>gi|26553490|ref|NP_757424.1| hypothetical protein MYPE380 [Mycoplasma penetrans HF-2] >gi|41018049|sp|Q8EX12|SCPA_MYCPE Segregation and condensation protein A >gi|26453496|dbj|BAC43828.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (291 aa)
Score = 1196, Expect = 1.7e-129, Identities = 284/284 (100%), Positives = 284/284 (100%)
  Q:     8 NEFKPENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           NEFKPENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY
  S:     8 NEFKPENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
>gi|31544607|ref|NP_853185.1| fused segregation and condensation protein A/unknown domain-containing protein [Mycoplasma gallisepticum R] >gi|31541452|gb|AAP56753.1| Dyr [Mycoplasma gallisepticum R] (599 aa)
Score = 269, Expect = 5.5e-22, Identities = 90/276 (32%), Positives = 149/276 (53%)
  Q:     8 NEFKPENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKI--SKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDY---FKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           N  KPE+L    N   +    +++ K F+GPF+L   LIK++KMDI+ ++L E+   Y  YIN ++  L  D +++YL MA  LL  KS   +P+ + E KI  + D ERD+ ++R++ YK+Y E++P L +    R  +F K     +  +    +  +      ++   + KAM++V+ KL     T+        I + E+SI+DV+ EI   ++   +     F+D    F+ I  +K   RYFV +FV +L+LVR   I L Q + DE+I    +D
  S:   163 NTKKPEDLIEELNINLNDDFLNLSFKHFSGPFDLLLHLIKDKKMDIMALDLFELTNQYFAYINKHMINL--DLVSDYLYMACELLRIKSDLSIPNFEDETKIDLNNDDERDRIVKRIIEYKRYSELLPSLQKMQLERFSLFAKEEDDWDVFKLTSNDLLEAPLPDYVNPKKLKKAMERVFEKLKIKTITEHK------IVIEELSIEDVKNEILSIIKKLLNNQYDRFIDLEKIFEQIDPKKLNLRYFVTSFVCLLILVREQKIDLNQKNDDESISACLVD 435
>gi|56757670|sp|Q7NB76|SCPA_MYCGA Segregation and condensation protein A (592 aa)
Score = 269, Expect = 5.5e-22, Identities = 90/276 (32%), Positives = 149/276 (53%)
  Q:     8 NEFKPENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKI--SKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDY---FKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           N  KPE+L    N   +    +++ K F+GPF+L   LIK++KMDI+ ++L E+   Y  YIN ++  L  D +++YL MA  LL  KS   +P+ + E KI  + D ERD+ ++R++ YK+Y E++P L +    R  +F K     +  +    +  +      ++   + KAM++V+ KL     T+        I + E+SI+DV+ EI   ++   +     F+D    F+ I  +K   RYFV +FV +L+LVR   I L Q + DE+I    +D
  S:   156 NTKKPEDLIEELNINLNDDFLNLSFKHFSGPFDLLLHLIKDKKMDIMALDLFELTNQYFAYINKHMINL--DLVSDYLYMACELLRIKSDLSIPNFEDETKIDLNNDDERDRIVKRIIEYKRYSELLPSLQKMQLERFSLFAKEEDDWDVFKLTSNDLLEAPLPDYVNPKKLKKAMERVFEKLKIKTITEHK------IVIEELSIEDVKNEILSIIKKLLNNQYDRFIDLEKIFEQIDPKKLNLRYFVTSFVCLLILVREQKIDLNQKNDDESISACLVD 428
>gi|188524515|ref|ZP_03004510.1| segregation and condensation protein A [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530902|ref|ZP_03005181.1| hypothetical protein Uurese_01000004_0200002110 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195659704|gb|EDX53084.1| segregation and condensation protein A [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (278 aa)
Score = 229, Expect = 2.8e-17, Identities = 74/258 (28%), Positives = 147/258 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +   +LIK++++DI N++++E+ + Y++++N  +  + ID L ++L MA+YL+E K++ ++PS+D ++ ++ + +R   I RL+ Y  Y+ +   L ++L+ R+ M + P Q  E   S     +D  Y P  + LD I+  ++ +  K++   + K+ +  +  I V E  I+ +E  +  +L   P+  + S   +F         KR+FV+ F+ IL+L+    I  E+    EN +++KI+ E  S++Y
  S:    17 DFNGPLDTLCALIKQKRLDINNLDILELSKQYLNFVNQLIKTIDIDVLGDHLAMASYLIELKTRMLMPSIDEKQILNIEEDRQNLIDRLIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYS-----EDVVYKPLPNCLDPII--LKNIMDKIIYENELKNYE--IDEIKVQEYDINQLEWLLLNYLNQSPN-QQASMFSFFNVQASVDKNKRFFVMMFLIILILINRNEILFEE---IENDYLLKINNEKISDDY 262
>gi|188568576|ref|ZP_03005373.1| hypothetical protein Uurealyserovar_00190 [Ureaplasma urealyticum serovar 2] (278 aa)
Score = 225, Expect = 6.9e-17, Identities = 74/258 (28%), Positives = 146/258 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + Y++++N  +  + ID L ++L MA+YL+E K++ ++PS+D ++ ++ + +R   I RL+ Y  Y+ +   L ++L+ R+ M + P Q  E   S     +D  Y P  + LD I+  ++ +  K++   + K+ +  +  I V E  I+ +E  +  +L   P+  + S   +F         KR+FV+ F+ IL+L+    I  E+    EN +++KI+ E  S++Y
  S:    17 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYLNFVNQLIKTIDIDVLGDHLAMASYLIELKTRMLMPSIDEKQILNIEEDRQNLIDRLIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYS-----EDVVYKPLPNCLDPII--LKNIMDKIIYENELKNYE--IDEIKVQEYDINQLEWLLLNYLNQSPN-QQASMFSFFNVQASVDKNKRFFVMMFLIILILINRNEILFEE---IENDYLLKINNEKISDDY 262
>gi|195868017|ref|ZP_03080012.1| ScpA/B protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660309|gb|EDX53571.1| ScpA/B protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (278 aa)
Score = 225, Expect = 8.9e-17, Identities = 73/258 (28%), Positives = 147/258 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + Y++++N  +  + ID L ++L MA+YL+E K++ ++PS++ ++ ++ + +R   I RL+ Y  Y+ +   L ++L+ R+ M + P Q  E   S     +D  Y P  + LD I+  ++ +  K++   + K+ +  +  I V E  I+ +E  +  +L   P+  ++S   +F         KR+FV+ F+ IL+L+    I  E+    EN +++KI+ E  S++Y
  S:    17 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYLNFVNQLIRTIDIDVLGDHLAMASYLIELKTRMLMPSINEKQILNIEEDRQNLIDRLIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYS-----EDVVYKPLPNCLDPII--LKNIMDKIIYENELKNYE--IDEIKVQEYDINQLEWLLLNYLNQSPN-QQVSMFSFFNVQASVDKNKRFFVMMFLIILILINRNEILFEE---IENDYLLKINNEKISDDY 262
>gi|188592386|ref|ZP_03005760.1| hypothetical protein Uureaserovar_00225 [Ureaplasma urealyticum serovar 10] (278 aa)
Score = 222, Expect = 1.6e-16, Identities = 73/258 (28%), Positives = 146/258 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + Y++++N  +  + ID L ++L MA+YL+E K++ ++PS+D ++ ++ + +R   I RL+ Y  Y+ +   L ++L+ R+ M + P Q  E   S     +D  Y P  + LD I+  ++ +  K++   + K+ +  +  I V E  I+ +E  +  +L   P+  + S   +F         KR+FV+ F+ IL+L+    I  E+    EN +++KI+ E  +++Y
  S:    17 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYLNFVNQLIKTIDIDVLGDHLAMASYLIELKTRMLMPSIDEKQILNIEEDRQNLIDRLIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYS-----EDVVYKPLPNCLDPII--LKNIMDKIIYENELKNYE--IDEIKVQEYDINQLEWLLLNYLNQSPN-QQASMFSFFNVQASVDKNKRFFVMMFLIILILINRNEILFEE---IENDYLLKINNEKINDDY 262
>gi|185178969|ref|ZP_02964726.1| ScpA/B protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188518601|ref|ZP_03004053.1| segregation and condensation protein A [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|184209248|gb|EDU06291.1| ScpA/B protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188997844|gb|EDU66941.1| segregation and condensation protein A [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (278 aa)
Score = 222, Expect = 1.7e-16, Identities = 73/258 (28%), Positives = 145/258 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + Y++++N  +  + ID L ++L MA+YL+E K++ ++PS+D ++ ++ + +R   I RL+ Y  Y+ +   L ++L+ R+ M + P Q  E   S     +D  Y P  + LD I+  ++ +  K++   + K+ +  +  I V E  I+ +E  +  +L   P+  + S   +F         KR+FV+ F+ IL+L+    I  E+    EN +++KI+ E   ++Y
  S:    17 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYLNFVNQLIKTIDIDVLGDHLAMASYLIELKTRMLMPSIDEKQILNIEEDRQNLIDRLIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYS-----EDVVYKPLPNCLDPII--LKNIMDKIIYENELKNYE--IDEIKVQEYDINQLEWLLLNYLNQSPN-QQASMFSFFNVQASVDKNKRFFVMMFLIILILINRNEILFEE---IENDYLLKINNEKNIDDY 262
>gi|171920872|ref|ZP_02932033.1| ScpA/B protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903081|gb|EDT49370.1| ScpA/B protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (278 aa)
Score = 222, Expect = 1.8e-16, Identities = 73/258 (28%), Positives = 146/258 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + Y++++N  +  + ID L ++L MA+YL+E K++ ++PS++ ++ ++ + +R   I RL+ Y  Y+ +   L ++L+ R+ M + P Q  E   S     +D  Y P  + LD I+  ++ +  K++   + K+ +  +  I V E  I+ +E  +  +L   P+  + S   +F         KR+FV+ F+ IL+L+    I  E+    EN +++KI+ E  S++Y
  S:    17 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYLNFVNQLIRTIDIDVLGDHLAMASYLIELKTRMLMPSINEKQILNIEEDRQNLIDRLIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYS-----EDVVYKPLPNCLDPII--LKNIMDKIIYENELKNYE--IDEIKVQEYDINQLEWLLLNYLNQSPN-QQASMFSFFNVQASVDKNKRFFVMMFLIILILINRNEILFEE---IENDYLLKINNEKISDDY 262
>gi|188024151|ref|ZP_02996880.1| segregation and condensation protein A [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039414|ref|ZP_02998182.1| hypothetical protein Uures_01716 [Ureaplasma urealyticum serovar 8] >gi|188018781|gb|EDU56821.1| segregation and condensation protein A [Ureaplasma urealyticum serovar 7 str. ATCC 27819] (278 aa)
Score = 220, Expect = 3.0e-16, Identities = 73/258 (28%), Positives = 145/258 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + Y++++N  +  + ID L ++L MA+YL+E K++ ++PS+D ++ ++ + +R   I RL+ Y  Y+ +   L ++L+ R+ M + P Q  E   S     +D  Y P  + LD I+  ++ +  K++   + K+ +  +  I V E  I+ +E  +  +L   P+  + S   +F         KR+FV+ F+ IL+L+    I  E+    EN +++KI+ E   ++Y
  S:    17 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYLNFVNQLIKTIDIDVLGDHLAMASYLIELKTRMLMPSIDEKQILNIEEDRQNLIDRLIEYNGYKNLTEHLKQRLDFRATMIDLPQQDYEPFYS-----EDVVYKPLPNCLDPII--LKNIMDKIIYENELKNYE--IDEIKVQEYDINQLEWLLLNYLNQSPN-QQASMFSFFNVQASVDKNKRFFVMMFLIILILINRNEILFEE---IENDYLLKINNEKIIDDY 262
>gi|169351241|ref|ZP_02868179.1| hypothetical protein CLOSPI_02020 [Clostridium spiroforme DSM 1552] >gi|169292303|gb|EDS74436.1| hypothetical protein CLOSPI_02020 [Clostridium spiroforme DSM 1552] (242 aa)
Score = 211, Expect = 3.0e-15, Identities = 78/247 (31%), Positives = 143/247 (57%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDV--ILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           +EF GP +L   LIKE++MD+  + L  +   Y+ YI+     L ++ ++EYL+MA  L+E KSK ++P    +EK+  + E     RD  I+RL+ YK+Y++++ ++ EK ++R  M  KP       ES+ +   D S +   DL+V  ++KAMQK++ +    K   +       I   +ISID+  ++IR F +   +  ++ F + F     +++ + YF+V F+A+LVL ++  +++ Q+   E I++
  S:     8 EEFQGPLDLLLHLIKEKEMDLETLELSVIADQYLQYIHAMDPSL-LEVMSEYLVMAADLIEMKSKMLIP----KEKVVINDEYQEDPRDALIKRLIEYKRYKDVLDEIREKYKQRQTMIIKPA------ESMDEYVIDTSTMIPDDLEVYDLMKAMQKMFQRKALLKPLDTH------IAKKDISIDERTEQIRNFFKTRVN-KRVKFEELF-----DRYDRFYFIVTFIAVLVLAKDKEVEIIQDGLFEEIYV 238
>gi|152976468|ref|YP_001375985.1| segregation and condensation protein A [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189046138|sp|A7GS82|SCPA_BACCN Segregation and condensation protein A >gi|152025220|gb|ABS22990.1| chromosome segregation and condensation protein ScpA [Bacillus cereus subsp. cytotoxis NVH 391-98] (248 aa)
Score = 210, Expect = 3.9e-15, Identities = 79/247 (31%), Positives = 134/247 (54%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISK----DIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           + F GP +L   LI   ++DI NI + E+ + Y+ YI+  + +L++D  +EYL+MA  LL+ KSK +LP  + +   S     D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  S  +E   N     + LDV L  M   + K++  KK+K P      I   EI I+    +I + LE      + SF D F    DE+  +   VV F+AIL L+++  I +EQ  + + IF+
  S:     8 ESFEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYIHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKQEEDVHDSGEDFIDDPRQELMERLIEYKKYKQVAAELKEREQERAQLYTRPPI---DFTSFQQEEAAN-----LPLDVTLYDMLAAFQKMMRRKKSKRPV--TARITRQEIPIEQRMTDILQKLETLGG--RQSFYDLFA---DEE--REVMVVTFLAILELMKHQQIVIEQEQNFDEIFL 240
>gi|47565940|ref|ZP_00236979.1| uncharacterised ACR, COG1354 [Bacillus cereus G9241] >gi|118479262|ref|YP_896413.1| segregation and condensation protein A [Bacillus thuringiensis str. Al Hakam] >gi|47557220|gb|EAL15549.1| uncharacterised ACR, COG1354 [Bacillus cereus G9241] >gi|118418487|gb|ABK86906.1| condensin subunit ScpA [Bacillus thuringiensis str. Al Hakam] (252 aa)
Score = 209, Expect = 5.5e-15, Identities = 81/250 (32%), Positives = 135/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E + N     + LDV L  M   + KL+  KK K P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    15 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEETN-----LPLDVTLYDMLAAFQKLMRRKKAKKPV--TTRITRQEIPIEQRMTDILKQLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSYTK 250
>gi|158320619|ref|YP_001513126.1| chromosome segregation and condensation protein ScpA [Alkaliphilus oremlandii OhILAs] >gi|158140818|gb|ABW19130.1| chromosome segregation and condensation protein ScpA [Alkaliphilus oremlandii OhILAs] (256 aa)
Score = 206, Expect = 1.3e-14, Identities = 76/245 (31%), Positives = 140/245 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDN-SYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GPF+L + LI++ K+DI +I + E+   Y+ Y++  L +L +D  +E+L+MA  L+E KSK +LP  S+D E+   +DI+ R + ++RLL YK+Y+    +L +K ++  +++ K  +     E +L   ++  S +  +D+  +L A+ K   + +   +T SP+  ++ +    I+IDD   +I E +    +  KI F D F N      TK   +  F+A+L L++   + + QNS+ ++I I
  S:    10 FEGPFDLLFHLIEKNKLDIYDIPMTEITDQYIAYLSE-LEELNLDVTSEFLIMAATLIEIKSKMLLPIQSIDNEQLSIEDIDPRGELVRRLLEYKKYKAAAEELKQKEQKYQKIYFKTKE-----EFILDPIEEPFSELENIDMKDLLSALSKCMERKI---RTASPEKTIREMQRDTITIDD---KINEIICILANERKILFQDMFSNAS----TKLEVITTFLALLELMKLKRVLVNQNSAYKDIII 242
>gi|166985600|ref|ZP_02256878.1| segregation and condensation protein A [Bacillus cereus AH187] (247 aa)
Score = 206, Expect = 1.4e-14, Identities = 80/250 (32%), Positives = 135/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E +      ++ LDV L  M   + KL+  KK K P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEET-----SLPLDVTLYDMLAAFQKLMRRKKAKKPV--TTRITRQEIPIEQRMTDILKLLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIVIEQEHNFDEIFVSSYTK 245
>gi|65321452|ref|ZP_00394411.1| COG1354: Uncharacterized conserved protein [Bacillus anthracis str. A2012] (251 aa)
Score = 205, Expect = 1.5e-14, Identities = 80/250 (32%), Positives = 135/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E + N     + LDV L  M   + KL+  KK + P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    14 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEETN-----LPLDVTLYDMLAAFQKLMRRKKAEKPV--TTRITRQEIPIEQRMTDILKQLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSYTK 249
>gi|49478513|ref|YP_038118.1| segregation and condensation protein A [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141434|ref|YP_085395.1| segregation and condensation protein A [Bacillus cereus E33L] >gi|166995628|ref|ZP_02262088.1| segregation and condensation protein A [Bacillus cereus AH820] >gi|196034993|ref|ZP_03102400.1| segregation and condensation protein A [Bacillus cereus W] >gi|196045921|ref|ZP_03113150.1| segregation and condensation protein A [Bacillus cereus 03BB108] >gi|81686387|sp|Q635M2|SCPA_BACCZ Segregation and condensation protein A >gi|56749592|sp|Q6HEA8|SCPA_BACHK Segregation and condensation protein A >gi|49330069|gb|AAT60715.1| conserved hypothetical protein [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974903|gb|AAU16453.1| conserved hypothetical protein [Bacillus cereus E33L] >gi|195992532|gb|EDX56493.1| segregation and condensation protein A [Bacillus cereus W] >gi|196023361|gb|EDX62039.1| segregation and condensation protein A [Bacillus cereus 03BB108] (247 aa)
Score = 205, Expect = 1.7e-14, Identities = 81/250 (32%), Positives = 135/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E + N     + LDV L  M   + KL+  KK K P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEETN-----LPLDVTLYDMLAAFQKLMRRKKAKKPV--TTRITRQEIPIEQRMTDILKQLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSYTK 245
>gi|42783172|ref|NP_980419.1| segregation and condensation protein A [Bacillus cereus ATCC 10987] >gi|56749632|sp|Q731P0|SCPA_BACC1 Segregation and condensation protein A >gi|42739100|gb|AAS43027.1| conserved hypothetical protein [Bacillus cereus ATCC 10987] (247 aa)
Score = 202, Expect = 4.0e-14, Identities = 80/250 (32%), Positives = 135/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E +      ++ LDV L  M   + KL+  KK K P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEET-----SLPLDVTLYDMLAAFQKLMRRKKAKKPV--TTRITRQEIPIEQRMTDILKQLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIVIEQEHNFDEIFVSSYTK 245
>gi|196038747|ref|ZP_03106055.1| segregation and condensation protein A [Bacillus cereus NVH0597-99] >gi|196030470|gb|EDX69069.1| segregation and condensation protein A [Bacillus cereus NVH0597-99] (247 aa)
Score = 202, Expect = 4.1e-14, Identities = 81/250 (32%), Positives = 135/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E + N     + LDV L  M   + KL+  KK K P      I   EI I+    +I + LE      + SF D F    DE+  +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEETN-----LPLDVTLYDMLAAFQKLMRRKKAKKPV--TTRITRQEIPIEQRMTDILKQLE--IQGGRQSFYDLFV---DEE--REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSYTK 245
