFIAAVDGALPVVPITLCGT 886
>gi|121609124|ref|YP_996931.1| phospholipid/glycerol acyltransferase [Verminephrobacter eiseniae EF01-2] >gi|121553764|gb|ABM57913.1| phospholipid/glycerol acyltransferase [Verminephrobacter eiseniae EF01-2] (283 aa)
Score = 116, Expect = 2.7e-04, Identities = 37/137 (27%), Positives = 72/137 (52%)
  Q:    67 KVKIKGSKNIP--ANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + ++ G +N+P  A +  + +  H+S ++ L       ++    P  L   +V K E+ +    G+A   +  I IDR Q LR F ++ Q+ ++LL +G   + +F EGTRI++ + G +++     A  T   +VP+ +
  S:    69 RTEVTGLENLPQGARQGAVLLVKHQSAYETL-------LLPTIMPHPL--AYVFKKELLQLPFFGWAIGRLQMIHIDRKQRLRAFHKLVQQGRQLLAEGIW-IIMFPEGTRIERGQTGVYQTGGARLAIDTGVPVVPIAV 198
>gi|94268153|ref|ZP_01291104.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [delta proteobacterium MLMS-1] >gi|93451711|gb|EAT02484.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [delta proteobacterium MLMS-1] (252 aa)
Score = 116, Expect = 2.7e-04, Identities = 44/198 (22%), Positives = 85/198 (42%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWS 266
           +I G  N+   +  +FV NH+S FD+ V    F+          D  +++K E+ +   +G+  +    I +DR + R  +       + +  G  S+ +F EGTR        FK+  +  A     ++VP+ I GT  +  + +  + +   V +E   PI    Y    K+ ++  ++ ++     K +  P  S
  S:    65 RINGLANLDGERPYIFVANHQSQFDIFVLQGYFEY---------DFRWLAKKELFQIPLLGWGMRRSGYIPVDRGHGRQALASLGVAAQRIAAG-TSVVIFPEGTRSPDGRLLPFKAGGMVLAIKAGVEVVPMAIAGTREILPKGRL-LPRPGPVCIEIGRPIASSAYNLKQKQELAALLEKEVRQLLAKAESAPQTS 251
>gi|52424565|ref|YP_087702.1| PlsC protein [Mannheimia succiniciproducens MBEL55E] >gi|52306617|gb|AAU37117.1| PlsC protein [Mannheimia succiniciproducens MBEL55E] (241 aa)
Score = 116, Expect = 2.8e-04, Identities = 47/180 (26%), Positives = 76/180 (42%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSE 246
           +V+ +   N+  N   +++ NH++N+D++       +    RP  +    V K  +      G        IF+DR N         E    +Q+   S+ +F EGTR +      FK+ A   A S    I+PVV   T    K+   N +   +V  E ++PI  + Y   SKE V E
  S:    52 RVEHRFPDNVDQNVPAIYIGNHQNNYDMVT------ISYMVRPRTVS---VGKKSLIWVPFFGILYWATGNIFLDRDNKNKAHNTMTELARRIQQDNISIWMFPEGTRSRGRGLLPFKTGAFHAAISAGVPIIPVVCSTT---HKKIDLNRWNNGKVICEIMQPIDTQSY---SKENVRE 216
>gi|124004022|ref|ZP_01688869.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Microscilla marina ATCC 23134] >gi|123990601|gb|EAY30081.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Microscilla marina ATCC 23134] (250 aa)
Score = 116, Expect = 2.8e-04, Identities = 40/175 (22%), Positives = 85/175 (48%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTP--AYSTFCQIVPVVIYGTLGVEKEHKSNI---FKYKEVTVEFLEPIKYK--DYIQTSKELV 244
           ++ ++ +P ++ ++ + NH+S FD+   +  F+    K        FV+K E+ K    + F  K   ++ IDR++     +  +   + +++  ++  +F EGTR +      FK+  +     +S    ++PV I G+  + K     I    KYK   +  +EP  Y   + +Q ++E +
  S:    65 LRSAQKVPTDRPIIIISNHQSMFDIPSIIWLFRKNHAK--------FVAKKELGKGIPSISFNLKHGGSVLIDRKDREQATQAIENLGKYIEEHNRAACIFPEGTRSRDGMLKPFKTTGIKTLLQHSPSALVIPVAISGSWELLKYKLKPIPFGVKYKTQILPPIEPANYSADEIVQKAEEQI 239
>gi|154249610|ref|YP_001410435.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Fervidobacterium nodosum Rt17-B1] >gi|154153546|gb|ABS60778.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Fervidobacterium nodosum Rt17-B1] (250 aa)
Score = 116, Expect = 2.9e-04, Identities = 46/165 (27%), Positives = 76/165 (46%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPT-FVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKEL 243
           N++ + V NH+S  D+ + +             + PT F++K E+ K   +    K + +  IDR N+R      +E  + L +G     +F EGTR    E  EFK  +L  A      I+PV I+G   V  +HK  I  Y +  +  +  + Y +  Q+ +EL
  S:    73 NRNYLVVCNHQSILDIPLVIG-----------YVGPTPFIAKKELGKFPMINVFLKYLGSELIDRGNIRQTALTIREVMKKLNEGYH-FVIFPEGTRSPDGEVHEFKPRSLEIAMKAKVPILPVSIWGNHLVIPKHKL-IVNYNKTGI-LIHDLVYPENFQSEEEL 224
>gi|150385426|ref|ZP_01924052.1| phospholipid/glycerol acyltransferase [Victivallis vadensis ATCC BAA-548] >gi|150258213|gb|EDM95500.1| phospholipid/glycerol acyltransferase [Victivallis vadensis ATCC BAA-548] (349 aa)
Score = 116, Expect = 3.1e-04, Identities = 47/184 (25%), Positives = 88/184 (47%)
  Q:    48 ERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKS-VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLR-DFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTL---GVEKEHKSNIFKYKEVTVEFLEPI 231
           +RQ+Y   L  + +     ++ ++G  ++       + V NH+S+ +  +       +   R   LD TFV K  +      G A + I+ I +DR N R DF  V +  +ELL++G +S+ +F E TR ++     F +  L  A S   +I+P+ +       G       ++ + + + +EF EP+
  S:   122 DRQSYYSGLNVRILESCGARIHLRGLNHLSDTPGPFVIVANHQSSVETAI----LNAVISPR---LDFTFVIKRSLFSVPFFGAAMRAIDAIGVDRVNPREDFKEVMRAGQELLKEG-RSVLIFPESTRQREFLPERFNTIGLKLAKSAGVRIIPLALKTDFLEPGALIPEFGSLHRSRHIHLEFGEPL 302
>gi|91203856|emb|CAJ71509.1| similar to 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGPacyltransferase) (1-AGPAT) (lysophosphatidic acid acyltransferase) (LPAAT). [Candidatus Kuenenia stuttgartiensis] (247 aa)
Score = 116, Expect = 3.2e-04, Identities = 49/176 (27%), Positives = 84/176 (47%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKE---VTVEFLEPIKYKDYIQTSKE 242
           KV ++G +NIP N+ V+F+ NH+S  D+ + L             ++ +F+SK  I     +G    +   I I R+  R  +  + +   EL  K ++SL +F EGTR +    G FK         +  ++VP+ I G+     +H      Y E   V + F +P+ + D  +T +E
  S:    64 KVALEGLENIPKNEPVIFIANHQSMMDIKLSLAYIP---------VNFSFISKEAIFHVPVLGAYMTVSGHIPIKREEDRKAYTSLIKAINELTAK-QKSLVIFPEGTRSEDGTLGTFKRGISLIVLKSKRRVVPMAISGSNRFMPKH--GFLSYPENRNVKISFGKPLSF-DNSRTDRE 230
>gi|153853959|ref|ZP_01995292.1| hypothetical protein DORLON_01283 [Dorea longicatena DSM 13814] >gi|149753341|gb|EDM63272.1| hypothetical protein DORLON_01283 [Dorea longicatena DSM 13814] (244 aa)
Score = 116, Expect = 3.2e-04, Identities = 43/180 (23%), Positives = 90/180 (50%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSE 246
           ++ + G +NI +   V+++ NH+S FD+++     K +           +++K E+     +    K +  +F+DR+N ++ ++   +  + ++ G  S+ +F EGTR K +E     F + +   A  T C I+P+ +  T  + + H   I K   V +E+ +PI  K+  +  K+ + E
  S:    58 ELTVIGEENI-SEGPVLYIGNHRSFFDIVITYARCKNLT---------GYIAKKEMLSIPLLRTWMKRLYCLFLDRENPKEGLKTILQAIDYVKHG-ISICIFPEGTRNKGEELSLLPFHNGSFKIAEKTGCPIIPMSLNNTCDIFEGHFPFI-KKTHVILEYGKPIYPKELDKDEKKRIGE 227
>gi|126662844|ref|ZP_01733843.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Flavobacteria bacterium BAL38] >gi|126626223|gb|EAZ96912.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Flavobacteria bacterium BAL38] (271 aa)
Score = 116, Expect = 3.2e-04, Identities = 36/127 (28%), Positives = 60/127 (47%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAY 192
           T   I+G +NIP NK ++ V NH+S  D+   +   + +         P F+SKIE+ K    V +  +   +  I+R++ +  +   ++  EL+     S+ +F EGTR K  E   F    L   Y
  S:    87 TTYHIEGMENIPENKPLIIVANHQSLHDITTIIWFLRKVH--------PKFISKIELGKGIPSVSYNLRHGGSALINRKDPKQALPEIKKVAELVNNNNYSVVIFPEGTRSKTGEPKPFAVNGLKMLY 206
>gi|163757738|ref|ZP_02164827.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Hoeflea phototrophica DFL-43] >gi|162285240|gb|EDQ35522.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Hoeflea phototrophica DFL-43] (265 aa)
Score = 116, Expect = 3.4e-04, Identities = 40/143 (27%), Positives = 64/143 (44%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFK-------SAALTPAYSTFCQIVPVVI 203
           + C    +K+     + A + ++ V NH S  D++V              + D  F++K E+ +    G+ A+L  ++F+DR   R+      E  E L  GE ++ +F EGT    +    FK       SAAL  A      I PV I
  S:    46 IMCRIIGLKVVVHGRLSAERPLLIVSNHISWKDIMVL-----------GSVADVVFIAKFEVRQWPVFGWLARLQRSVFVDRARPREVGVQTSEVSERLLAGE-AVVLFAEGTTSDGNRVMPFKSSLFGAASAALPRAPDNTVHIQPVAI 183
>gi|86134918|ref|ZP_01053500.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Tenacibaculum sp. MED152] >gi|85821781|gb|EAQ42928.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Polaribacter dokdonensis MED152] (242 aa)
Score = 115, Expect = 3.5e-04, Identities = 45/163 (27%), Positives = 75/163 (46%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLV---YLKAFKMIKEKRPEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALT--PAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIK 232
           +K    +P N S++FV NH+S FD+     Y + FK           P FV+K E+ K    V +  +      I+R++ +  +    +  + + K +    +F EGTR K  E  +F S  L     Y+    +VP+ I  +  V K  K  +     +T+   +PIK
  S:    63 LKNEHELPKNTSLIFVANHQSTFDIPPIGWYFREFK-----------PKFVAKYELGKGIPSVSYNLRHGGAALINRKDPKQAISALVDFSKRINKNKWGAIIFPEGTRSKTGEPKKFASNGLKVITKYNKDGYVVPLTINNSWKVFKYGKFPLGIGSPITITTHKPIK 220
>gi|110759980|ref|XP_001120897.1| PREDICTED: similar to CG3812-PA, isoform A [Apis mellifera] (211 aa)
Score = 115, Expect = 3.6e-04, Identities = 34/134 (25%), Positives = 66/134 (49%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVV 202
           +++G +++  ++  + V NH+S FD+L   + + ++K+        T +++ E+      G AA L   IFIDR+N      +  +  + +++ +  L ++ EGTR    E   FK  A   A      I+P+V
  S:    23 ELRGKEHLEQDRGCIIVSNHQSAFDILGMYQIWPIMKK-------CTAIARRELFYVWPFGLAAWLAGLIFIDRRNAEKARLLINDTAKYVKEKKIKLWIYPEGTRRNTGEIHPFKKGAFYAAIHGQIPILPIV 149
>gi|94969645|ref|YP_591693.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Acidobacteria bacterium Ellin345] >gi|94551695|gb|ABF41619.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Acidobacteria bacterium Ellin345] (244 aa)
Score = 115, Expect = 3.7e-04, Identities = 44/165 (26%), Positives = 71/165 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP------TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           K+ I G +NI   +  +F+ NH SN D               P I+ P      + + K E+ +   +G A KL   + +DR N    V   +   +++Q G   + VF EGTR    +    K         +   ++PV I G+  +  +H+  I     VT+ F  PI
  S:    53 KITIVGLENIQPGQHYIFMSNHVSNMD---------------PPIVIPLIPGRTSVLVKKELFRIPLLGTAMKLAQLVPVDRSNREAAVASIRAASDVMQHGLH-MAVFPEGTRSSDGKMRPLKKGPFYLVEESGAAVIPVTIAGSYEMWPKHRFAITP-GPVTLTFHPPI 206
>gi|149245478|ref|XP_001527216.1| hypothetical protein LELG_02045 [Lodderomyces elongisporus NRRL YB-4239] >gi|146449610|gb|EDK43866.1| hypothetical protein LELG_02045 [Lodderomyces elongisporus NRRL YB-4239] (288 aa)
Score = 115, Expect = 4.0e-04, Identities = 62/227 (27%), Positives = 107/227 (47%)
  Q:    43 LLGLTERQNYVYSLASKAVFCTF-----TKVKIKGS---KNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVS----------EKMKA--KMEAAYLKIKEDPNWSEKE 269
           LL +  +  Y     ++  + TF      K+ IK     K++PA    + + NH+S  D+L+  K F+            T  SK  +     +G+   L  T F++R       +V     + L++ E++L +F EGTR   +      FK  A   A      ++PVV+  T  +    K  IF   E+ +E L P+   D ++T++++ +          EK+K+    +A  +K  ED   SE E
  S:    35 LLRIVGKIEYAQYTVARVFYHTFRTLLGVKITIKNEHYLKDLPA----IVISNHQSALDILILGKVFQP---------GYTVTSKASLKYVPFLGWFMALSGTFFLNRSKSAQAKKVLDGALQNLKQQERALFMFPEGTRSATEALDMLPFKKGAFHLAKQARIPVIPVVVSNTSTIFNA-KRKIFNTGEIFIEVLPPVSTDD-LETNEDVTNICAEVRKSMIEKLKSIGYSKAPGVKPSEDHYPSENE 268
>gi|71001026|ref|XP_755194.1| 1-acylglycerol-3-phosphate acyltransferase (AtaAp) [Aspergillus fumigatus Af293] >gi|66852832|gb|EAL93156.1| 1-acylglycerol-3-phosphate acyltransferase (AtaAp), putative [Aspergillus fumigatus Af293] >gi|159129283|gb|EDP54397.1| 1-acylglycerol-3-phosphate acyltransferase (AtaAp), putative [Aspergillus fumigatus A1163] (292 aa)
Score = 115, Expect = 4.1e-04, Identities = 40/133 (30%), Positives = 63/133 (47%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRV---GFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVV 202
           I+G++++ + +  +F+ NH+S  DVL+    F            P + S       K +   G+   L  T+FIDR N    ++      E ++K  QS+ +F EGTR   +K E   FK  A   A      IVP+V
  S:    90 IQGAEHL-STRPAVFIGNHQSELDVLMLGHIF------------PPYCSVTAKKSLKHIPFLGWFMALSRTVFIDRANRETAMKAFDGAAEEMRKYRQSVFIFPEGTRSYSEKPELLPFKKGAFHLAVKAGVPIVPIV 214
>gi|126699425|ref|YP_001088322.1| putative acyltransferase [Clostridium difficile 630] >gi|145954706|ref|ZP_01803711.1| hypothetical protein CdifQ_04002103 [Clostridium difficile QCD-32g58] >gi|168723758|ref|ZP_02756035.1| putative acyltransferase [Clostridium difficile QCD-76w55] >gi|168730473|ref|ZP_02762750.1| putative acyltransferase [Clostridium difficile QCD-97b34] >gi|115250862|emb|CAJ68687.1| putative acyltransferase [Clostridium difficile 630] (198 aa)
Score = 115, Expect = 4.1e-04, Identities = 53/194 (27%), Positives = 93/194 (47%)
  Q:    65 FTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK---EVTVEFLEPIKYKDYIQTS-----KELVSEKMKAKMEAAYLK 258
           F K ++ G++NIP   +++   NHKSN D +    A         E  +   ++K E+ K K +GF  K ++ + I+R+   D   +    + +  +    L +F EGTRIK D FG+ K+        +  ++VPV I             I KYK   +V V   EPI ++++ +        E +S+++   ++  Y K
  S:    18 FFKYEVIGAENIPDRGNIVIASNHKSNLDPIFLAAAI--------ENREIAAIAKKELFKVKPLGFILKKLHVMPINREK-PDVSTIKTILRSV--RDGYVLGIFPEGTRIKGDSFGKAKAGLSVFTIKSKSKVVPVSI-------------ISKYKLFSKVIVYIGEPISFEEHFKEKLSNDDHERISQEILEVIKQNYFK 195
>gi|119480677|ref|XP_001260367.1| 1-acylglycerol-3-phosphate acyltransferase (AtaAp), putative [Neosartorya fischeri NRRL 181] >gi|119408521|gb|EAW18470.1| 1-acylglycerol-3-phosphate acyltransferase (AtaAp), putative [Neosartorya fischeri NRRL 181] (292 aa)
Score = 115, Expect = 4.2e-04, Identities = 40/133 (30%), Positives = 64/133 (48%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVV 202
           I+G++++ + +  +F+ NH+S  DVL+    F       P     T  +K  +     +G+   L  T+FIDR N    ++      E ++K  QS+ +F EGTR   +K E   FK  A   A      IVP+V
  S:    90 IQGAEHL-STRPAVFIGNHQSELDVLMLGYIF-------PPYCSVT--AKKSLKNIPFLGWFMALSRTVFIDRANRETAMKAFDGAAEEMRKHRQSVFIFPEGTRSYSEKPELLPFKKGAFHLAVKAGVPIVPIV 214
>gi|196125786|ref|ZP_03117535.1| putative acyltransferase [Clostridium difficile ATCC 43255] (197 aa)
Score = 115, Expect = 4.3e-04, Identities = 53/197 (26%), Positives = 93/197 (47%)
  Q:    62 FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK---EVTVEFLEPIKYKDYIQTS-----KELVSEKMKAKMEAAYLK 258
           F    K ++ G++NIP   +++   NHKSN D +    A         E  +   ++K E+ K K +GF  K ++ + I+R+   D   +    + +  +    L +F EGTRIK D FG+ K+        +  ++VPV I             I KYK   +V V   EPI ++++ +        E +S+++   ++  Y K
  S:    14 FLNIFKYEVIGAENIPDRGNIVIASNHKSNLDPIFLAAAI--------ENREIAAIAKKELFKVKPLGFILKKLHVMPINREK-PDVSTIKTILRSV--RDGYVLGIFPEGTRIKGDSFGKAKAGLSVFTIKSKSKVVPVSI-------------ISKYKLFSKVIVYIGEPISFEEHFKEKLSNDDHERISQEILEVIKQNYFK 194
>gi|149909421|ref|ZP_01898076.1| putative 1-acyl-sn-glycerol-3-phosphateacyltransferase [Moritella sp. PE36] >gi|149807531|gb|EDM67480.1| putative 1-acyl-sn-glycerol-3-phosphateacyltransferase [Moritella sp. PE36] (239 aa)
Score = 115, Expect = 4.3e-04, Identities = 46/171 (26%), Positives = 71/171 (41%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           +FV NH++N+D++       M    +P  +    V K  +      GF   L   I IDR N            + ++KG  S+ +F EGTR +      FK+ A   A      IVPV    T     + K N +   EV +E + PI      ++S   +S  + A M+
  S:    68 VFVGNHQNNYDLVT------MTAAVQPGTVS---VGKKSLVWVPIFGFVYWLSGNILIDRNNKSKAFGTISAVADRIRKGHLSIWMFAEGTRSRGRGLLPFKTGAFHTAIQAEVPIVPVCCSNT---HNKIKLNRWDNGEVIIEIMAPIPTVGLERSSVRKLSTDVHAIMK 226
>gi|118620014|ref|YP_908346.1| acyltransferase [Mycobacterium ulcerans Agy99] >gi|118572124|gb|ABL06875.1| acyltransferase [Mycobacterium ulcerans Agy99] (251 aa)
Score = 115, Expect = 4.3e-04, Identities = 44/150 (29%), Positives = 65/150 (43%)
  Q:    56 LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           LA   V  T T++   G +N+P     +   NH S  D L    A  M +  R       F+ K E+ + K V F  K   TI +DR        +  +    L++GE  + V+ E T  +  E  EFK+ A   A      IVPV+++G
  S:    12 LAKLLVLATGTRITYVGVENVPERGGAVIAINHTSYVDWLP--AALAMNRRHR----RMRFMIKAEMQRVKVVNFLIKRTRTIPVDRGAGAGAYALAVQR---LREGEL-VGVYPEATISRSFELKEFKTGAARMALDADVPIVPVIVWG 151