>gi|30264135|ref|NP_846512.1| segregation and condensation protein A [Bacillus anthracis str. Ames] >gi|47529570|ref|YP_020919.1| segregation and condensation protein A [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186966|ref|YP_030218.1| segregation and condensation protein A [Bacillus anthracis str. Sterne] >gi|165871157|ref|ZP_02215807.1| segregation and condensation protein A [Bacillus anthracis str. A0488] >gi|167639397|ref|ZP_02397668.1| segregation and condensation protein A [Bacillus anthracis str. A0193] >gi|170705882|ref|ZP_02896345.1| segregation and condensation protein A [Bacillus anthracis str. A0389] >gi|177652630|ref|ZP_02935046.1| segregation and condensation protein A [Bacillus anthracis str. A0174] >gi|190566207|ref|ZP_03019126.1| segregation and condensation protein A [Bacillus anthracis Tsiankovskii-I] >gi|41017965|sp|Q81MH0|SCPA_BACAN Segregation and condensation protein A >gi|30258780|gb|AAP27998.1| conserved hypothetical protein [Bacillus anthracis str. Ames] >gi|47504718|gb|AAT33394.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180893|gb|AAT56269.1| conserved hypothetical protein [Bacillus anthracis str. Sterne] >gi|164713076|gb|EDR18603.1| segregation and condensation protein A [Bacillus anthracis str. A0488] >gi|167512456|gb|EDR87831.1| segregation and condensation protein A [Bacillus anthracis str. A0193] >gi|170129422|gb|EDS98286.1| segregation and condensation protein A [Bacillus anthracis str. A0389] >gi|172081965|gb|EDT67033.1| segregation and condensation protein A [Bacillus anthracis str. A0174] >gi|190563126|gb|EDV17092.1| segregation and condensation protein A [Bacillus anthracis Tsiankovskii-I] (247 aa)
Score = 201, Expect = 4.3e-14, Identities = 80/250 (32%), Positives = 135/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E + N     + LDV L  M   + KL+  KK + P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEETN-----LPLDVTLYDMLAAFQKLMRRKKAEKPV--TTRITRQEIPIEQRMTDILKQLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSYTK 245
>gi|89099066|ref|ZP_01171945.1| segregation and condensation protein A [Bacillus sp. NRRL B-14911] >gi|89086196|gb|EAR65318.1| segregation and condensation protein A [Bacillus sp. NRRL B-14911] (249 aa)
Score = 201, Expect = 4.4e-14, Identities = 80/245 (32%), Positives = 130/245 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE------RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I + E+ + Y+ YI+  + +L++D  +E+L+MA  LL  KSK +LP  + E+    D+E      RD+ ++RL+ YK+Y+E   +L  K + R  MF KP        S L ++  +      DL+V L  +   + KL+  KK + P      +   EI I+    EI + L+      K SF D F +  DE   K + VV+F+A+L L++   I+L Q  +   IF+
  S:    10 FEGPLDLLLHLINRLEIDIYDIPVAEITEQYLIYIHT-MKELELDVASEFLVMAATLLAIKSKMLLPKHEEEQLDEFDMEEGEEDPRDELVERLVEYKKYKEAAAELKTKEQERGLMFTKPP-------SDLSDYAKDVQPEKADLNVSLYDVLGAFQKLMRRKKLQKPV--TAKVARQEIPIEKRMDEILDQLQ--RARVKTSFYDLFPS--DE---KEHLVVSFLAVLELMKRKQIELNQEHNFAEIFV 243
>gi|163941799|ref|YP_001646683.1| segregation and condensation protein A [Bacillus weihenstephanensis KBAB4] >gi|163863996|gb|ABY45055.1| chromosome segregation and condensation protein ScpA [Bacillus weihenstephanensis KBAB4] (247 aa)
Score = 201, Expect = 4.8e-14, Identities = 77/252 (30%), Positives = 133/252 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISK----DIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEV 286
           F GP +L   LI   ++DI NI + ++ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP  + +   +     D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P             FQ      ++ LDV L  M   + KL+  KK K+P      I   EI I     +I + LE      + SF D F    DE+  +   VV F+A+L L++N  I +EQ  + + IF+   +K V
  S:    10 FEGPLDLLLHLINRYEIDIYNIPVAKITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKQEEDVPDNGEDFIDDPRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPID-------FTSFQQEEET-SLPLDVTLYDMLAAFQKLMRRKKAKTPV--TTRITRQEIPIAQRMTDILQQLE--VRGGRQSFYDLFA---DEE--REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSSNKSV 247
>gi|168162911|ref|ZP_02598144.1| segregation and condensation protein A [Bacillus cereus H3081.97] (247 aa)
Score = 200, Expect = 6.8e-14, Identities = 79/250 (31%), Positives = 134/250 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E +      ++ LDV L  M   + KL+  KK K P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I + Q  + + IF+    K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEE-----TSLPLDVTLYDMLAAFQKLMRRKKAKKPV--TTRITRQEIPIEQRMTDILKLLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIVIVQEHNFDEIFVSSYTK 245
>gi|154686567|ref|YP_001421728.1| segregation and condensation protein A [Bacillus amyloliquefaciens FZB42] >gi|167016550|sp|A7Z671|SCPA_BACA2 Segregation and condensation protein A >gi|154352418|gb|ABS74497.1| ScpA [Bacillus amyloliquefaciens FZB42] (251 aa)
Score = 198, Expect = 1.1e-13, Identities = 74/245 (30%), Positives = 127/245 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTE----EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I +  + + Y+ Y++  + +L++D  +EYL+MA  LL  KS+ +LP  + E    E + ++  RD+ I++L+ Y++Y+     L E+ E R + F KP        S L E+          L V +  M   + K++  KK   PK+    I   EI I+D   EI + L+      +I+F + F +       K + VV F+A+L L++N  I +EQ  +  +I+I
  S:    11 FEGPLDLLLHLINRLEIDIYDIPVATITEQYLLYVHT-MQELELDVASEYLVMAATLLSIKSRMLLPKQEEELFEDEMLEEEDPRDELIEKLIEYRKYKTAAKDLKEREEERQKSFTKPP-------SDLSEYAKEIKQTEQKLSVTVYDMIGAFQKVLQRKKITRPKETT--ITRQEIPIEDRMNEIVKSLKTAGR--RINFTELFPS-----RQKDHLVVTFLAVLELMKNQQIIIEQEENFSDIYI 242
>gi|116873393|ref|YP_850174.1| segregation and condensation protein A [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123466482|sp|A0AK63|SCPA_LISW6 Segregation and condensation protein A >gi|116742271|emb|CAK21395.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (249 aa)
Score = 198, Expect = 1.2e-13, Identities = 74/245 (30%), Positives = 131/245 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + ++DI +I + E+   Y+++++  + ++++D  +EYL+MA  LL  KSK +LP     +D +    ++  RD  +++L+ YK+++E   +L EK   RS  F KP          L E+ D + V   +LDV L  M   + K++  KK   P      I   EISIDD    +   L    + +++ F + F     E+ TK   VV F+A+L L++   +++EQ+ S  ++++
  S:    11 FEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHT-MQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEYKRFKEAAKELKEKEAERSFYFSKPPMD-------LAEYDDGTKVA--ELDVSLNDMLSAFNKMLRRKKLNKPLHT--RITTQEISIDDRMNSVLGKLNQQKN-HRLRFDELF-----EEQTKEQLVVTFLALLELMKRKLVEVEQSESFADLYV 241
>gi|16801131|ref|NP_471399.1| segregation and condensation protein A [Listeria innocua Clip11262] >gi|41018102|sp|Q92A57|SCPA_LISIN Segregation and condensation protein A >gi|16414566|emb|CAC97295.1| lin2065 [Listeria innocua] (249 aa)
Score = 197, Expect = 1.2e-13, Identities = 73/245 (29%), Positives = 132/245 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + ++DI +I + E+   Y+++++  + ++++D  +EYL+MA  LL  KSK +LP     +D +    ++  RD  +++L+ YK+++E   +L EK   RS  F KP          L E+ + + V   +LDV L  M   + K++  KK   P      I   EISIDD    +   L    + +++ F + F     E+ TK   VV F+A+L L++   +++EQ++S  ++++
  S:    11 FEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHT-MQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEYKRFKEAAKELKEKEAERSFYFSKPPMD-------LAEYDEGTKVA--ELDVSLNDMLSAFNKMLRRKKLNKPLHT--RITTQEISIDDRMNSVLGKLHQQTN-HRLRFDELF-----EEQTKEQLVVTFLALLELMKRKLVEVEQSASFADLYV 241
>gi|167755785|ref|ZP_02427912.1| hypothetical protein CLORAM_01300 [Clostridium ramosum DSM 1402] >gi|167704724|gb|EDS19303.1| hypothetical protein CLORAM_01300 [Clostridium ramosum DSM 1402] (242 aa)
Score = 197, Expect = 1.5e-13, Identities = 74/247 (29%), Positives = 144/247 (58%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE----DKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           ++F GP +L   LIKE++MD+  + L  +   Y+ YI+  +   K++ ++EYL+MA  L+E KSK ++P    +EK++ + E     R+  I+RL+ YK+Y++++ ++ +K E+R  +  KP +S +    D  S++ E         +++  ++KAMQK++ +    K    P D    I   +ISID+   +IR + +   +  K+ F + F     ++  + YF+V F++ILVL ++  +++ Q+   E I++
  S:     8 EDFQGPLDLLLHLIKEKEMDLEKLELSLIADQYLQYIHA-MDPSKLEIMSEYLVMAADLIEMKSKMLIP----KEKVTINDEYQEDPREALIKRLIEYKRYKDVLDEIRDKYEQRQTVIIKPAESMDEYVVDTSSMIPE--------GLEVYDLMKAMQKMFQR----KAMMKPLDT--HIAKKDISIDERTAQIRNYFKTRVN-KKVKFEELF-----DRHDRFYFIVTFISILVLAKDKEVEIIQDGLFEEIYV 238
>gi|167633775|ref|ZP_02392099.1| segregation and condensation protein A [Bacillus anthracis str. A0442] >gi|170687121|ref|ZP_02878339.1| segregation and condensation protein A [Bacillus anthracis str. A0465] >gi|167531181|gb|EDR93868.1| segregation and condensation protein A [Bacillus anthracis str. A0442] >gi|170668738|gb|EDT19483.1| segregation and condensation protein A [Bacillus anthracis str. A0465] (247 aa)
Score = 195, Expect = 2.1e-13, Identities = 79/250 (31%), Positives = 134/250 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + E+ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++ L+ YK+Y+++  +L E+ + R++++ +P     D  SL +E + N     + LDV L  M   + KL+  KK + P      I   EI I+    +I + LE      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+    K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMETLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEETN-----LPLDVTLYDMLAAFQKLMRRKKAEKPV--TTRITRQEIPIEQRMTDILKQLE--IQGGRQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSYTK 245
>gi|167971805|ref|ZP_02554082.1| ScpA/B protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282574|ref|ZP_02690241.1| ScpA/B protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308729|ref|ZP_02691404.1| ScpA/B protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762138|ref|YP_001752428.1| segregation and condensation protein A [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|168827715|gb|ACA32977.1| segregation and condensation protein A [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902978|gb|EDT49267.1| ScpA/B protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675737|gb|EDT87642.1| ScpA/B protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700950|gb|EDU19232.1| ScpA/B protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (291 aa)
Score = 195, Expect = 2.3e-13, Identities = 72/258 (27%), Positives = 144/258 (55%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + YV+++N  +  + ID L ++L MA+YLLE K++ ++P++D ++ +S + +R   I RL+ Y  Y+ +   L ++ E R+ M + P Q  E         +D  Y P  + LD ++  ++ +  K++   + K+ K N   I V E  +  +E+ +  +L+  P+  + S + +F         KR+F + F+ IL+L+    I  E+  +D   +++KI+ E   ++Y
  S:    17 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYVNFVNQLIKTIDIDILGDHLAMASYLLELKTRMLMPTVDEKQIMSIEEDRQNLIDRLIEYNGYKNLSEHLKQRFEFRATMMDLPQQDYEQ-----FYLKDAIYKPLPNHLDSMI--LKNIMDKIIYENELKNYKINK--IKVHEYDVKQLEQLLLNYLKQSPN-QQASMLSFFDIQAVIDKNKRFFAIMFLIILILINRNEILFEELDND---YLLKINIERVVDDY 262
>gi|13357905|ref|NP_078179.1| hypothetical protein UU345 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|41018152|sp|Q9PQE6|SCPA_UREPA Segregation and condensation protein A >gi|11356801|pir||F82903 conserved hypothetical UU345 [imported] - Ureaplasma urealyticum >gi|6899324|gb|AAF30754.1|AE002131_8 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (294 aa)
Score = 195, Expect = 2.3e-13, Identities = 72/258 (27%), Positives = 144/258 (55%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNEY 291
           +FNGP +    LIK++++DI N++++E+ + YV+++N  +  + ID L ++L MA+YLLE K++ ++P++D ++ +S + +R   I RL+ Y  Y+ +   L ++ E R+ M + P Q  E         +D  Y P  + LD ++  ++ +  K++   + K+ K N   I V E  +  +E+ +  +L+  P+  + S + +F         KR+F + F+ IL+L+    I  E+  +D   +++KI+ E   ++Y
  S:    20 DFNGPLDTLCVLIKQKRLDINNLDILELSKQYVNFVNQLIKTIDIDILGDHLAMASYLLELKTRMLMPTVDEKQIMSIEEDRQNLIDRLIEYNGYKNLSEHLKQRFEFRATMMDLPQQDYEQ-----FYLKDAIYKPLPNHLDSMI--LKNIMDKIIYENELKNYKINK--IKVHEYDVKQLEQLLLNYLKQSPN-QQASMLSFFDIQAVIDKNKRFFAIMFLIILILINRNEILFEELDND---YLLKINIERVVDDY 265
>gi|30022145|ref|NP_833776.1| segregation and condensation protein A [Bacillus cereus ATCC 14579] >gi|167939668|ref|ZP_02526743.1| segregation and condensation protein A [Bacillus cereus AH1134] >gi|168136699|ref|ZP_02579928.1| segregation and condensation protein A [Bacillus cereus B4264] >gi|168140033|ref|ZP_02583262.1| segregation and condensation protein A [Bacillus cereus G9842] >gi|41017957|sp|Q812U6|SCPA_BACCR Segregation and condensation protein A >gi|29897702|gb|AAP10977.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579] (247 aa)
Score = 195, Expect = 2.6e-13, Identities = 78/250 (31%), Positives = 136/250 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI   ++DI NI + ++ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P     D  SL +E +      ++ LDV L  M   + KL+  KK K P      I   EI I+    +I + L+      + SF D F  + DE   +   VV F+A+L L++N  I +EQ  + + IF+   +K
  S:    10 FEGPLDLLLHLIHRYEIDIYNIPVADITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRPPI---DFTSLQQEEET-----SLPLDVTLYDMLAAFQKLMRRKKAKKPV--TTRITRQEIPIEQRMTDILKQLKIKGG--RQSFYDLF--VDDE---REIMVVTFLAVLELMKNQQIIIEQEHNFDEIFVSSSNK 245
>gi|16803990|ref|NP_465475.1| segregation and condensation protein A [Listeria monocytogenes EGD-e] >gi|46908185|ref|YP_014574.1| segregation and condensation protein A [Listeria monocytogenes str. 4b F2365] >gi|47093380|ref|ZP_00231147.1| segregation and condensation protein A [Listeria monocytogenes str. 4b H7858] >gi|47097094|ref|ZP_00234664.1| segregation and condensation protein A [Listeria monocytogenes str. 1/2a F6854] >gi|153167806|ref|ZP_01927891.1| segregation and condensation protein A [Listeria monocytogenes FSL N1-017] >gi|153175178|ref|ZP_01930573.1| segregation and condensation protein A [Listeria monocytogenes FSL N3-165] >gi|153180000|ref|ZP_01933139.1| segregation and condensation protein A [Listeria monocytogenes F6900] >gi|153183436|ref|ZP_01934296.1| segregation and condensation protein A [Listeria monocytogenes J0161] >gi|153191447|ref|ZP_01938667.1| segregation and condensation protein A [Listeria monocytogenes J2818] >gi|153196458|ref|ZP_01940828.1| segregation and condensation protein A [Listeria monocytogenes 10403S] >gi|153202944|ref|ZP_01944382.1| segregation and condensation protein A [Listeria monocytogenes HPB2262] >gi|167015106|ref|ZP_02277639.1| segregation and condensation protein A [Listeria monocytogenes FSL J1-194] >gi|167212662|ref|ZP_02282969.1| segregation and condensation protein A [Listeria monocytogenes LO28] >gi|167454498|ref|ZP_02320721.1| segregation and condensation protein A [Listeria monocytogenes FSL J2-064] >gi|41018094|sp|Q8Y5V4|SCPA_LISMO Segregation and condensation protein A >gi|56749620|sp|Q71Y63|SCPA_LISMF Segregation and condensation protein A >gi|16411404|emb|CAD00029.1| lmo1951 [Listeria monocytogenes] >gi|46881455|gb|AAT04751.1| segregation and condensation protein A [Listeria monocytogenes str. 4b F2365] >gi|47014539|gb|EAL05502.1| segregation and condensation protein A [Listeria monocytogenes str. 1/2a F6854] >gi|47018251|gb|EAL09017.1| segregation and condensation protein A [Listeria monocytogenes str. 4b H7858] >gi|126943727|gb|EBA21444.1| segregation and condensation protein A [Listeria monocytogenes J0161] >gi|127633919|gb|EBA23311.1| segregation and condensation protein A [Listeria monocytogenes 10403S] >gi|127765226|gb|EBA25576.1| segregation and condensation protein A [Listeria monocytogenes J2818] >gi|133726677|gb|EBA28375.1| segregation and condensation protein A [Listeria monocytogenes FSL N1-017] >gi|133729631|gb|EBA31329.1| segregation and condensation protein A [Listeria monocytogenes FSL N3-165] >gi|133732175|gb|EBA33873.1| segregation and condensation protein A [Listeria monocytogenes F6900] >gi|133735014|gb|EBA36712.1| segregation and condensation protein A [Listeria monocytogenes HPB2262] (249 aa)
Score = 194, Expect = 3.0e-13, Identities = 75/252 (29%), Positives = 132/252 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEV 286
           F GP +L   LI + ++DI +I + E+   Y+++++  + ++++D  +EYL+MA  LL  KSK +LP     +D +    ++  RD  +++L+ YK+++E   +L EK   RS  F KP          L E+ D + V   +LDV L  M   + K++  KK   P      I   EISID     + E L      +++ F + F     E+ TK   VV F+A+L L++   +++EQ  S  ++++    +E+
  S:    11 FEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHT-MQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEYKRFKEAAKELKEKEAERSFYFSKPPMD-------LAEYDDGTKVA--ELDVSLNDMLSAFNKMLRRKKLNKPLHT--RITTQEISIDQRMDSVLEKLN-LQVNHRLRFDELF-----EEQTKEQLVVTFLALLELMKRKLVEVEQAESFADLYVQGKGEEI 248
>gi|171323466|ref|ZP_02911986.1| chromosome segregation and condensation protein ScpA [Geobacillus sp. WCH70] >gi|171090660|gb|EDT36953.1| chromosome segregation and condensation protein ScpA [Geobacillus sp. WCH70] (254 aa)
Score = 194, Expect = 3.4e-13, Identities = 80/245 (32%), Positives = 129/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE------RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSP-KDNVKLIDVSEISIDDVEKEIREFLEPFPHL-YKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I + ++ + Y+ YI+  + +L++D  +EYL+MA  LL  KSK +LP  + EE + + +E      R++ +QRLL YK+++E    L +K E R+ +F KP        S L  + D   +    LDV +  M     KL+  KK + P    V   D+S      +EK + E LE       + +F D F       + + + VV F+AIL L++   I +EQ  +  +IFI
  S:    10 FEGPLDLLLHLINRYEIDIYDIPVAQITEQYMAYIHA-MQELQLDIASEYLVMAATLLAIKSKMLLPKHE-EEILDEGVELPESDPREELMQRLLEYKKFKEAAQALKKKEEERALLFTKPP-------SDLSMYADEKEMMKRPLDVNVYDMLGALSKLLRRKKLQKPLHTKVTRQDIS------IEKRMEEILEELRRTKTRKNFYDLFP-----YYDRGHIVVTFLAILELMKKNAIIIEQERNFADIFI 242
>gi|116491034|ref|YP_810578.1| condensin subunit ScpA [Oenococcus oeni PSU-1] >gi|116091759|gb|ABJ56913.1| condensin subunit ScpA [Oenococcus oeni PSU-1] (254 aa)
Score = 193, Expect = 4.5e-13, Identities = 71/264 (26%), Positives = 131/264 (49%)
  Q:    18 LNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           ++N +  IS+ D     F+GP +L   LI+ +++DI ++ + +V   ++ +I+N L    +D   EYL MA+ L+  KS+ +LP++  E++  K+ + R++ +  L+ Y+ YQ +   + E    RS  F +P          + +  +N  +  +   V L+ +QK +L++   +K   PK   + I+    S+ D   EI+ F        KI F   FK       +    +  F+AIL L ++  I L QN  ++ IF+ K
  S:     8 VSNKQLTISLDD-----FSGPLDLLLHLIRTQELDIFDLPIAKVTDQFLSFIDNQLNP-SLDSAGEYLYMASTLIRIKSRFLLPTVKNEQEDEKEEDPRNELVNALIEYECYQAVTQDMSELEHSRSLSFTRP----------VAKIPENIEIKPLSAGVTLQDLQKAFLEIANRQKDLHPKK--RTIERENFSVADKINEIKTFFGQKKLDSKIEFQYLFK----LSSSNDEMITTFLAILELAKDHFILLSQN-DEQQIFLTK 249
>gi|168266336|ref|ZP_02688301.1| segregation and condensation protein A [Listeria monocytogenes FSL J2-071] (249 aa)
Score = 192, Expect = 4.7e-13, Identities = 73/245 (29%), Positives = 130/245 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + ++DI +I + E+   Y+++++  + ++++D  +EYL+MA  LL  KSK +LP     +D +    ++  RD  +++L+ YK+++E   +L EK   RS  F KP          L E+ D + V   +LDV L  M   + K++  KK   P      I   EISID+    +   L    + +++ F + F     E+ TK   VV F+A+L L++   +++EQ  S  ++++
  S:    11 FEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHT-MQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEYKRFKEAAKELKEKEAERSFYFSKPPMD-------LAEYDDGTKVA--ELDVSLNDMLSAFNKMLRRKKLNKPLHT--RITTQEISIDERMDSVLGKLHQQVN-HRLRFDELF-----EEQTKEQLVVTFLALLELMKRKLVEVEQAESFADLYV 241
>gi|167344174|ref|ZP_02290015.1| segregation and condensation protein A [Listeria monocytogenes FSL J1-208] (249 aa)
Score = 192, Expect = 5.0e-13, Identities = 73/245 (29%), Positives = 130/245 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + ++DI +I + E+   Y+++++  + ++++D  +EYL+MA  LL  KSK +LP     +D +    ++  RD  +++L+ YK+++E   +L EK   RS  F KP          L E+ D + V   +LDV L  M   + K++  KK   P      I   EISID+    +   L    + +++ F + F     E+ TK   VV F+A+L L++   +++EQ  S  ++++
  S:    11 FEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHT-MQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEYKRFKEAAKELKEKEAERSFYFSKPPMD-------LAEYDDGTKVA--ELDVSLNDMLSAFNKMLRRKKLNKPLHT--RITTQEISIDERMDAVLGKLHQQVN-HRLRFDELF-----EEQTKEQLVVTFLALLELMKRKLVEVEQAESFADLYV 241
>gi|146295972|ref|YP_001179743.1| chromosome segregation and condensation protein ScpA [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409548|gb|ABP66552.1| condensin subunit ScpA [Caldicellulosiruptor saccharolyticus DSM 8903] (233 aa)
Score = 191, Expect = 6.0e-13, Identities = 72/247 (29%), Positives = 127/247 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           F GP +L   LIK+ K++I +I + E+   Y+ YIN +L  + +D ++E+L+MA  LLE KSK +LP +  EE    +  R + ++RL  Y++Y+E+   L E           P +    +   L+ F+ N +V  +D++ +++     Y  +++ K+T S  ++ +L ++++     + K I++ LE         F    K I  ++   R     F+AIL L R GHI L Q    ++I I K
  S:    10 FEGPLDLLLYLIKKEKINIYDIPIAEITNQYLMYIN-HLDTINVDSISEFLVMAATLLEIKSKMLLPKLQEEE----EDPRQELVERLREYQKYKEVAIYLKEN---------HPYRESYKRAFELRNFESN-FVVKVDVNKLIET----YKNILSKKETTSSNNDERLQEITKKQTISILKVIKQVLEYIKQKGVAYFSHLIKGISKDEIVYR-----FLAILELCRLGHISLHQQKVFDDIKITK 232
>gi|118586873|ref|ZP_01544307.1| hypothetical protein OENOO_56042 [Oenococcus oeni ATCC BAA-1163] >gi|118432705|gb|EAV39437.1| hypothetical protein OENOO_56042 [Oenococcus oeni ATCC BAA-1163] (254 aa)
Score = 191, Expect = 7.4e-13, Identities = 67/252 (26%), Positives = 126/252 (50%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           I+  +F+GP +L   LI+ +++DI ++ + +V   ++ +I+N L    +D   EYL MA+ L+  KS+ +LP++  E++  K+ + R++ +  L+ Y+ YQ +   + E    RS  F +P          + +  +N  +  +   V L+ +QK +L++   +K   PK   + I+    S+ D   EI+ F        KI F   FK       +    +  F+AIL L ++  + L QN  ++ IF+ K
  S:    15 ISLDDFSGPLDLLLHLIRTQELDIFDLPIAKVTDQFLSFIDNQLNP-SLDSAGEYLYMASTLIRIKSRFLLPTVKNEQEDEKEEDPRNELVNALIEYECYQAVTQDMSELEHSRSLSFTRP----------VAKIPENIEIKPLSAGVTLQDLQKAFLEIANRQKDLHPKK--RTIERENFSVADKINEIKTFFSQKKLDSKIEFQYLFK----LSSSNDEMITTFLAILELAKDHFVLLSQN-DEQQIFLTK 249
>gi|56420826|ref|YP_148144.1| segregation and condensation protein A [Geobacillus kaustophilus HTA426] >gi|56380668|dbj|BAD76576.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (304 aa)
Score = 191, Expect = 7.8e-13, Identities = 78/245 (31%), Positives = 129/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-------RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSP-KDNVKLIDVSEISIDDVEKEIREFLEPFPHLY-KISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I + ++ + Y+ YI+  + +L++D  +EYL+MA  LL  KSK +LP  + EE +  DIE       R++  QRLL YK+++E   +L  + E R+ +F KP        S L  + D     A  LDV +  M     KL+  KK + P +  +   D+S      VE+ + E L        + +F + F +     + + Y VV F+AIL L++   I +EQ  +  ++F+
  S:    67 FEGPLDLLLHLINRYEIDIYDIPVAQITEQYMAYIHA-MQELELDIASEYLVMAATLLAIKSKMLLPPSN-EEAVDGDIEWGDDGDPREELAQRLLEYKKFKEAARELKRREEERALLFTKPP-------SDLSAYADEK--KAAPLDVNVYDMLGALSKLLRRKKLQKPMRAKISRQDIS------VEQRMAEILHELKQANGRKNFYELFPS-----YDRSYIVVTFLAILELMKQDEIIVEQERNFSDLFL 298
>gi|149181676|ref|ZP_01860169.1| segregation and condensation protein A [Bacillus sp. SG-1] >gi|148850654|gb|EDL64811.1| segregation and condensation protein A [Bacillus sp. SG-1] (253 aa)
Score = 190, Expect = 8.5e-13, Identities = 78/253 (30%), Positives = 131/253 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD-TEEKISKDIE---RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVE 287
           F GP +L   LI   ++DI +I + ++ + Y+ YI+  + +L++D  +EYL+MA  LL  KSK +LP  +  E++   +IE   RD+ + RL+ YK+Y+E   +L  + E R +M+ KP        S L +F D      +D DV +  M   + KL+  KK + P      I   EI I+    EI        HL        F ++ D +  + + VV F+A+L L++   I + Q+ + ++ F V+  +E E
  S:    10 FEGPLDLLLHLIHSLEIDIYDIPMAQITEQYLLYIHT-MKELELDVASEYLVMAATLLAIKSKMLLPKHEEIEDEADFEIEEDPRDELVDRLIEYKKYKEAAEELKSREEERGQMYTKPP-------SDLSQFADEKVTGQLDHDVTIYDMLGAFNKLLRRKKLQKPV--TTKISRQEIPIEKRMDEI------MVHLKGTRKKQRFFSLFDYE-DREHLVVTFLAVLELMKRKQIIVRQDQNFDD-FTVQSAEEAE 248
>gi|157692823|ref|YP_001487285.1| segregation and condensation protein A [Bacillus pumilus SAFR-032] >gi|167016551|sp|A8FEQ8|SCPA_BACP2 Segregation and condensation protein A >gi|157681581|gb|ABV62725.1| segregation and condensation protein A [Bacillus pumilus SAFR-032] (252 aa)
Score = 188, Expect = 1.4e-12, Identities = 74/246 (30%), Positives = 126/246 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKY-----IQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV 280
           F GP +L   LI   ++DI +I + ++ + Y+ Y++  + +L++D  +EYL+MA  LL  KS+ +LP  + E      +E ++      I +L+ Y++Y++   +L E+ E R   F KP        S L EF   S     +L V +  M   + K++  KK   P  +   I   EI I+D   EI   L       + +FM  F++       K + VV F+A+L L+++  I LEQ  + E+I+I+
  S:    11 FEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHT-MRELELDVASEYLVMAATLLSIKSRMLLPKQEEELFDEDLLEEEEDPREELIGKLIEYRKYKDAAQELKEREEERQNAFTKPP-------SDLSEFAKESEAKDTNLHVTVYDMLGAFQKVLNRKKITKPAPS--RITRQEIPIEDKMNEIMNHLRKTKK--RTNFMTLFQHD-----QKEHLVVTFLAVLELMKSHQIMLEQEGNFEDIYII 244
>gi|194017015|ref|ZP_03055628.1| ScpA/B protein [Bacillus pumilus ATCC 7061] >gi|194011621|gb|EDW21190.1| ScpA/B protein [Bacillus pumilus ATCC 7061] (252 aa)
Score = 188, Expect = 1.5e-12, Identities = 74/246 (30%), Positives = 124/246 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKY-----IQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV 280
           F GP +L   LI   ++DI +I + ++ + Y+ Y++  + +L++D  +EYL+MA  LL  KS+ +LP  + E      +E ++      I +L+ Y++Y++   +L E+ E R   F KP        S L EF   S     +L V +  M   + K+   KK   P  +   I   EI I+D   EI   L       + +FM  F++       K + VV F+A+L L++   I LEQ  + E+I+I+
  S:    11 FEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHT-MRELELDVASEYLVMAATLLSIKSRMLLPKQEEELFDEDLLEEEEDPREELIGKLIEYRKYKDAAQELKEREEERQNAFTKPP-------SDLSEFAKESEAKDTNLHVTVYDMLGAFQKVFNRKKITKPAPS--RITRQEIPIEDKMNEIMNHLRKTKK--RTNFMTLFQHD-----QKEHLVVTFLAVLELMKGHQIMLEQEGNFEDIYII 244
>gi|138895860|ref|YP_001126313.1| segregation and condensation protein A [Geobacillus thermodenitrificans NG80-2] >gi|134267373|gb|ABO67568.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] (261 aa)
Score = 186, Expect = 2.5e-12, Identities = 77/245 (31%), Positives = 128/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTE-----EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSP-KDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I + ++ + Y+ YI+  + +L++D  +EYL+MA  LL  KSK +LP+ + E     E    D  R++ +QRLL YK+++E   +L  + E R+ +F KP        S L  + D     A  LDV +  M     KL+  KK + P +  +   D+S      VEK + E L       +    ++++  P   + + Y VV F+AIL L++   I +EQ  +  ++FI
  S:    24 FEGPLDLLLHLINRYEIDIYDIPVAQITEQYMAYIHA-MQELELDIASEYLVMAATLLAIKSKMLLPAPEEEDDGDMEFDEADDPREELMQRLLEYKKFKEAARELKRREEERALLFTKPP-------SDLSAYADEK--KAAPLDVNVYDMLGALSKLLRRKKLQKPMRTKITRQDIS------VEKRMAEILHELRQTNERK--NFYELFP--SYDRSYIVVTFLAILELMKQNEIIIEQERNFSDLFI 254
>gi|28378543|ref|NP_785435.1| hypothetical protein lp_1890 [Lactobacillus plantarum WCFS1] >gi|41018001|sp|Q88VY7|SCPA_LACPL Segregation and condensation protein A >gi|28271379|emb|CAD64284.1| unknown [Lactobacillus plantarum WCFS1] (245 aa)
Score = 185, Expect = 3.3e-12, Identities = 69/237 (29%), Positives = 116/237 (48%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS---MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           EF GP +L   LI++ KMDI +I +  + Q Y+DY+++ +  LK+D   +YL+MA  L+  KS+ +LP     + +E    D  RD  +  LL YK YQE   +L EK + R + F         +E++L     +   P +   + L  +Q  + +LV  ++   P    K +    I+ID+   +I   L+  P    + F D F     ++      V  F+A+L L +   + L+Q
  S:     5 EFEGPLDLLLHLIRQNKMDIYDIPIAAITQQYLDYLHS-MRALKLDIAGDYLVMAATLMTIKSRFLLPQPEPDEMDEDNEDDDPRDSLVAELLAYKVYQEAAGELREKEQARHQHFT--------REAML--VPADLSAPKLTAGITLDDLQAAFRQLVAKRRRVRPL--TKTVVAETINIDERMTQITTQLQHQPQ--GLDFADLFTVSASDEM----LVTTFMAVLELTKQDQVALQQ 225
>gi|196248752|ref|ZP_03147452.1| chromosome segregation and condensation protein ScpA [Geobacillus sp. G11MC16] >gi|196211628|gb|EDY06387.1| chromosome segregation and condensation protein ScpA [Geobacillus sp. G11MC16] (261 aa)
Score = 184, Expect = 3.9e-12, Identities = 75/245 (30%), Positives = 129/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSP-KDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I + ++ + Y+ YI+  + +L++D  +EYL+MA  LL  KSK +LP+ + E+    + +     R++ +QRLL YK+++E   +L  + E R+ +F KP        S L  + D     A  LDV +  M     KL+  KK + P +  +   D+S      VEK + E L       +    ++++  P   + + Y VV F+AIL L++   I +EQ  +  ++FI
  S:    24 FEGPLDLLLHLINRYEIDIYDIPVAQITEQYMAYIHA-MQELELDIASEYLVMAATLLAIKSKMLLPAPEEEDDGDMEFDEVDDPREELMQRLLEYKKFKEAARELKRREEERALLFTKPP-------SDLSAYADEK--KAAPLDVNVYDMLGALSKLLRRKKLQKPMRTKITRQDIS------VEKRMAEILHELRQTNERK--NFYELFP--SYDRSYIVVTFLAILELMKQNEIIIEQERNFSDLFI 254
>gi|152967066|ref|YP_001362850.1| chromosome segregation and condensation protein ScpA [Kineococcus radiotolerans SRS30216] >gi|151361583|gb|ABS04586.1| chromosome segregation and condensation protein ScpA [Kineococcus radiotolerans SRS30216] (293 aa)
Score = 183, Expect = 5.2e-12, Identities = 62/254 (24%), Positives = 117/254 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYI---NNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTE--EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEI--SIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVES 288
           F GPF+L   LI + ++D+  + L  V   ++ ++   +       +D+ +E+LL+A  LL+ K+ R+LP+ D E  E ++    RD    RLL Y+ Y+++   L E+ E+ SR   +        E LL E             ++L   ++ +  +     T  P     L+D+  +  S   V ++    ++        +F +   +  D +      V  F+A+L L R   ++LEQ  +   +  V+ D +VE+
  S:    28 FEGPFDLLLGLITKHQLDVTEVALARVTDDFIAHLRAASRQEEDFDLDEASEFLLVAATLLDLKAARLLPAADVEDPEDLALLEARDLLFARLLQYRAYKQVAALLAERFEQASRRVPRAVAVEPHFEKLLPE-------------LVLTVSREQFAAIAARALTPRP---TALVDLDHLHSSAVSVREQASLVVDRLRRAGTATFAELVADAGDGELGTLVVVARFLAVLELFRERRVRLEQPEALGEL-TVRWDAQVEA 271
>gi|119964137|ref|YP_947433.1| segregation and condensation protein A [Arthrobacter aurescens TC1] >gi|119950996|gb|ABM09907.1| segregation and condensation protein A [Arthrobacter aurescens TC1] (307 aa)
Score = 183, Expect = 5.6e-12, Identities = 66/236 (27%), Positives = 115/236 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKL----KIDDLTEYLLMATYLLEQKSKRILPSMDTE--EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEK---EIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           F GPF+L   LI + K+DI  + L  V   ++ YI   L +L     +D+ +E+L++A  LL+ K+ R+LP+ + E  E I+    RD    RLL YK +++I   L EKLE+ +R + +         +LL E     + P    ++  KA++              PKD+      +E+ +D +      ++E  E   +  K+     F+ +  +  T    V  F+A+L + R+  +  EQ
  S:    41 FTGPFDLLLGLISKHKLDITEVALATVTDEFIKYIRR-LQELGEDWALDEASEFLVIAATLLDLKAARLLPAGEVEDAEDIALLEARDLLFARLLQYKAFKQIAGILGEKLEQEARRYPRQVALEGHFAALLPELV-WRHTPEQFAELAAKALK--------------PKDSAP----AEVGLDHLHAPPVSVKEQAEIMGYRLKLGAPLSFQTLIADAETTLVVVARFLALLEMFRDRVVAFEQ 265
>gi|150390294|ref|YP_001320343.1| chromosome segregation and condensation protein ScpA [Alkaliphilus metalliredigens QYMF] >gi|149950156|gb|ABR48684.1| chromosome segregation and condensation protein ScpA [Alkaliphilus metalliredigens QYMF] (248 aa)
Score = 180, Expect = 1.3e-11, Identities = 69/251 (27%), Positives = 138/251 (54%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSM---DTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDV--EKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           +I  + F GPF+L + L+++ +++I +I + ++ + YVDY+   +  L +D  +E+LLMA  LLE KSK +LP     D + +I +   R++ ++RLL YK+Y+    +L +K +  +R++ KP +     E ++++   +  +  MDL  ++ A +K+             K +VK+  + E+  ++V  EK++++ +        +SF   F +      +K   +  F+A+L L++   I ++Q  S E+I I
  S:     4 NIKIEAFEGPFDLLFHLLEKNEIEIYDIPIHDITEQYVDYLKQ-MEHLDLDVTSEFLLMAATLLEIKSKMLLPRPIIDDQQLEIGEIDPREELVKRLLEYKKYKNAAGELRDKEDSLNRLYFKPRE-----EFIIEKEIYDEVLEGMDLTDLIGAFEKII--------QGKFKHHVKVQQIREMQREEVSIEKKVQDLIHLINENGTVSFHSLFSDTT----SKIEVITTFLALLELIKMNKIIIQQTKSFESIMI 241
>gi|16079379|ref|NP_390203.1| segregation and condensation protein A [Bacillus subtilis subsp. subtilis str. 168] >gi|466185|sp|P35154|SCPA_BACSU Segregation and condensation protein A >gi|410131|gb|AAA67487.1| ORFX7 >gi|2634757|emb|CAB14254.1| ypuG [Bacillus subtilis subsp. subtilis str. 168] (251 aa)
Score = 179, Expect = 1.5e-11, Identities = 73/245 (29%), Positives = 127/245 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I + ++ + Y+ Y++  +  L++D  +EYL+MA  LL  KS+ +LP  + E    + +E    R++ I++L+ Y++Y++    L E+ E R + F KP        S L E+          L V +  M   + K++  KK   P +    I   +I I+    EI   L+      +I+FMD F   P E+  K + VV F+A+L L++N  + +EQ  +  +I+I
  S:    11 FEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHT-MRVLELDIASEYLVMAATLLSIKSRMLLPKQEEELFEDELLEEEDPREELIEKLIEYRKYKDAAKDLKEREEERQKSFTKPP-------SDLSEYAKEVKQSEQKLSVTVYDMIGAFQKVLKRKKINRPMETT--ITRQDIPIEARMNEIVHSLK--SRGTRINFMDLF---PYEQ--KEHLVVTFLAVLELMKNQLVLIEQEHNFSDIYI 242
>gi|23099283|ref|NP_692749.1| segregation and condensation protein A [Oceanobacillus iheyensis HTE831] >gi|41017956|sp|Q7ZAM4|SCPA_OCEIH Segregation and condensation protein A >gi|22777512|dbj|BAC13784.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (249 aa)