>gi|183985346|ref|YP_001853637.1| acyltransferase [Mycobacterium marinum M] >gi|183178672|gb|ACC43782.1| acyltransferase [Mycobacterium marinum M] (251 aa)
Score = 114, Expect = 4.5e-04, Identities = 44/150 (29%), Positives = 65/150 (43%)
  Q:    56 LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG 205
           LA   V  T T++   G +N+P     +   NH S  D L    A  M +  R       F+ K E+ + K V F  K   TI +DR        +  +    L++GE  + V+ E T  +  E  EFK+ A   A      IVPV+++G
  S:    12 LAKLLVLATGTRITYVGVENVPERGGAVIAINHTSYVDWLP--AALAMNRRHR----RMRFMIKAEMQRVKVVNFLIKRTRTIPVDRGAGAGAYALAVQR---LREGEL-VGVYPEATISRSFELKEFKTGAARMALDADVPIVPVIVWG 151
>gi|119504519|ref|ZP_01626598.1| phospholipid/glycerol acyltransferase [marine gamma proteobacterium HTCC2080] >gi|119459541|gb|EAW40637.1| phospholipid/glycerol acyltransferase [marine gamma proteobacterium HTCC2080] (249 aa)
Score = 114, Expect = 4.5e-04, Identities = 45/187 (24%), Positives = 84/187 (44%)
  Q:    17 PFCVFFLWLSLRSSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPA---NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQ-NLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           P   F L  SL  S ++   W   P          Y+Y+      +    K ++ G +N+P    N+ ++  P H+S ++          I    P  L   +V K E+      G+A   ++ + IDR    + + +V     +L+ KG+  + +F EGTR  + + G++K+ A   A +T  +I+P+ +
  S:    19 PVGTFLLIFSLFVSAERLWWWFAQP----------YLYAAILVVRWVGGVKYRVLGLENLPDIDDNQRIILCPKHQSTWETF-------FIPSMTPHPL--AYVFKRELLLIPFFGWAMARLDMVHIDRSARSQAWSKVADLGVKLMDKGKW-VIMFPEGTRTHRGQQGDYKNGAARLALATGAKIIPIAV 189
>gi|33151322|ref|NP_872675.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Haemophilus ducreyi 35000HP] >gi|33147542|gb|AAP95064.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Haemophilus ducreyi 35000HP] (241 aa)
Score = 114, Expect = 4.6e-04, Identities = 46/174 (26%), Positives = 82/174 (47%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTV--EFLEPIKYKDYIQTS-KELVSEK---MKAKM 252
           N+  +++ NH++N+D+L        I    P  L    + K  +      G A      IFIDRQ   + +    +  +++ + + S+ +F EGTR +      FK+ A   A +    IVP+V          +K ++ ++   TV  E LEPI  + Y + + +EL+ +    M AK+
  S:    62 NQQAIYIANHQNNYDMLT-------IAGMVP--LRTVTIGKKSLIWLPFFGLAYWATGNIFIDRQKRSNAINTMSKVIKIIHERQISIWMFPEGTRSRGRGLLPFKTGAFHTAITAGLPIVPIVCSNL-----HNKVDLNRWDNGTVICEMLEPIDTRGYNRENLRELIDKSYTMMAAKI 227
>gi|53728818|ref|ZP_00134952.2| COG0204: 1-acyl-sn-glycerol-3-phosphate acyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208952|ref|YP_001054177.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Actinobacillus pleuropneumoniae L20] >gi|126097744|gb|ABN74572.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Actinobacillus pleuropneumoniae L20] (244 aa)
Score = 114, Expect = 4.7e-04, Identities = 49/178 (27%), Positives = 83/178 (46%)
  Q:    77 PA-NKSVMFVPNHKSNFDVLV---YLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTS-KELVSEK---MKAKMEA 254
           PA N+S +++ NH++N+D+L     +    +   K+  I  P F            G        IFI+R+     +    +  E++++ + S+ +F EGTR +      FK+ A   A +    IVP+V      +  +   N +    V  E LEPI    Y + + KEL+ +    M AK+EA
  S:    59 PAFNQSAIYIANHQNNYDMLTIAGMVPPRTVTIGKKSLIWIPFF------------GLVYWATGNIFINREKRSSAISTMNKVGEIIRERQISIWMFPEGTRSRGRGLLPFKTGAFHTAIAAGVPIVPIVCS---SLHNKVDLNRWNNGVVICETLEPIDTSGYNRDNIKELIEKSYAVMSAKIEA 229
>gi|34497113|ref|NP_901328.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chromobacterium violaceum ATCC 12472] >gi|34102970|gb|AAQ59334.1| probable 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chromobacterium violaceum ATCC 12472] (258 aa)
Score = 114, Expect = 4.8e-04, Identities = 44/135 (32%), Positives = 65/135 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQS------LTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           K K+ G++NIP+  SV+    H+S ++ L   K F              +V+K E++     G+   L+N I I+R    D  R NQ    LL +G +       +TVF EGTR K    G++K  A   A      +VPV
  S:    59 KYKVIGAENIPSAPSVI-ASKHQSGWETLALQKIFPW----------QVYVAKRELTWIPLFGWGLVLMNPIIINRS---DRARANQR---LLDQGLERKRHGFWITVFPEGTRTKPGVGGKYKLGAARMAKQFDMPMVPV 182
>gi|170692125|ref|ZP_02883289.1| phospholipid/glycerol acyltransferase [Burkholderia graminis C4D1M] >gi|170143409|gb|EDT11573.1| phospholipid/glycerol acyltransferase [Burkholderia graminis C4D1M] (279 aa)
Score = 114, Expect = 5.0e-04, Identities = 39/125 (31%), Positives = 55/125 (44%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           ++  + V NH S  D+ V       I   RP      FVSK EI     VG+ A+ ++T+FI R+   D  R+  E  + L  GE  + VF EGT     E   F +     A S    + P+ I
  S:    62 DRGALVVANHISWIDIYV-------INAWRPT----PFVSKAEIRHWPLVGWLAQQLDTVFIQREKRSDAKRIMHELSDRLSAGEL-MCVFPEGTTSNGLELLPFHANMFQAAVSASVPVQPLCI 174
>gi|196163941|ref|ZP_03124472.1| putative acyltransferase [Clostridium difficile QCD-23m63] (198 aa)
Score = 114, Expect = 5.4e-04, Identities = 53/194 (27%), Positives = 93/194 (47%)
  Q:    65 FTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK---EVTVEFLEPIKYKDYIQTS-----KELVSEKMKAKMEAAYLK 258
           F K ++ G++NIP   +++   NHKSN D +    A         E  +   ++K E+ K K +GF  K ++ + I+R+   D   +    + +  +    L +F EGTRIK D FG+ K+        +  ++VPV I             I KYK   +V V   EPI ++++ +        E +S+++   ++  Y K
  S:    18 FFKYEVIGAENIPDRGNIVIASNHKSNLDPIFLAAAV--------ENREIAAIAKKELFKVKPLGFILKKMHVMPINREK-PDVSTIKTILRSV--RDGYVLGIFPEGTRIKGDSFGKAKAGLSVFTIKSKSKVVPVSI-------------ISKYKLFSKVIVYIGEPISFEEHFKEKLTNDDHERISQEILEVIKQNYFK 195
>gi|145246442|ref|XP_001395470.1| hypothetical protein An12g03960 [Aspergillus niger] >gi|134080186|emb|CAK46166.1| unnamed protein product [Aspergillus niger] (293 aa)
Score = 114, Expect = 5.6e-04, Identities = 48/192 (25%), Positives = 80/192 (41%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRV---GFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKD--EFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           ++G++++    +V F+ NH+S  DVL+    F            P + S       K +   G+   L  T+FIDR N    V+      + ++   QS+ +F EGTR   D  E   FK  A   A      IVPVV      V        F+   + ++ L PI  +       + +++  +  M    L++ E
  S:    90 VEGAEHLNTRPAV-FIGNHQSELDVLMLGYIF------------PPYCSVTAKKSLKHIPFLGWFMALSRTVFIDRANRETAVKAFDSAADEMRNHRQSVFIFAEGTRSYSDTPELLPFKKGAFHLALKAGVPIVPVVTENYSHVLSPRNMR-FEPGTIKIKVLPPISTEGLTTADIDALTKSTRESMLKTLLELAE 272
>gi|85709118|ref|ZP_01040184.1| putative acyltransferase transmembrane protein [Erythrobacter sp. NAP1] >gi|85690652|gb|EAQ30655.1| putative acyltransferase transmembrane protein [Erythrobacter sp. NAP1] (307 aa)
Score = 114, Expect = 5.7e-04, Identities = 54/197 (27%), Positives = 92/197 (46%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALT----PAYSTFCQIV-----PVVIY-GTLGVEK--EHKSNIFKYK---EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           KVK++G+      + V ++ NH S  D+L    A               FV+K E++K   VG+ A +  T+++ R++     +     KE L     S+TVF EGT         FK++ L+    P      Q V     PV  + G +G E    +   +   K   ++ + FLEP    DY+   ++ +S + + ++E A L+    P
  S:    86 KVKVEGTH---LKRDVFYIANHVSWIDILSLSGA-----------CGTAFVAKAELAKAPLVGWLADMNRTVYVKREHRMGVAQQINALKEALAD-NWSVTVFPEGTTTDGQSLLPFKTSMLSVLEPPPPGVLVQPVLLDYGPVAEWIGWIGEEGGLNNAKRVLARKGTFDMRIVFLEPFSPADYV--GRKAISVEARRRIEEALLEALGKP 280
>gi|163803760|ref|ZP_02197617.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio campbellii AND4] >gi|159172444|gb|EDP57313.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio campbellii AND4] (241 aa)
Score = 114, Expect = 5.7e-04, Identities = 46/179 (25%), Positives = 84/179 (46%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEH-KSNIFKYKEVTVEFLEPIKYKDY-IQTSKELVS---EKMKAKMEAAYLKIKE 261
           +++ NH++N+D+      F +     P+++    V K  ++     G    L   I IDR N         +  + ++  + S+ +F EGTR +      FK+ A   A      I+P+V   T     +H K N +    V +E L P+  + Y  + ++EL +   E+MK K+EA   ++K+
  S:    68 VYIANHQNNWDL------FTVSSAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANRSKAKGTIDQVIDSIKNSDVSVWMFPEGTRSRGRGLLPFKTGAFHAAIGAEVPIIPIVCSST-----DHIKFNRWNNGHVIIEMLPPVSTQGYGKEGTRELANVCREQMKEKLEALDAEVKQ 237
>gi|165976916|ref|YP_001652509.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150817|ref|YP_001969342.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165877017|gb|ABY70065.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189915948|gb|ACE62200.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (248 aa)
Score = 114, Expect = 5.8e-04, Identities = 49/178 (27%), Positives = 83/178 (46%)
  Q:    77 PA-NKSVMFVPNHKSNFDVLV---YLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTS-KELVSEK---MKAKMEA 254
           PA N+S +++ NH++N+D+L     +    +   K+  I  P F            G        IFI+R+     +    +  E++++ + S+ +F EGTR +      FK+ A   A +    IVP+V      +  +   N +    V  E LEPI    Y + + KEL+ +    M AK+EA
  S:    59 PAFNQSAIYIANHQNNYDMLTIAGMVPPRTVTIGKKSLIWIPFF------------GLVYWATGNIFINREKRSSAISTMNKVGEIIRERQISIWMFPEGTRSRGRGLLPFKTGAFHTAIAAGVPIVPIVCS---SLHNKVDLNRWNNGVVICETLEPIDTSGYNRDNIKELIEKSYAVMSAKIEA 229
>gi|3914376|sp|Q42870|PLSC_LIMDO 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) >gi|1197334|emb|CAA58239.1| 1-acylglycerol-3-phosphate O-acyltransferase [Limnanthes douglasii] >gi|89147818|gb|ABD62751.1| acyl-CoA:sn-1-acylglycerol-3-phosphate acyltransferase [Limnanthes douglasii] (281 aa)
Score = 113, Expect = 5.9e-04, Identities = 44/169 (26%), Positives = 78/169 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDV--LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEV--TVEFLEPIKYKDY 236
           +KI+GS++    K  +++ NH S  D   +++L     +            V+K E+     +G    L + I IDR N    ++  +E   ++ +   SL +F EGTR +      FK   +  A  +   IVP+++ GT       +   F+ + V  TV++L PI   D+
  S:    91 IKIQGSEH--TKKRAIYISNHASPIDAFFVMWLAPIGTVG-----------VAKKEVIWYPLLGQLYTLAHHIRIDRSNPAAAIQSMKEAVRVITEKNLSLIMFPEGTRSRDGRLLPFKKGFVHLALQSHLPIVPMILTGT---HLAWRKGTFRVRPVPITVKYLPPINTDDW 247
>gi|145220434|ref|YP_001131143.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prosthecochloris vibrioformis DSM 265] >gi|145206598|gb|ABP37641.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prosthecochloris vibrioformis DSM 265] (230 aa)
Score = 113, Expect = 5.9e-04, Identities = 38/140 (27%), Positives = 64/140 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           +V ++G +N     + + V NH    D+ + L   K         L+  FV+K E+ K    G+A K    + I R   R+ ++   E   +++ G +S+ +F EGTR +      FK  A   A     +I+PV I G+
  S:    54 EVTVEGEENYRPEGNYLVVSNHAGMADIPLLLGWMK---------LNLRFVAKEELGKIPVFGWALKSGGYVMIKRGQNREALKSLLEAASVIKSG-RSVHIFPEGTRSETGTLLPFKRGAFLVARKADAEILPVTIIGS 183
>gi|170732193|ref|YP_001764140.1| phospholipid/glycerol acyltransferase [Burkholderia cenocepacia MC0-3] >gi|169815435|gb|ACA90018.1| phospholipid/glycerol acyltransferase [Burkholderia cenocepacia MC0-3] (285 aa)
Score = 113, Expect = 6.2e-04, Identities = 35/125 (28%), Positives = 57/125 (45%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         +   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +R+  E  E L+ G   + VF EGT     E   F +     A S  C + P+ +
  S:    61 DASALVVGNHVSWLDIYA-------VNAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRIMHEMAERLRTG-GLMCVFPEGTTSDGQELLPFHANLFQAAVSAGCAVQPICL 173
>gi|90415374|ref|ZP_01223308.1| probable acyltransferase [marine gamma proteobacterium HTCC2207] >gi|90332697|gb|EAS47867.1| probable acyltransferase [marine gamma proteobacterium HTCC2207] (240 aa)
Score = 113, Expect = 6.4e-04, Identities = 40/135 (29%), Positives = 67/135 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDV--LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           K+ ++G  NIP +  V+ + NH+S ++   L YL     +  KR  +  P F            G+    +  I I R N    +R V ++ K+ L KG  ++ +F EGTR++  + G F ++    A ST  Q++PV
  S:    67 KINVRGLDNIPTSACVV-LSNHQSTWETFFLQYLFVPASVILKRELLWIPFF------------GWGLYFMRAIAIKRSNPAGAIRQVLKQGKQRLAKG-INVVIFPEGTRVRGADLGAFMTSGAALAKSTGVQLLPV 190
>gi|83590177|ref|YP_430186.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Moorella thermoacetica ATCC 39073] >gi|83573091|gb|ABC19643.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Moorella thermoacetica ATCC 39073] (193 aa)
Score = 113, Expect = 6.5e-04, Identities = 54/193 (27%), Positives = 87/193 (45%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAF-KMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTS-KELVSEKMKAKMEAAYLKIKE 261
           +++G +NIPA   V+ V NH S  D +V   AF +M++    E L       I I K    G  A  +     DR  L+  +++       L +G Q L +F EGTR        F++ A   A  T   ++PV I  T          +F+   + + F  P+K    I TS +   S++++    AAY ++K+
  S:    21 EVRGQENIPAEGPVVIVANHVSYLDPVVVGVAFPRMVRFMAKEEL-----FHIPIFKYIIRGLQAFPVRRGESDRAALKTALQI-------LHQG-QVLGIFPEGTRSPDGRLLPFQAGAAVLALKTGAVLLPVAIKDT--------DRVFRGGHIKITFGRPLK----ITTSGRNYTSQQVQDLTSAAYQEVKK 190
>gi|145297619|ref|YP_001140460.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142850391|gb|ABO88712.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Aeromonas salmonicida subsp. salmonicida A449] (242 aa)
Score = 113, Expect = 6.6e-04, Identities = 47/193 (24%), Positives = 81/193 (41%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI 259
           KVK+     I +    ++V NH+SNFD+      F +     P ++    V K  +      G    L   + IDR N    +    +  + ++    S+ +F EGTR K      FK+ A   A      +VP+V     G   +   N +   EV VE + P+  K++       +S+  +A ME+  +++
  S:    52 KVKVTIPDEIKSLGPAVYVCNHQSNFDI------FTVTGAVMPGVVA---VGKKSLLWLPFFGLIFWLSGNVLIDRSNRSRAIGTIGQVVDRIKNHGTSIWMFPEGTRSKGRGLLPFKAGAFHTAVQAEVPVVPIVCSSYFG---QVDLNRWDNGEVLVEVMAPLCSKEHGAAGIRDLSDTCRAAMESKLVEL 232
>gi|88770658|gb|ABD51932.1| chloroplast lysophosphatidic acid acyltransferase [Guillardia theta] (265 aa)
Score = 113, Expect = 6.7e-04, Identities = 55/198 (27%), Positives = 91/198 (45%)
  Q:    65 FTKVKIKGSKNIPA--NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT---LGVEKEHKSNIFKYK--EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           F +  I G +NI    + +V+FV NH+S  D+++        K          +VSK        +G+   + + + + R +     ++ +  K+ L+ G  SL  F EG+R    +   FK  A + A      IVP+V+ G+   L   K     I+      +T++ LEPI Y D    S E + EK++  M   + KIK D
  S:    59 FCQTTILGRENIKKVRDNAVIFVCNHQSTTDIMLLYGIETHFK----------WVSKSSNFMIPFIGWNMWMNDYVPVKRGDKDSVHKMFEHCKKHLKAG-NSLVFFPEGSRSTDGQIKAFKPGAFSLAMEAKVPIVPLVLDGSADCLTAGKGMTVAIYNGGGWNITLKALEPI-YPDKFGNSVESLMEKVRNIMVEDFEKIKSD 251
>gi|167756642|ref|ZP_02428769.1| hypothetical protein CLORAM_02179 [Clostridium ramosum DSM 1402] >gi|167702817|gb|EDS17396.1| hypothetical protein CLORAM_02179 [Clostridium ramosum DSM 1402] (238 aa)
Score = 113, Expect = 6.8e-04, Identities = 46/189 (24%), Positives = 81/189 (42%)
  Q:    48 ERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRP--EILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKK-DEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           ER  +++ + +        +++  G +N+P        PNH+  FD L   +        RP   I+    VS I +          K++  I +DR N+R+  ++ +     +  G ++  VF EGTR +  +   EFK      A      IVPV +   +   K   +N  K     + +L+PI Y++Y
  S:    36 ERYGFIHQVVAIVTRKARVELECYGVENLPKKSGYFVAPNHQGLFDPLAIFQT-----HSRPIRAIVKKELVSVILVKDV------IKMLEFISMDRSNVRESAKIIKYVANEVAAG-KNFFVFPEGTRSRDGNNILEFKGGTFKIATKAKAPIVPVAL---IDCYKVFDNNTIKKTTAQIHYLKPIYYEEY 212
>gi|163791107|ref|ZP_02185527.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Carnobacterium sp. AT7] >gi|159873663|gb|EDP67747.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Carnobacterium sp. AT7] (206 aa)
Score = 113, Expect = 6.9e-04, Identities = 54/190 (28%), Positives = 89/190 (46%)
  Q:    76 IPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKE---LVSEKMKAKMEAAYLKIKEDPNW 265