Score = 179, Expect = 1.5e-11, Identities = 69/250 (27%), Positives = 130/250 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI---ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKD-NVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI + ++DI +I + ++ Q Y++YI+  +  L+++  +EYL+MA+ LL  KS+ +LP  + E+ + ++     R++ +QRL+ Y++Y+EI  +L EK    ++++ +P    E K+   K   + + +   D+   LK M K        K+   P D  V+ +D+       +E  ++E L+           D     P    TK Y VV FVA+L L+++  I   Q    E +++  +++
  S:    12 FEGPLDLLLHLINQFEIDIYDIPVAQITQQYMEYIHT-MQHLELNIASEYLVMASTLLAIKSQMLLPKQELEDDLDEEYMEDPREELMQRLIEYRKYKEIAERLKEKESEDNQLYTRPPVVFEFKDIPEKITTNQTDISIFDMVGALKNMLK-------RKEWTEPHDTTVQRMDIP------IETRMKEVLQQVQSNSDGLVFDKLFPSP----TKNYIVVTFVAVLELMKDKQIYAVQERHFEELYLYSMEE 247
>gi|116494856|ref|YP_806590.1| hypothetical protein LSEI_1370 [Lactobacillus casei ATCC 334] >gi|116105006|gb|ABJ70148.1| condensin subunit ScpA [Lactobacillus casei ATCC 334] (241 aa)
Score = 178, Expect = 2.0e-11, Identities = 62/239 (25%), Positives = 113/239 (47%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNS 272
           +F+GP +L + LI+  ++DI +I + E+   Y+DY++  +  L +D   +Y +MA  L+  KS+ +LP  + E     +    R   + +LL Y+ YQE    L  +  +R++ + KPT   + K +          VP     V L  +Q    +++  K  ++ +  +  I+   +S   VEK I E L+      +  F D       E+      V  F+A+L L++N  +  EQ +
  S:     9 DFSGPLDLLWHLIRTNEVDIYDIPIAEITAQYLDYLHQ-MQDLALDVAGDYFVMAANLMVLKSRLLLPQPEPETMAPDEAPDPRADLVAQLLTYQVYQEAAKDLKAREAKRAQAYAKPTTLPDAKMA----------VPLAPGSVKLVDLQAAMARVM--KAQQATRQTIAHIETEPVS---VEKRIGEVLQTLQKGGQCLFADLLSVQSVEQ-----VVTTFLALLELMKNDQVICEQEA 228
>gi|116492848|ref|YP_804583.1| condensin subunit ScpA [Pediococcus pentosaceus ATCC 25745] >gi|116102998|gb|ABJ68141.1| condensin subunit ScpA [Pediococcus pentosaceus ATCC 25745] (242 aa)
Score = 178, Expect = 2.3e-11, Identities = 67/254 (26%), Positives = 121/254 (47%)
  Q:    26 SIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           ++ ++   EF GP +L   LI++ +M I +I + E+   Y+ Y+++    L ++   EYL+MA  L E K K +LP    EE I ++  R+  + +LLVY+ ++E    L    + R   F +P       E+       N   P + +  +  A+QKV  +    + T       + +   E+++++   EI++ +     L +  F D F       F++   V  F+AIL L +N  I LEQ +  ++I I
  S:     7 TLPNVKLAEFEGPLDLLLHLIRKSQMSIYDIKISEITAQYLQYLHSQ-ESLVLNIAGEYLVMAAKLTEIKGKLLLPH--DEEVIEEEDPRNDLVDQLLVYQMFKEASEGLKSLEKERQTSFTRPEMEIPPNEA-------NRLAPGVKISDLQFALQKVLARQALLEPT------YRTVKAEEVTLEERMSEIKKRIF---DLKQCCFEDLFIG----HFSRETLVTTFMAILELAKNHQILLEQPARKQSILI 237
>gi|167214776|ref|ZP_02285083.1| segregation and condensation protein A [Listeria monocytogenes FSL R2-503] (243 aa)
Score = 177, Expect = 3.2e-11, Identities = 72/228 (31%), Positives = 116/228 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVR 262
           F GP +L   LI + ++DI +I + E+   Y+++++  + ++++D  +EYL+MA  LL  KSK +LP     +D +    ++  RD  +++L+ YK+++E   +L EK   RS  F KP          L E+ D + V   +LDV L  M   + K++  KK   P      I   EISID     + E L      +++ F + F     E+ TK   VV F   LV VR
  S:    11 FEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHT-MQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEYKRFKEAAKELKEKEAERSFYFSKPPMD-------LAEYDDGTKVA--ELDVSLNDMLSAFNKMLRRKKLNKPLHT--RITTQEISIDQRMDSVLEKLN-LQVNHRLRFDELF-----EEQTKEQLVVTF---LVFVR 221
>gi|81428637|ref|YP_395637.1| hypothetical protein LSA1026 [Lactobacillus sakei subsp. sakei 23K] >gi|78610279|emb|CAI55328.1| Hypothetical protein [Lactobacillus sakei subsp. sakei 23K] (251 aa)
Score = 176, Expect = 3.5e-11, Identities = 64/246 (26%), Positives = 117/246 (47%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDT-EEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           +F GP +L   LI + K+DI +I + E+   Y+DY++  + +LK+D   +YL+MA  L++ KSK +LP+     E + +D    R + + +LL Y+ +Q+I   L E+   R  +F KP  +   ++           VP     +  + +     K++     + P  + K +   EI+I +    I + L       K      F+ +   +F +   V  F+A+L L++   I  +Q   DE I +
  S:    11 DFEGPLDLLLHLINQTKIDIYDIPIAEITTQYLDYLHQ-MQELKLDIAGDYLVMAATLMKIKSKLLLPAPPAMAETLEEDYVDPRQELVDQLLAYQAFQKIATVLQERESERQLLFAKPASANPAEK----------VVPLARGVIKPRDLAAAVSKMLVEATVQQP--DFKTVQNDEITIAEKMDWIIDCL-------KTRATTTFEQLVINRFDREEIVTTFLAVLELMKERLINCDQAGYDEQILV 239
>gi|110004421|emb|CAK98759.1| putative chromosome segregation and condensation a transmembrane protein [Spiroplasma citri] (253 aa)
Score = 176, Expect = 3.8e-11, Identities = 69/257 (26%), Positives = 133/257 (51%)
  Q:    23 FHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
            H+   ++    F+GP +L   LIKE++M++  I L E+   ++ YI   + +L I+  +EYL MA+YL+E K+K +LP   ++ ++   KD  RD+ I RLL YK+ +E+     ++ +   R   KP      K + +KE +D    P +++D +  +  K+  ++   K  +S       + ++E+S +++ + I   L      + +  +     + +   + + FV  F+A+L L R+  I++EQ    E I+I
  S:     2 LHLPRYEVKLDNFSGPLDLLLHLIKEKEMNLFEIKLTEITDQFLAYIRE-IEQLNIEIASEYLTMASYLVETKTKLVLPKEQVEIDDNYEKD-ARDEIINRLLEYKKIKEVSQYFKDQHQEGIRYLSKPRTI--IKGNSIKE-EDLPLSPKINIDKLTNSFLKMLERINAAKPLESN------VVITEVSPEEMAERIMMLLAQDDKEWTLEEL-----LGNFTLSLQAFVACFIALLDLSRHQKIEIEQYQHLEAIYI 244
>gi|111017944|ref|YP_700916.1| segregation and condensation protein [Rhodococcus sp. RHA1] >gi|110817474|gb|ABG92758.1| possible segregation and condensation protein [Rhodococcus sp. RHA1] (291 aa)
Score = 176, Expect = 3.9e-11, Identities = 63/241 (26%), Positives = 113/241 (46%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTE--EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRS-RMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           +T + F GPF+L  +LI +R++D+  + L +V   ++ Y  +  T++ +D  TE+L++A  LL+ K+ R+LP+   E  E ++    RD    RLL Y+ Y++ V +L  +LE  + R + +     +    LL E             V+L    + + ++  T  T  PK  V L  + ++    V ++    LE         +   F ++  E       V  F+A+L L R   +  EQ
  S:    37 VTLRNFEGPFDLLLTLINQRQLDVTEVALHQVTDDFIAYTRSLGTEMGLDQTTEFLVVAATLLDLKAARLLPAGQVEDAEDLALLEARDLLFARLLQYRAYKQ-VAQLFGELEAAALRRYPRSAALEDQFTKLLPE-------------VLLGVDPQRFAEIAATVFTPRPKPTVGLDHLHDMHAVSVPEQAARMLELLRERGAGEWAT-FGDLVSECEVTTLIVARFLALLELYREQSVLFEQ 265
>gi|167462343|ref|ZP_02327432.1| segregation and condensation protein A [Paenibacillus larvae subsp. larvae BRL-230010] (292 aa)
Score = 175, Expect = 4.3e-11, Identities = 71/245 (28%), Positives = 129/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-----SMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + ++DI NI + E+   Y++Y+   + +L+++  +E+L+MA  LL  KSK +LP      MD +     +++ R + +Q+L+ Y++++ +   L EK   RS ++   T+  ED    L E Q+N  V  +++  ++ A Q+ + K+V        +++V  I   EIS+ D  KE+        +L        F ++ D   T+   VV F+A+L L++   IQ  Q    ++I I
  S:    42 FEGPLDLLLHLIDKSEVDIYNIPVKEITDQYLEYVQA-MQELELEVTSEFLVMAATLLSIKSKMLLPKPPEIEMDFDYYQEDEMDPRAELVQKLVEYRKFKAVADVLREKEVERSLVY---TREPEDLSPFLPEKQENP-VKGLEIGDLVLAFQRTFRKMVH-------RNSVAKIQRDEISVKDRMKEV------VGNLAVQGGTMMFSDLFDVHMTREDLVVTFLALLELMKIKRIQCFQYHLFDDIMI 274
>gi|160941667|ref|ZP_02088994.1| hypothetical protein CLOBOL_06563 [Clostridium bolteae ATCC BAA-613] >gi|158435164|gb|EDP12931.1| hypothetical protein CLOBOL_06563 [Clostridium bolteae ATCC BAA-613] (273 aa)
Score = 175, Expect = 5.1e-11, Identities = 68/241 (28%), Positives = 124/241 (51%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISID----DVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           + F GP +L   LI++ K++I +I +VE+   Y+DY+  ++ +  ++ ++E+L+MA  LL+ K+K +LP    EE    D  R + + RLL YK+Y+ +  +L ++ +   +   KP+       +L  E     Y P +DLD +L  +    L+ +  +  K  +D +  I  +  +I      +E++I   L       + SF +  +  PD    K   VV F+A+L L++ G I L Q  +
  S:    16 EHFEGPLDLLLHLIEKNKINIYDIPIVEITAQYLDYV-RHMEREDLNIVSEFLVMAATLLDIKAKMLLPKEVDEEGEEID-PRAELVMRLLEYKKYRLMADELADREDGALKHLYKPS-------TLPPEVA--KYEPPVDLDKLLDGLTLAKLQRIFEQVMKRKEDKIDPIRSNFGTIHREPVSLEQKIGNVLLYARRKRRFSFRELLEGQPD----KLEVVVTFLAVLELMKIGKIHLSQEET 245
>gi|169334031|ref|ZP_02861224.1| hypothetical protein ANASTE_00424 [Anaerofustis stercorihominis DSM 17244] >gi|169258748|gb|EDS72714.1| hypothetical protein ANASTE_00424 [Anaerofustis stercorihominis DSM 17244] (239 aa)
Score = 174, Expect = 6.1e-11, Identities = 74/248 (29%), Positives = 129/248 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKE-SLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKI 282
           F GP +L   LI + ++DI +I +VE+ + Y+DYI N L  L ++  +E+++MA+ LLE KSK +LP ++ +E   +   R+  + RL+ YK ++E+  +L E         EK   S   K+     E ++   V  +DL ++ KA++ +   L+  K   +     + I+    S+DD    I + LE      KISF   FK     +  K Y +  F+A L L++   ++L QN + ++I + +I
  S:    11 FEGPLDLLLHLISKNEIDIYDIPIVEITKQYLDYIYN-LNDLDMEVASEFVVMASTLLEIKSKMLLP-VEVDENEEEIDPREDLVARLIEYKAFKELTKELKES--------EKIYNSTVTKDPEYYSEIKEEYVVEDIDLTLLSKALRSI---LIKHKMRVNEFSENQTIETDTFSVDDSILTITKVLE---QKEKISFFSLFKG----EVKKGYVIATFLATLELLKMNMVKLIQNEAYDDILLERI 239
>gi|154483609|ref|ZP_02026057.1| hypothetical protein EUBVEN_01313 [Eubacterium ventriosum ATCC 27560] >gi|149735519|gb|EDM51405.1| hypothetical protein EUBVEN_01313 [Eubacterium ventriosum ATCC 27560] (247 aa)
Score = 174, Expect = 7.1e-11, Identities = 66/249 (26%), Positives = 132/249 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME-KLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           F GP +L   LI++ K+DI +I +VE+ + Y+DY++  + K  +D  +E+L+MA  L++ KSK +LP  + +E   +   R + +++L+ YK Y+    +L + ++     ++++PT   E  +          Y P +DLD +LK +    L  +     K   D +  +  +   I+  E  + E ++   +  K      FK + +E+ +K   +V+F+A+L L++ G I++ Q  + ++I+I  I+
  S:    10 FEGPLDLLLHLIEKNKVDIYDIPIVEITEQYLDYVSK-MPKDDLDLASEFLVMAATLIDIKSKMLLPK-EVDENGEEIDPRAELVEKLIEYKVYKYAAVELRDMQVYAGKSLYKEPTIPDEVAK----------YAPPVDLDNLLKDVDLEKLNEIFKMVLKRQMDKIDPVRSTFGKIEMEEVSLPEKIDYVANKVKKKKRCSFKQLLEEQSSKMEVIVSFLAVLELIKIGQIEVHQERTFDDIYIDSIE 247
>gi|191638363|ref|YP_001987529.1| Segregation and condensation protein A [Lactobacillus casei] >gi|190712665|emb|CAQ66671.1| Segregation and condensation protein A [Lactobacillus casei BL23] (243 aa)
Score = 173, Expect = 7.4e-11, Identities = 62/239 (25%), Positives = 112/239 (46%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNS 272
           +F+GP +L   LI+  ++DI +I + E+   Y+DY++  +  L +D   +Y +MA  L+  KS+ +LP  + E     +    R   + +LL Y+ YQE    L  +  +R++ + KPT   + K +          VP     V L  +Q    +++  K  ++ +  +  I+   +S   VEK I E L+      +  F D       E+      V  F+A+L L++N  +  EQ +
  S:    11 DFSGPLDLLLHLIRTNEVDIYDIPIAEITAQYLDYLHQ-MQDLALDVAGDYFVMAANLMVLKSRLLLPQPEPETMAPDEAPDPRADLVAQLLTYQVYQEAAKDLKAREAKRAQAYAKPTTLPDAKMA----------VPLAPGSVKLVDLQAAMARVM--KAQQATRQTIAHIETEPVS---VEKRIGEVLQTLQKGGQCLFADLLSVQSVEQ-----VVTTFLALLELMKNDQVICEQEA 230
>gi|72161608|ref|YP_289265.1| condensin subunit ScpA [Thermobifida fusca YX] >gi|71915340|gb|AAZ55242.1| condensin subunit ScpA [Thermobifida fusca YX] (274 aa)
Score = 172, Expect = 9.7e-11, Identities = 60/236 (25%), Positives = 109/236 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVA-FVAILVLVRNGHIQLEQ 270
           F GPF+L  +LI + K+DI  + L +V   ++ +I  Y     +D ++ +LL+A  LL+ K+ R+LP  + E++    +   RD    RLL Y+ Y+++     E+L  +SR + +          L   F D      +  DV+L    + +  L     T     +V +  + +      E+ +    E   H   ++F +  +   D      + +VA F+A+L L RN H+  +Q
  S:    18 FEGPFDLLLTLISKHKLDITEVALSKVTDEFIAHIKAYEDSWDLDMVSNFLLVAATLLDLKAARLLPRGEVEDEADLALLEARDLLFARLLQYRAYKQVAAVFAERLAAQSRRWARAV-------PLEPRFAD------LRPDVLLTLGPQEFAALAARVFTPREPPSVPVTHIHQPKTSVAEQAVLVVAELREH-GTLTFTELTRACTDT-----FEIVARFLALLELYRNAHVSFDQ 237
>gi|70726422|ref|YP_253336.1| hypothetical protein SH1421 [Staphylococcus haemolyticus JCSC1435] >gi|82581639|sp|Q4L6J5|SCPA_STAHJ Segregation and condensation protein A >gi|68447146|dbj|BAE04730.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (243 aa)
Score = 172, Expect = 9.8e-11, Identities = 76/247 (30%), Positives = 129/247 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQ-SGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFK-NIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL+MA+ LL  KSK +LP  D ++ + +D  R+  + RL+ Y+ Y+E    L EK E R   F K PT  S  +K     E Q       +DL  ++ A Q+V  +L   K    PK  V++I  S      +++   +      H    +F   F  + P E+      V  F+AIL + ++G I +EQ  S ++I I++
  S:     9 FNGPLDLLLHLIQKYEIDIYDIPMKSLTEQYMQYVHA-MKQLEINVASEYLVMASELLMIKSKLLLPQHDVDDNLEED-PREDLVGRLIEYQNYKEYTQLLTEKKEEREHYFTKHPTDLSHLEKNVTWDECQ------TLDLTDLIVAYQRVKSRLALNK----PK-TVEIIKESFT----IQQATEKVTTQLRHHTSFNFFSLFTFSEPIEQ-----VVTHFLAILEMSKSGVINIEQVRSFDDIRIIR 236
>gi|117928445|ref|YP_872996.1| condensin subunit ScpA [Acidothermus cellulolyticus 11B] >gi|117648908|gb|ABK53010.1| condensin subunit ScpA [Acidothermus cellulolyticus 11B] (275 aa)
Score = 172, Expect = 1.1e-10, Identities = 40/123 (32%), Positives = 70/123 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKE 157
           F+GPFEL  +LI + ++DI  I+L +V   ++ YI        +D  T +L++A  L++ K+ R+LPS  ++ EE ++    RD    RLL Y+ Y+++   L    + ++R +  P  +G D E
  S:    35 FDGPFELLLALIAKHELDITAISLSKVTDDFIAYIREMGPTWDLDKATSFLVVAATLVDLKAARLLPSAPVEDEEDVALLEARDLLFARLLQYRAYKQVAGILGAMCDEQARRY--PRTAGPDPE 157
>gi|148543986|ref|YP_001271356.1| condensin subunit ScpA [Lactobacillus reuteri F275] >gi|184153381|ref|YP_001841722.1| hypothetical protein LAR_0726 [Lactobacillus reuteri F275] >gi|148531020|gb|ABQ83019.1| condensin subunit ScpA [Lactobacillus reuteri F275] >gi|183224725|dbj|BAG25242.1| conserved hypothetical protein [Lactobacillus reuteri F275] (263 aa)
Score = 172, Expect = 1.2e-10, Identities = 64/257 (24%), Positives = 131/257 (50%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS---MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK--EVESNE 290
           +F G  +L   LIK+ +MDI +I + ++   Y+DY++  +   +++   EY +MA  L++ KS+ +LPS   +D E ++ +   R + +++LL Y++Y++   +L +K   R + + +P         + +E   +   P +     L  +Q+ +  ++  ++  +P   V+ +   ++SI      + E +   P    + F D FK++     T+   V  F+AIL L ++  I + Q    E I +V+  K  E E+N+
  S:    19 DFEGSLDLLLHLIKQSEMDIYDIQISQITSQYLDYLHQ-MQSHQLEVAGEYFVMAATLMDIKSQMLLPSPPVLDDEPEVEEIDPRQELVEQLLEYQRYKKAADRLKDKENLRQQEYTRPAM------QVPREMVKSHVEPGIK----LTDLQQAFAAVLRRQQLATPL--VETVAAEKVSIGQQMNHVIEIVHDGP----VRFEDLFKDL----HTRDGLVTTFLAILELAKHQAITINQGGLFEPIILVEGPKSDEYETNQ 259
>gi|34496777|ref|NP_900992.1| hypothetical protein CV_1322 [Chromobacterium violaceum ATCC 12472] >gi|34102632|gb|AAQ58997.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] (319 aa)
Score = 171, Expect = 1.5e-10, Identities = 62/247 (25%), Positives = 124/247 (50%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-----PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           + F GP +L   LI+++ +D+LNI + E+   Y+ YI+  +   +++   EYLLMA  L+E KS+ +LP    +E    D  R + ++RLL Y+Q +    +L +K+ +  R F           ++L E      +P    DV    +++ ++ +++  K +        ++  E+S+ +    I  +L+     PF  L+ +      K +        + VV F+A+L LV+ G +++ Q++  + I++
  S:    93 ESFEGPLDLLLYLIRKQNLDVLNIPMAEITAQYMSYIDA-MKHGRLELAAEYLLMAALLIEIKSRLLLPRPQLDEDGEPDDPRAELVRRLLEYEQMKLAALEL-DKIPQADRDFA--------WLAVLIEQSAEQRLP----DVGAADLRQAWMAILSRAKHRRHHK----VEKDELSVREQMSWILRYLDGKEYVPFEELFDVD-----KGVA-------HLVVNFIAVLELVKEGMVKVSQDAPYQPIYV 314
>gi|52080836|ref|YP_079627.1| segregation and condensation protein A [Bacillus licheniformis ATCC 14580] >gi|52786207|ref|YP_092036.1| segregation and condensation protein A [Bacillus licheniformis ATCC 14580] >gi|81385178|sp|Q65HX1|SCPA_BACLD Segregation and condensation protein A >gi|52004047|gb|AAU23989.1| Segregation and condensation protein A ScpA [Bacillus licheniformis ATCC 14580] >gi|52348709|gb|AAU41343.1| YpuG [Bacillus licheniformis DSM 13] (251 aa)
Score = 171, Expect = 1.6e-10, Identities = 72/245 (29%), Positives = 128/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI   ++DI +I + ++ + Y+ Y++  + +L++D  +EYL+MA  LL  KS+ +LP       D E    ++  R++ I++L+ Y++Y+     L E+ E R + F KP        S L ++     +    L V +  M   + K++  KK   P +    I   EI I++   +I + L+      ++ FM+ F   P E+  K + VV F+AIL L++N  I +EQ  +  +I+I
  S:    10 FEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHT-MRELELDVASEYLVMAATLLSIKSRMLLPKQEEELFDEEFLEEEEDPREELIEKLIEYRKYKSAAQNLKEREEERQKAFAKPP-------SDLSDYAKEIKLSEQKLSVTVYDMLGAFQKVLNRKKINRPSET--RISRQEIPIEERMTQIVDCLK--SSRKRMHFMELF---PYEQ--KEHLVVTFLAILELMKNQLIIIEQEHNFSDIYI 242
>gi|13508039|ref|NP_109988.1| fused segregation and condensation protein A/unknown domain-containing protein [Mycoplasma pneumoniae M129] >gi|2496330|sp|P75478|SCPA_MYCPN Segregation and condensation protein A >gi|1674232|gb|AAB96184.1| dihydrofolate reductase [Mycoplasma pneumoniae M129] (506 aa)
Score = 171, Expect = 1.6e-10, Identities = 65/251 (25%), Positives = 127/251 (50%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDT--EEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK--------PTQSGEDKESLLKEFQDNSYVPAMDL-DVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           +++NG       L+ ++K ++  +++ ++   Y+  IN  L K  I+ +T+YL++ + ++EQK+  +L   D   +     +  RDK + +L+ YK+Y+E +    +    R   F K         T    + E +  E +  +YV  + L   + K MQ+   + +  K           I + E+SI+ V+ EI   ++ F + + +S       + +   +  YF+ AFVA+LVL+ N  I +EQ S D+ ++I  +D
  S:   166 EDYNGTLPNLLELLIDKKFNLHQVDIAKITTQYLHLINTNLNKQAIEPITDYLVITSRIVEQKANNLLQINDIALDSDFLDNKLRDKLVAQLVEYKRYRESLDDFEKLRINRLAYFSKDNDFNRFIQTVDKSNTEPVKIEDELPNYVSVLKLHHAMNKLMQRWRAQFLANKN----------ISIQELSIEQVQAEILATIKQFGY-HSVSLKRVLLKV-NHHISLMYFITAFVALLVLINNQIIDIEQTSFDDELYICLLD 415
>gi|90961917|ref|YP_535833.1| segregation and condensation protein ScpA [Lactobacillus salivarius UCC118] >gi|122448958|sp|Q1WTK0|SCPA_LACS1 Segregation and condensation protein A >gi|90821111|gb|ABD99750.1| Segregation and condensation protein ScpA [Lactobacillus salivarius UCC118] (261 aa)
Score = 170, Expect = 2.0e-10, Identities = 69/246 (28%), Positives = 122/246 (49%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           +F GP +L   LIK+ +MDI +I + E+   Y+DY++  +  L++D   EYL++A  LL  KSK +LP ++ E+++ +D    R+  +Q+L+ ++ YQE+  K     ++R  +F +     ED    + E               +  +QK + KL+  KK K  K   + I     +I +  + I   L+   H   ++F D F    D +      V +F+A+L LVR G +   Q  ++  I +
  S:    21 QFEGPLDLLLHLIKQNEMDIYDIQVAEITSQYIDYLHQ-MQDLRLDIAGEYLVIAATLLNIKSKMLLP-VEQEQQVEEDYVDPREDLVQQLVSHQLYQEVAAKFHVMEKQRMELFSREQAVNEDVTYEVSE------------GTTIDLLQKAFAKLMARKKVKKIKKIKRKIIPERYTIKEEIENIEHTLK--MHKGTMNFTDLFDF--DGEVEVEKVVTSFLALLELVRVGRVSASQEENNGPILM 250
>gi|194467808|ref|ZP_03073794.1| chromosome segregation and condensation protein ScpA [Lactobacillus reuteri 100-23] >gi|194452661|gb|EDX41559.1| chromosome segregation and condensation protein ScpA [Lactobacillus reuteri 100-23] (263 aa)
Score = 170, Expect = 2.1e-10, Identities = 62/257 (24%), Positives = 131/257 (50%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS---MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK--EVESNE 290
           +F GP +L   LIK+ +MDI +I + ++   Y+DY++  +   +++   EY +MA  L++ KS+ +LPS   +D E ++ +   R + +++LL Y++Y++   +L +K   R + + +P         + +E   +   P ++    L  +Q+ +  ++   +  +P   V+ +   ++S+      + E +   P    + F D F+++     T+   V  F+AIL L ++  I + Q    E I + +  K  E E+N+
  S:    19 DFEGPLDLLLHLIKQSEMDIYDIQISQITSQYLDYLHQ-MQSHQLEVAGEYFVMAATLMDIKSQMLLPSPPVLDDELEVEEIDPRQELVEQLLEYQRYKKAAARLKDKENLRQQEYTRPAM------QVPREMVKSHVEPGIE----LTDLQEAFAAVLRRHQLATPL--VETVAAEKVSVGQQMNHVIEIVHDGP----VRFEDLFEDL----HTRDGLVTTFLAILELAKHQVITINQGGLFEPIILAEGPKSDEYETNQ 259
>gi|153814790|ref|ZP_01967458.1| hypothetical protein RUMTOR_01005 [Ruminococcus torques ATCC 27756] >gi|145847821|gb|EDK24739.1| hypothetical protein RUMTOR_01005 [Ruminococcus torques ATCC 27756] (252 aa)
Score = 169, Expect = 2.4e-10, Identities = 70/250 (28%), Positives = 134/250 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEK-LERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDY---FKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F GP +L   LI + K+DI +I +VE+   Y++YI N + K  ++ ++E+L+MA  LL+ K + +LP  +TEE   +D  R+  +++LL YK Y+ +  +L ++  +    +++ PT   E KE          Y   +DLD +L  +    LK +     +  K  V  ID        +EKE     + F ++++     +   F+ + +++ +K + VV F+A+L +++ G I++EQ  +   I I ++++
  S:    10 FEGPLDLLLHLIDKNKIDIYDIPIVEITNQYMEYIRN-MQKEDLNIMSEFLVMAATLLDIKCRMLLPKEETEEGEEEDPRRE-LVEQLLQYKMYKYMAYELKDRQTDADMILYKDPTIPEEVKE----------YAEPVDLDELLGDLT---LKKLNEIFKEVMKRQVDKIDPVRSKFGKIEKEEVTVSDKFIYIHEYMHTHHKFSFRQLLEKQKSKMHIVVTFLAVLEMMKLGEIRVEQEETCGEIMIERVEE 248
>gi|118442854|ref|YP_878105.1| segregation and condensation protein A [Clostridium novyi NT] >gi|118133310|gb|ABK60354.1| segregation and condensation protein A [Clostridium novyi NT] (250 aa)
Score = 168, Expect = 3.1e-10, Identities = 62/195 (31%), Positives = 109/195 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE--RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV--KLIDVSEISIDDVEKEIREFLE 223
           +I  + F GPF+L   LIK+ +MDI +I + E+   Y++YINN + +L ++  +E++++A  LLE KSK +LP    EE   +D E  R + I +LL YK+++++   LM++      M+ K       K  ++++   +  V  +  D+ +  +  +Y  L+ T K K   +NV  K I + +  I+D   EI E L+
  S:     4 NIKIENFEGPFDLLLHLIKKNEMDIYDIKIYEITTQYLNYINN-MKELDLEVTSEFIVIAATLLEIKSKMLLPKQVVEEN-EEDTEDPRQELINKLLEYKKFKQVADYLMKREATVGFMYSK-------KPEIIEDIHKDDNVDILK-DITILKLFNIYNDLINTYKNKMNTENVIPKEIALDKFKIEDKMVEISEILK 192
>gi|182439520|ref|YP_001827239.1| hypothetical protein SGR_5727 [Streptomyces griseus subsp. griseus NBRC 13350] >gi|178468036|dbj|BAG22556.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] (263 aa)
Score = 167, Expect = 4.4e-10, Identities = 61/245 (24%), Positives = 114/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GPF+L   LI + K+D+  + L +V   ++ YI        +D  TE+L++A  LL+ K+ R+LP+ + E++    +   RD    RLL Y+ Y+ I      +LE  +R + + T   ED+ + L        +P + + +  +   ++ +K +  K    P+  V  I    +S+ +    + E L        +SF     + PD        V  F+A+L L R   + L+Q+ +  ++ +
  S:     3 FEGPFDLLLQLISKHKLDVTEVALSKVTDEFMAYIRAMGPDGDLDQTTEFLVVAATLLDLKAARLLPAAEVEDEADLALLEARDLLFARLLQYRAYKRIADIFQGRLESEARRYPR-TVGLEDQHAAL--------LPEVVISIGPEGFARLAVKAMQPK--AEPQVYVDHIHAPLVSVREQAGLVVERLRAAGA--AVSFTVLTGDAPD----TLTVVARFLALLELYREKAVTLDQDEALGDLLV 232
>gi|167759040|ref|ZP_02431167.1| hypothetical protein CLOSCI_01387 [Clostridium scindens ATCC 35704] >gi|167663447|gb|EDS07577.1| hypothetical protein CLOSCI_01387 [Clostridium scindens ATCC 35704] (249 aa)
Score = 167, Expect = 4.5e-10, Identities = 68/246 (27%), Positives = 120/246 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEK-LERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV 280
           F GP +L   LI + K+DI +I +VE+   Y+DYI   + K  ++ ++E+L+MA  LL+ K + +LP    EE   +D  R + +++LL YK Y+ +  +L ++ +E    M++ PT   E             YV  +DLD +L  +    L  +     K   D +  +      I+  E  + + L+      K      F+ +  ++ +K   VV F+AIL L++ G I + Q    ++I I+
  S:    10 FEGPLDLLLHLIDKNKIDIYDIPIVEITSQYMDYIKA-MDKEDLNIMSEFLVMAATLLDIKCRMLLPKEVNEEGEEED-PRQELVEQLLEYKMYKYMSYELRDRQVEGEQVMYKAPTIPQEVL----------GYVEPVDLDALLGDLTLSKLNRIFKDVMKKQVDKIDPVRSKFGKIEKEEVTLPDKLDYVTEYAKSHGRFSFRELLKKQSSKTQIVVTFLAILQLMKEGVIMIRQEQPFDDIMIL 244
>gi|89895034|ref|YP_518521.1| hypothetical protein DSY2288 [Desulfitobacterium hafniense Y51] >gi|109645369|ref|ZP_01369289.1| chromosome segregation and condensation protein ScpA [Desulfitobacterium hafniense DCB-2] >gi|89334482|dbj|BAE84077.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109643318|gb|EAT52871.1| chromosome segregation and condensation protein ScpA [Desulfitobacterium hafniense DCB-2] (261 aa)
Score = 166, Expect = 5.9e-10, Identities = 58/256 (22%), Positives = 126/256 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLME-KLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRY-FVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           F GP +L   LI++ K+DI +I +  +   ++  +   +  L ++  TE+L++A  LL+ KS+ +LP    +  + ++ + R + ++RLL Y+ +++    L E ++    R F +      D + L  +F     +  +  + +  A Q++        +     + ++ ++  EI I+ +  ++   +   P   + S +         + TKR   +V+F+A+L L+++G +  EQ+S +E IF+   +K  E  E
  S:    22 FQGPMDLLLHLIQQEKVDIYDIPIARITDQFIQVVRQ-MEDLDMEVTTEFLVLAAQLLQIKSRYLLPKPVKDVTVEEEGDPRQELVERLLAYRAFKQAAETLGEIQISSGQRYFREV-----DVDGLRSQFTPADPLAGIHFEALWHAFQRII-------ERAEQGEEIRTVEPDEIPIEVMVNDVLRRVILHPRGLRFSQLI--------RGTKRMEIIVSFLALLELLKSGKVHCEQSSQNEEIFVFPTEKAWEFTE 259
>gi|166030460|ref|ZP_02233289.1| hypothetical protein DORFOR_00121 [Dorea formicigenerans ATCC 27755] >gi|166029818|gb|EDR48575.1| hypothetical protein DORFOR_00121 [Dorea formicigenerans ATCC 27755] (247 aa)
Score = 165, Expect = 6.7e-10, Identities = 67/245 (27%), Positives = 125/245 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEK-LERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + K+DI +I +VE+   Y+DYI   + +  ++ ++E+L+MA  LL+ K K +LP   TE+   +D  R + +++LL YK Y+ +  +L ++ L+    M++ PT        + +E  D  YV  +DLD +L  +    L  V     +  +D +  +      ++  E  + E LE      +      F+ +   + +K   VV F+A+L L++ G + ++Q  + ++I I
  S:    10 FEGPLDLLLHLIDKNKIDIYDIPIVEITNQYMDYIKA-MEREDLNVMSEFLVMAATLLDIKCKMLLPKEVTEDGEEED-PRQELVEQLLQYKMYKYMSYELRDRELDGGRTMYKDPT--------IPEEVMD--YVEPVDLDELLGDLTLATLNRVFQDVIRRQEDKIDPVRSKFGKLEKEEVTVEEKLETVTDYAREHKHFSFRTLLGSQKSKMQTVVTFLAVLQLIKEGILIVQQEHAFDDIMI 243
>gi|15674516|ref|NP_268690.1| segregation and condensation protein A [Streptococcus pyogenes M1 GAS] >gi|71910122|ref|YP_281672.1| segregation and condensation protein A [Streptococcus pyogenes MGAS5005] >gi|41018124|sp|Q9A1B2|SCPA_STRP1 Segregation and condensation protein A >gi|13621619|gb|AAK33411.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] >gi|71852904|gb|AAZ50927.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS5005] (233 aa)
Score = 165, Expect = 7.7e-10, Identities = 53/189 (28%), Positives = 106/189 (56%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKE 217
           DI  K+F GP +L   L+ + K+DI  + +VEVI+ Y++YI   L  +K++   +Y+LMA+ L+  KS+R+LP +   E I +D+E+D  ++++  Y +++ +   L ++ ++R++ + KP Q    ++++L+E +       MDL +    +      ++    T   +D+ K+ D+       +EKE
  S:     2 DIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIET-LQVMKLEVAGDYMLMASQLMLIKSRRLLPKV--VEHIEEDLEQD-LLEKIEEYSRFKAVSQALAKQHDQRAKWYSKPKQELIFEDAILQEDKT-----VMDLFLAFSNIMAAKRAVLKNNHTVIERDDYKIEDMMASIKQRLEKE 181
>gi|160915007|ref|ZP_02077220.1| hypothetical protein EUBDOL_01014 [Eubacterium dolichum DSM 3991] >gi|158432806|gb|EDP11095.1| hypothetical protein EUBDOL_01014 [Eubacterium dolichum DSM 3991] (288 aa)
Score = 165, Expect = 7.8e-10, Identities = 67/256 (26%), Positives = 137/256 (53%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ---SGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKE 285
           +T  +F GP +L   LIK+ K+D+ ++++  +   Y+ Y+N  +  L ++  +EYL     LLE KSK++LP   +   E+  +D +R++ ++RLL Y++++EI     E  ++R+   EKP         + ++  E + + Y        + KAM KV  ++  T   ++       + V E+S+D+   +I++ L  +  + K+SF++    + D+       +V F+++L L+++  I    +  +E I+I+K  +E
  S:    48 VTIDQFEGPLDLMLHLIKDNKLDLFDLDMNILTDQYLQYLNA-MESLHLEVASEYLSELAGLLEYKSKKLLPREKVVITEEFEED-QRERLVKRLLEYQRFKEISAAFDEAQKKRALCLEKPISEITQAWRQTTIETELKGSPY-------DLFKAMHKVLRRVALTHPYETK------MTVKELSLDERVLQIKQRLNHW--VGKMSFVE----LCDDCIDLHMVIVTFLSLLDLIKHREITYHID-EEEMIWIIKGSEE 286
>gi|153855281|ref|ZP_01996447.1| hypothetical protein DORLON_02461 [Dorea longicatena DSM 13814] >gi|149752280|gb|EDM62211.1| hypothetical protein DORLON_02461 [Dorea longicatena DSM 13814] (250 aa)
Score = 164, Expect = 9.4e-10, Identities = 70/252 (27%), Positives = 127/252 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEK-LERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEV 286
           F GP +L   LI++ K+DI +I +VE+   Y++YI   + K  ++ ++E+L+MA  LL+ K + +LP    EE   +D  R + +++LL YK Y+ +  +L ++ L+    M++  T   E K           YVP ++LD +L  +  V L  +  +  K  +  V  +      I+  E  + + L+      +      F+ +  ++ +K   VV F+AIL L++ G I +EQ+   + I I    +EV
  S:    10 FEGPLDLLLHLIEKNKIDIYDIPIVEITNQYMEYIKA-MQKEDLNIMSEFLVMAATLLDIKCRMLLPKEVNEEGEEED-PRQELVEQLLEYKMYKFMSYELKDRELDGDRVMYKSATIPDEVK----------GYVPPVNLDELLGDLTLVQLNRIFKEVMKRQESKVDPVRSKFGKIEKEEVTLPDKLDYVTEYARSHRKFGFRALLKKQSSKVQVVVTFLAILQLMKEGVIFIEQDQPFDEIMITSKVEEV 250
>gi|56808582|ref|ZP_00366313.1| COG1354: Uncharacterized conserved protein [Streptococcus pyogenes M49 591] >gi|71902963|ref|YP_279766.1| segregation and condensation protein A [Streptococcus pyogenes MGAS6180] >gi|94987938|ref|YP_596039.1| segregation and condensation protein A [Streptococcus pyogenes MGAS9429] >gi|94991822|ref|YP_599921.1| segregation and condensation protein A [Streptococcus pyogenes MGAS2096] >gi|123640453|sp|Q48V45|SCPA_STRPM Segregation and condensation protein A >gi|167016574|sp|Q1JDD1|SCPA_STRPB Segregation and condensation protein A >gi|167016575|sp|Q1JNA4|SCPA_STRPC Segregation and condensation protein A >gi|71802058|gb|AAX71411.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS6180] >gi|94541446|gb|ABF31495.1| segregation and condensation protein [Streptococcus pyogenes MGAS9429] >gi|94545330|gb|ABF35377.1| Segregation and condensation protein ScpA [Streptococcus pyogenes MGAS2096] (234 aa)
Score = 164, Expect = 1.0e-09, Identities = 53/189 (28%), Positives = 106/189 (56%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKE 217
           DI  K+F GP +L   L+ + K+DI  + +VEVI+ Y++YI   L  +K++   +Y+LMA+ L+  KS+R+LP +  E    +D+E+D  ++++  Y +++ +   L ++ ++R++ + KP Q    ++++L+E +       MDL +    +      ++ T  T   +D+ K+ D+       +EKE
  S:     2 DIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIET-LQVMKLEVAGDYMLMASQLMLIKSRRLLPKV-VEHIEEEDLEQD-LLEKIEEYSRFKAVSQALAKQHDQRAKWYSKPKQELIFEDAILQEDKT-----VMDLFLAFSNIMAAKRAVLKTNHTVIERDDYKIEDMMASIKQRLEKE 182
>gi|15614123|ref|NP_242426.1| segregation and condensation protein A [Bacillus halodurans C-125] >gi|41018145|sp|Q9KCL1|SCPA_BACHD Segregation and condensation protein A >gi|10174177|dbj|BAB05279.1| BH1560 [Bacillus halodurans C-125] (260 aa)
Score = 164, Expect = 1.0e-09, Identities = 71/247 (28%), Positives = 130/247 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           F GP +L   LI + ++DI +I +  + + Y+ YI+  + +L++D  +EYL+MA  LL+ KSK +LP      D   +  ++  R++ + RL+ Y++Y+E   +L EK   RS++  +   + +D   L +E +    +  + L  +L A QK+       K+    +     + V E SID+   +I   LE      K +    F+++  EK  + + VV F+A+L L++   I  EQN +  +I+I +
  S:    11 FEGPLDLLLHLINQAEVDIYDIPVALITEQYMAYIHT-MQELQLDVASEYLVMAATLLQIKSKMLLPKQEEIFDETFEYEEEDPREELMFRLIEYRRYKEAAQELKEKEGERSQVHTRLPDNLDD--YLTEEERQRQSIQGVTLFDMLAAYQKLL------KRRAYSRPRTSTVKVEEYSIDERMTDILMDLE------KCNGKCRFQDLFVEK-GRGHMVVTFLAMLELMKTDAIYCEQNENFADIWIYR 245
>gi|25028111|ref|NP_738165.1| hypothetical protein CE1555 [Corynebacterium efficiens YS-314] >gi|23493395|dbj|BAC18365.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] (274 aa)
Score = 163, Expect = 1.2e-09, Identities = 37/110 (33%), Positives = 63/110 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GPF+L   LI  +K+D+  + L EV   ++ Y         +D++TE+L++A  LL+ K+ R+LP   +  EE ++    RD    RLL Y+ Y++ V +L  + +R +R
  S:    25 FEGPFDLLLQLITRKKLDVTEVALSEVTDEFIAYTRTLDQGRDLDEVTEFLVVAATLLDLKTARLLPRGQVTDEEDLALLEVRDLLFARLLQYRAYKQ-VAELFARWQREAR 135
>gi|148264299|ref|YP_001231005.1| chromosome segregation and condensation protein ScpA [Geobacter uraniireducens Rf4] >gi|146397799|gb|ABQ26432.1| condensin subunit ScpA [Geobacter uraniireducens Rf4] (273 aa)
Score = 163, Expect = 1.2e-09, Identities = 71/258 (27%), Positives = 127/258 (49%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-----PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVE 287
           ++ +EF GP +L   LIK+ ++DI NI +  + + Y+DYI + +  L +D   E+L+MA  L++ KSK +LP    +  E+  ++  R + ++RLL Y++Y+E    L ++      +F +   S +      +E  D + V   +L   ++A Q+V  K+          +N   +    +SI D   E+   LE     PF  L+              + T+   VV F+AIL L +   I++ Q  S   I+I+ +  E +
  S:    20 VSIEEFEGPLDLLLHLIKKNEVDIYNIPIAAITRQYLDYI-DLMKDLNLDIAGEFLVMAATLIQIKSKMLLPPSVEEEAEEEEEEDPRAELVRRLLEYQKYKEAAVMLGQRELLGRDIFARKFPSADLATCEAEE--DPTEVELFEL---IEAFQRVLAKVSV--------ENFHEVGADGVSIADKIAEVLSLLEGKEAVPFESLFL------------SEVTRDGLVVTFLAILELCKLKMIRISQARSLGTIWIMPVAVEAD 258
>gi|69248062|ref|ZP_00604607.1| Protein of unknown function DUF173 [Enterococcus faecium DO] >gi|68194581|gb|EAN09072.1| Protein of unknown function DUF173 [Enterococcus faecium DO] (265 aa)
Score = 163, Expect = 1.3e-09, Identities = 73/256 (28%), Positives = 134/256 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD---TEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE---DKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           F GP +L   LI++ ++DI +I +  + + Y++YI+   T L++    EYL+MA  L+  KSK +LP  +    +E++ ++  R++ + +LL Y++Y+    +L EK E RS  + K   + +   D E  LK  Q    V  +DL   ++AMQK+  +   ++K +      K I   + +I++    I E ++   H    +F  +F     E  +K   V  F+A+L L++ G I  +Q  + E+I +     + E +E
  S:    23 FEGPLDLLLHLIQQMEIDIYDIPIATITEQYMNYIHTMKT-LELAVAGEYLVMAATLMAIKSKTLLPVQEFVTDDEELWEEDPREELVTQLLEYRKYKYAAERLTEKAEERSLYYTKEPMNIDGLADAEKPLKRGQ----VKKIDL---IRAMQKILERKKFSQKVE------KTITPDDTTIEERMVFIEERIKRNAH--GCTFDSFF-----ESPSKSEVVTTFMALLELMKKGQIIAQQKENYESIMLYPAVGDTEHDE 263