           +P + S + V  H++  D  VYL    +    +P     TF++K E+ K   + +  +  N   +DR N        +   ++L+KG+ SL +F  GTR       E K  A T A  +   I+P V  G L +       I K K+VTV F +PI     ++ +KE   L+ E+++   +   L+I  DP +
  S:    29 LPTDSSYILVAPHRTYIDP-VYLA---LAASPKPF----TFMAKKELFKNPILSWIIRHANAFPVDRANPGP--SAIKTPVKILKKGDLSLMIFPTGTR----HSNEIKGGAATIAKLSGVPIIPAVYQGPLKL-----GGILKRKKVTVRFGDPIIIDRTVKLTKENLKLIDEQIQQAFDQLDLEI--DPTF 200
>gi|170728653|ref|YP_001762679.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Shewanella woodyi ATCC 51908] >gi|169814000|gb|ACA88584.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Shewanella woodyi ATCC 51908] (240 aa)
Score = 113, Expect = 6.9e-04, Identities = 48/188 (25%), Positives = 85/188 (45%)
  Q:    75 NIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNL-RDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEH-KSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           N+   +  +F+ NH++NFD+  +  A        P+      + K  ++     G    L   I IDR+N  R F  + Q  K++  K   S+ +F EGTR +      FKS A   A      +VPV     L   + H K N +    V +E +EPI+ K   ++  + +S+++ + M     ++ ++
  S:    59 NVATTEPCVFLANHQNNFDMFTHTAAV-------PK--GTVSLGKKSLAWVPFFGQIYWLSGNILIDRKNRSRAFETMAQTAKKIKDKC-LSIWIFPEGTRSRGKGLLPFKSGAFHTAIEAGVAMVPV-----LASNQGHIKLNRWNNGVVIIEMMEPIETKGLAKSQVKELSKRIHSMMSTRLTQLDQE 233
>gi|118602499|ref|YP_903714.1| phospholipid/glycerol acyltransferase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567438|gb|ABL02243.1| phospholipid/glycerol acyltransferase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (233 aa)
Score = 113, Expect = 7.1e-04, Identities = 57/192 (29%), Positives = 99/192 (51%)
  Q:    52 YVYSLASK-AVFC----TFT---KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKEL 243
           + Y++ SK ++FC     FT   K+++ G +NIP+ K  + + NH+S ++ L + + F       P+    T+V K  +      G+   L+  I I+R + L+    + +E K  L+KG   + +F EGTR    + G +++ A+  A  T C ++PV  Y   G      S I     +TV   +PI  K+  ++ KEL
  S:    34 FRYAILSKWSMFCLWWLAFTLDVKLQVIGKENIPS-KPCVIISNHQSTWETLGFQQIFP------PQ----TWVLKQILLWIPFFGWGLALLKPIVINRDKKLKALKTIIKEGKARLKKG-IFVVIFPEGTRQPYKKLGRYQNGAIAIAKKTSCNVIPV--YHNAGAIWPKGSFIKTPGTITVIIGKPINIKE--KSVKEL 218
>gi|167627083|ref|YP_001677583.1| acyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597084|gb|ABZ87082.1| acyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] (246 aa)
Score = 113, Expect = 7.4e-04, Identities = 45/169 (26%), Positives = 77/169 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVE-KEHKSNIFKYKEVTVEFLEPIKYKDY 236
           VK++G +NIP +   ++V  H+S  +  V+             + D  FV K E+ +    G        I +DR + L    +V ++ K+ ++    S+ +F EGTR+   E+ +F  +A+  A  +   I+PV      GV     K +  K     + F +PI  KDY
  S:    67 VKVEGKENIP-DYPCIYVSKHQSMLETFVFYGL----------VHDCCFVMKQELLEKPIFGKTNIFAEAIGVDRSKGLSAIKKVLEDGKDRIENKNLSIIIFPEGTRVPVGEYPKFHRSAMKLAKVSNVPIIPVA--HNFGVYFGRKKGDFVKPGIARMSFGKPIDPKDY 224
>gi|28899431|ref|NP_799036.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|153839295|ref|ZP_01991962.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio parahaemolyticus AQ3810] >gi|28807667|dbj|BAC60920.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|149747196|gb|EDM58184.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio parahaemolyticus AQ3810] (241 aa)
Score = 113, Expect = 7.4e-04, Identities = 47/179 (26%), Positives = 81/179 (45%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEH-KSNIFKYKEVTVEFLEPIKY----KDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           +++ NH++N+D+      F +     P+++    V K  ++     G    L   I IDR N         +    +++ + S+ +F EGTR +      FK+ A   A      I+P+V   T     +H K N +    V VE L P+      KD I+    +  E+MK K+EA   ++K+
  S:    68 VYIANHQNNWDM------FTVSAAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANRSKAKGTIDQVVNSMKESDVSVWMFPEGTRSRGRGLLPFKTGAFHAAIGAEVPIIPIVCSST-----DHIKLNRWNNGHVIVEMLPPVSTEGYGKDGIRELANVCREQMKEKLEALDEEVKQ 237
>gi|22127380|ref|NP_670803.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis KIM] >gi|167425098|ref|ZP_02316851.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|21960466|gb|AAM87054.1|AE013953_10 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis KIM] >gi|167055861|gb|EDR65642.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Mediaevalis str. K1973002] (243 aa)
Score = 113, Expect = 7.5e-04, Identities = 51/189 (26%), Positives = 81/189 (42%)
  Q:    65 FTKVKIKGSKNIPANKS----VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK----MKAKME 253
           F    I   + IPA  +     +++ NH++N+D++       M    +P  +    V K  +      G    L   + IDR N         +  E +QK   S+ +F EGTR +      FK+ A   A +    IVP+ +  T G++    SN     +V +E L PI    Y +     +SE     M AK+E
  S:    46 FVLFGITIEQRIPAEAAKYGNCIYIANHQNNYDMVT------MSNVVQPGTVT---VGKKSLLWVPLFGPLYWLTGNLLIDRDNRAKAHSTIAQVVEQVQKRNISIWMFPEGTRSRGRGLLPFKTGAFHAAIAAGVPIVPICVSSTNGIKLNRWSN----GKVIIEMLPPIDTSGYTKERVRELSEHCRNLMLAKIE 229
>gi|57167564|ref|ZP_00366704.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter coli RM2228] >gi|57020686|gb|EAL57350.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter coli RM2228] (230 aa)
Score = 112, Expect = 7.6e-04, Identities = 39/139 (28%), Positives = 74/139 (53%)
  Q:    65 FTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           F K ++ G  ++ AN   M + NH+S  D++        +++  P+ L   +++K E+ +      A K    + IDR+N RD VRV +E K+ L + ++ L +F EGTR + ++  +F+S A   +     ++ P++I
  S:    51 FCKYEVIGEFDLKAN---MILMNHQSTLDIIA-------LEDLYPKNL--CWIAKKELGEIPLFKIAIKKPKLLCIDRKNPRDLVRVLKEAKQRLSE-DRVLAIFPEGTRSRNEKLLKFQSGAKILSEKLDLKVQPILI 176
>gi|66043280|ref|YP_233121.1| phospholipid/glycerol acyltransferase [Pseudomonas syringae pv. syringae B728a] >gi|63253987|gb|AAY35083.1| Phospholipid/glycerol acyltransferase [Pseudomonas syringae pv. syringae B728a] (256 aa)
Score = 112, Expect = 7.8e-04, Identities = 37/135 (27%), Positives = 68/135 (50%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKE--KRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           KV++ G++N+P    V+ + NH+S ++       F+ + +  KR  +  P F            G+A  ++  I IDR+N +  +R + ++  ELL+ G   L +F EGTR+   + G+F       A +    ++PV
  S:    62 KVEVTGAENVPKTPCVI-ISNHQSTWETFFLSAYFEPMSQVLKRELLYVPFF------------GWAMAMLRPIAIDRENPKAALREIAKKGDELLKDGVWVL-IFPEGTRVPYGQVGKFSRGGTALAVNADLPVLPV 185
>gi|33598172|ref|NP_885815.1| acyltransferase [Bordetella parapertussis 12822] >gi|33566730|emb|CAE38941.1| probable acyltransferase [Bordetella parapertussis] (242 aa)
Score = 112, Expect = 8.1e-04, Identities = 40/133 (30%), Positives = 66/133 (49%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           +IKG++N+P   +++ +  H+S ++ L +     M +E         FV K E+      G+   L+  I IDR   RD F +V ++ +  L +G   L +F EGTR+   + G FK      A  T  +I+PV
  S:    59 RIKGAENLPDGPAIL-LSKHQSAWETLFF--PAHMPREV-------CFVYKKELHMVPFFGWGLALLRMIPIDRAKGRDAFEQVVRQGQVRLDEGRWPL-LFPEGTRVPPGKTGRFKMGGALLASRTGARIIPV 181
>gi|33591306|ref|NP_878950.1| acyltransferase [Bordetella pertussis Tohama I] >gi|33603066|ref|NP_890626.1| acyltransferase [Bordetella bronchiseptica RB50] >gi|33568697|emb|CAE34455.1| probable acyltransferase [Bordetella bronchiseptica RB50] >gi|33570948|emb|CAE40415.1| probable acyltransferase [Bordetella pertussis Tohama I] (242 aa)
Score = 112, Expect = 8.1e-04, Identities = 40/133 (30%), Positives = 66/133 (49%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           +IKG++N+P   +++ +  H+S ++ L +     M +E         FV K E+      G+   L+  I IDR   RD F +V ++ +  L +G   L +F EGTR+   + G FK      A  T  +I+PV
  S:    59 RIKGAENLPDGPAIL-LSKHQSAWETLFF--PAHMPREV-------CFVYKKELHMVPFFGWGLALLRMIPIDRAKGRDAFEQVVRQGQVRLDEGRWPL-LFPEGTRVPPGKTGRFKMGGALLASRTGARIIPV 181
>gi|125549817|gb|EAY95639.1| hypothetical protein OsI_016872 [Oryza sativa (indica cultivar-group)] (238 aa)
Score = 112, Expect = 8.1e-04, Identities = 46/171 (26%), Positives = 77/171 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTF---VSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQ 238
           +K++G +N+  N   +F+ NH S  D+ + +             L PT    ++K EI      G    L N + I R N    +   +E    + K   SL +F EGTR K      FK   +  A  T   IVP+V+ GT    +++   + +   +TV+ L PI+   +++
  S:    44 IKLEGMENL--NTRGIFICNHASPLDIFLVM------------WLAPTGTVGIAKKEIIWYPLFGQLYVLANHLRIHRSNPAAAIESMKEVARAVTKNNLSLILFPEGTRSKTGRLLPFKKGFVHTALQTRLPIVPMVVTGTHLAWRKNSLRV-RPAPLTVKVLPPIETDGWVE 202
>gi|50426017|ref|XP_461605.1| hypothetical protein DEHA0G01848g [Debaryomyces hansenii CBS767] >gi|49657275|emb|CAG90052.1| unnamed protein product [Debaryomyces hansenii CBS767] (271 aa)
Score = 112, Expect = 8.3e-04, Identities = 56/211 (26%), Positives = 97/211 (45%)
  Q:    43 LLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVM------FVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           LL L  +++Y     ++  + TF+K  I G K    N+  +       V NH+S  D+L+  K F       P     T  +K  +     +G+      T F+DR       +V     + L+  +++L +F EGTR   K+ E   FK  A   A      I+PVV+  T  +    K  IF   E+ +E L+P+   D ++T+ ++ +  ++ + E
  S:    12 LLRLVGKKDYAQYTVARVFYHTFSK--ILGIKITIKNEHFLHDVPGIIVSNHQSALDILMLGKVF------HPGY---TVTAKKALQYFPFLGWFMLASGTFFLDRARGEKARKVLDNALKSLKAEKRALFMFPEGTRSATKELEMLPFKKGAFHLAQQAGIPIIPVVVSNTSNIFNA-KDRIFNSGEIFIEVLKPMPTDD-LETNSDISAFSVQVRDE 217
>gi|157372491|ref|YP_001480480.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Serratia proteamaculans 568] >gi|157324255|gb|ABV43352.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Serratia proteamaculans 568] (245 aa)
Score = 112, Expect = 8.3e-04, Identities = 49/195 (25%), Positives = 83/195 (42%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK--EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           KV+++   +   N + +++ NH++N+D++   KA +      P  +    V K  +      G    +   + IDR N         +  E  +K + S+ +F EGTR +      FK+ A   A +    IVP+ +  T G     K N+ ++      VE +EPI   +Y    +E V E      E    KI E
  S:    53 KVEVRVPADAAKNGNCIYIANHQNNYDMVTAAKAVQ------PRTVT---VGKKSLLWVPFFGPLYWVTGNLLIDRDNRAKAHGTIAQVAEQFKKRDISVWMFPEGTRSRGRGLMPFKTGAFHAAIAAGVPIVPICVSTTSG-----KINLNRWDNGHAIVEVMEPIDISNY---GRENVRELAAHCHELMLAKIAE 232
>gi|167752020|ref|ZP_02424147.1| hypothetical protein ALIPUT_00262 [Alistipes putredinis DSM 17216] >gi|167660261|gb|EDS04391.1| hypothetical protein ALIPUT_00262 [Alistipes putredinis DSM 17216] (242 aa)
Score = 112, Expect = 8.5e-04, Identities = 50/186 (26%), Positives = 90/186 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDV--LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFV-RVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           K ++ G + I   K  + V NH++  D+  L ++             L+  +VSK E+ K    G    L   I I+R +    + +V ++ K  L +G  S+ +F EGTR    E   FK+ A T A     +I+PVV+ GT  +    ++ +F ++ ++TV  L P+  +       + + E+++A M
  S:    57 KFRVTGREYIDRRKPYVIVVNHQAGLDIPTLYFVP------------LNFRWVSKREVFKVPFFGQFLLLHGDICINRGHATAAMEKVIRDGKLWLSRG-ASVAIFPEGTRSHDGEIYRFKAGAFTLAREAGVEILPVVLDGTTTMIG--RNGMFNWRNKLTVSILPPVSAERVAAADPKELMEQVRASM 231
>gi|121592960|ref|YP_984856.1| phospholipid/glycerol acyltransferase [Acidovorax sp. JS42] >gi|120605040|gb|ABM40780.1| phospholipid/glycerol acyltransferase [Acidovorax sp. JS42] (249 aa)
Score = 112, Expect = 8.6e-04, Identities = 36/137 (26%), Positives = 67/137 (48%)
  Q:    67 KVKIKGSKNIPA--NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + +I G +++P    +  + +  H+S ++         ++    P  L   +V K E+      G++   ++ I IDR Q  R F +V Q+ + LL KG   + +F EGTR+++   GE+KS     A      +VP+ +
  S:    59 RTQITGMEHLPQGEQQGAVLLVKHQSTYETF-------LMPAIMPHPL--AYVFKKELLSVPFFGWSIGSLDMIHIDRGQRARAFAKVLQQGRRLLAKGTW-VIMFPEGTRVERGAKGEYKSGGTRLAIDAGVPVVPIAV 188
>gi|58266556|ref|XP_570434.1| transferase [Cryptococcus neoformans var. neoformans JEC21] >gi|134111064|ref|XP_775674.1| hypothetical protein CNBD4030 [Cryptococcus neoformans var. neoformans B-3501A] >gi|50258338|gb|EAL21027.1| hypothetical protein CNBD4030 [Cryptococcus neoformans var. neoformans B-3501A] >gi|57226667|gb|AAW43127.1| transferase, putative [Cryptococcus neoformans var. neoformans JEC21] (783 aa)
Score = 112, Expect = 9.0e-04, Identities = 47/160 (29%), Positives = 71/160 (44%)
  Q:    72 GSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           G K     +S++ V NH+S  D+L   + F     K   I+     +K  I     +G+   +  T+FI+R N +  +   Q   E +++   SL +F EGTR    + E   FK  A   A      IVPVV   Y  L   K H    F+   + ++ L PI
  S:    77 GGKANEKGRSMVMVGNHQSFVDILYLGRIFP----KHAAIM-----AKKSIQWIPGLGWFMMMSGTVFINRSNNKSAIASLQHAGEEMKRKRISLWIFPEGTRHNTPEPELLNFKKGAFYLAVQAGVPIVPVVCENYNHLFNGKSH----FRRGTLRIKVLPPI 227
>gi|16120997|ref|NP_404310.1| putative acyltransferase [Yersinia pestis CO92] >gi|45442751|ref|NP_994290.1| putative acyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|51597689|ref|YP_071880.1| putative acyltransferase (LPAAT) [Yersinia pseudotuberculosis IP 32953] >gi|108809110|ref|YP_653026.1| putative acyltransferase [Yersinia pestis Antiqua] >gi|108810695|ref|YP_646462.1| acyltransferase [Yersinia pestis Nepal516] >gi|145597765|ref|YP_001161841.1| acyltransferase [Yersinia pestis Pestoides F] >gi|150260296|ref|ZP_01917024.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis CA88-4125] >gi|153947585|ref|YP_001399575.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pseudotuberculosis IP 31758] >gi|162421401|ref|YP_001604892.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis Angola] >gi|165924974|ref|ZP_02220806.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165939859|ref|ZP_02228398.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Orientalis str. IP275] >gi|166008748|ref|ZP_02229646.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166211993|ref|ZP_02238028.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398515|ref|ZP_02304039.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167418807|ref|ZP_02310560.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167469329|ref|ZP_02334033.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis FV-1] >gi|170022914|ref|YP_001719419.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pseudotuberculosis YPIII] >gi|186896830|ref|YP_001873942.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pseudotuberculosis PB1/+] >gi|45437617|gb|AAS63167.1| putative acyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|51590971|emb|CAH22629.1| Putative acyltransferase (LPAAT) [Yersinia pseudotuberculosis IP 32953] >gi|108774343|gb|ABG16862.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis Nepal516] >gi|108781023|gb|ABG15081.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis Antiqua] >gi|115346476|emb|CAL19349.1| putative acyltransferase [Yersinia pestis CO92] >gi|145209461|gb|ABP38868.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis Pestoides F] >gi|149289704|gb|EDM39781.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis CA88-4125] >gi|152959080|gb|ABS46541.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pseudotuberculosis IP 31758] >gi|162354216|gb|ABX88164.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis Angola] >gi|165912170|gb|EDR30808.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Orientalis str. IP275] >gi|165923174|gb|EDR40325.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992087|gb|EDR44388.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206739|gb|EDR51219.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962801|gb|EDR58822.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051019|gb|EDR62427.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|169749448|gb|ACA66966.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pseudotuberculosis YPIII] >gi|186699856|gb|ACC90485.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Yersinia pseudotuberculosis PB1/+] (243 aa)