>gi|121635176|ref|YP_975421.1| hypothetical protein NMC1433 [Neisseria meningitidis FAM18] >gi|120866882|emb|CAM10641.1| hypothetical protein [Neisseria meningitidis FAM18] (284 aa)
Score = 163, Expect = 1.3e-09, Identities = 39/112 (34%), Positives = 66/112 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++ +D+L+I +V++ + Y+ YI   +   + D   EYLLMA  L+E KS+ +LP  +T E    D  R + ++RLL Y+Q  ++  + ++ L R  R F
  S:    44 FQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQ-IEAYQFDLAAEYLLMAAMLIEIKSRLLLPRTETVEDEEAD-PRAELVRRLLAYEQ-MKLAAQGLDALPRAGRDF 152
>gi|126650123|ref|ZP_01722356.1| segregation and condensation protein A [Bacillus sp. B14905] >gi|126593295|gb|EAZ87257.1| segregation and condensation protein A [Bacillus sp. B14905] (259 aa)
Score = 163, Expect = 1.3e-09, Identities = 41/115 (35%), Positives = 72/115 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           F+GP +L   LI   ++DI +I + E+ Q Y+D+I+  +  L++++ +EYL+MA  LL  KS+ +LP       D E ++     R++ +QRL+ YK+Y+E    L E    R+++F +P
  S:    10 FSGPLDLLLHLIHRLEIDIYDIPMAEITQQYIDHIHA-MQVLELNEASEYLVMAATLLAIKSRMLLPIHEGEMEDAELEVDGPDPREELVQRLIEYKKYKEAASNLQELETDRAQVFTRP 128
>gi|167629954|ref|YP_001680453.1| segregation and condensation protein a [Heliobacterium modesticaldum Ice1] >gi|167592694|gb|ABZ84442.1| segregation and condensation protein a [Heliobacterium modesticaldum Ice1] (247 aa)
Score = 163, Expect = 1.4e-09, Identities = 58/246 (23%), Positives = 123/246 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV 280
           F GPF+L   LI++ +++I +I + ++   Y+ Y+   L +L ++  + +LLMA  LL  K++ +LP     E  ++  E    R + + RL+ Y++Y+ +   L E+   R+R F +      D  +L   F + + +  + +  +L A++K   +       ++ ++ V  I   E+S+    +E+   +   P    I+F   F      ++     +V F+A+L LVR   +++ Q  + + I+++
  S:    10 FEGPFDLLVHLIEKNQVNIYDIPIAQIAAEYLAYLQQ-LDELDLERASAFLLMAAQLLAIKARMLLPKPPKAEAETEGDEGEDPRRELVDRLIEYRRYKAVAELLKEREVDRNRRFSRVV----DPTTLAHLFVEENPLEGVMIGDLLAALRKALSR-------RAKEEPVAAIPREEVSVQARMQELLTSMAQLPPHAPIAFSTLFAG----RWRPAEIIVTFLAMLELVRLKKVRVLQREAFDEIYLL 243
>gi|15677357|ref|NP_274512.1| segregation and condensation protein A [Neisseria meningitidis MC58] >gi|7226747|gb|AAF41860.1| segregation and condensation protein A [Neisseria meningitidis MC58] (284 aa)
Score = 162, Expect = 1.5e-09, Identities = 40/112 (35%), Positives = 66/112 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++ +D+L+I +V++ + Y+ YI    T  + D   EYLLMA  L+E KS+ +LP  +T E    D  R + ++RLL Y+Q  ++  + ++ L R  R F
  S:    44 FQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIET-YQFDLAAEYLLMAAMLIEIKSRLLLPRTETVEDEEAD-PRAELVRRLLAYEQ-MKLAAQGLDALPRAGRDF 152
>gi|116670093|ref|YP_831026.1| condensin subunit ScpA [Arthrobacter sp. FB24] >gi|116610202|gb|ABK02926.1| condensin subunit ScpA [Arthrobacter sp. FB24] (296 aa)
Score = 162, Expect = 1.5e-09, Identities = 42/129 (32%), Positives = 72/129 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKL----KIDDLTEYLLMATYLLEQKSKRILPSMDTE--EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEF 163
           F GPF+L   LI + ++DI  + L  V   ++ YI N L +L     +D+ +E+L++A  LL+ K+ R+LP+ + E  E ++    RD    RLL YK ++++   +   LE  +R + +     E   +LL E 
  S:    41 FTGPFDLLLGLISKHQLDITEVALATVTDEFIKYIRN-LQQLGEEWALDEASEFLVIAATLLDLKAARLLPAGEVEDDEDVALLEARDLLFARLLQYKAFKQVAGLINSTLEIEARSYPRQVALEEHFAALLPEL 174
>gi|188586269|ref|YP_001917814.1| chromosome segregation and condensation protein ScpA [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350956|gb|ACB85226.1| chromosome segregation and condensation protein ScpA [Natranaerobius thermophilus JW/NM-WN-LF] (240 aa)
Score = 162, Expect = 1.7e-09, Identities = 61/245 (24%), Positives = 128/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE--RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDV--ILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L Y L+K+ ++DI +I++ E+   Y+ Y+  +  +  ++  +E+L+MA  L+E KS+ +LP    +E   ++    +++ + +++ Y+ ++EI   L EK + R +++         +E     FQ+   +P  ++ +  +LKA Q V        K ++  + V+ ID +E+SI + +K++   L        + F + F+  P    T+   +  F+A+L LV+ G + + Q      ++I
  S:    10 FEGPLDLLYHLVKKAEVDIYDISISEITDQYLSYLEEW-ERFNLEIASEFLVMAARLMELKSRELLPKQTNKETEDEEETDPKEELLTKIMEYRYFKEIAYHLKEKEQERFQVYW--------REQPKIPFQEQEEIPIGNVGMHDLLKAFQNVL-------KKQALDNKVETIDTNEVSISE-QKDVLMKLLKNREKQTMHFQELFEQFP----TRLEIIATFIALLDLVKEGKLSVSQQGIKSPLWI 237
>gi|189345653|ref|YP_001942182.1| chromosome segregation and condensation protein ScpA [Chlorobium limicola DSM 245] >gi|189339800|gb|ACD89203.1| chromosome segregation and condensation protein ScpA [Chlorobium limicola DSM 245] (241 aa)
Score = 161, Expect = 1.9e-09, Identities = 62/237 (26%), Positives = 113/237 (47%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKT---KSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHI 266
           IT +EF GP +L    I+  ++DI NI +  +   ++ YIN  +    ++   E++ MA+ L+  K+K +LP    E   + + + R + +Q+LL Y+Q +E   KL E  + R+R+F K             E  D   V  +D ++     +     L+T  ++     PK  ++ +  + ++   VE++    L       ++SF    + + +       FVV F+A+L L RNG I
  S:     4 ITLEEFEGPLDLLLFFIRRDELDIYNIPISRITADFIVYING-MRATNLEVAAEFIYMASMLMSIKAKMLLPRPSAEIGDTDEFDPRTELVQKLLEYRQMKECAGKLGELADERARLFSKG----------FAESFDPLVVDQLDEEI----HRPTLYHLITAYRSVLENIPKPMIRNVKDAPVT---VEEQSALILSKLRERVQVSFRSVMEGVCESII----FVVTFLAVLELCRNGKI 222
>gi|154502524|ref|ZP_02039584.1| hypothetical protein RUMGNA_00337 [Ruminococcus gnavus ATCC 29149] >gi|153796920|gb|EDN79340.1| hypothetical protein RUMGNA_00337 [Ruminococcus gnavus ATCC 29149] (253 aa)
Score = 161, Expect = 1.9e-09, Identities = 62/236 (26%), Positives = 124/236 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           F GP +L   LI++ K+DI +I +VE+   Y++YI   + +  ++ ++E+L+MA  LL+ K + +LP    EE   +D  R + +++LL YK Y+ +  +L ++     + F +          + KE +  SYVPA+DLD +L  +  V L+ +  +  +  ++ +  +      I+  E  + + L       +      F+ + +++ +K + VV F+A+L L++ G I++ Q
  S:    16 FEGPLDLLLHLIEKNKIDIYDIPIVEITSQYMEYIRQ-MEREDLNVMSEFLVMAATLLDIKCRMLLPKEINEEGEEED-PRAELVEQLLQYKMYKYMSYELRDRQVDADQYFYREV-------DIPKEVK--SYVPAVDLDQLLGDVTLVQLRKIFREVMRRQEEKIDPVRSKFGKIEKEEVPLPDKLLYVETYARTHKKFSFRMLLEKQRSKMHIVVTFLAVLELMKTGMIRVYQ 240
>gi|59801350|ref|YP_208062.1| hypothetical protein NGO0961 [Neisseria gonorrhoeae FA 1090] >gi|59718245|gb|AAW89650.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] (284 aa)
Score = 161, Expect = 2.0e-09, Identities = 39/112 (34%), Positives = 64/112 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++ +D+L+I +VE+   Y+ YI   +   + D   EYLLMA  L+E KS+ +LP  +  E    D  R + ++RLL Y+Q  ++  + ++ L R  R F
  S:    44 FQGPLDLLLYLIRKQNIDVLDIPMVEITGQYLHYIAQ-MEAYQFDLAAEYLLMAAMLIEIKSRLLLPRTEAVEDEEAD-PRAELVRRLLAYEQ-MKLAAQGLDALPRAGRDF 152
>gi|182415655|ref|YP_001820721.1| chromosome segregation and condensation protein ScpA [Opitutus terrae PB90-1] >gi|177842869|gb|ACB77121.1| chromosome segregation and condensation protein ScpA [Opitutus terrae PB90-1] (287 aa)
Score = 161, Expect = 2.2e-09, Identities = 64/252 (25%), Positives = 120/252 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKV-----YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEV 286
           F GP +L   LI++ ++DI +I +  V + YVD ++  + +L +D   E+ +MA  L+E KS+ +LP   +    + D E    R   + +LL YK+++E   KL E    R  + E+                   YV +M +D   + ++ V     +       +  + K  V  I   ++++ D  +EI E  +      + +F+  F  +   K T R  V  F+A+L L R   ++L+Q+ +  +I    ++ E+
  S:    41 FEGPLDLLLFLIRKNELDIYDIPIESVTRQYVDALHA-MQQLDLDVAGEFFVMAATLMEIKSRMLLPKGQSAVDPNADEEEIDPRWDLVHQLLQYKKFKEAAAKLNELAALRQDLMER-------------------YVSSMSMDGAARPLKTVDRIELWNAFNIVLRRLAEKLVVGEIHDEQVTVADKMEEILELTQT-----RKTFV--FSELLTGKVTLRLLVATFLAVLELTRLKRLRLQQDEAFADIVCSAVEAEM 274
>gi|15794598|ref|NP_284420.1| hypothetical protein NMA1705 [Neisseria meningitidis Z2491] >gi|121052495|emb|CAM08834.1| hypothetical protein [Neisseria meningitidis Z2491] (284 aa)
Score = 161, Expect = 2.2e-09, Identities = 40/112 (35%), Positives = 66/112 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++ +D+L+I +V++ + Y+ YI    T  + D   EYLLMA  L+E KS+ +LP  +T E    D  R + ++RLL Y+Q  ++  + ++ L R  R F
  S:    44 FQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIET-YQFDLAAEYLLMAAMLIEIKSRLLLPRTETVEDEEAD-PRAELVRRLLAYEQ-MKLAAQGLDALPRAGRDF 152
>gi|110601893|ref|ZP_01390056.1| Prokaryotic chromosome segregation and condensation protein ScpA [Geobacter sp. FRC-32] >gi|110547400|gb|EAT60663.1| Prokaryotic chromosome segregation and condensation protein ScpA [Geobacter sp. FRC-32] (271 aa)
Score = 161, Expect = 2.3e-09, Identities = 76/248 (30%), Positives = 127/248 (51%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLERR--SRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV 280
           +EF GP +L   LIK+ ++DI NI +  + + Y+DYI + L  L +D   E+L+MA  LL+ KSK +LP +++ E + +++  R + ++RLL Y++Y+E    L   E L R   +R F  P          L  F+       ++L  +++A Q+V  K+       SP D+   +    +SI D   E+   LE       I+F   F  I D   T+   V+ F+A+L L +   I++ Q      I+I+
  S:    21 EEFEGPLDLLLHLIKKNEVDIYNIPIAAITRQYLDYI-DLLKDLNLDIAGEFLVMAATLLQIKSKMLLPVTVEEESEEAEEDPRAELVRRLLEYQKYKEAATTLGQCELLGRDLFARKFPAPE---------LASFEAEEEPADVELFELIEAFQRVLAKI-------SP-DSFHEVGADGLSIADRITEVLALLEGEE---AITFEALF--IGD--VTRDALVITFLAVLELCKLKMIRITQVKEKGTIWIM 248
>gi|160892715|ref|ZP_02073505.1| hypothetical protein CLOL250_00245 [Clostridium sp. L2-50] >gi|156865756|gb|EDO59187.1| hypothetical protein CLOL250_00245 [Clostridium sp. L2-50] (288 aa)
Score = 161, Expect = 2.3e-09, Identities = 70/246 (28%), Positives = 136/246 (55%)
  Q:    25 ISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-------LDVILKAMQKVYLKLV--TTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           +S  D+    F GP +L   LI++ K++I +I +V + + Y+DY+ N++ +  +D ++E+L+MA  L+  KSK +LP + TE+   ++  RD+ ++RLL YK Y+    +L +     ++ F K       KES+  E ++  + PA+D        D+ L+ + +++  ++    +K    +   K I+  EIS++    EIRE +     +        F+ + + + ++   +V F+AIL L++ G IQ+ Q
  S:     7 MSAIDVKLNVFEGPLDLLLHLIEKNKVNIYDIPIVTITEQYLDYV-NHMEEEDLDVMSEFLVMAATLIRIKSKMLLPKV-TEDDEEEEDPRDELVRRLLEYKMYKYAASELKDLELDGAKAFYK-------KESIPAEVKN--FKPAVDTVALISEYDINLERLNEIFKSVMRKQVEKVDPIRSKFKNIEREEISLEAKMAEIREQVRGLAGI-------NFRTLLEMQASRSNIIVTFLAILELMKIGAIQIRQ 243
>gi|87306813|ref|ZP_01088959.1| hypothetical protein DSM3645_00130 [Blastopirellula marina DSM 3645] >gi|87290186|gb|EAQ82074.1| hypothetical protein DSM3645_00130 [Blastopirellula marina DSM 3645] (268 aa)
Score = 160, Expect = 2.4e-09, Identities = 59/245 (24%), Positives = 122/245 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           + GP +L   L+++ ++DI +I +  V + YV Y++  L  L +D   ++L MA+ L+E KSK +LP +D +E++ +D  R++ ++RLL YK++++    L ++    +R F + +                  +P   +D   + + +V L  + +  ++  +DN K++  + I  DD    IR ++E             F ++ + +  K   +  F+A+L LVR+  +  +Q      I++
  S:    10 YRGPLDLLLYLVRKHEIDIRDIPIAMVTEQYVIYLD-ILQHLDVDAAADFLEMASTLVEIKSKLLLPGVDADEELIED-PREQLVERLLEYKRFKDAAGLLDDQGRAWNRRFARLSDD----------------LPPRRIDPAQQPIHEVELWDLVSALSRIVRDN-KIVQPTSIVYDDT--PIRVYMERIHQRIVTEDNVSFTSMFEGQVHKIVIIGLFLAVLELVRHCGVIAQQPEPHGEIYL 233
>gi|145594469|ref|YP_001158766.1| chromosome segregation and condensation protein ScpA [Salinispora tropica CNB-440] >gi|145303806|gb|ABP54388.1| condensin subunit ScpA [Salinispora tropica CNB-440] (359 aa)
Score = 160, Expect = 2.4e-09, Identities = 56/245 (22%), Positives = 103/245 (42%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GPF+L   LI + K+D+  + L +V   ++ Y+        +D+ +E+LL+A  LL+ K+ R+LP+ + E++    +   RD    RLL YK Y+E    +    E   R + +                +  Y  A+  D++     +    L     T +P   V +  V ++ +      +RE  E      + +    F  +  +       V  F+A+L L R G +   Q  + E + +
  S:    58 FTGPFDLLLQLISKHKLDVTEVALHQVTDEFIAYLRAMGEHWDLDETSEFLLVAATLLDLKAARLLPAAEVEDEADLALLEARDLLFARLLQYKAYKEAAAHIAVLEETGGRRYPRAVT------------LEPRYAQALP-DLVFGIGPQRLRDLAVRVFTPTPPPEVSIAHVHQVRV-----SVREHAEIIAERLRRAGTATFSGLCADCEALLEVVARFLALLELYREGLVAFAQEEALEELTV 286
>gi|194098401|ref|YP_002001459.1| Segregation and condensation protein A [Neisseria gonorrhoeae NCCP11945] >gi|193933691|gb|ACF29515.1| Segregation and condensation protein A [Neisseria gonorrhoeae NCCP11945] (284 aa)
Score = 160, Expect = 2.8e-09, Identities = 39/112 (34%), Positives = 64/112 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++ +D+L+I +VE+   Y+ YI   +   + D   EYLLMA  L+E KS+ +LP  +  E    D  R + ++RLL Y+Q  ++  + ++ L R  R F
  S:    44 FQGPLDLLLYLIRKQNIDVLDIPMVEITGQYLHYIAQ-MEAYQFDLAAEYLLMAAMLIEIKSRLLLPRTEAVEDEEAD-PRAELVRRLLAYEQ-MKLAAQGLDALPRAGRDF 152
>gi|40062486|gb|AAR37438.1| conserved hypothetical protein [uncultured marine bacterium 105] (262 aa)
Score = 160, Expect = 2.9e-09, Identities = 65/278 (23%), Positives = 130/278 (46%)
  Q:    11 KPENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDV--ILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVES 288
           +P+N ESL      +    I    F GP +L   LI++ ++DI +I +  + + Y++Y+   +  L +D + E+LLMA  L+  KS+ +LP   + E+ S++  R+  + RL+ +++++     L E+   RS  + +P       +  + E     Y P +++D+  +L A Q V  +         P        + +ISI   E  I + +          F + F +      ++   +  F+A+L ++R   +++ Q+ S   I I K  + V++
  S:     3 RPDNFESL------LEAYPIKVANFEGPLDLLLFLIRKHEIDIQDIPIALITEQYLEYLE-LMQDLDLDVVGEFLLMAATLIYIKSRALLPRPVSSEEGSEEDPREALMLRLIEHRKFKAAAELLHERETVRSAQWGRP-------DDRISEIAGEEYEPELEVDLFSLLTAFQAVVERAKQRPSMALP--------IEQISI---ETRIEQLVARLSETEACGFEELFADAS----SRADLIATFLALLEMIRLKLVRVFQDGSFGPIRIYKRARPVDA 253
>gi|54020285|ref|YP_116161.1| segregation and condensation protein A [Mycoplasma hyopneumoniae 232] >gi|53987458|gb|AAV27659.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] >gi|144575564|gb|AAZ53994.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (249 aa)
Score = 160, Expect = 2.9e-09, Identities = 70/251 (27%), Positives = 126/251 (50%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDK--YIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+    F+GP +L   L++ + ++IL+INLVE+   YV+ I+N L +  I    EYL++A+ L+  KSK I  S D +E++  + ++D+  ++  L  Y+Q + I   L E+ E R+  FEK T +  D        + + +   + L  +LK M   + ++    + K     V      E+S D     ++  LE   +  K SF + F N+P  K    +FV+  +++L + +   + L+Q S    I +
  S:     8 DVKLGNFSGPLDLLLDLVRSKNINILDINLVELASQYVNIIDN-LKQKSIQIAGEYLVIASTLVHLKSKIIFAS-DKQEELDSETKQDRLEFLALLSDYQQIKNITKMLKEQQEHRNDYFEKSTSNYSDFRRPHNPNKLDGHSSQLILSKVLKLM---FDRIRAKNRLKISTKQV------EVSADKQTLWLKNILE---NKGKFSFEELF-NLPSMK----HFVITMISLLEMAKKQVLHLKQESQFSEILV 241
>gi|56963580|ref|YP_175311.1| segregation and condensation protein A [Bacillus clausii KSM-K16] >gi|56909823|dbj|BAD64350.1| conserved hypothetical protein [Bacillus clausii KSM-K16] (256 aa)
Score = 160, Expect = 2.9e-09, Identities = 69/251 (27%), Positives = 120/251 (47%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD----TEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ------SGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           ++    F GP +L   LI + ++DI +I + ++   Y+ YI+  + +L++D  +EYL+MA  LL+ KS+ +LP  +     +E +  +  RD+ +++LL Y+ ++E   +L EK  +RS +  +P        S E++  L  E             V L  M   + KL+      +PK   K +   E SI+    E+ + L    H  K  F   +     E       +V F+A+L L++   I   Q  S   I I
  S:     7 NVKTDSFEGPLDLLLHLIAQAEVDIYDIPVAKITDQYLHYIHT-MQELELDLASEYLVMAATLLQIKSQMLLPKPEELFYEDEGMEAEDPRDELVEQLLEYRAFKEAAEQLKEKEAQRSLVHTRPPNDLDAFLSAEEERKLQIE------------GVTLADMLGAFQKLLQRNAWNAPK--TKTVQSEEQSIELRMNELLDELS--AHSGKAPFHTLY-----ETGNVSQLIVTFLAMLELIKTRAIHCVQEESFAEIMI 245
>gi|50913680|ref|YP_059652.1| segregation and condensation protein A [Streptococcus pyogenes MGAS10394] >gi|73919292|sp|Q5XDP4|SCPA_STRP6 Segregation and condensation protein A >gi|50902754|gb|AAT86469.1| ScpA [Streptococcus pyogenes MGAS10394] (234 aa)
Score = 159, Expect = 3.1e-09, Identities = 52/189 (27%), Positives = 105/189 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKE 217
           DI  K+F GP +L   L+ + K+DI  + +VEVI+ Y++YI   L  +K++   +Y+LMA+ L+  KS+R+LP +  E    +D+E+D  ++++  Y +++ +   L ++ ++R++ + KP Q    ++++L+E +       MDL +    +      ++    T   +D+ K+ D+       +EKE
  S:     2 DIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIET-LQVMKLEVAGDYMLMASQLMLIKSRRLLPKV-VEHIEEEDLEQD-LLEKIEEYSRFKAVSQALAKQHDQRAKWYSKPKQELIFEDAILQEDKT-----VMDLFLAFSNIMAAKRAVLKNNHTVIERDDYKIEDMMASIKQRLEKE 182
>gi|21909803|ref|NP_664071.1| segregation and condensation protein A [Streptococcus pyogenes MGAS315] >gi|28896504|ref|NP_802854.1| segregation and condensation protein A [Streptococcus pyogenes SSI-1] >gi|94989812|ref|YP_597912.1| segregation and condensation protein A [Streptococcus pyogenes MGAS10270] >gi|94993698|ref|YP_601796.1| segregation and condensation protein A [Streptococcus pyogenes MGAS10750] >gi|167016576|sp|Q1JIF5|SCPA_STRPD Segregation and condensation protein A >gi|167016577|sp|Q1J8A9|SCPA_STRPF Segregation and condensation protein A >gi|41018063|sp|Q8K8I5|SCPA_STRP3 Segregation and condensation protein A >gi|21903988|gb|AAM78874.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811758|dbj|BAC64687.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] >gi|94543320|gb|ABF33368.1| Segregation and condensation protein ScpA [Streptococcus pyogenes MGAS10270] >gi|94547206|gb|ABF37252.1| Segregation and condensation protein ScpA [Streptococcus pyogenes MGAS10750] (234 aa)
Score = 159, Expect = 3.2e-09, Identities = 52/189 (27%), Positives = 105/189 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKE 217
           DI  K+F GP +L   L+ + K+DI  + +VEVI+ Y++YI   L  +K++   +Y+LMA+ L+  KS+R+LP +  E    +D+E+D  ++++  Y +++ +   L ++ ++R++ + KP Q    ++++L+E +       MDL +    +      ++    T   +D+ K+ D+       +EKE
  S:     2 DIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIET-LQVMKLEVAGDYMLMASQLMLIKSRRLLPKV-VEHIEEEDLEQD-LLEKIEEYSRFKAVSQALAKQHDQRAKWYSKPKQELIFEDAILQEDKT-----VMDLFLAFSNIMAAKRAVLKNNHTVIERDDYKIEDMMASIKQRLEKE 182
>gi|20807773|ref|NP_622944.1| hypothetical protein TTE1324 [Thermoanaerobacter tengcongensis MB4] >gi|41018082|sp|Q8RAA1|SCPA_THETN Segregation and condensation protein A >gi|20516329|gb|AAM24548.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis MB4] (247 aa)
Score = 159, Expect = 3.3e-09, Identities = 68/251 (27%), Positives = 133/251 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPA-MDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKE 285
           F GPF+L + LI++ ++D+++I +  ++  Y++YI + L ++ +D  +E+++MA  L+E KS+ +LP   ++ E +  ++  R++ +++L+ YK+Y+EI   L        R F              KE  D +Y+   + L+  ++ +  VY K++   K K  K  +K     E ++    KE+  +L   P L       +F  I  +  +K   VV+FVA+L L++   +  EQ ++  +IFI  + +E
  S:     9 FEGPFDLLFHLIEKNEIDLMDIPISIILDQYMEYIRS-LQEMDLDVASEFIVMAATLVEIKSRMLLPKFRLEEEAEKIEEDPREELVKQLIEYKKYKEIAQLLSGICGINRRFF--------------KEEPDLNYIDKRVALNYSVEDIVNVYRKILERNKEKENKIEIK---KEEYTVVSKIKELLTYLVKKPAL-------WFSEIVRKSRSKLEVVVSFVALLELIKLNRVAAEQQTAYGDIFIRFLGRE 237
>gi|68535952|ref|YP_250657.1| segregation and condensation protein A [Corynebacterium jeikeium K411] >gi|68263551|emb|CAI37039.1| segregation and condensation protein A [Corynebacterium jeikeium K411] (255 aa)
Score = 159, Expect = 3.5e-09, Identities = 38/130 (29%), Positives = 71/130 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLK-IDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQ 164
           F+GPF+L   LI   K+DI  + L +V   ++ Y     +  + +D++TE+L++A+ LL+ K+ R++P   +D+EE ++    RD    RLL Y+ Y+++     +     +R +       E   +LL E +
  S:     6 FDGPFDLLLQLIHSHKLDITEVALAQVTDEFIAYTKTLSSSAEDLDEVTEFLVVASTLLDLKAARLVPRGEVDSEEDLALLETRDLLFARLLQYRAYKQVADLFADWQRDAARAYPATLSLEEHHANLLPEVK 138
>gi|167404853|ref|ZP_02309626.1| segregation and condensation protein A [Listeria monocytogenes FSL J2-003] (165 aa)
Score = 159, Expect = 3.5e-09, Identities = 52/161 (32%), Positives = 90/161 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTK 195
           F GP +L   LI + ++DI +I + E+   Y+++++  + ++++D  +EYL+MA  LL  KSK +LP     +D +    ++  RD  +++L+ YK+++E   +L EK   RS  F KP          L E+ D + V   +LDV L  M   + K++  KK K
  S:    11 FEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHT-MQEMELDVASEYLVMAATLLAIKSKMLLPKQELEIDYDTLEEEEDPRDALVEKLMEYKRFKEAAKELKEKEAERSFYFSKPPMD-------LAEYDDGTKVA--ELDVSLNDMLSAFNKMLRRKKLK 165
>gi|163763816|ref|ZP_02170876.1| GTP cyclohydrolase II [Bacillus selenitireducens MLS10] >gi|160355641|gb|EDP82294.1| GTP cyclohydrolase II [Bacillus selenitireducens MLS10] (246 aa)
Score = 159, Expect = 3.8e-09, Identities = 43/115 (37%), Positives = 73/115 (63%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI------ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           F GP +L   LI++  +D+ +I + E+ + Y+ YI+  +  L +D  +EYL+MA  LL+ KSK +LP    EE + +DI       RD+ +Q+L+ YK+Y++    L E+  +RS +F +P
  S:    11 FEGPLDLLLHLIQKNDLDLYDIPVREITEQYMTYIHA-MQVLHLDIASEYLVMAATLLQMKSKLLLPV--EEEILDEDILDYEEDPRDELMQKLIEYKRYKDAASDLKERESKRSDLFSRP 128
>gi|139474357|ref|YP_001129073.1| segregation and condensation protein A [Streptococcus pyogenes str. Manfredo] >gi|167016578|sp|A2RG92|SCPA_STRPG Segregation and condensation protein A >gi|134272604|emb|CAM30871.1| segregation and condensation protein A [Streptococcus pyogenes str. Manfredo] (234 aa)
Score = 159, Expect = 4.0e-09, Identities = 52/189 (27%), Positives = 105/189 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKE 217
           DI  K+F GP +L   L+ + K+DI  + +VEVI+ Y++YI   L  +K++   +Y+LMA+ L+  KS+R+LP +  E    +D+E+D  ++++  Y +++ +   L ++ ++R++ + KP Q    ++++L+E +       MDL +    +      ++    T   +D+ K+ D+       +EKE
  S:     2 DIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIET-LQVMKLEVAGDYMLMASQLMLIKSRRLLPKV-VEHIEEEDLEQD-LLEKIEEYSRFKAVSQALAKQHDQRAKWYSKPKQELIFEDAILQEDKT-----VMDLFLAFSNIMAAKRAVLKNNHTVIERDDYKIEDMMASIKQRLEKE 182
>gi|19745524|ref|NP_606660.1| segregation and condensation protein A [Streptococcus pyogenes MGAS8232] >gi|41018072|sp|Q8P2C9|SCPA_STRP8 Segregation and condensation protein A >gi|19747643|gb|AAL97159.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] (234 aa)
Score = 159, Expect = 4.0e-09, Identities = 52/189 (27%), Positives = 105/189 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKE 217
           DI  K+F GP +L   L+ + K+DI  + +VEVI+ Y++YI   L  +K++   +Y+LMA+ L+  KS+R+LP +  E    +D+E+D  ++++  Y +++ +   L ++ ++R++ + KP Q    ++++L+E +       MDL +    +      ++    T   +D+ K+ D+       +EKE
  S:     2 DIKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIET-LQVMKLEVAGDYMLMASQLMLIKSRRLLPKV-VEHIEEEDLEQD-LLEKIEEYSRFKTVSQALAKQHDQRAKWYSKPKQELIFEDAILQEDKT-----VMDLFLAFSNIMAAKRAVLKNNHTVIERDDYKIEDMMASIKQRLEKE 182
>gi|75764913|ref|ZP_00744260.1| Segregation and condensation protein ScpA [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74487597|gb|EAO51466.1| Segregation and condensation protein ScpA [Bacillus thuringiensis serovar israelensis ATCC 35646] (148 aa)
Score = 158, Expect = 4.5e-09, Identities = 38/115 (33%), Positives = 74/115 (64%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-----MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           F GP +L   LI   ++DI NI + ++ + Y+ Y++  + +L++D  +EYL+MA  LL+ KSK +LP      +D  +    D  R + ++RL+ YK+Y+++  +L E+ + R++++ +P
  S:    15 FEGPLDLLLHLIHRYEIDIYNIPVADITEQYLSYVHT-MKELQLDVASEYLVMAATLLQIKSKMLLPKHEEDVLDNGDDFIDD-PRQELMERLIEYKKYKQVATELKEREQERAQLYTRP 132
>gi|189485303|ref|YP_001956244.1| segregation and condensation protein subunit A [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287262|dbj|BAG13783.1| segregation and condensation protein subunit A [uncultured Termite group 1 bacterium phylotype Rs-D17] (234 aa)
Score = 158, Expect = 4.9e-09, Identities = 71/256 (27%), Positives = 123/256 (48%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKI 282
           + DI    F GP ++   LIK+  ++I  I + E+   Y+ Y+ + + +L ID   E+L+M++ L++ K++ ++PS + E+ I +D        RL  Y++Y+E+   L  K+   S+++ +P                   +P    D +L A     +    T  T+ P +N+K I   EI I   E +IRE L+       ISF D  +     + TK   +V F+A+L LV+N  I  +Q+     I I +I
  S:     2 VYDIHLDTFEGPLDILLHLIKKNDLEINEIKIAEITAEYLTYL-DLMQELNIDIAGEFLVMSSTLIQIKARTLIPS-NNEKDILEDDSLSFLKNRLFEYQKYKELGRLLSYKIIENSQIYYRPA------------------LPINKQDFVLDATIFDLVGSFRTALTRLP-ENIKEIMYQEIPI---ETKIREILDVLEGRQYISFNDILR----MQETKTALIVCFMAVLELVKNKQIVAKQSELFSEIRIYRI 229
>gi|72080959|ref|YP_288017.1| segregation and condensation protein A [Mycoplasma hyopneumoniae 7448] (239 aa)
Score = 158, Expect = 5.0e-09, Identities = 69/245 (28%), Positives = 124/245 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDK--YIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F+GP +L   L++ + ++IL+INLVE+   YV+ I+N L +  I    EYL++A+ L+  KSK I  S D +E++  + ++D+  ++  L  Y+Q + I   L E+ E R+  FEK T +  D        + + +   + L  +LK M   + ++    + K     V      E+S D     ++  LE   +  K SF + F N+P  K    +FV+  +++L + +   + L+Q S    I +
  S:     4 FSGPLDLLLDLVRSKNINILDINLVELASQYVNIIDN-LKQKSIQIAGEYLVIASTLVHLKSKIIFAS-DKQEELDSETKQDRLEFLALLSDYQQIKNITKMLKEQQEHRNDYFEKSTSNYSDFRRPHNPNKLDGHSSQLILSKVLKLM---FDRIRAKNRLKISTKQV------EVSADKQTLWLKNILE---NKGKFSFEELF-NLPSMK----HFVITMISLLEMAKKQVLHLKQESQFSEILV 231
>gi|168186270|ref|ZP_02620905.1| segregation and condensation protein A [Clostridium botulinum C str. Eklund] >gi|169295840|gb|EDS77973.1| segregation and condensation protein A [Clostridium botulinum C str. Eklund] (250 aa)
Score = 158, Expect = 5.2e-09, Identities = 71/251 (28%), Positives = 129/251 (51%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISID--DVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           +I  + F GPF+L   LIK+ +MDI +I + E+   Y++YINN + +L ++  +E++++A  LLE KSK +LP    EE   +  + R + I +LL YK+++++   LM +      M+ K       K  ++++   +  V  +  DV +  +  +Y  L+ T K K    N +     EI++D   +E ++ E  E   +   I F     +  D    K   +V F+A+L L++   I   Q S+ + I++
  S:     4 NIKIENFEGPFDLLLHLIKKNEMDIYDIKIYEITTQYLNYINN-MKELDLEVTSEFIVIAATLLEIKSKMLLPKQVVEENEEEAEDPRQELINKLLEYKKFKQVADYLMNREATVGFMYSK-------KPEIIEDIHKDDNVDILK-DVTILKLFNIYNDLINTYKNKM---NTESAIPKEIALDKFKIEDKMVEISEKLKNGSTIGFSKLVSSCED----KIEAIVTFLALLELIKLRVISAIQESNFQEIYL 241
>gi|161870365|ref|YP_001599535.1| segregation and condensation protein A [Neisseria meningitidis 053442] >gi|161595918|gb|ABX73578.1| segregation and condensation protein A [Neisseria meningitidis 053442] (284 aa)
Score = 157, Expect = 5.6e-09, Identities = 38/112 (33%), Positives = 65/112 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++ +D+L+I +V++ + Y+ YI   +   + D   EYLLMA  L+E KS+ +LP  +  E    D  R + ++RLL Y+Q  ++  + ++ L R  R F
  S:    44 FQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQ-IEAYQFDLAAEYLLMAAMLIEIKSRLLLPRTEAVEDEEAD-PRAELVRRLLAYEQ-MKLAAQGLDALPRAGRDF 152
>gi|81177090|ref|ZP_00875984.1| Protein of unknown function DUF173 [Streptococcus suis 89/1591] >gi|80976221|gb|EAP39854.1| Protein of unknown function DUF173 [Streptococcus suis 89/1591] (239 aa)
Score = 157, Expect = 5.7e-09, Identities = 70/257 (27%), Positives = 121/257 (47%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKE 285
           DI  K+F GP +L   L+ + ++DI  + + EVI+ Y+ YI   L  ++++   EY+LMA+ L+  KS+R+LP +  +     D E D  + +L  Y++++ +  KL E+ + R+  F KP      K  L+  + D        +  I  A  K     V  +K  S + +   I   E  I+D+   +R   E  P L         + +  E       +  F+A L LV+   I LEQ  +  +I++V+ + E
  S:     2 DIKLKDFEGPLDLLLHLVSKYQVDIYEVPITEVIEQYLAYIAT-LQAMRLEVAGEYMLMASQLMVIKSRRLLPKVVEQIDPEDDPEMD-LLDQLEEYRKFKLLSEKLGEQHDERANYFSKP------KLDLI--YDDVQLAKDKTIIDIFLAFSK-----VMAEKQASLRQSHATIARDEYKIEDMMDFVRSRFETGPRL-------ELRQLFQESQDVNEMITIFLATLELVKVHEIVLEQTETFGDIYLVRSEDE 236
>gi|169190125|ref|ZP_02850100.1| chromosome segregation and condensation protein ScpA [Paenibacillus sp. JDR-2] >gi|169003172|gb|EDS50044.1| chromosome segregation and condensation protein ScpA [Paenibacillus sp. JDR-2] (259 aa)
Score = 157, Expect = 5.7e-09, Identities = 67/247 (27%), Positives = 125/247 (50%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI------ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           + F GP +L   LI + ++DI  +++ E+   Y+DY+N  + +L+++  +E+L+MA  LL  KS ++LP     E   ++        RD+ IQ+L+ Y+++++I  +L EK   RS ++   ++  +D    +KE   N        D+I    +          +  + ++ V  +   EIS+ D  ++I E L+ F        +  F  +  E   K   VV F+AIL L++  HI+  Q+   ++I I
  S:     8 ESFEGPLDLLLHLIDKSEIDIHEVSISEITDQYMDYLNA-MKELELELTSEFLVMAATLLAIKSNQLLPKPPVFEDFYEEWPDDGLDPRDELIQKLVEYRKFKQIAEQLREKELERSLIY---SREPDDMTPYMKEEIVNPLEGLHISDLIAAFQR--------ALRRAARRNIVATVQRDEISVKDRIRDIVEVLKQFE-------IVRFSRLIRENMNKHEVVVTFLAILELMKMKHIRCFQHQLFDDIVI 241
>gi|146319355|ref|YP_001199067.1| segregation and condensation protein A [Streptococcus suis 05ZYH33] >gi|146321560|ref|YP_001201271.1| segregation and condensation protein A [Streptococcus suis 98HAH33] >gi|167016579|sp|A4W3D2|SCPA_STRS2 Segregation and condensation protein A >gi|167016581|sp|A4VX28|SCPA_STRSY Segregation and condensation protein A >gi|145690161|gb|ABP90667.1| Uncharacterized conserved protein [Streptococcus suis 05ZYH33] >gi|145692366|gb|ABP92871.1| Uncharacterized conserved protein [Streptococcus suis 98HAH33] (239 aa)
Score = 157, Expect = 6.2e-09, Identities = 70/257 (27%), Positives = 121/257 (47%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKE 285
           DI  K+F GP +L   L+ + ++DI  + + EVI+ Y+ YI   L  ++++   EY+LMA+ L+  KS+R+LP +  +     D E D  + +L  Y++++ +  KL E+ + R+  F KP      K  L+  + D        +  I  A  K     V  +K  S + +   I   E  I+D+   +R   E  P L         + +  E       +  F+A L LV+   I LEQ  +  +I++V+ + E
  S:     2 DIKLKDFEGPLDLLLHLVSKYQVDIYEVPITEVIEQYLAYIAT-LQAMRLEVAGEYMLMASQLMVIKSRRLLPKVVEQIDPEDDPEMD-LLDQLEEYRKFKLLSEKLGEQHDERANYFSKP------KLDLI--YDDVQLAKDKTVIDIFLAFSK-----VMAEKQASLRQSHATIARDEYKIEDMMDFVRSRFETGPRL-------ELRQLFQESQDVNEMITIFLATLELVKVHEIVLEQTETFGDIYLVRSEDE 236
>gi|29833052|ref|NP_827686.1| hypothetical protein SAV_6510 [Streptomyces avermitilis MA-4680] >gi|29610173|dbj|BAC74221.1| putative chromosome segregation and condensation protein A [Streptomyces avermitilis MA-4680] (263 aa)
Score = 157, Expect = 6.2e-09, Identities = 57/239 (23%), Positives = 107/239 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GPF+L   LI + K+D+  + L +V   ++ +I        +D  TE+L++A  LL+ K+ R+LP+ + E++    +   RD    RLL Y+ Y++I      ++E  +R + +          LL E             V++    + + KL        P+  V  +D     +  V+++    +     L + SF    ++  D+  T    V  F+A+L L R   + L+Q ++
  S:     6 FEGPFDLLLQLISKHKLDVTEVALSKVTDEFMAHIRAMGPDWDLDQTTEFLVVAATLLDLKAARLLPTAEVEDEADLALLEARDLLFARLLQYRAYKQIADIFNRRVEEEARRYPRTVGLEPHHAELLPE-------------VVISIGAEGFAKLAVKAMQPKPRPQV-YVDHIHAPLVSVQEQAGIVVARLRELGEASFRTLVEDT-DDTLT---VVARFLALLELYREKAVALDQETA 228
>gi|169178385|ref|ZP_02839778.1| Cobyrinic acid ac-diamide synthase [Arthrobacter chlorophenolicus A6] >gi|169013774|gb|EDS60368.1| Cobyrinic acid ac-diamide synthase [Arthrobacter chlorophenolicus A6] (573 aa)
Score = 157, Expect = 6.4e-09, Identities = 40/129 (31%), Positives = 71/129 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKL----KIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEF 163
           F GPF+L   LI + ++DI  + +  V   ++ YI   L +L     +D+ +E+L++A  LL+ K+ R+LP+  ++++E I+    RD    RLL YK ++++   L   L    R F +     E   ++L E 
  S:   318 FTGPFDLLLGLIAKHQLDITEVAIATVTDEFIKYIRK-LQELGEDWALDEASEFLVIAATLLDLKAARLLPAGEVESDEDIALLEARDLLFARLLQYKAFKQVAGILGGALHEEGRRFPRQVALEEHFPAMLPEL 451
>gi|159037540|ref|YP_001536793.1| chromosome segregation and condensation protein ScpA [Salinispora arenicola CNS-205] >gi|157916375|gb|ABV97802.1| chromosome segregation and condensation protein ScpA [Salinispora arenicola CNS-205] (342 aa)
Score = 157, Expect = 6.5e-09, Identities = 32/95 (33%), Positives = 56/95 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQ 129
           F GPF+L   LI + K+D+  + L +V   ++ Y+     +  +D+ +E+LL+A  LL+ K+ R+LP+ + E++    +   RD    RLL YK Y+
  S:    51 FTGPFDLLLQLISKHKLDVTEVALHQVTDEFITYLRALGDQWDLDETSEFLLVAATLLDLKAARLLPAAEVEDEADLALLEARDLLFARLLQYKAYK 147
>gi|144227734|gb|AAZ44716.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (249 aa)
Score = 157, Expect = 6.6e-09, Identities = 70/251 (27%), Positives = 125/251 (49%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDK--YIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+    F+GP +L   L++ + ++IL+INLVE+   YV+ I+N L +  I    EYL++A+ L+  KSK I  S D +E++  + ++D+  ++  L  Y+Q + I   L E+ E R+  FEK T +  D        + + +   + L  +LK M   + ++    + K     V      E+S D     ++  LE      K SF + F N+P  K    +FV+  +++L + +   + L+Q S    I +
  S:     8 DVKLGNFSGPLDLLLDLVRSKNINILDINLVELASQYVNIIDN-LKQKSIQIAGEYLVIASTLVHLKSKIIFAS-DKQEELDSETKQDQLEFLALLSDYQQIKNITKMLKEQQEHRNDYFEKSTSNYSDFRRPHNPNKLDGHSSQLILSKVLKLM---FDRIRAKNRLKISTKQV------EVSADKQTLWLKNILE---KKGKFSFEELF-NLPSMK----HFVITMISLLEMAKKQVLHLKQESQFSEILV 241
>gi|83746711|ref|ZP_00943760.1| Segregation and condensation protein ScpA [Ralstonia solanacearum UW551] >gi|83726664|gb|EAP73793.1| Segregation and condensation protein ScpA [Ralstonia solanacearum UW551] (342 aa)