Score = 112, Expect = 9.1e-04, Identities = 49/180 (27%), Positives = 79/180 (43%)
  Q:    74 KNIPANKS----VMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK----MKAKME 253
           + IPA  +     +++ NH++N+D++       M    +P  +    V K  +      G    L   + IDR N         +  E +QK   S+ +F EGTR +      FK+ A   A +    IVP+ +  T G++    SN     +V +E L PI    Y +     +SE     M AK+E
  S:    55 QRIPAEAAKYGNCIYIANHQNNYDMVT------MSNVVQPGTVT---VGKKSLLWVPLFGPLYWLTGNLLIDRDNRAKAHSTIAQVVEQVQKRNISIWMFPEGTRSRGRGLLPFKTGAFHAAIAAGVPIVPICVSSTNGIKLNRWSN----GKVIIEMLPPIDTSGYTKERVRELSEHCRNLMLAKIE 229
>gi|157414800|ref|YP_001482056.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 81116] >gi|157385764|gb|ABV52079.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 81116] (230 aa)
Score = 112, Expect = 9.4e-04, Identities = 42/164 (25%), Positives = 85/164 (51%)
  Q:    46 LTERQNYVYSLASKAVFCTFTKVKIKGSKNIPAN---KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV 209
            T+ QN ++ +  + ++  F +  I   + I      ++ M + NH+S  D++        ++E  P+ L   +++K E+ +      A K    + IDR+N RD VRV +E KE + + ++ L +F EGTR K ++  +F+S A   +     ++ P++I  ++ +
  S:    28 FTKSQNTLWKI--RKIWAKFQRYTISYKQEIIGTFNPQAQMILMNHQSALDIIA-------LEELYPKNL--CWIAKKELGEIPIFKVAMKKPKLLCIDRKNPRDLVRVLKEAKERISE-DRVLAIFPEGTRSKNEKMLKFQSGAKILSEKLNLKVQPILIVDSVKI 182
>gi|146413465|ref|XP_001482703.1| hypothetical protein PGUG_04658 [Pichia guilliermondii ATCC 6260] >gi|146392402|gb|EDK40560.1| hypothetical protein PGUG_04658 [Pichia guilliermondii ATCC 6260] (288 aa)
Score = 112, Expect = 9.5e-04, Identities = 55/211 (26%), Positives = 97/211 (45%)
  Q:    43 LLGLTERQNYVYSLASKAVFCTFT-----KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKEL------VSEKMKAKME 253
            L +  +  Y     ++A + +F+     K+ IK +  +   K  + + NH+S  D+LV  K F       P +   T  +K  +     +G+      T F+DR       +V       L++  ++L +F EGTR    K +   FK  A   A      IVP V+  T G+     +  F   E+T+E L P+    +++T+++L      V +KMK  ++
  S:    34 FLRIIGKPQYAQYTVARAFYYSFSTVLGVKINIKNAHYL-NEKPAIVISNHQSALDILVLGKTFT------PGM---TVTAKRALKFFPFLGWFMLASGTFFLDRTRGEKARKVLDGALASLKRDNRALFIFPEGTRSGTTKLDLLPFKKGAFHLAKQAQIPIVPFVVSNTSGIFHA-STRTFNRGEITIEVLPPMS-TSHLETNEQLNDFALEVHDKMKTTLQ 245
>gi|108761281|ref|YP_631529.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase family protein [Myxococcus xanthus DK 1622] >gi|108465161|gb|ABF90346.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase family protein [Myxococcus xanthus DK 1622] (264 aa)
Score = 112, Expect = 9.7e-04, Identities = 42/193 (21%), Positives = 83/193 (43%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKI 259
           K+++ G +N+  N+  ++V NH+S  D+  +  A  +          P  +V+K ++     +G+   L   +FI+R N R     +        +G  S+ ++ EGTR        FK      A      + PV I G+  +  +   NI     + V+  +PI    + +  +E ++  ++A + A  L +
  S:    53 KLEVIGQENVDPNRPTIYVANHQSTIDIPAHFLAVPI----------PFRYVAKTQLKWVPLIGWYLALAGHVFINRSN-RSKAIASLNAAAAKIRGGTSIFLYPEGTRSTDGRVLPFKKGPFALALKARVPVCPVTIEGSGDLMPKSTWNITP-GPIRVKIGKPIDTTTFAENDREGLARAVRAVIIADSLSL 234
>gi|149918930|ref|ZP_01907416.1| phospholipid/glycerol acyltransferase [Plesiocystis pacifica SIR-1] >gi|149820304|gb|EDM79721.1| phospholipid/glycerol acyltransferase [Plesiocystis pacifica SIR-1] (267 aa)
Score = 112, Expect = 9.8e-04, Identities = 39/177 (22%), Positives = 79/177 (44%)
  Q:    77 PANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEP----IKYKDYIQTSKELVSEKMKAKME 253
           PA    + V NH+S  D+ + +  F             + +S+ +I     +G AA+   TIF+DR++ R   +  +  +  L  G +++++F EGT    DE   F + A         + VP+ +    G E    + +   + +    L P    +     I+   ++V++++ A++E
  S:    85 PARGPRLVVSNHRSAVDIPILITHF-----------GGSVLSRGDIESWPILGLAAQKAQTIFVDRESTRSGAQAIRAIRAQLAAG-RTVSIFPEGTTFAGDELRPFNAGAFAACRKLEVEYVPIGLAYPPGCEYIQDNFLSHAQAIASRPLTPVVLAVGRARRIEAKAKVVADELHAEIE 253
>gi|119944624|ref|YP_942304.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Psychromonas ingrahamii 37] >gi|119863228|gb|ABM02705.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Psychromonas ingrahamii 37] (231 aa)
Score = 111, Expect = 1.0e-03, Identities = 51/209 (24%), Positives = 85/209 (40%)
  Q:    56 LASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFK---MIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPN 264
           L SK  +    KV ++  ++   N SV+++ NH++++D++    A +   +   K+  +  P F            G    L   I I R N         E  + ++    ++ +F EGTR +      FK  A   A      +VP V   T    K+   N +   EV VE LEPI    Y +     + E   A M   Y ++ ++ N
  S:    25 LFSKLSWLFGLKVTLRIPESAKNNGSVVYLANHQNSYDMVTVSGAVQPGSVTIGKQSLVWIPFF------------GIIYWLTGNILISRDNKNKSRNTINEVVDQMRAKNLAVWIFPEGTRSRGRGLLPFKMGAFHTALQAGVNVVPTVTSNT---HKQVNLNRWNNGEVIVEMLEPIDITQYKKREIRRLMEDSHAIMLEKYQQLNQEVN 221
>gi|169627271|ref|YP_001700920.1| putative acyltransferase [Mycobacterium abscessus] >gi|169239238|emb|CAM60266.1| Putative acyltransferase [Mycobacterium abscessus] (254 aa)
Score = 111, Expect = 1.0e-03, Identities = 43/161 (26%), Positives = 71/161 (44%)
  Q:    57 ASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNI 217
           A  AVF T TKV+ +G   +P+    +   NH S  D L       M++  R       F+ K E+ +   + F  K    I +DR          +   + L+ GE  + V+ E T  +  E  EFK+ A   A+     IVP++++G   +  K+H  ++
  S:    12 AHAAVFLTGTKVRYRGLGQVPSRGGAVIAINHTSYVDFLP--AGLAMVRAGR----RMRFMLKAEMQEVPVMSFLIKHAKAIPVDRSAGHG---AYEAAVDSLRSGE-IVGVYPEATISRSFELKEFKTGAARMAHEAGVPIVPLIVWGAQRIWTKDHPKDL 163
>gi|182419845|ref|ZP_02951085.1| sn-glycerol-3-phosphate acyltransferase [Clostridium butyricum 5521] >gi|182376393|gb|EDT73975.1| sn-glycerol-3-phosphate acyltransferase [Clostridium butyricum 5521] (234 aa)
Score = 111, Expect = 1.1e-03, Identities = 46/153 (30%), Positives = 76/153 (49%)
  Q:    65 FTKVKIKGSKNIP-ANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT-----------LGVEKEHKSNI 217
           +  + ++G +NI    K  +FV NH SN D LV     K++KEK     DP F++ I++S         K++  I I + N  D   + +  K L  K  + + +F EGTR +     E K   L  A     +I+P+ + GT           +G EK  ++++
  S:    33 YANITVRGLENIDNVKKPRIFVCNHLSNSDGLVL---NKILKEKS----DPYFIAGIKLSNDPITNIGTKIVKNIAI-KPNSADKEAITKVVKAL--KSGEDILIFPEGTRSRTGAMIEGKKGILLFARMAKAEIIPIGMSGTDKLLPISTDGNMGAEKWQRADV 187
>gi|91225573|ref|ZP_01260647.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio alginolyticus 12G01] >gi|194539657|ref|YP_002074704.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases domain protein [Vibrio sp. Ex25] >gi|91189693|gb|EAS75967.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio alginolyticus 12G01] >gi|151938212|gb|EDN57052.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases domain protein [Vibrio sp. Ex25] (241 aa)
Score = 111, Expect = 1.1e-03, Identities = 45/179 (25%), Positives = 80/179 (44%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY----IQTSKELVSEKMKAKMEAAYLKIKE 261
           +++ NH++N+D+      F +     P+++    V K  ++     G    L   I IDR N         +    +++ + S+ +F EGTR +      FK+ A   A      I+P+V   T  +    K N +    V VE L PI  + Y    I+    +  E+MK K+E+   ++K+
  S:    68 VYIANHQNNWDM------FTVSAAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANRSKAKGTIDQVVSSMKESDVSVWMFPEGTRSRGRGLLPFKTGAFHAAIGAGVPIIPIVCSSTNKI----KLNRWNNGHVIVEMLPPISTEGYGKEGIRELANICREQMKEKLESLDEEVKQ 237
>gi|153956019|ref|YP_001396784.1| hypothetical protein CKL_3411 [Clostridium kluyveri DSM 555] >gi|146348877|gb|EDK35413.1| Hypothetical protein CKL_3411 [Clostridium kluyveri DSM 555] (239 aa)
Score = 111, Expect = 1.1e-03, Identities = 45/157 (28%), Positives = 74/157 (47%)
  Q:    50 QNYVYSLASKAVFCTFTK---VKIKGSKNI-PANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           + YV  +++K +F    K   +K+KG +N+    K  +F+ NH SN D LV     K          + TFV+  ++++         +  TI I + N  D   +++  K L  K  +S+ +F EGTR +    G  +   +     T   IVP+ IYGT
  S:    15 KKYVSYISNKILFGYLEKYADIKVKGIENLNKVEKPAIFICNHLSNSDALVLSSVLKS--------ENLTFVAGAKLNQNPLTQLGMSMTKTITI-KPNSADKEAISKIVKTL--KAGESILIFPEGTRSRTGAMGRARKGVVLIQKLTKASIVPIGIYGT 164
>gi|57238281|ref|YP_178638.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni RM1221] >gi|57167085|gb|AAW35864.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni RM1221] (230 aa)
Score = 111, Expect = 1.1e-03, Identities = 42/158 (26%), Positives = 82/158 (51%)
  Q:    46 LTERQNYVYSLASKAVFCTFTKVKIKGSKNIPAN---KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
            T+ QN ++ +  + ++  F +  I   + I      ++ M + NH+S  D++        ++E  P+ L   +++K E+ +      A K    + IDR+N RD VRV +E KE + + ++ L +F EGTR K ++  +F+S A   +     ++ P++I
  S:    28 FTKSQNTLWKI--RKIWAKFQRYTISYKQEIIGTFNPQAQMILMNHQSALDIIA-------LEELYPKNL--CWIAKKELGEIPIFKVAMKKPKLLCIDRKNPRDLVRVLKEAKERISE-DRVLAIFPEGTRSKNEKMLKFQSGAKILSEKLNLKVQPILI 176
>gi|83856163|ref|ZP_00949692.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Croceibacter atlanticus HTCC2559] >gi|83849963|gb|EAP87831.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Croceibacter atlanticus HTCC2559] (216 aa)
Score = 111, Expect = 1.2e-03, Identities = 39/138 (28%), Positives = 59/138 (42%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTP--AYSTFCQIVPVVI 203
           T+        +P     + V NH+S +D+   +   +         L P FVSKIE+ K    + +  +   ++ IDR+N R  +   +     LQ+  +S  +F EGTR KK     F    L     Y     IVPV I
  S:    27 TRNTFSNPHKLPKGAPCIIVSNHQSQYDISPLIWHLRK--------LHPKFVSKIELGKGIPSISYNLRHGGSVLIDRKNPRQSLPALKNFATYLQENNRSTVIFPEGTRGKKGMPKRFAPNGLKTLFKYMPNAWIVPVTI 159
>gi|194333103|ref|YP_002014963.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prosthecochloris aestuarii DSM 271] >gi|194310921|gb|ACF45316.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prosthecochloris aestuarii DSM 271] (236 aa)
Score = 111, Expect = 1.2e-03, Identities = 35/140 (25%), Positives = 64/140 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           ++ + G ++  A K+ + + NH    D+ + L   +         L+  FV+K E+ +    G+A K    + I R   ++ ++   +  E+L  G +S+ +F EGTR    E   FK  A   A      I+P+ I G+
  S:    54 RIDVVGREHYDATKNYLVISNHAGMADIPILLGTLQ---------LNLRFVAKEELGRIPVFGWALKKGGYVLIKRGQNKEALKSLFKAAEVLNSG-RSVHIFPEGTRSATGELLPFKRGAFLIAQKAPTPILPIAIIGS 183
>gi|124268562|ref|YP_001022566.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Methylibium petroleiphilum PM1] >gi|124261337|gb|ABM96331.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Methylibium petroleiphilum PM1] (254 aa)
Score = 111, Expect = 1.2e-03, Identities = 37/149 (24%), Positives = 74/149 (49%)
  Q:    55 SLASKAVFCTFTKVKIKGSKNIPANK--SVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP--TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           S+    V C   + +++G + +PA++   V+ +P H+S ++   +           P ++     +V K E+      G+A   ++ I IDR    + + RV ++ +E + KG   + +F EGTR  + + G +KS     A +T   +VP+ +
  S:    51 SIWGARVICG-VRYRVQGMERLPADRLSPVILLPKHQSTWETFAF-----------PTLMSHPLCYVFKRELLYIPFFGWAIGRLDMIHIDRSKRTEAWNRVAEQGREYMAKGNW-VIMFPEGTRTPRGDQGVYKSGGTRLAVTTRTPVVPIAV 191
>gi|15791878|ref|NP_281701.1| putative 1-acyl-SN-glycerol-3-phosphate acyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86149166|ref|ZP_01067398.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni CF93-6] >gi|88597121|ref|ZP_01100357.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612293|ref|YP_001000219.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 81-176] >gi|167005174|ref|ZP_02270932.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 81-176] >gi|85840524|gb|EAQ57781.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni CF93-6] >gi|87250388|gb|EAQ73346.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190810|gb|EAQ94783.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 84-25] >gi|112359875|emb|CAL34663.1| putative 1-acyl-SN-glycerol-3-phosphate acyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] (230 aa)
Score = 111, Expect = 1.3e-03, Identities = 42/158 (26%), Positives = 82/158 (51%)
  Q:    46 LTERQNYVYSLASKAVFCTFTKVKIKGSKNIPAN---KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
            T+ QN ++ +  + ++  F +  I   + I      ++ M + NH+S  D++        ++E  P+ L   +++K E+ +      A K    + IDR+N RD VRV +E KE + + ++ L +F EGTR K ++  +F+S A   +     ++ P++I
  S:    28 FTKSQNTLWKI--RKIWAKFQRYTISYKQEIIGTFNPQAQMILMNHQSALDIIA-------LEELYPKNL--CWIAKKELGEIPIFKVAMKKPKLLCIDRKNPRDLVRVLKEAKERISE-DRVLAIFPEGTRSKNEKMLKFQSGAKILSEKLNLKVQPILI 176
>gi|78188120|ref|YP_378458.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium chlorochromatii CaD3] >gi|78170319|gb|ABB27415.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Chlorobium chlorochromatii CaD3] (236 aa)
Score = 111, Expect = 1.3e-03, Identities = 37/140 (26%), Positives = 63/140 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           K+++ GS+N    +  + V NH    D+ + L   K         L+  F++K E+ +    G A +    + I R   R+ ++      E+L+ G +S+ +F EGTR    E   FK  A   A      ++PV I G+
  S:    54 KIEVIGSENYNPAQHYLVVSNHAGMADIPLLLGCMK---------LNLRFLAKEELGRVPIFGTALRRSGYVMIKRGQNREAMQSLLAAAEVLKSG-RSVHIFPEGTRSATGELLPFKRGAFLVAIKGGAPVLPVTIIGS 183
>gi|187477215|ref|YP_785239.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha [Bordetella avium 197N] >gi|115421801|emb|CAJ48312.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha [Bordetella avium 197N] (242 aa)
Score = 111, Expect = 1.3e-03, Identities = 54/194 (27%), Positives = 86/194 (44%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKE--VTVEFLEPIKYKDYIQTSKELVSEKMKAKMEA 254
           VFC   + +IKG +N+P +  ++ +  H+S ++ L +           P  +   FV K  +      G+   L+  I IDR   RD F +V +E  + L  G   L +F EGTR+   + G FK      A      +VPV     L   +  + N F  +   VTV F  PI        S+ L  +++ A++ A
  S:    52 VFCGI-RWRIKGGENLP-DGPIVLLSKHQSAWETLFF-------PAHMPRQV--CFVYKKSLHWVPFFGWGLALLRMIPIDRAKGRDAFEQVVREGGKCLADGRWPL-LFPEGTRVAPGQMGRFKMGGALLASRNGAAVVPV----ALNAGECWRRNAFVKRPGLVTVSFGPPIP-------SEGLSPDELNARVHA 225
>gi|126302705|ref|XP_001372646.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 2 [Monodelphis domestica] (273 aa)
Score = 110, Expect = 1.3e-03, Identities = 47/198 (23%), Positives = 90/198 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFV--SKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY-IQTSKELVSEKMKAKMEAAYLKIKEDPN 264
           +++  G + +  +K  + + NH+S  D++  +           EIL    +  +K E+     VG    L   IFI+R+     + V  E  ++L K    + ++ EGTR    +   FK  A   A      I+PVV Y +     + +  IF   ++ +E L+P+K +   ++   EL+ +   + M+ A+ +I +  N
  S:    73 RLEAHGVEKLHDDKPCVIISNHQSILDMIGMM-----------EILPKNCIQIAKRELVFAGPVGLIMYLGGVIFINRKQTSTAMSVMGEVGDILVKENLKVWIYPEGTRNGSYDMLPFKKGAFYVAVQAQVPIIPVV-YSSFTSFYQPEKKIFTSGKIKIEVLDPVKTEGLTVEDIPELI-KTCHSAMKEAFFRISDKLN 260
>gi|195566452|ref|XP_002106794.1| GD17087 [Drosophila simulans] >gi|194204186|gb|EDX17762.1| GD17087 [Drosophila simulans] (348 aa)
Score = 110, Expect = 1.3e-03, Identities = 43/184 (23%), Positives = 77/184 (41%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKM 252
           +++G +++  +++ + V NH+S  DVL        I     +    T V+K E+      G AA L   IFIDR           +    ++K    L VF EGTR        FK  A   A      I+PVV + +       K  I     + +  L P+  +   +   +++ ++++++M
  S:    82 ELRGKEHLAKDQACIIVANHQSALDVLAQPIGMFNIWHVMNKC---TVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEGTRRNTGALHPFKKGAFHMAIDQQIPILPVV-FSSYCTFLNDKKKILNSGRIVITTLPPVSTEGLTKDDIDVLMDRVRSQM 261
>gi|116749031|ref|YP_845718.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Syntrophobacter fumaroxidans MPOB] >gi|116698095|gb|ABK17283.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Syntrophobacter fumaroxidans MPOB] (244 aa)
Score = 110, Expect = 1.3e-03, Identities = 47/195 (24%), Positives = 88/195 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRD-FVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           +V + G + +   +  ++  NH+S FD+ V L   K+  + R       +++K E+ +   +G A K    I I+R + R  F  +NQ   ++  +G  S+ +F EGTR +     +FK      A  +   IVP+ I G+  V       +     V +   +PI         ++L+ E+++  +   YL  +E
  S:    55 EVDVHGLERLRPERPCIYAANHQSLFDIFVVLG--KLPVQFR-------WLAKEELFRLFVMGRAMKATGYIPINRSDHRKAFESINQAADKV--RGGVSIVIFPEGTRSENGVLKDFKKGGFILAIKSQQPIVPISISGSHRVVPRKDKWVIHPGVVRMTIGDPIPTAGATTKERDLLIEEVREAIR-RYLTTEE 238
>gi|149921563|ref|ZP_01910014.1| putative acetyltransferase [Plesiocystis pacifica SIR-1] >gi|149817638|gb|EDM77106.1| putative acetyltransferase [Plesiocystis pacifica SIR-1] (285 aa)
Score = 110, Expect = 1.3e-03, Identities = 53/231 (22%), Positives = 101/231 (43%)
  Q:     6 FLFKLGHSLG-FPFCVFFLWLSLR--SSKKKYKRWQEDPELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEV---TVEFLEPIKYKDY 236
           F F L  SL  F F V   WL +     ++++  W              Y Y+ A+     +  +++++G +++  + + +   NH+S+ D+L     F + K+ R       +V+K E+     +G+   +   + I R +     ++  + +  L+ G  S+ +F EGTR +  +   FK  A   A      ++PV++ GT        S +F    +    V  LEP+   DY
  S:    23 FWFYLVASLTVFWFAVAIPWLLITPFDRRRRFSHW--------------YAYTWANHLELMSLWRIQVEGGEHMREDTAYVLACNHQSSGDILTL---FSLRKQFR-------WVAKRELFAVPFLGWMMAMAGYVGIKRGDPNSRKKMMAKCRRHLELG-NSVAIFPEGTRSESGDIQPFKIGAFVLACEADAAVLPVLMEGTREA-LPRASFVFGVDALIYPIVRVLEPLHPADY 233
>gi|28867427|ref|NP_790046.1| hdtS protein [Pseudomonas syringae pv. tomato str. DC3000] >gi|28850661|gb|AAO53741.1| hdtS protein [Pseudomonas syringae pv. tomato str. DC3000] (256 aa)
Score = 110, Expect = 1.4e-03, Identities = 36/135 (26%), Positives = 66/135 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKE--KRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           KV++ G+ N+P    V+ + NH+S ++       F+ + +  KR  +  P F            G+A  ++  I IDR N +  +R + ++  ELL+ G   L +F EGTR+   + G+F       A +    ++P+
  S:    62 KVEVSGADNVPKTPCVI-ISNHQSTWETFFLSAYFEPLSQVLKRELLYVPFF------------GWAMAMLRPIAIDRDNPKAALREIAKKGDELLKDGVWVL-IFPEGTRVPYGQVGKFSRGGTALAVNADLPVLPI 185
>gi|83595098|ref|YP_428850.1| lyso-ornithine lipid acyltransferase [Rhodospirillum rubrum ATCC 11170] >gi|83578012|gb|ABC24563.1| lyso-ornithine lipid acyltransferase [Rhodospirillum rubrum ATCC 11170] (319 aa)
Score = 110, Expect = 1.4e-03, Identities = 43/152 (28%), Positives = 70/152 (46%)
  Q:    43 LLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQK--GEQSLTVFIEGTRIKKDEFGEFKSAALTPAYST 194
           L+G   R++ +      A  C  T V+ +GS  +  ++ ++ V NH S  D++V              ++   FV+K E+      G+ AKL  TIFIDR+         +   E+L++  G + L +F EGT    +    FKSA  + A  T
  S:    36 LIGWRVRESGMIYWKGVAGVCRIT-VRSRGS--LVGDRPLLVVANHSSYLDIVVL-----------GTLIPGVFVAKAEVGGWPIFGWMAKLARTIFIDRKR----SATGEARAEILKRLAGGEPLILFPEGTSNDGNRVYPFKSALFSVAQET 171
>gi|153834575|ref|ZP_01987242.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio harveyi HY01] >gi|148869018|gb|EDL68063.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio harveyi HY01] (241 aa)
Score = 110, Expect = 1.4e-03, Identities = 44/179 (24%), Positives = 81/179 (45%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEH-KSNIFKYKEVTVEFLEPIKYKDY----IQTSKELVSEKMKAKMEAAYLKIKE 261
           +++ NH++N+D+      F +     P+++    V K  ++     G    L   I IDR N         +  + ++  + S+ +F EGTR +      FK+ A   A      I+P+V   T     +H K N +    V +E L P+  + Y    ++    +  E+MK K+EA   ++K+
  S:    68 VYIANHQNNWDL------FTVSSAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANRSKAKGTIDQVVDSIKNSDVSVWMFPEGTRSRGRGLLPFKTGAFHAAIGAEVPIIPIVCSST-----DHIKLNRWNNGHVIIEMLPPVSTEGYGKEGVRELANVCREEMKVKLEALDEEVKQ 237
>gi|70733524|ref|YP_257163.1| acylhomoserine lactone synthase HdtS, putative [Pseudomonas fluorescens Pf-5] >gi|68347823|gb|AAY95429.1| acylhomoserine lactone synthase HdtS, putative [Pseudomonas fluorescens Pf-5] (256 aa)
Score = 110, Expect = 1.4e-03, Identities = 34/135 (25%), Positives = 65/135 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKE--KRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           +V++KG++N+P    V+ V NH+S ++       F+ + +  KR  +  P F            G+A  ++  I IDR N +  ++    + + L K    + +F EGTR+   + G+F  +    A +    ++PV
  S:    62 RVEVKGAENVPERPCVI-VSNHQSTWETFFLSAYFEPLSQVLKRELLYVPFF------------GWAMAMLRPIAIDRDNPKAALKQVASKGDELLKDNVWVLIFPEGTRVPHGQIGKFSRSGSALAVNADLPVLPV 185
>gi|154300239|ref|XP_001550536.1| hypothetical protein BC1G_10495 [Botryotinia fuckeliana B05.10] >gi|150856784|gb|EDN31976.1| hypothetical protein BC1G_10495 [Botryotinia fuckeliana B05.10] (306 aa)
Score = 110, Expect = 1.5e-03, Identities = 49/184 (26%), Positives = 85/184 (46%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVS----EKMKAKMEAAYLKIKEDP 263
           +  + + NH++  DVL+    F       P+    T  +K  +     +G+   L  T+FIDR N +D  +      + +++ +Q++ +F EGTR   K      FK  A   A      IVPVV+     V    +S  FK  ++ V+ L+PI+ K+      E ++    E M  ++ A   K++  P
  S:   101 RPAVLIGNHQTELDVLMLGCIF-------PQYCSVT--AKKSLKNVPFLGWFMSLSGTVFIDRGNAKDARQAMAGAAKEIREEKQNVYMFPEGTRSYAKDPTLLPFKKGAFHLAVQAGVPIVPVVVACYSNV-LHVQSWRFKSGKIPVKVLKPIETKNLTSADVEDLARDTRELMLGELVALTSKVEGKP 280
>gi|86151546|ref|ZP_01069760.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 260.94] >gi|86153366|ref|ZP_01071570.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85841175|gb|EAQ58423.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase, putative [Campylobacter jejuni subsp. jejuni 260.94] >gi|85843092|gb|EAQ60303.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Campylobacter jejuni subsp. jejuni HB93-13] (230 aa)
Score = 110, Expect = 1.5e-03, Identities = 42/158 (26%), Positives = 82/158 (51%)
  Q:    46 LTERQNYVYSLASKAVFCTFTKVKIKGSKNIPAN---KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
            T+ QN ++ +  + ++  F +  I   + I      ++ M + NH+S  D++        ++E  P+ L   +++K E+ +      A K    + IDR+N RD VRV +E KE + + ++ L +F EGTR K ++  +F+S A   +     ++ P++I
  S:    28 FTKSQNTLWKI--RKIWAKFQRYTISYKQEIIGTFNPQAQMILMNHQSALDIIA-------LEELYPKNL--CWIAKKELGEIPIFKVAMKKPKLLCIDRKNPRDLVRVLKEAKERISE-DRVLAIFPEGTRSKNEKMLKFQSGAKILSEKLNLKVQPILI 176
>gi|170698777|ref|ZP_02889841.1| phospholipid/glycerol acyltransferase [Burkholderia ambifaria IOP40-10] >gi|170136334|gb|EDT04598.1| phospholipid/glycerol acyltransferase [Burkholderia ambifaria IOP40-10] (285 aa)
Score = 110, Expect = 1.5e-03, Identities = 36/125 (28%), Positives = 56/125 (44%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         I   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +R+  E  E L+ G   + VF EGT         F +     A S  C + PV +
  S:    61 DASALVVGNHVSWIDIYA-------INAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRIMHEMAERLRNG-GLMCVFPEGTTSDGQALLPFHANLFQAAVSAGCAVQPVCL 173
>gi|172059819|ref|YP_001807471.1| phospholipid/glycerol acyltransferase [Burkholderia ambifaria MC40-6] >gi|171992336|gb|ACB63255.1| phospholipid/glycerol acyltransferase [Burkholderia ambifaria MC40-6] (285 aa)
Score = 110, Expect = 1.5e-03, Identities = 36/125 (28%), Positives = 56/125 (44%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         I   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +R+  E  E L+ G   + VF EGT         F +     A S  C + PV +
  S:    61 DASALVVGNHVSWIDIYA-------INAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRIMHEMAERLRNG-GLMCVFPEGTTSDGQALLPFHANLFQAAVSAGCAVQPVCL 173
>gi|94501102|ref|ZP_01307626.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Oceanobacter sp. RED65] >gi|94426849|gb|EAT11833.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Oceanobacter sp. RED65] (260 aa)
Score = 110, Expect = 1.5e-03, Identities = 48/191 (25%), Positives = 84/191 (43%)
  Q:    60 AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYK--------DYIQTSKELVSEKMKA 250
            +F    K K+ G +++  ++  +++ NH+SN+D+LV       +  KR   L      K  +      G    L   + IDR N +  +      ++ L +   ++ +F EGTR K      FK  A   A +    IVPV     L   KE   N  K     ++ L PI  K        + ++  +ELV +++++
  S:    57 GLFVMGMKTKVIGREHMEQHQPCLYIANHQSNWDLLV----LGSVVPKRTVSL-----GKKSLKWVPLFGQLYWLAGNVLIDRGNRQKAMEALDITEKALTEKNTAIWIFPEGTRNKGHNVKTFKKGAFVTAINAGVPIVPVCCSPYL---KELNLNACKSGTAYIKALPPISTKGLTLDDAENLMKQCQELVQQEVES 243
>gi|115350796|ref|YP_772635.1| phospholipid/glycerol acyltransferase [Burkholderia ambifaria AMMD] >gi|115280784|gb|ABI86301.1| lyso-ornithine lipid acyltransferase [Burkholderia ambifaria AMMD] (285 aa)
Score = 110, Expect = 1.5e-03, Identities = 36/125 (28%), Positives = 56/125 (44%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         I   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +R+  E  E L+ G   + VF EGT         F +     A S  C + PV +
  S:    61 DASALVVGNHVSWIDIYA-------INAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRIMHEMAERLRNG-GLMCVFPEGTTSDGQALLPFHANLFQAAVSAGCAVQPVCL 173
>gi|23099256|ref|NP_692722.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Oceanobacillus iheyensis HTE831] >gi|22777485|dbj|BAC13757.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase [Oceanobacillus iheyensis HTE831] (193 aa)
Score = 110, Expect = 1.6e-03, Identities = 54/193 (27%), Positives = 89/193 (46%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTK-----RVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKME 253
           +F    ++K+ G +NIP +  V+   NH SNFD  V       I   R    D +F++K E+ +        +G  A  +     DR  LR+ +++       L++G  +L +F EGTR K  E G+  S     A  +   +VP VI G      E+K     + + TV + +P+    Y + +K    +  +A ME
  S:    13 IFYPLYRIKVIGKENIPESGPVIICSNHISNFDPPVV-----GITSNR----DISFMAKGELFEKPLLGRLLIGIKAFPVRRGLADRNALRNGLKI-------LEEG-HTLGLFPEGTRSKTGELGKPLSGVGFFALRSKAVVVPCVIIG------EYKP----FSKTTVAYGKPMNVNTY-RENKASAKDMSEAIME 182
>gi|2271396|gb|AAC46006.1| sn-glycerol-3-phosphate acyltransferase [Clostridium butyricum] (234 aa)
Score = 110, Expect = 1.6e-03, Identities = 46/153 (30%), Positives = 76/153 (49%)
  Q:    65 FTKVKIKGSKNIP-ANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT-----------LGVEKEHKSNI 217
           +  + ++G +NI    K  +FV NH SN D LV     K++KEK     DP F++ I++S         K++  I I + N  D   + +  K L  K  + + +F EGTR +     E K   L  A     +I+P+ + GT           +G EK  ++++
  S:    33 YANITVRGLENIDNVKKPRIFVCNHLSNSDGLVL---NKILKEKS----DPYFIAGIKLSNDPITNIGTKIVKNIAI-KPNSADKEAITKVVKAL--KSGEDILIFPEGTRSRIGAMIEGKKGILLFARMAKAEIIPIGMSGTDKLLPISNDGNMGAEKWQRADV 187
>gi|194557139|ref|YP_002092165.1| Phospholipid/glycerol acyltransferase [Burkholderia cenocepacia PC184] >gi|124870930|gb|EAY62646.1| Phospholipid/glycerol acyltransferase [Burkholderia cenocepacia PC184] (285 aa)
Score = 110, Expect = 1.7e-03, Identities = 34/125 (27%), Positives = 57/125 (45%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         +   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +R+  E  E L+ G   + VF EGT     +   F +     A S  C + P+ +
  S:    61 DASALVVGNHVSWLDIYA-------VNAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRIMHEMAERLRTG-GLMCVFPEGTTSDGQDLLPFHANLFQAAVSAGCAVQPICL 173
>gi|107021945|ref|YP_620272.1| phospholipid/glycerol acyltransferase [Burkholderia cenocepacia AU 1054] >gi|116688892|ref|YP_834515.1| phospholipid/glycerol acyltransferase [Burkholderia cenocepacia HI2424] >gi|105892134|gb|ABF75299.1| lyso-ornithine lipid acyltransferase [Burkholderia cenocepacia AU 1054] >gi|116646981|gb|ABK07622.1| lyso-ornithine lipid acyltransferase [Burkholderia cenocepacia HI2424] (285 aa)
Score = 110, Expect = 1.7e-03, Identities = 34/125 (27%), Positives = 57/125 (45%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         +   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +R+  E  E L+ G   + VF EGT     +   F +     A S  C + P+ +
  S:    61 DASALVVGNHVSWLDIYA-------VNAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRIMHEMAERLRTG-GLMCVFPEGTTSDGQDLLPFHANLFQAAVSAGCAVQPICL 173
>gi|1067140|emb|CAA86877.1| ORF [Limnanthes douglasii] (281 aa)
Score = 109, Expect = 1.7e-03, Identities = 44/169 (26%), Positives = 77/169 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDV--LVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEV--TVEFLEPIKYKDY 236
           +KI+GS++    K  +++ NH S  D   +++L     +            V+K E+     +G    L + I IDR N    ++  +E   ++ +   SL +F EGTR        FK   +  A  +   IVP+++ GT       +   F+ + V  TV++L PI   D+
  S:    91 IKIQGSEH--TKKRAIYISNHASPIDAFFVMWLAPIGTVG-----------VAKKEVIWYPLLGQLYTLAHHIRIDRSNPAAAIQSMKEAVRVITEKNLSLIMFPEGTRSGDGRLLPFKKGFVHLALQSHLPIVPMILTGT---HLAWRKGTFRVRPVPITVKYLPPINTDDW 247
>gi|167570971|ref|ZP_02363845.1| acyltransferase domain protein [Burkholderia oklahomensis C6786] (289 aa)
Score = 109, Expect = 1.7e-03, Identities = 38/125 (30%), Positives = 54/125 (43%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+ V       I   RP      FVSK E+     VG+ A+ + T+FI R+   +  R+  E  + L KGE  + VF EGT         F S       S  C + P+ +
  S:    61 DASALVVGNHVSWLDIYV-------INAWRPT----PFVSKAEVRAWPVVGWLAERLGTVFIQREKRSEAKRIMHELSDRLGKGEL-MCVFPEGTTSDGLGLLPFHSNMFQAVVSAGCAVQPICL 173
>gi|167563832|ref|ZP_02356748.1| acyltransferase domain protein [Burkholderia oklahomensis EO147] (215 aa)
Score = 109, Expect = 1.7e-03, Identities = 38/125 (30%), Positives = 54/125 (43%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+ V       I   RP      FVSK E+     VG+ A+ + T+FI R+   +  R+  E  + L KGE  + VF EGT         F S       S  C + P+ +
  S:    45 DASALVVGNHVSWLDIYV-------INAWRPT----PFVSKAEVRAWPVVGWLAERLGTVFIQREKRSEAKRIMHELSDRLGKGEL-MCVFPEGTTSDGLGLLPFHSNMFQAVVSAGCAVQPICL 157
>gi|104779328|ref|YP_605826.1| N-acylhomoserine lactone synthase [Pseudomonas entomophila L48] >gi|95108315|emb|CAK13009.1| N-acylhomoserine lactone synthase [Pseudomonas entomophila L48] (256 aa)
Score = 109, Expect = 1.8e-03, Identities = 36/133 (27%), Positives = 66/133 (49%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKE--KRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           KI G++++P    V+ + NH+S ++       F  + +  KR  +  P F            G+A  ++  I IDR+N ++ +R V  +  ELL++G   L +F EGTR+   + G+F       A +    ++P+
  S:    64 KITGAEHVPDVPCVI-LSNHQSTWETFFLSAYFSPLSQVLKRELLYVPFF------------GWAMAMLRPIAIDRKNPKEALRQVASQGDELLKQGTWVL-IFPEGTRVPHGQMGKFSRGGTALAVNAGLPVLPI 185
>gi|83644557|ref|YP_432992.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Hahella chejuensis KCTC 2396] >gi|83632600|gb|ABC28567.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Hahella chejuensis KCTC 2396] (213 aa)
Score = 109, Expect = 1.8e-03, Identities = 43/149 (28%), Positives = 74/149 (49%)
  Q:    53 VYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLT------VFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           V++L    V C   + +I+G +NIP    V+ V NH+S ++  +    F      RP+      V K E+ K    G+A K +  I IDR       + +   K+LL++G++ LT      ++ EGTR++  + G++       A S    ++PV
  S:    21 VFALWWARVVCGI-RYEIEGLENIPKTSCVV-VSNHQSAWETYLLGVIF------RPQCT----VLKQELMKIPFFGWALKRLKPIAIDRS------KPSAALKQLLKQGKERLTSGYWVVIYPEGTRVRPGQVGKYNKGGALLAVSAGVPLLPV 157
>gi|144899560|emb|CAM76424.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Magnetospirillum gryphiswaldense MSR-1] (269 aa)
Score = 109, Expect = 1.8e-03, Identities = 39/135 (28%), Positives = 61/135 (45%)
  Q:    60 AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYST 194
           A  C F  VK +G + + A+  V+FV NH S  D+++              ++   FV+K E++     GF AK+  T+F+ R+  R      ++      KG  SL +F EGT    +    FKS+    A  T
  S:    48 ARICGFV-VKTRG-QPLQASGPVLFVSNHASYLDIIIL-----------GSVIKANFVAKAEVANWPGFGFLAKIARTVFVARK--RGGTAGERDALTNRLKGGDSLMLFPEGTSNDGNNVLAFKSSLFAVAEMT 167
>gi|162447549|ref|YP_001620681.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Acholeplasma laidlawii PG-8A] >gi|161985656|gb|ABX81305.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Acholeplasma laidlawii PG-8A] (263 aa)
Score = 109, Expect = 1.9e-03, Identities = 55/200 (27%), Positives = 93/200 (46%)
  Q:    37 WQEDPELLGLTERQNYVYSLASKA----VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDP-TFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFG--EFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           WQ+ P    L  R  Y Y   S A    VF     +K+ G +N+P +  ++   NHKS  D ++ ++A       RP    P + + KI I K        K ++ + I R + R   +   E  + ++ G  S+ VF EG R  +D+      ++ A   A      I+P+ I G    E +H++  F+  ++ V   +PI ++DY
  S:    53 WQKLP----LMNRYKY-YGWQSLARFLSVFVFNISIKVIGKENVPKDGKMVVYTNHKSYLDPVIAIQAI-----NRPMAFTPKSTLYKIPILKD-----GMKQMHCMPIYRDDTRKTAKALVETIKNIEAG-FSMVVFPEGGRKNRDQDSVVATRAGAFQIAVKPKATILPMTIIGN--SEIQHRAP-FRKTKIKVIIHKPITHEDY 240
>gi|71909544|ref|YP_287131.1| lyso-ornithine lipid acyltransferase [Dechloromonas aromatica RCB] >gi|71849165|gb|AAZ48661.1| lyso-ornithine lipid acyltransferase [Dechloromonas aromatica RCB] (232 aa)
Score = 109, Expect = 1.9e-03, Identities = 38/121 (31%), Positives = 57/121 (47%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRV-NQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + V NH S  D+ V   A           L   FVSK E+     +G+ A   +T+F+ R+  R   R+ NQ+  E+L KG+  + VF EGT         F +A + PA +    ++PV I
  S:    21 LIVANHISWIDIYVINAA-----------LPAAFVSKEEVRHWPLIGWLAAKNDTVFL-RRGSRGHARIINQQVAEILDKGKH-VAVFPEGTTTDGRSLLHFHAALIQPALAAGRPVLPVAI 129
>gi|182626596|ref|ZP_02954342.1| sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens D str. JGS1721] >gi|177908076|gb|EDT70649.1| sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens D str. JGS1721] (234 aa)
Score = 109, Expect = 1.9e-03, Identities = 43/149 (28%), Positives = 73/149 (48%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFI-----DRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNI----FKYKEVTVEFLEPI 231
           +F+ NH SN D LV  K  +  KE      DP F++ ++++         +L+  I I     DR++L   V+          KG +++ +F EGTR +  +  E K   +  A  T  +IVP  + GT  +   +  N+    F + +V ++F  PI
  S:    52 IFIGNHLSNADGLVLDKVLQ--KE-----YDPYFIAGVKLNDEALTNIGTRLVKNIKIKPNSADRESLSKIVKA--------VKGGENIVIFPEGTRSRNAKMIEAKKGIILIARLTKAKIVPFGMTGTEKIMPINDENMGAEKFHHSKVNIKFGTPI 194
>gi|28210110|ref|NP_781054.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium tetani E88] >gi|28202546|gb|AAO34991.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Clostridium tetani E88] (239 aa)
Score = 109, Expect = 2.0e-03, Identities = 45/167 (26%), Positives = 83/167 (49%)
  Q:    65 FTKVKIKGSKNI-PANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV----EKEHKSNIFKYKEVTVEFLEPI 231
           +  +KI+G +N+    K ++F+ NH SN D L+      ++KE+     D TFV+ I++SK        K+  TI I + N  D   ++   K L  KG  ++ +F EGTR +     E K   +     +   ++P+ + GT  +     K+  +  F + ++ V+  +P+
  S:    37 YANIKIEGLENLNDIKKPILFISNHLSNADALII---DDILKEQ-----DITFVAGIKLSKNPLTNLGLKITKTITI-KPNTADKEAISNIIKTL--KGGNNVLIFPEGTRSRNGSLIEGKKGVILIQKLSKATVIPMSLTGTEKLLPINNKDMGAEKFNHSDIHVKIGKPL 197
>gi|124514312|gb|EAY55826.1| Acyltransferase [Leptospirillum sp. Group II UBA] (228 aa)
Score = 109, Expect = 2.0e-03, Identities = 47/155 (30%), Positives = 74/155 (47%)
  Q:    57 ASKAVFC-TFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQE--------EKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG---TLGVEK 211
           A+ ++FC ++ ++K+ G +N+PA    +   NH+S+ DV   L    + +E R       F  K E+       F +      F+   NL  F  V  E         + +LQ+G+  L +F EGTR +  + G F       +  T   IVP  I G   +LGV K
  S:    27 ATFSLFCRSYLRLKVDGLENLPAEGGTIVAVNHQSHLDVP--LMGLALPREAR-------FPGKAEL-------FTSSFFLRTFL--LNLGGFPIVRGEGDRKAISLSESILQRGD-VLVLFPEGTRTRTGDIGAFHRGLGVLSIRTGSPIVPAAIRGSGDSLGVGK 174
>gi|157273526|gb|ABV27425.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Candidatus Chloracidobacterium thermophilum] (209 aa)
Score = 109, Expect = 2.1e-03, Identities = 50/209 (23%), Positives = 91/209 (43%)
  Q:    52 YVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKM-IKEKRPEILDPTFVSKIEISKTKRVGFAAKLI---NTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIK 260
           YV   A +     F ++   G +++P    V+  PNH+S      Y   F + +  +RP       +  +  S+  RV +   L+       +D     D   + +  +ELL+ G Q++ +F EG R    +  EFK+ A   A      IVP+ + G   V   H+  + +  ++TV F  P+ +    +  KE+ +E  +   E    K++
  S:     8 YVTRPALRVALHPFFRMAYFGVEHVPKTGPVLLAPNHQS------YADPFWIGLPIRRP-------IHFMTWSRVFRVSYLRPLLRYFQCFPVDHDKPFDKSAL-KTTQELLRAG-QAVMIFPEGGRTPHGDLQEFKAGAFRIAVKMEVPIVPITLNGGFEVWSMHR-KLPRPGKITVHFHPPMYFSARDRDLKEVTAEAARTVWEVIASKLQ 204
>gi|114606644|ref|XP_001163738.1| PREDICTED: hypothetical protein LOC462582 isoform 2 [Pan troglodytes] (170 aa)
Score = 109, Expect = 2.2e-03, Identities = 38/146 (26%), Positives = 61/146 (41%)
  Q:   117 VSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    11 IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 155
>gi|109070594|ref|XP_001114503.1| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 1 isoform 1 [Macaca mulatta] >gi|10441998|gb|AAG17276.1|AF218034_1 unknown [Homo sapiens] >gi|67969735|dbj|BAE01216.1| unnamed protein product [Macaca fascicularis] (171 aa)
Score = 109, Expect = 2.2e-03, Identities = 38/146 (26%), Positives = 61/146 (41%)
  Q:   117 VSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI--YGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           ++K E+      G A  L   IFIDR+   D + V  E  + L   +  + VF EGTR        FK  A   A      IVP+V+  Y     +KE +   F   +  V  L P+  +         ++++++  M   + +I  D
  S:    12 IAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERR---FTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTD 156
>gi|19115517|ref|NP_594605.1| 1-acylglycerol-3-phosphate O-acyltransferase [Schizosaccharomyces pombe] >gi|74638856|sp|Q9US20|YLD2_SCHPO Uncharacterized acyltransferase C1851.02 >gi|6562195|emb|CAB62428.1| 1-acylglycerol-3-phosphate O-acyltransferase [Schizosaccharomyces pombe] (279 aa)
Score = 109, Expect = 2.2e-03, Identities = 46/178 (25%), Positives = 78/178 (43%)
  Q:    54 YSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIK--KDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI 231
           Y LAS  +   F   KI+  + +  +KS + V NH+S  D+L   + F           + + ++K  +     +G+   L + +FIDR    D +++  +    ++K   S+ VF EGTR    K      K  A   A      I+P+ I  T G      + +F   E  ++ L+PI
  S:    76 YGLASTILDFRF---KIENEEILRKHKSAVLVVNHQSELDILAIGRTFGP---------NYSVIAKKSLRYVPILGWFMILSDVVFIDRSRRSDAIQLFAKAARRMRKENISIWVFAEGTRSYSLKPCLLPLKKGAFHLAVQAQVPIIPIAIQ-TYGHLFHPPTKVFNKGEALIKVLDPI 242
>gi|153874345|ref|ZP_02002601.1| Phospholipid/glycerol acyltransferase [Beggiatoa sp. PS] >gi|152069190|gb|EDN67398.1| Phospholipid/glycerol acyltransferase [Beggiatoa sp. PS] (254 aa)
Score = 108, Expect = 2.3e-03, Identities = 37/133 (27%), Positives = 65/133 (48%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFV-RVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           +++G +NIP N   + +  H+S ++ +VY + F              ++ K E+     +G+A   +N I IDR+NLR  + ++ ++ K+ L  G   L +F EGTR+   E   +          T C I+PV
  S:    59 QVEGLENIP-NTPTIILSKHQSAWETIVYQQIFPA----------HVWLLKRELLYIPLLGWALASLNPISIDRKNLRQSISKIVEQGKQRLANGLW-LLIFPEGTRVAPGEKKRYGIGGALLGEKTGCPILPV 180
>gi|118578822|ref|YP_900072.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Pelobacter propionicus DSM 2379] >gi|118501532|gb|ABK98014.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Pelobacter propionicus DSM 2379] (234 aa)
Score = 108, Expect = 2.3e-03, Identities = 36/147 (24%), Positives = 69/147 (46%)
  Q:    60 AVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           ++F   T+V++ G +++P+   V+F+ NH+S FD+   L             L+  +++K E+      G A      I +DR++    ++  +   ++++ G +SL +F EGTR        FK      A      +VP+ I G+
  S:    46 SLFLAGTRVRLTGVEHLPSG-PVIFMSNHQSGFDIPTLLAVLP---------LETCWIAKKELFDIPVFGSAMGRGGYIPLDRRDAHRALKSLEMAVKVVRSG-RSLLIFPEGTRSMDFRLLPFKRGGFKLALQAGVPVVPLTINGS 181
>gi|120612811|ref|YP_972489.1| phospholipid/glycerol acyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120591275|gb|ABM34715.1| phospholipid/glycerol acyltransferase [Acidovorax avenae subsp. citrulli AAC00-1] (251 aa)
Score = 108, Expect = 2.3e-03, Identities = 34/121 (28%), Positives = 65/121 (53%)
  Q:    67 KVKIKGSKNIPAN--KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAA 187
           + +I G +++P +  + V+ +  H+S ++         ++    P  L   +V K E+ +    G++   ++ I IDR Q  R FV+V Q+ + LL +G   + +F EGTRI + + G++KS  
  S:    59 RTRITGMEHLPQDPGQGVVLLVKHQSTYETF-------LMPAIMPRPL--AYVFKKELLQIPFFGWSIGSLDMIHIDRAQRARAFVKVLQQGRALLARGTW-VIMFPEGTRIDRGQKGDYKSGG 172
>gi|121698327|ref|XP_001267785.1| 1-acylglycerol-3-phosphate acyltransferase (AtaAp), putative [Aspergillus clavatus NRRL 1] >gi|119395927|gb|EAW06359.1| 1-acylglycerol-3-phosphate acyltransferase (AtaAp), putative [Aspergillus clavatus NRRL 1] (292 aa)
Score = 108, Expect = 2.4e-03, Identities = 39/125 (31%), Positives = 54/125 (43%)
  Q:    78 ANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVS---KIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKD--EFGEFKSAALTPAYSTFCQIVPVV 202
           + +  +F+ NH+S  DVL+    F            P + S   K  +     +G+   L  T+FIDR N    V+      E +    QS+ +F EGTR   D  E   FK  A   A      IVPVV
  S:    97 STRPAVFIGNHQSELDVLMLGHIF------------PPYCSVTAKKSLRNVPFLGWFMALSRTVFIDRANRETAVKAFDSAAEEMCVHRQSVFIFPEGTRSYSDKPELLPFKKGAFHLAVKAGVPIVPVV 214
>gi|150015468|ref|YP_001307722.1| phospholipid/glycerol acyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|149901933|gb|ABR32766.1| phospholipid/glycerol acyltransferase [Clostridium beijerinckii NCIMB 8052] (234 aa)
Score = 108, Expect = 2.4e-03, Identities = 43/142 (30%), Positives = 68/142 (47%)
  Q:    65 FTKVKIKGSKNI-PANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFI-----DRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           +  + + G+ NI    K  +FV NH SN D LV     KM+KEK     DP FV  I++S+        +++  I I     D++ +   V+  +E  ++L        +F EGTR +     E K   L  A     +I+P+ + GT
  S:    33 YANITVNGADNIDKVKKPRIFVCNHLSNSDGLVL---SKMLKEKS----DPHFVMGIKLSEDPITKLGTQIVKNIPIKPNSADKEAITRVVKALKEGNDIL--------IFPEGTRSRTGAMIEGKKGILLFARMAKAEIIPIGMSGT 165
>gi|168207646|ref|ZP_02633651.1| sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens E str. JGS1987] >gi|170661000|gb|EDT13683.1| sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens E str. JGS1987] (234 aa)
Score = 108, Expect = 2.5e-03, Identities = 43/149 (28%), Positives = 73/149 (48%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFI-----DRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNI----FKYKEVTVEFLEPI 231
           +F+ NH SN D LV  K  +  KE      DP F++ ++++         +L+  I I     DR++L   V+          KG +++ +F EGTR +  +  E K   +  A  T  +IVP  + GT  +   +  N+    F + +V ++F  PI
  S:    52 IFIGNHLSNADGLVLDKVLQ--KE-----YDPYFIAGVKLNDEALTNIGTRLVKNIKIKPNSADRESLSKIVKA--------VKGGENIVIFPEGTRSRNAKMIEAKKGIILIARLTKAKIVPFGMTGTEKLMPINDENMGAEKFHHSKVNIKFGTPI 194
>gi|186477073|ref|YP_001858543.1| phospholipid/glycerol acyltransferase [Burkholderia phymatum STM815] >gi|184193532|gb|ACC71497.1| phospholipid/glycerol acyltransferase [Burkholderia phymatum STM815] (283 aa)
Score = 108, Expect = 2.5e-03, Identities = 38/125 (30%), Positives = 56/125 (44%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           ++ V+ V NH S  D+ V       I   RP      F+SK EI K   VG+ A+ + T+FI R+   D  R+  +  + L  GE  + VF EGT     +   F +     A S    + PV +
  S:    62 DEGVLVVANHISWIDIYV-------INAWRPT----PFLSKAEIRKWPVVGWCAQQLGTVFIQREKRSDAKRIMHDLADRLNAGEL-MCVFPEGTTSDGVQLLPFHANMFQAAVSASRPVQPVCM 174
>gi|156549981|ref|XP_001603835.1| PREDICTED: similar to 1-acyl-sn-glycerol-3-phosphate acyltransferase [Nasonia vitripennis] (273 aa)
Score = 108, Expect = 2.5e-03, Identities = 32/135 (23%), Positives = 61/135 (45%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           +++G +NI  +   + + NH+SN D+ V  + + +++         T +SK ++      G A+ L  TIFIDR    +         E++++ +  + ++ EG R        FK      A  +   I PVV+
  S:    77 QVRGKENIVKDSGAVVLINHQSNLDLCVLAQLWPILQR-------CTVISKKQVLYFGTFGLASWLWGTIFIDRVKKEEAQSTVNSTAEIIKRRKAKVLMYPEGKRHTGSSLLPFKKGGFHVAIDSQTPIQPVVV 204
>gi|108758938|ref|YP_629780.1| putative long-chain-fatty-acid CoA ligase [Myxococcus xanthus DK 1622] >gi|108462818|gb|ABF88003.1| putative long-chain-fatty-acid CoA ligase [Myxococcus xanthus DK 1622] (1470 aa)
Score = 108, Expect = 2.5e-03, Identities = 46/167 (27%), Positives = 75/167 (44%)
  Q:    41 PELLGLTERQNYVYSLASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQ-NLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTL 207
           P+++    RQ  + S   K ++     VK+ G   IP N++ + + NH S+ D  +   A     E+   +    +     +   KR  F     N I I+RQ +LR+ +R+     E L++G   L +F EGTR    E  EFKS     A +    ++P+ I G  
  S:  1226 PDVVADVGRQ--LLSFGQKVLYGGVFDVKVTGKSFIPQNRNFLVIANHSSHLDAGLVRVALGDQGERLVSLAARDYFFNTPL---KRAWF-ENFTNLIPIERQGSLRESLRM---AGEALRQGFNVL-IFPEGTRSTTGELMEFKSTLGYLALTFNMDVLPLYIGGAF 1383
>gi|108801987|ref|YP_642184.1| phospholipid/glycerol acyltransferase [Mycobacterium sp. MCS] >gi|119871139|ref|YP_941091.1| phospholipid/glycerol acyltransferase [Mycobacterium sp. KMS] >gi|126437968|ref|YP_001073659.1| phospholipid/glycerol acyltransferase [Mycobacterium sp. JLS] >gi|108772406|gb|ABG11128.1| phospholipid/glycerol acyltransferase [Mycobacterium sp. MCS] >gi|119697228|gb|ABL94301.1| phospholipid/glycerol acyltransferase [Mycobacterium sp. KMS] >gi|126237768|gb|ABO01169.1| phospholipid/glycerol acyltransferase [Mycobacterium sp. JLS] (249 aa)
Score = 108, Expect = 2.5e-03, Identities = 51/199 (25%), Positives = 80/199 (40%)
  Q:    57 ASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           A  A   T T++   G  NIPA    +   NH    D L            +       F+ K E+ + K VG+  +   TI +DR   R          + L+ GE  + V+ E T  +  E  EFK+ A   A      I+P++++G   +  K+H   + + +  VTV   EPI     +      +   M A +E A
  S:    12 AEAATRVTGTRITYHGLDNIPARGGAVVAINHTGYIDFL------PAALAAKRRRRRMRFMIKAEMEQVKIVGYLIRHTGTIPVDR---RAGAGAYAVAVQALRAGEL-VGVYPEATISRSFELKEFKTGAGRMAIEADVPILPLIVWGAHRLWTKDHPRALGRNRIPVTVVVGEPIPPAGPVSELSTTLRASMNALLERA 202
>gi|194683676|emb|CAR44629.1| 1-acyl-glycerol-3-phosphate acyltransferase [Proteus mirabilis HI4320] (249 aa)
Score = 108, Expect = 2.6e-03, Identities = 51/179 (28%), Positives = 81/179 (45%)
  Q:    83 MFVPNHKSNFDVLVYLKAFK---MIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPI---KY-KDYIQTSKELVSEKMKAKMEAAYLKIKE 261
           +++ NH++NFD++    A +   +   K+  +  P F            G    +   I IDR N         +  E ++  + S+ +F EGTR +      FK+ A   A      IVPV +  T G   + K N +    V VE L PI   KY KD ++   E   + MKAK+E    +++E
  S:    68 IYIGNHQNNFDMVTMSNAVQPNTVTVGKKSLVFIPFF------------GQLYWITGNILIDRGNRSKAHSTITQVAEQIKAKKISVWMFPEGTRSRGRGLLPFKTGAFHAAMQAGVPIVPVCVSTTQG---KIKLNRWNNGYVIVEMLPPIDVSKYNKDQVRELAEDCRQIMKAKIEELDKEVEE 238
>gi|149632680|ref|XP_001512291.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] (241 aa)
Score = 108, Expect = 2.6e-03, Identities = 42/196 (21%), Positives = 84/196 (42%)
  Q:    69 KIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPN 264
           ++KG +        + + NH+S  D++  ++   ++ ++  +I      +K E+     VG    L   IFI+R+     +    E  + + K    + ++ EGTR    +   FK  A   A  +   I+PVV Y +       ++ +F    + VE L+PI+ K     +   + E+  + M  ++  +   PN
  S:    42 ELKGLEKFETEGPCVIISNHQSILDMMGLME---ILPDRCIQI------AKKELMYMGTVGLVMYLGGVIFINRKRTSTAMSALTEVGDTMVKENLKVWIYPEGTRNGNGDLLPFKKGAFHLAIHSKVPIIPVV-YSSYTSFYRPETKLFTSGTIKVEVLDPIETKGMTAENVPELMERCHSIMRESFFSLSNFPN 227
>gi|110597220|ref|ZP_01385508.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Chlorobium ferrooxidans DSM 13031] >gi|110341056|gb|EAT59524.1| 1-acyl-sn-glycerol-3-phosphate acyltransferases [Chlorobium ferrooxidans DSM 13031] (236 aa)
Score = 108, Expect = 2.7e-03, Identities = 36/139 (25%), Positives = 64/139 (46%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           V++ G +N  ++++ + V NH    D+ + L             ++  F++K E+ K    G+  KL   + I R   RD ++       +L+KG +S+ +F EGTR    +   FK  A   A      ++PV I G+
  S:    55 VEVIGRENYSSDQNYLLVSNHAGMADIPLILGNIA---------INLRFLAKEELGKIPIFGWTLKLAGYVMIKRGQNRDALKSLLAASNVLKKG-RSVHIFPEGTRSFDGKLLPFKRGAFLVAEKGGAPVLPVTIIGS 183
>gi|87122771|ref|ZP_01078644.1| hdtS protein [Marinomonas sp. MED121] >gi|86161936|gb|EAQ63228.1| hdtS protein [Marinomonas sp. MED121] (245 aa)
Score = 108, Expect = 2.7e-03, Identities = 37/142 (26%), Positives = 70/142 (49%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR--VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVV 202
           +FC  T V ++G +N+   ++ + V NH+S ++   +L+           +   + V K E+      G+  +++  I IDR    + ++  + Q ++ LL  G +S+ +F EGTR++  E   F   A   A S    I+P+V
  S:    60 IFCGVT-VNVQGRENLEKGRAYVIVANHQSEWETY-FLQVL---------VTPLSTVLKKELLSVPFFGWGLRMVQPIAIDRSQKSNALKQILKQGKERLL--GGRSVLIFPEGTRVRAGEEKSFNKGAAMLATSADKAILPIV 190
>gi|156048298|ref|XP_001590116.1| hypothetical protein SS1G_08880 [Sclerotinia sclerotiorum 1980] >gi|154693277|gb|EDN93015.1| hypothetical protein SS1G_08880 [Sclerotinia sclerotiorum 1980] (306 aa)
Score = 108, Expect = 2.8e-03, Identities = 44/155 (28%), Positives = 68/155 (43%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYK 234
           +  +F+ NH++  DVL+    F       P     T  +K  +     +G+   L  T+FIDR N +D  +        +++ +QS+ +F EGTR   K      FK  A   A      IVPVV+     V    +S  F    + V  L+PI+ K
  S:   101 RPAVFIGNHQTELDVLMLGCIF-------PRYCSVT--AKKSLKNVPFLGWFMSLSGTVFIDRGNAKDARQAMAGAATEIKEEKQSVYIFPEGTRSYAKDPTLLPFKKGAFHLAVQAGVPIVPVVVACYSDV-LHVQSWRFTSGRIPVRVLKPIETK 247
>gi|145348620|ref|XP_001418744.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144578974|gb|ABO97037.1| predicted protein [Ostreococcus lucimarinus CCE9901] (214 aa)
Score = 107, Expect = 2.9e-03, Identities = 46/198 (23%), Positives = 90/198 (45%)
  Q:    51 NYVYSLASKAVFCTFTKVKIKGSKNIPA-NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYG---TLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKM 248
           N V++  S A+F     + ++G +++P  +++ ++V NH S  D+      + M   +RP      F+SK        VG++  L   + + R   R  +   ++ +E+L  G  S+  F EGTR    +   FK  A + A      ++PV I G    +   KE++ +    K +    ++     D    S++++ E +
  S:    23 NDVWATVSTALF---FPIVVEGREHLPRHDEAAVYVANHASFMDI------YSMFHLRRPF----KFISKTSNFLIPVVGWSMFLTGHVPLKRMERRSQMETLKKCREMLADG-GSVLFFPEGTRSATGKMAAFKKGAFSVAAKENVPVIPVTIVGAHEAMASGKEYELHNAGIKVIVHPRIQSTDADDLCARSEKIIKEAL 210
>gi|194564068|ref|YP_002099091.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Burkholderia dolosa AUO158] >gi|124895692|gb|EAY69572.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Burkholderia dolosa AUO158] (285 aa)
Score = 107, Expect = 2.9e-03, Identities = 35/125 (28%), Positives = 55/125 (44%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + S + V NH S  D+         I   RP      FVSK E+ +   VG+ A+ ++T+F+ R+   + +R+  E  E L  G   + VF EGT         F +     A S  C + P+ +
  S:    61 DASALVVGNHVSWLDIYA-------INAWRPT----PFVSKAEVRQWPVVGWLAEKLDTVFLQREKRTEAMRIMHEMAERLSNG-GVMCVFPEGTTSDGQGLLPFHANLFQAAVSAGCAVQPICL 173
>gi|73612132|gb|AAZ78229.1| acyl transfer enzyme [Acidithiobacillus ferrooxidans] (242 aa)
Score = 107, Expect = 3.0e-03, Identities = 37/137 (27%), Positives = 63/137 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           + ++ G  NIPA   V+ V NH+S  + L++   F       P++   +FV K E+ +   +G+  +L   I IDR   R+ +    E+ +L       + +F EGTR      G F S A   A      ++P+ +
  S:    58 RYRVSGLANIPATPCVI-VANHQSALETLLFWCIF-------PQL---SFVLKKELFRIPVIGWGLRLAWPIGIDRNGGREALLQVIEQGKLRLAAGFHVVIFPEGTRHPCGTVGPFSSTAAGLAIRAQAPLLPIAV 183
>gi|115376335|ref|ZP_01463574.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Stigmatella aurantiaca DW4/3-1] >gi|115366685|gb|EAU65681.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Stigmatella aurantiaca DW4/3-1] (255 aa)
Score = 107, Expect = 3.0e-03, Identities = 42/157 (26%), Positives = 78/157 (49%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFI-----DRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT----------LGVEKEHKSNI 217
           V+  +  +++ G +++P   + ++V NH SN D L   +A + ++          F++ +++ +T     A++ +NTIFI     D + LR  V   +E + +L        VF EG R +       K      A+ T   IVPV + GT          +G E+ H++ +
  S:    28 VWKRYADMQVHGREHLPLGPA-LYVCNHLSNADGLTLQRALQPLR--------IWFLAGVKLRRTAMTRLASEAVNTIFIRPGSPDIEALRRAVAALKEGRSVL--------VFPEGGRSRTGALLRAKKGVSLIAHRTGVPIVPVALTGTERLLPIDERNMGGERLHRARV 182
>gi|110799186|ref|YP_695969.1| sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens ATCC 13124] >gi|110673833|gb|ABG82820.1| sn-glycerol-3-phosphate acyltransferase [Clostridium perfringens ATCC 13124] (234 aa)
Score = 107, Expect = 3.1e-03, Identities = 43/149 (28%), Positives = 73/149 (48%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFI-----DRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNI----FKYKEVTVEFLEPI 231
           +F+ NH SN D LV  K  +  KE      DP F++ ++++         +L+  I I     DR++L   V+          KG +++ +F EGTR +  +  E K   +  A  T  +IVP  + GT  +   +  N+    F + +V ++F  PI
  S:    52 IFIGNHLSNADGLVLDKVLQ--KE-----YDPYFIAGVKLNDEALTNIGTRLVKNIKIKPNSADRESLSKIVKA--------VKGGENIVIFPEGTRSRNAKMIEAKKGIILIARLTKAKIVPFGMTGTEKLMPINDENMGAEKFHHSKVNIKFGTPI 194
>gi|88711458|ref|ZP_01105546.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Flavobacteriales bacterium HTCC2170] >gi|88710399|gb|EAR02631.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Flavobacteriales bacterium HTCC2170] (245 aa)
Score = 107, Expect = 3.1e-03, Identities = 32/123 (26%), Positives = 62/123 (50%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFD---VLVYLKAFKMIKEKRPEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAAL 188
           T  K   S  IPA++ ++ V NH+S  D   ++ +++ +            P FVSKIE+ K    V +  +   ++ IDR++ +  +    +  + ++K ++S  +F EGTR +     +F+   L
  S:    60 TTYKFNNSHKIPADRPLIMVLNHQSMNDIPPIIWFMRKYH-----------PKFVSKIELGKGIPSVSYNLRHGGSVLIDRKDSKQALMQIAKLGKYIEKHDRSAVIFPEGTRSRNGHPKKFQPTGL 175
>gi|153801143|ref|ZP_01955729.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MZO-3] >gi|124123376|gb|EAY42119.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MZO-3] (261 aa)
Score = 107, Expect = 3.1e-03, Identities = 46/186 (24%), Positives = 82/186 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY----IQTSKELVSEKMKAKM 252
           K++ +   ++      +++ NH++N+D+      F + K   P+++    V K  ++     G    L   I IDR N         +  + +++ + S+ +F EGTR +      FK+ A   A      I+P+V   T     + K N +    V VE L PI  + Y    I+   +   E MKAK+
  S:    71 KLEYRAPADVDQRGQHIYIANHQNNWDL------FTVSKAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANKAKAKGTIDQVVDSMKQSDVSVWMFPEGTRSRGRGLLPFKAGAFHAAIGAGVPIIPIVCSST----DKLKFNRWNNGHVIVEVLPPISTEGYSKENIRELSQHCYELMKAKL 247
>gi|71736112|ref|YP_272323.1| hdtS protein [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556665|gb|AAZ35876.1| hdtS protein [Pseudomonas syringae pv. phaseolicola 1448A] (256 aa)
Score = 107, Expect = 3.1e-03, Identities = 36/135 (26%), Positives = 67/135 (49%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKE--KRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           +V++ G++N+P    V+ + NH+S ++       F+ + +  KR  +  P F            G+A  ++  I IDR N +  +R + ++  ELL+ G   L +F EGTR+   + G+F       A +    ++PV
  S:    62 QVEVTGAENVPTPPCVI-ISNHQSTWETFFLSAYFEPMSQVLKRELLYVPFF------------GWAMAMLRPIAIDRDNPKAALREIAKKGDELLKDGVWVL-IFPEGTRVPYGQVGKFSRGGTALAVNADLPVLPV 185
>gi|154245763|ref|YP_001416721.1| phospholipid/glycerol acyltransferase [Xanthobacter autotrophicus Py2] >gi|154159848|gb|ABS67064.1| phospholipid/glycerol acyltransferase [Xanthobacter autotrophicus Py2] (271 aa)
Score = 107, Expect = 3.3e-03, Identities = 35/120 (29%), Positives = 58/120 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSA 186
           +V +KG+    A++ ++ + NH S  D+ V       I    P +    FV+K E+ +   +G  AK   T+F+DRQ       VN+   E LQ G+  + +F EGT    +    F++A
  S:    45 RVTVKGAP--AADRPLLILANHCSWIDIPV-------IGSLTPLV----FVAKSEVGRWPLIGLLAKFQRTVFVDRQRRHATGEVNRTIAERLQDGD-PVVLFAEGTSSDGNRVLPFRTA 150
>gi|194337689|ref|YP_002019483.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Pelodictyon phaeoclathratiforme BU-1] >gi|194310166|gb|ACF44866.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Pelodictyon phaeoclathratiforme BU-1] (236 aa)
Score = 107, Expect = 3.3e-03, Identities = 47/187 (25%), Positives = 81/187 (43%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEA 254
           +++ G +N    ++ + + NH    D+ + L             L+  F++K E+ K    G A +    + I R   RD ++      ++L+ G  S+ +F EGTR    E   FK  A   A +    ++PV I G+  +  +    I K K + V   +PI+      +S + V E M A  EA
  S:    55 IEVIGRENYSTEENYLVISNHAGMADIPLLLGTMN---------LNLRFLAKEELGKIPLFGRALREAGYVMIKRGQNRDALKSLLAATKVLKSG-HSVHIFPEGTRSATGELLPFKRGAFRVAQAGGAPVLPVTIIGSHLITPKKSLKINKGK-IRVIIDKPIQ-----PSSFDSVEELMAACSEA 225
>gi|89902453|ref|YP_524924.1| phospholipid/glycerol acyltransferase [Rhodoferax ferrireducens T118] >gi|89347190|gb|ABD71393.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Rhodoferax ferrireducens T118] (244 aa)
Score = 107, Expect = 3.3e-03, Identities = 36/137 (26%), Positives = 71/137 (51%)
  Q:    67 KVKIKGSKNIPANKSV--MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           +V+++G +++PA  S   + +  H+S  + L       +I    P  L   FV K E+ +    G++   ++ I IDR++    ++ V ++ K  L +G   + +F EGTRI + + G +++A    A  T   +VP+ +
  S:    58 RVRVRGLEHLPAGASTPAILLSKHQSTLETL-------LIPTLMPRPL--AFVFKRELLRIPFFGWSMARLDMIHIDRESRALAMKHVIEQGKRRLAQGTW-VIMFPEGTRIARGQTGTYQTAGTRLAVETGAPVVPIAV 187
>gi|162451704|ref|YP_001614071.1| 1-acylglycerol-3-phosphate O-acyltransferase [Sorangium cellulosum 'So ce 56'] >gi|161162286|emb|CAN93591.1| 1-acylglycerol-3-phosphate O-acyltransferase [Sorangium cellulosum 'So ce 56'] (249 aa)
Score = 107, Expect = 3.4e-03, Identities = 48/194 (24%), Positives = 79/194 (40%)
  Q:    70 IKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           ++G ++    +  + + NH+S FD+ V  +A        P  L    ++K E+      G A K    I I+R +        Q    +LQ G + + +  EGTR K      FKS     A  T   I+PV I GT  V +     + ++  V V  + PI    Y    +  +   ++A +  A   +  DP
  S:    55 VRGREHASGTRPFVVMSNHQSLFDIPVVFRAI-------PGRL--RMIAKKELFNVPIFGQAMKAAGFIRINRSDHVQASASLQVGASMLQDGTR-VWIAPEGTRSKTGALLPFKSGGFRMAIETNTPILPVAIDGTRHVLRAKDFVVQEHHRVVVTIMPPIDPAPYGAGGRNRLMRDVRAAIAGA---LGHDP 235
>gi|190572223|ref|YP_001970068.1| putative transmembrane acetyltransferase [Stenotrophomonas maltophilia K279a] >gi|190010145|emb|CAQ43753.1| putative transmembrane acetyltransferase [Stenotrophomonas maltophilia K279a] (272 aa)
Score = 107, Expect = 3.4e-03, Identities = 51/179 (28%), Positives = 83/179 (46%)
  Q:    77 PANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV-VIYG---------TLGVEKEHKSNIFKY-----KEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           P   +V+FV NH S  D+ + L + +M+           FV+K EI+    VG+ A    TIF  R +      V Q   + L++G +++ VF EG      E G F +     A  T   + PV ++YG           G  +   +N  +      +   V FL PI  +D     +  ++E  +A++ AA
  S:    89 PLPGAVLFVANHVSWVDICI-LHSQRMMG----------FVAKREIASWPLVGWLAARGQTIFHQRGSTESLGGVMQVMADRLREG-KAVGVFPEGRTRGGHEVGPFHARIFQAAVETGVPVQPVALVYGAKGDAQTIVAFGPNESFFANFLRLLGEPARRAEVHFLAPIGAQDL--EGRRRIAETSRARIVAA 268
>gi|162149068|ref|YP_001603529.1| putative acetyl transferase [Gluconacetobacter diazotrophicus PAl 5] >gi|187598224|ref|ZP_02984478.1| phospholipid/glycerol acyltransferase [Gluconacetobacter diazotrophicus PAl 5] >gi|161787645|emb|CAP57241.1| putative acetyl transferase [Gluconacetobacter diazotrophicus PAl 5] >gi|187489598|gb|EDU27545.1| phospholipid/glycerol acyltransferase [Gluconacetobacter diazotrophicus PAl 5] (261 aa)
Score = 107, Expect = 3.5e-03, Identities = 37/157 (23%), Positives = 65/157 (41%)
  Q:    45 GLTERQNYVYSLASKAVFCTF--TKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILD-PTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           G   R   +++  S A  C     +V + G +N+PA +  +    H+S FD LV++            ++D P +V K E+++   VG    L   I + R +    +R             + + +F EGTR +  E        +  A  T   ++PV
  S:    33 GFALRYAKLWTRLSVAALCRICGIRVIVTGRENLPAGQPCLLASQHQSAFDTLVWMN-----------LVDRPAYVMKEELTRIPLVGPMLLLAGMIPVRRTDGPKALRALLAATGQAAADARQIVIFPEGTRTRPGEKARLHPGIVAMANHTGLPVIPV 181
>gi|159902693|ref|YP_001550037.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prochlorococcus marinus str. MIT 9211] >gi|159887869|gb|ABX08083.1| putative 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prochlorococcus marinus str. MIT 9211] (225 aa)
Score = 107, Expect = 3.6e-03, Identities = 45/158 (28%), Positives = 74/158 (46%)
  Q:    46 LTERQNYVYSLASKAV----FCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDR-QNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           L  RQ+ VY+  S  +    F  F + +I G +N+P   S++ V NH S+ D  +   A       RP      F++K E+ +   +G+  +      + R  + R+ +RV  E    L +G  +  VF++GTR +        + A   A  T  QI+PV I
  S:    14 LPPRQSLVYAFISYCIVFPIFRIFFRGRISGIQNVPLQGSLVIVANHASHLDPPLLGHAL-----GRP----IAFMAKQELFRIPILGWIIRACGAYPVSRGASDREAIRVASER---LHQG-WATGVFLDGTRQENGRVNNPMAGAALLAARTNSQILPVAI 163
>gi|149186794|ref|ZP_01865105.1| acetyltransferase [Erythrobacter sp. SD-21] >gi|148829702|gb|EDL48142.1| acetyltransferase [Erythrobacter sp. SD-21] (299 aa)
Score = 107, Expect = 3.6e-03, Identities = 35/123 (28%), Positives = 56/123 (45%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALT 189
           +V+++G+   P  + V F+ NH S  D+L    A               FV+K E+S+   +G+   L  T+F+ R++           KE LQ    S+TVF EGT         FKS+ ++
  S:    84 RVEVRGT---PLRRDVFFISNHISWIDILAMAGASGT-----------AFVAKWELSQVPVIGWLCSLNRTVFVKREHRMGVAEQINALKEALQD-NWSVTVFPEGTVTDGHSLLPFKSSMIS 191
>gi|116191807|ref|XP_001221716.1| hypothetical protein CHGG_05621 [Chaetomium globosum CBS 148.51] >gi|88181534|gb|EAQ89002.1| hypothetical protein CHGG_05621 [Chaetomium globosum CBS 148.51] (303 aa)
Score = 107, Expect = 3.6e-03, Identities = 36/124 (29%), Positives = 57/124 (45%)
  Q:    80 KSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE--FGEFKSAALTPAYSTFCQIVPVVI 203
           +  +F+ NH++  DVL+    F       P+    T  +K  + K   +G+   L  ++F+DR N +D  +  Q     ++   QS+ +F EGTR    E     FK  A   A      IVPVV+
  S:   100 RPAVFLGNHQTELDVLMLGCMF-------PKYCSVT--AKASLKKVPFLGWFMALSGSVFLDRANSKDARQAMQGAANEIRDKRQSVYMFPEGTRSYSKEPMLLPFKKGAFHLAVQAQVPIVPVVV 216
>gi|146305053|ref|YP_001185518.1| phospholipid/glycerol acyltransferase [Pseudomonas mendocina ymp] >gi|145573254|gb|ABP82786.1| phospholipid/glycerol acyltransferase [Pseudomonas mendocina ymp] (255 aa)
Score = 107, Expect = 3.7e-03, Identities = 34/135 (25%), Positives = 66/135 (48%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVR-VNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPV 201
           + +++G +NIP    V+   NH+S ++       F+ + +          V K E+ +    G+   L+  I IDR N +  ++ + ++ +E L++G   L VF EGTRI   + G+F     + A +    ++P+
  S:    62 RYEVRGLENIPERPCVILA-NHQSTWETFFLSSYFEPLSQ----------VVKRELLRVPFFGWGMALLKPIAIDRSNPKAALKQLAKQGEERLKQGAWVL-VFPEGTRIPPGQIGKFSRGGTSLAVNAGLPVLPI 185
>gi|168042363|ref|XP_001773658.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162675046|gb|EDQ61546.1| predicted protein [Physcomitrella patens subsp. patens] (245 aa)
Score = 107, Expect = 3.7e-03, Identities = 43/166 (25%), Positives = 81/166 (48%)
  Q:    41 PELLGLTERQNYVYSLASK--AVFCT--FTKVKIKGSKNIPA-NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGT 206
           P +L L +++     L +K  A+  T  F K +I+G +N+PA ++  ++V NH+S  D+      + + +  RP      F+SK        +G++  +   I + R + R  +   +   +L+++G  S+  F EGTR        FK  A + A      +VP+ + G+
  S:    33 PFVLLLDKQRRRAQHLVNKVWAILTTSLFYKTEIEGWENLPASDEGAVYVANHQSFLDI------YTLFQLGRPF----KFISKTSNFLIPIIGWSMYMTGHIPLKRMDKRSQLECLKTCMKLVKEG-VSVLFFPEGTRTTDGAMAAFKKGAFSVAAKGGVPVVPITLIGS 192
>gi|3914374|sp|Q42670|PLSC_COCNU 1-acyl-sn-glycerol-3-phosphate acyltransferase (1-AGP acyltransferase) (1-AGPAT) (Lysophosphatidic acid acyltransferase) (LPAAT) >gi|1098605|gb|AAC49119.1| lysophosphatidic acid acyltransferase >gi|1586836|prf||2204401A 1-acyl-sn-glycerol-3-phosphate acyltransferase (308 aa)
Score = 106, Expect = 3.8e-03, Identities = 45/169 (26%), Positives = 74/169 (43%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           + I+GS+   +N   +++ NH S  D+ + +          P+      ++K EI      G    L N   IDR N    +   +E    + K   SL +F EGTR K      FK   +  A  T   IVP+V+ GT    +++   + +   +TV++  PIK  D+
  S:   112 ITIEGSEF--SNTRAIYICNHASLVDIFLIMWLI-------PK--GTVTIAKKEIIWYPLFGQLYVLANHQRIDRSNPSAAIESIKEVARAVVKKNLSLIIFPEGTRSKTGRLLPFKKGFIHIALQTRLPIVPMVLTGTHLAWRKNSLRV-RPAPITVKYFSPIKTDDW 268
>gi|91782038|ref|YP_557244.1| lyso-ornithine lipid acyltransferase [Burkholderia xenovorans LB400] >gi|91685992|gb|ABE29192.1| lyso-ornithine lipid acyltransferase [Burkholderia xenovorans LB400] (292 aa)
Score = 106, Expect = 3.9e-03, Identities = 38/125 (30%), Positives = 55/125 (44%)
  Q:    79 NKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVI 203
           ++  + V NH S  D+ V       I   RP      FVSK EI +   VG+ A+ ++T+FI R+   D  R+  E  + L  GE  + VF EGT         F +     A S    + P+ I
  S:    62 DRGALVVANHISWIDIYV-------INAWRPT----PFVSKAEIRQWPVVGWLAQQLDTVFIQREKRSDAKRIMHELSDRLGAGEL-MCVFPEGTTSNGLAVLPFHANMFQAAVSASVPVQPLCI 174
>gi|118464870|ref|YP_879496.1| acyltransferase family protein [Mycobacterium avium 104] >gi|118166157|gb|ABK67054.1| acyltransferase family protein [Mycobacterium avium 104] (255 aa)
Score = 106, Expect = 3.9e-03, Identities = 49/189 (25%), Positives = 85/189 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFD-VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           K+ I G +N+P +   +   NH    D     L A+K    ++       F++K E+   K  G   + +  I ++RQ   D     +     L+ GE  + V+ E T  +  E  EFKS A   A      IVP +++G   +  K+H   +++ K  + V   EPI+    ++  K L+  +M+  +E A
  S:    22 KITITGVENLPKSGGAVIAINHTGYLDFTFAGLPAYKQGLGRKVR-----FMAKQEVFDHKITGPIMRSLRHISVNRQ---DGAASYEAAVRNLKDGEL-VGVYPEATISRSFEIKEFKSGAARMAVEAGVPIVPHIVWGAQRIWTKDHPKKLWRPKVPIIVLVGEPIQPTLGVEELKGLLHSRMQHLLERA 204
>gi|41406303|ref|NP_959139.1| hypothetical protein MAP0205 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41394651|gb|AAS02522.1| hypothetical protein MAP_0205 [Mycobacterium avium subsp. paratuberculosis K-10] (252 aa)
Score = 106, Expect = 3.9e-03, Identities = 49/189 (25%), Positives = 85/189 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFD-VLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAA 255
           K+ I G +N+P +   +   NH    D     L A+K    ++       F++K E+   K  G   + +  I ++RQ   D     +     L+ GE  + V+ E T  +  E  EFKS A   A      IVP +++G   +  K+H   +++ K  + V   EPI+    ++  K L+  +M+  +E A
  S:    19 KITITGVENLPKSGGAVIAINHTGYLDFTFAGLPAYKQGLGRKVR-----FMAKQEVFDHKITGPIMRSLRHISVNRQ---DGAASYEAAVRNLKDGEL-VGVYPEATISRSFEIKEFKSGAARMAVEAGVPIVPHIVWGAQRIWTKDHPKKLWRPKVPIIVLVGEPIQPTLGVEELKGLLHSRMQHLLERA 201
>gi|127511384|ref|YP_001092581.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Shewanella loihica PV-4] >gi|126636679|gb|ABO22322.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Shewanella loihica PV-4] (244 aa)
Score = 106, Expect = 3.9e-03, Identities = 47/180 (26%), Positives = 82/180 (45%)
  Q:    83 MFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNL-RDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEH-KSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           +F+ NH++NFD+  +  A        P+      + K  ++     G    L   I IDR+N  R F  + Q  K++  K   S+ +F EGTR +      FK+ A   A      +VPV     L   +EH K N +    V +E ++PI+ K   ++  + +S ++ A M     ++ ++
  S:    67 IFLANHQNNFDMFTHTAAV-------PK--GTVSLGKKSLAWIPFFGQIYWLSGNILIDRKNRNRAFETMAQTAKKIKDKC-LSIWIFPEGTRSRGKGLLPFKAGAFHTAIEAGVAMVPV-----LASNQEHIKLNRWNNGVVIIEVMDPIETKGLAKSQVKELSTRIHAMMAEKLAQLNQE 233
>gi|108763748|ref|YP_628430.1| putative acetyltransferase [Myxococcus xanthus DK 1622] >gi|108467628|gb|ABF92813.1| putative acetyltransferase [Myxococcus xanthus DK 1622] (282 aa)
Score = 106, Expect = 3.9e-03, Identities = 46/187 (24%), Positives = 85/187 (45%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY--IQTSKE-----LVSEKMKAKMEA 254
           +++ G +++P     + V NH+S  D+LV    ++  K          +VSK    K   +G+  +L   + + R +     ++  + +  L +G   L +F EGTR        FK  A   A    C ++PVV+ GT     +H   +       V+ + P+    +  + + +E     +VSE  KA++EA
  S:    97 LEVDGREHLPWRGPAVLVSNHESLGDILVLFGLYRPFK----------WVSKASNFKLPLIGWNMRLNRYVPLVRGDRASITKMLADCEYWLSRGVPIL-MFPEGTRSSDGVVKPFKDGAFALALKQRCPVIPVVLTGTARTLPKHGLVLETTARCHVQVMPPVDPSAFTDVASLREHVRNLIVSE--KARIEA 277
>gi|15642509|ref|NP_232142.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591252|ref|ZP_01678551.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae 2740-80] >gi|121727431|ref|ZP_01680559.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae V52] >gi|147674609|ref|YP_001218011.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae O395] >gi|153215711|ref|ZP_01950092.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae 1587] >gi|153221986|ref|ZP_01952813.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MAK 757] >gi|153818035|ref|ZP_01970702.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae NCTC 8457] >gi|153822415|ref|ZP_01975082.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae B33] >gi|153825772|ref|ZP_01978439.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MZO-2] >gi|153829799|ref|ZP_01982466.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae 623-39] >gi|194532133|ref|YP_002067566.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MO10] >gi|194534740|ref|YP_002069942.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae RC385] >gi|9657096|gb|AAF95655.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121546898|gb|EAX57052.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae 2740-80] >gi|121630203|gb|EAX62603.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae V52] >gi|124114629|gb|EAY33449.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae 1587] >gi|124119207|gb|EAY37950.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MAK 757] >gi|125618087|gb|EAZ46633.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MO10] >gi|126511470|gb|EAZ74064.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae NCTC 8457] >gi|126520058|gb|EAZ77281.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae B33] >gi|146316492|gb|ABQ21031.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae O395] >gi|148874717|gb|EDL72852.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae 623-39] >gi|149740495|gb|EDM54610.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae MZO-2] >gi|150419534|gb|EDN11860.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae RC385] >gi|150422621|gb|EDN14576.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Vibrio cholerae AM-19226] (261 aa)
Score = 106, Expect = 3.9e-03, Identities = 45/186 (24%), Positives = 83/186 (44%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEK----MKAKM 252
           K++ +   ++      +++ NH++N+D+      F + K   P+++    V K  ++     G    L   I IDR N         +  + +++ + S+ +F EGTR +      FK+ A   A      I+P+V   T     + K N +    V VE L PI  + Y + +   +S+     MKAK+
  S:    71 KLEYRAPADVDQRGQHIYIANHQNNWDL------FTVSKAVTPKVVT---VGKKSLAWMPLFGQLYWLTGNILIDRANKAKAKGTIDQVVDSMKQSDVSVWMFPEGTRSRGRGLLPFKAGAFHAAIGAGVPIIPIVCSST----DKLKFNRWNNGHVIVEVLPPISTEGYSKENIRELSQHCYDLMKAKL 247
>gi|86135133|ref|ZP_01053715.1| acyltransferase [Tenacibaculum sp. MED152] >gi|85821996|gb|EAQ43143.1| acyltransferase [Polaribacter dokdonensis MED152] (237 aa)
Score = 106, Expect = 4.3e-03, Identities = 57/203 (28%), Positives = 96/203 (47%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDE-FGEFKSAALTPAYSTFCQIVPVVIY------------GTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDPNWSEKE 269
           ++K+     I  +KS MF PNH S  D       F MI   +  I+   F+ K E+ K    GF  K +  I +DR + +   RV +  KE L+ G  S+ +F EG    ++     FK  A + A      IVP V Y            G  G+ + H+ +  + K + +  ++ +K + +    ++L+++K        Y+K    PN +E+E
  S:    36 RLKVDREMKIERDKSYMFCPNHGSLMD------PFVMIALSKNPIV---FIGKKELVKIPIFGFFYKRV-VIMVDRSSPKSRKRVFKMAKEKLRNG-TSMAIFPEGLVPAENVILAPFKDGAFSLAIEFEMPIVPQVYYDCKRLFSWDFFKGGPGLFRIHQHSFIETKNLELSDVDQLKKQTFDLIYQDLINDK-------KYMKDTNRPN-NERE 232
>gi|194226015|ref|XP_001498665.2| PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Equus caballus] (252 aa)
Score = 106, Expect = 4.3e-03, Identities = 44/197 (22%), Positives = 80/197 (40%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFV--SKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           + +IKG   +  +   + + NH+S  D++  +           EIL P  +  +K E+     +G    L   +FI+RQ     + V  +  E L + +  + ++ EGTR    +   FK  A   A      I+PVV   +       ++ +F    V VE L+ I  +    T    + +     M   + +I + P
  S:    51 RFEIKGRGKLEVDHPCVIISNHQSILDMMGLM-----------EILPPRCIQIAKRELLFLGPLGLIMYLGGVVFINRQRSSTAMTVMADVGEHLVREDLKVWIYPEGTRNDNGDLLPFKKGAFHLAIQAQVPIIPVVYS-SFSSFYNSRTKLFTSGTVKVEVLDAIPTRGLTVTDVPKLMDTCHQAMRTTFFRISKMP 237
>gi|145221746|ref|YP_001132424.1| phospholipid/glycerol acyltransferase [Mycobacterium gilvum PYR-GCK] >gi|145214232|gb|ABP43636.1| phospholipid/glycerol acyltransferase [Mycobacterium gilvum PYR-GCK] (248 aa)
Score = 106, Expect = 4.4e-03, Identities = 48/176 (27%), Positives = 78/176 (44%)
  Q:    57 ASKAVFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVL-VYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGV-EKEHKSNIFKYK-EVTVEFLEPIK 232
           A   V  T T++  +G +N+PA    +   NH    D L   L A +  +  R       F+ K E+     +G+  +   TI +DRQ          +    L +GE  + V+ E T  +  E  EFKS A+  A      IVP++++G   V  K+H   + + +  VTV    P++
  S:    12 AEALVRATGTEITFRGLENLPATGGAVIAINHTGYVDFLPAALAAKRRGRRMR-------FMIKAEMQDVPVLGWLIEHTGTIPVDRQAGAGAYAAAVQS---LLRGE-IVGVYPEATISRSFELKEFKSGAVRMAVEARVPIVPLIVWGAHRVWTKDHPRALGRRRFPVTVSVGAPLE 179
>gi|163750475|ref|ZP_02157714.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Shewanella benthica KT99] >gi|161329796|gb|EDQ00784.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Shewanella benthica KT99] (229 aa)
Score = 106, Expect = 4.6e-03, Identities = 44/196 (22%), Positives = 81/196 (41%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           KV ++   +   ++  +++ NH++NFD+  +  A        P+      + K  ++     G    L   I IDR+N         +    ++    S+ +F EGTR K      FKS A   A      +VPV+       +   K N +    V +E +EPI+ K   +   + +S ++ A M A   ++  +
  S:    40 KVIVRKPSSGLKDEPCIYLANHQNNFDMFTHTAAV-------PK--GTVSLGKKSLAWVPFFGQIYWLSGNILIDRKNRNKAFETMAQTARKIKDKYLSIWIFPEGTRSKGKGLLPFKSGAFHTAIEAGVSMVPVLA----SCQGHIKMNRWDNGVVIIEMMEPIETKGLAKNQVKELSSRIHALMSARLTQLNRE 222
>gi|194474046|ref|NP_001124006.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 [Sus scrofa] >gi|192758427|gb|ACF05194.1| 1-acylglycerol-3-phosphate O-acyltransferase 2 [Sus scrofa] (278 aa)
Score = 106, Expect = 4.6e-03, Identities = 42/197 (21%), Positives = 83/197 (42%)
  Q:    67 KVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKEDP 263
           + +IKG + +  ++S + + NH+S  D++  ++A        P+      ++K E+     VG    L   IFI+RQ  +  V    +  E + + +  + ++ EGTR    +   FK  A   A      IVPVV   +     + ++ +F    + VE L+ +  +         + +     M  ++  I + P
  S:    77 RFEIKGRQRLDEDRSCVIISNHQSILDMMGLMEAL-------PDRC--VQIAKRELLFLGPVGLIMYLGGVIFINRQRSQTAVSALADVGERMVREKLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIVPVVYS-SFSSFYDSRTKLFTSGTIKVEVLDAVPTRGLTVADIPRLMDTCYQAMRTSFFSISKTP 263
>gi|86140987|ref|ZP_01059546.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Flavobacterium sp. MED217] >gi|85832929|gb|EAQ51378.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Leeuwenhoekiella blandensis MED217] (255 aa)
Score = 106, Expect = 4.6e-03, Identities = 36/138 (26%), Positives = 65/138 (47%)
  Q:    66 TKVKIKGSKNIPANKSVMFVPNHKSNFDV---LVYLKAFKMIKEKRPEILDPTFVSKIEISK-TKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTF--CQIVPVVI 203
           T+   +    I  ++ ++ V NH+  +D+   + YL+            L P F+SKIE+ K    + +  +   +  IDR++ R  +   ++  + L K  +S+ +F EGTR K     +F +  L   +       IVPV I
  S:    60 TRFTFENPHTITRDQPIIIVANHQGQWDISPIIWYLRR-----------LHPKFISKIELGKGIPSISYNLRKGGSALIDRKDKRQSIMAIRDLTKTLNKTNRSVVIFPEGTRSKDGIPKQFATGGLITLFKFMPTAIIVPVTI 192
>gi|164657794|ref|XP_001730023.1| hypothetical protein MGL_3009 [Malassezia globosa CBS 7966] >gi|159103917|gb|EDP42809.1| hypothetical protein MGL_3009 [Malassezia globosa CBS 7966] (301 aa)
Score = 106, Expect = 4.7e-03, Identities = 45/195 (23%), Positives = 87/195 (44%)
  Q:    68 VKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTR--IKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHK----SNIFKYKEVTVEFLEPIKYKDYIQTSKELVSEKMKAKMEAAYLKIKED 262
           V+++G +++    ++M V NH+S+ D L   + F          ++   ++K E+     +G    L  + FIDR++    ++      E ++K    L VF EGTR  +   +   FK  A   A  T   I+P+V       E  H+       F+  ++ ++ L PI+     +   +++   ++ KM +  L    D
  S:    86 VEVEGEEHLKRRPAIM-VGNHQSSIDTLYLGRMFP---------VNSIIMAKKELKWVPFLGQFMMLSGSAFIDRKSRASAIKTMNATGEHMRKNNLMLFVFPEGTRSNLSTPDMLPFKKGAFHLAVQTQLPIIPMV------CENYHRLFDSKTRFEPGKIRLKILPPIETTGMTEKDVDMLCNTVREKMLSQLLSYAND 270
>gi|150020037|ref|YP_001305391.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermosipho melanesiensis BI429] >gi|149792558|gb|ABR30006.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Thermosipho melanesiensis BI429] (251 aa)
Score = 106, Expect = 4.7e-03, Identities = 41/154 (26%), Positives = 71/154 (46%)
  Q:    67 KVKIKGSK-NIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKY 220
           KV + G K N+  N   + V NH+S  D+ + +     +           F++K E+ K   + +  K + ++ IDR N+R      ++  E L+ G     +F EGTR       EFK  +L  A+    +I+PV I+G   V ++    + +Y
  S:    65 KVHVFGEKPNLGEN--FIVVANHQSALDIPLIIGYVAPV----------AFIAKRELGKVPGINWYLKYLGSVLIDRGNVRKTAMALKQVVEKLKFGVH-FIIFPEGTRSHDGNVLEFKKKSLEIAFKYKVKILPVSIWGVHKVLRKKSLMLNRY 206
>gi|34540954|ref|NP_905433.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Porphyromonas gingivalis W83] >gi|34397269|gb|AAQ66332.1| 1-acyl-sn-glycerol-3-phosphate acetyltransferase, putative [Porphyromonas gingivalis W83] (204 aa)
Score = 106, Expect = 4.8e-03, Identities = 39/176 (22%), Positives = 73/176 (41%)
  Q:    61 VFCTFTKVKIKGSKNIPANKSVMFVPNHKSNFDVLVYLKAFKMIKEKRPEILDPTFVSKIEISKTKRVGFAAKLINTIFIDRQNLRDFVRVNQEEKELLQKGEQSLTVFIEGTRIKKDEFGEFKSAALTPAYSTFCQIVPVVIYGTLGVEKEHKSNIFKYKEVTVEFLEPIKYKDY 236
           +F     ++++G ++IP     + + NH+   D+ + +  +  I  K        +V K  I K   VG+A +    +F+D            + K +L +G  S+ +F EG+R +      FK      A      I+PV + G+  V    K  I +   +T+    P+   D+
  S:     8 LFLFLCPIRVRGREHIPGKGPFVVMANHQGACDIFM-MYGYLGIPFK--------WVLKEGIRKLPFVGYACRSAGFVFVDDTRPSSIAHTMDQAKRVLAEG-TSIFIFPEGSRTRNGRLARFKKGGFLMADELGVPIIPVSLDGSYRVLPSGKL-IPRPHRLTLTIHPPLSVADF 172