Score = 156, Expect = 6.8e-09, Identities = 60/245 (24%), Positives = 110/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+ +  ++L+I + +V + Y+ YI   +    ++   EYLLMA  L+E KS+ +LP   T+     +  R + ++RLL Y+Q +    KL + L +  R F +     E  +SL   +      P ++ D +  A   V  +   T+  K  ++ +            V + + + L    H   + F + F+++          VV FVA+L L R   +++ Q      I++
  S:   112 FEGPLDLLLYLIRRQNFNVLDIPMAQVTRQYLAYIEQ-IRATNLELAAEYLLMAAMLIEIKSRMLLPVKKTDSGEEPEDPRAELVRRLLEYEQMKLAAQKL-DALPQLGRDFLRAQVYIE--QSLAPRY------PDVNSDDLRAAWADVLRRAKLTQHHKITREELS-----------VREHMSQILRRLQHARFMEFTELFEDVIQSGKGAPIVVVNFVAMLELSRESLVEITQAEPYAPIYV 335
>gi|194344730|gb|EDX25696.1| chromosome segregation and condensation protein ScpA [Streptomyces sp. Mg1] (281 aa)
Score = 156, Expect = 7.7e-09, Identities = 35/114 (30%), Positives = 59/114 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           F GPF+L   LI   K+D+  + L +V   ++ YI        +D  TE+L++A  LL+ K+ R+LP  + E++    +   RD    RLL YK Y+ +      + E  +R + +
  S:    24 FEGPFDLLLQLISRHKLDVTEVALSKVTDEFMAYIRTMGPDWDLDQTTEFLVVAATLLDLKAARLLPVAEVEDEADLALLEARDLLFARLLQYKAYKRVAEIFQGRAEDEARRYPR 139
>gi|148379817|ref|YP_001254358.1| segregation and condensation protein A [Clostridium botulinum A str. ATCC 3502] >gi|153931686|ref|YP_001384115.1| segregation and condensation protein A [Clostridium botulinum A str. ATCC 19397] >gi|153935515|ref|YP_001387655.1| segregation and condensation protein A [Clostridium botulinum A str. Hall] >gi|148289301|emb|CAL83397.1| segregation and condensation protein A [Clostridium botulinum A str. ATCC 3502] >gi|152927730|gb|ABS33230.1| segregation and condensation protein A [Clostridium botulinum A str. ATCC 19397] >gi|152931429|gb|ABS36928.1| segregation and condensation protein A [Clostridium botulinum A str. Hall] (248 aa)
Score = 155, Expect = 9.4e-09, Identities = 61/245 (24%), Positives = 126/245 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F+GPF+L   LIK+ KM+I ++++ E+   Y+ Y+N  + +L ++  +E+++MA  L+E KSK +LP ++ E++  ++  + + + +LL YK+++        + +     F K       K  +++     +    +  DV + ++   Y  L+ +K +    +NV+     ++    +E +I+   +      K  F D+ K    E   K   VV F+AIL L++   IQ+ Q+++  +I+I
  S:    10 FDGPFDLLLHLIKKNKMEIYDVSIYEITNQYLQYLNQ-MEELDLEITSEFIVMAATLIEIKSKYLLPKVEEEKEEEENDPQKELLSKLLEYKKFKAAAEFFKNRQQISGTSFSK-------KPEIIEVKNKETTTDELLKDVTMLSLYNTYNDLI-SKYSNKMNENVEFKGEIQLDKYKIEDKIKYIGKKITSKEKCLFSDFIK----ECSCKMEIVVTFLAILELIKLKTIQVYQSNNFNDIYI 241
>gi|15828586|ref|NP_325946.1| segregation and condensation protein A [Mycoplasma pulmonis UAB CTIP] >gi|41018121|sp|Q98R95|SCPA_MYCPU Segregation and condensation protein A >gi|14089528|emb|CAC13288.1| conserved hypothetical protein [Mycoplasma pulmonis] (249 aa)
Score = 155, Expect = 1.1e-08, Identities = 45/123 (36%), Positives = 71/123 (57%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGED 155
           K F+GP +L  SL+K++ +DI  INLVE+   Y++ I   L   KID  ++YL+MA  LL+ K+   L     +E++  D ER   + +L  YKQ++EI   L  + E+R  +F K +   E+
  S:    15 KNFSGPLDLLLSLVKDKNIDIFEINLVELATQYLEIIKK-LQDDKIDLASDYLVMAATLLQIKASMALQGEKVDEEVELDKER--LLMKLAEYKQFKEISQILRYQEEKRKEIFLKKSSPAEE 134
>gi|71893981|ref|YP_279427.1| segregation and condensation protein A [Mycoplasma hyopneumoniae J] (239 aa)
Score = 155, Expect = 1.1e-08, Identities = 69/245 (28%), Positives = 123/245 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDK--YIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F+GP +L   L++ + ++IL+INLVE+   YV+ I+N L +  I    EYL++A+ L+  KSK I  S D +E++  + ++D+  ++  L  Y+Q + I   L E+ E R+  FEK T +  D        + + +   + L  +LK M   + ++    + K     V      E+S D     ++  LE      K SF + F N+P  K    +FV+  +++L + +   + L+Q S    I +
  S:     4 FSGPLDLLLDLVRSKNINILDINLVELASQYVNIIDN-LKQKSIQIAGEYLVIASTLVHLKSKIIFAS-DKQEELDSETKQDQLEFLALLSDYQQIKNITKMLKEQQEHRNDYFEKSTSNYSDFRRPHNPNKLDGHSSQLILSKVLKLM---FDRIRAKNRLKISTKQV------EVSADKQTLWLKNILE---KKGKFSFEELF-NLPSMK----HFVITMISLLEMAKKQVLHLKQESQFSEILV 231
>gi|163813993|ref|ZP_02205386.1| hypothetical protein COPEUT_00145 [Coprococcus eutactus ATCC 27759] >gi|158450687|gb|EDP27682.1| hypothetical protein COPEUT_00145 [Coprococcus eutactus ATCC 27759] (252 aa)
Score = 154, Expect = 1.2e-08, Identities = 68/259 (26%), Positives = 139/259 (53%)
  Q:    25 ISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME-KLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTK--KTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           +S  D+    F GP +L   LI++ K++I +I +V + + Y++Y+NN + +  +D ++E+L+MA  L++ KS+ +LP    E +  ++  R++ ++RLL YK Y+    +L + +LE     F+K T   E K ++ ++      +   D+D  L+ + +++  ++  +  K    +   K I+  EIS+++   E+RE +     +        F+ + + + +K   +V F+AIL L++ G I ++Q      I I  +D
  S:     1 MSAIDVKLNVFEGPLDLLLHLIEKNKVNIYDIPIVTITEQYLEYVNN-MEEEDLDVMSEFLVMAATLIKIKSRMLLPKD-EETEEDEEDPREELVRRLLEYKMYKYAAGELKDLELEGNKAFFKKATIPAEVK-NVKQDVDPYELISKADID--LQKLNEIFKSVMRKQVDKVDPIRSKFKEIEREEISLEEKMAEVREQVRGLEGI-------NFRTLLEMQASKMNVIVTFLAILELMKIGAITIKQEEIFGEIVIDSLD 250
>gi|86740158|ref|YP_480558.1| condensin subunit ScpA [Frankia sp. CcI3] >gi|86567020|gb|ABD10829.1| condensin subunit ScpA [Frankia sp. CcI3] (314 aa)
Score = 154, Expect = 1.3e-08, Identities = 35/96 (36%), Positives = 57/96 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI----ERDKYIQRLLVYKQYQE 130
           F GPF+L  SLI + ++D+  + L +V   +V +I     +  +   TE+L++A  LL+ K+ R+LP   +E++ S D+     RD    RLL YK Y+E
  S:    46 FTGPFDLLLSLIAKHRLDVTEVALSQVTDEFVAHIRRLGDRFDLGQATEFLVIAATLLDLKAARLLPGALSEDE-SADLALLEARDLLFARLLQYKAYKE 144
>gi|21220262|ref|NP_626041.1| hypothetical protein SCO1770 [Streptomyces coelicolor A3(2)] >gi|5738486|emb|CAB52834.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)] (264 aa)
Score = 154, Expect = 1.3e-08, Identities = 35/110 (31%), Positives = 62/110 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GPF+L   LI + K+D+  + L +V   ++ +I        +D  TE+L++A  LL+ K+ R+LP+ + E++    +   RD    RLL Y+ Y++I     ++LE  +R
  S:     6 FEGPFDLLLQLISKHKLDVTEVALSKVTDEFMAHIRAMGPDWDLDQTTEFLVVAATLLDLKAARLLPAAEVEDEADLALLEARDLLFARLLQYRAYKQIAEIFNDRLEAEAR 117
>gi|153953880|ref|YP_001394645.1| segregation and condensation protein A [Clostridium kluyveri DSM 555] >gi|146346761|gb|EDK33297.1| ScpA [Clostridium kluyveri DSM 555] (254 aa)
Score = 154, Expect = 1.3e-08, Identities = 67/254 (26%), Positives = 126/254 (49%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE--RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV--KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKI 282
           +I  + F GPF+L   LIK+ KM+I +I + ++ + Y+ YINN +  + ++  +E++++A  L+E KSK +LP    +E  + D +  R + + +LL YK+++       E+     +M+ K  +  E K            V  +  D  ++ + ++Y KL+     K  K+N   K I V +  ++D  + I E LE    +        F  + +    K   ++ FVA+L LV+   I + Q  +   I+I ++
  S:     4 NIKIENFQGPFDLLLHLIKKNKMNIYDIKIHDITEQYIQYINN-MKDMDLEVTSEFIVIAASLIEIKSKVLLPKPKLDESAADDEKDPRKQLVDKLLQYKRFKAAAEFFKERALNIGKMYGKMPEIIEVKNK-------PENVEEILRDTDMEKLHEIYKKLIDLYTNKLNKENTVNKNITVDKFKLEDKMQYIVEILEGKKKI-------RFSTVVESCSFKIETIITFVALLELVKLRTISIMQYKNFSEIYIERV 246
>gi|58426380|gb|AAW75417.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] (342 aa)
Score = 154, Expect = 1.4e-08, Identities = 42/110 (38%), Positives = 66/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL---PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +L   PS D EE    D  R + ++RL  Y+++++    L + L R  R
  S:    95 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQDGEE----DDPRAELVRRLQEYERFKQAAEDL-DTLPRMGR 201
>gi|153939963|ref|YP_001391117.1| segregation and condensation protein A [Clostridium botulinum F str. Langeland] >gi|170757252|ref|YP_001781405.1| segregation and condensation protein A [Clostridium botulinum B1 str. Okra] >gi|152935859|gb|ABS41357.1| segregation and condensation protein A [Clostridium botulinum F str. Langeland] >gi|169122464|gb|ACA46300.1| segregation and condensation protein A [Clostridium botulinum B1 str. Okra] (248 aa)
Score = 154, Expect = 1.4e-08, Identities = 61/245 (24%), Positives = 126/245 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F+GPF+L   LIK+ KM+I ++++ E+   Y+ Y+N  + +L ++  +E+++MA  L+E KSK +LP ++ E++  ++  + + + +LL YK+++        + +     F K       K  +++     +    +  DV + ++   Y  L+ +K +    +NV+     ++    +E +I+   +      K  F D+ K    E   K   VV F+AIL L++   IQ+ Q+++  +I+I
  S:    10 FDGPFDLLLHLIKKNKMEIYDVSIYEITNQYLQYLNQ-MEELDLEITSEFIVMAATLIEIKSKYLLPKVEEEKEEEENDPQKELLSKLLEYKKFKAAAEFFKNRQQISGTSFSK-------KPEIIEVKNKETTTDELLKDVTMLSLYNTYNDLI-SKYSNKMNENVEFKGEIQLDKYKIEDKIKYIGKKITSKEKWLFSDFIK----ECSCKMEIVVTFLAILELIKLKTIQVYQSNNFNDIYI 241
>gi|111221681|ref|YP_712475.1| putative segregation and condensation protein A [Frankia alni ACN14a] >gi|111149213|emb|CAJ60898.1| putative segregation and condensation protein A [Frankia alni ACN14a] (314 aa)
Score = 154, Expect = 1.4e-08, Identities = 34/96 (35%), Positives = 55/96 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP---SMDTEEKISKDIERDKYIQRLLVYKQYQE 130
           F GPF+L  SLI + ++D+  + L +V   +V +I     +  +   TE+L++A  LL+ K+ R+LP   S D  E ++    RD    RLL Y+ Y+E
  S:    50 FTGPFDLLLSLIAKHRLDVTEVALSQVTDEFVAHIRRLGDRFDLGQATEFLVIAATLLDLKAARLLPGALSEDESEDLALLEARDLLFARLLQYRAYKE 148
>gi|25011684|ref|NP_736079.1| segregation and condensation protein A [Streptococcus agalactiae NEM316] >gi|77414386|ref|ZP_00790541.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae 515] >gi|41017954|sp|Q7ZAL5|SCPA_STRA3 Segregation and condensation protein A >gi|24413224|emb|CAD47303.1| unknown [Streptococcus agalactiae NEM316] >gi|77159576|gb|EAO70732.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae 515] (235 aa)
Score = 154, Expect = 1.4e-08, Identities = 67/256 (26%), Positives = 129/256 (50%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           DI  K+F GP +L   L+ + ++DI ++ +VEVI+ Y+ YI   L  ++++   EY+LMA+ L+  KS+ +LP +     I  D E +  + +L  Y++++ +  +L  + + R++ F KP Q    ++++L    D S    MDL +    M         ++K K   ++  +I+  +  I+D+   I      F    K +  + F +      TK   +  F+A+L L++   I +EQ+S+   + + K +K
  S:     2 DIKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIAT-LQAMRLEVAGEYMLMASQLMLIKSRNLLPKVVESTPIEDDPEME-LLSQLEEYRRFKVLSEELANQHQERAKYFSKPKQEVIFEDAIL--LHDKS---VMDLFLTFSQMM--------SQKQKELSNSQTVIEKEDYRIEDMMIVIERH---FNLKKKTTLQEVFADCQ----TKSEMITLFLAMLELIKLHQITVEQDSNFSQVILRKEEK 235
>gi|110640010|ref|YP_680220.1| condensin subunit ScpA [Cytophaga hutchinsonii ATCC 33406] >gi|110282691|gb|ABG60877.1| condensin subunit ScpA [Cytophaga hutchinsonii ATCC 33406] (262 aa)
Score = 154, Expect = 1.4e-08, Identities = 67/257 (26%), Positives = 123/257 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKE-VESNEY 291
           F GPF+L    I+  ++DI +I + ++   +++YI+  L K+ +D  +E++L+A  L+  K+K +LP  D + + ++   R++ +  LL YK+Y+ ++ +  E LE  S   EK     ++    LK   + S V     D+ L  + KV+ K++   K +  K    ++         +E +    +       +ISF +   +IP     K   +  F++IL L+    IQL       N +I + D E    NEY
  S:    14 FAGPFDLLLFFIERDELDIYDIPISKITNDFLEYIHR-LEKMNVDIASEFILVAATLMRIKAKTLLPRPDIDPQGNEIDPREELVSHLLEYKKYKSVIAEFSE-LEETSLKREKRGNIAKE----LKLLSEVSNVETELQDIDLYKLLKVFEKVIVRWKEEKTKPVHHVVQYPY----SIELQKEYIINKVSRGQRISFTEIINDIP----VKMAVIYNFLSILELLALQKIQLHLGEGFNNFWIAQYDGEHAAVNEY 257
>gi|22537735|ref|NP_688586.1| segregation and condensation protein A [Streptococcus agalactiae 2603V/R] >gi|76788054|ref|YP_330213.1| segregation and condensation protein A [Streptococcus agalactiae A909] >gi|77406888|ref|ZP_00783913.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae H36B] >gi|77408469|ref|ZP_00785207.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae COH1] >gi|77412363|ref|ZP_00788674.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae CJB111] >gi|123601422|sp|Q3JZU0|SCPA_STRA1 Segregation and condensation protein A >gi|41017952|sp|Q7ZAL1|SCPA_STRA5 Segregation and condensation protein A >gi|22534625|gb|AAN00459.1|AE014264_14 conserved hypothetical protein [Streptococcus agalactiae 2603V/R] >gi|76563111|gb|ABA45695.1| segregation and condensation protein A [Streptococcus agalactiae A909] >gi|77161583|gb|EAO72583.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae CJB111] >gi|77172911|gb|EAO76042.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae COH1] >gi|77174497|gb|EAO77341.1| Uncharacterised ACR, COG1354 [Streptococcus agalactiae H36B] (235 aa)
Score = 154, Expect = 1.4e-08, Identities = 66/256 (25%), Positives = 130/256 (50%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           DI  K+F GP +L   L+ + ++DI ++ +VEVI+ Y+ YI   L  ++++   EY+LMA+ L+  KS+ +LP +     I  D E +  + +L  Y++++ +  +L  + + R++ F KP Q    ++++L    D S    MDL +    M     K ++  +T   K++ ++ D+  +    +E+        F    K +  + F +      TK   +  F+A+L L++   I +EQ+S+   + + K +K
  S:     2 DIKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIAT-LQAMRLEVAGEYMLMASQLMLIKSRNLLPKVVESNPIEDDPEME-LLSQLEEYRRFKVLSEELANQHQERAKYFSKPKQEVIFEDAIL--LHDKS---VMDLFLTFSQMMSQKQKELSNSQTVIEKEDYRIEDMMIV----IERH-------FNLKKKTTLQEVFADCQ----TKSEMITLFLAMLELIKLHQITVEQDSNFSQVILRKEEK 235
>gi|77747876|ref|NP_637568.2| hypothetical protein XCC2212 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|77761175|ref|YP_242989.2| hypothetical protein XC_1906 [Xanthomonas campestris pv. campestris str. 8004] >gi|188991363|ref|YP_001903373.1| hypothetical protein xccb100_1968 [Xanthomonas campestris pv. campestris] >gi|167733123|emb|CAP51321.1| Conserved hypothetical protein [Xanthomonas campestris pv. campestris] (301 aa)
Score = 153, Expect = 1.5e-08, Identities = 48/150 (32%), Positives = 81/150 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYV---PAMDLDVILKAMQKV 184
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP   ++E   +D  R + ++RL  Y+++++      E L+   RM       G D   +     + + V   P +DL  +L A+  V
  S:    54 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQEG-EEDDPRAELVRRLQEYERFKQAA----EDLDTLPRM-------GRDSAPVQAHLPERAAVKLPPPVDLKEMLMALYDV 193
>gi|154508821|ref|ZP_02044463.1| hypothetical protein ACTODO_01331 [Actinomyces odontolyticus ATCC 17982] >gi|153798455|gb|EDN80875.1| hypothetical protein ACTODO_01331 [Actinomyces odontolyticus ATCC 17982] (292 aa)
Score = 153, Expect = 1.6e-08, Identities = 63/251 (25%), Positives = 112/251 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISK-DIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEF------QDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKE 285
           F GPF+L  SLI  +K+DI  + L +V   ++ ++        +   TE+L++A  LL+ K+  +LPS+D E+  S+ D+E RD    RLL Y+ ++E    +  ++        +         SLL E       +D + + A  L    + +Q  +L            D V  +    + +  +  E            +I+F    ++ P    T+   V  F+A+L L R G ++ EQ+ +   + I   D E
  S:    24 FEGPFDLLLSLIARKKLDITEVALAQVTDEFIAFMK---ASPDLSRTTEFLVVAATLLDMKAAHLLPSVDEEDNASEADLEARDLLFSRLLQYRAFKEAAKHINARMGEYGSYVARDVPLEPHFASLLPELRWLTTPEDLARLAADALSSTNQTVQVAHL-----------HDPVVPVREQALLVSSMLAEAG----------RITFHQLVEDAP----TRAVVVSRFLALLELYRRGAVEFEQDGALGTLTIQWTDSE 254
>gi|38233778|ref|NP_939545.1| hypothetical protein DIP1188 [Corynebacterium diphtheriae NCTC 13129] >gi|38200039|emb|CAE49715.1| Conserved hypothetical protein [Corynebacterium diphtheriae] (272 aa)
Score = 153, Expect = 1.6e-08, Identities = 64/245 (26%), Positives = 113/245 (46%)
  Q:    29 DITG-----KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           +ITG       F GPF+L   LI  +K+D+ ++ L +V   +V Y        ++D++TE+L++A  LL+ K+ R+LP  + ++    D+E    RD    RLL YK Y+++  +         R + +     E   SLL   +  S+ P            K + +L  +     P D V    V  + +  V ++  + L+      +  +MD+   I   + +    V  F+A+L L +   + LEQ  S
  S:    12 EITGFRIVLNNFEGPFDLLLQLISAKKLDVTDVALHKVTDDFVAYTRALGEFAELDEVTEFLVVAATLLDLKAARLLPRGEVDD--LSDLELLESRDLLFARLLQYKAYKQVADQFARWQLAAQRRYPRAVGMEEQFSSLLPPVKI-SHTP------------KSFAELAASVFRPKPPDTVGTSHVHGVEV-SVPEQAGKVLDLLVECGEGVWMDFPDLITGCRVSLE-VVGRFLALLELYKARAVSLEQEES 248
>gi|195978742|ref|YP_002123986.1| segregation and condensation protein A ScpA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975447|gb|ACG62973.1| segregation and condensation protein A ScpA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (235 aa)
Score = 153, Expect = 1.7e-08, Identities = 37/123 (30%), Positives = 77/123 (62%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ 151
           DI  K+F GP +L   L+ + ++D+  + +V+VI+ Y+ YI   L  ++++   EY+LMA+ L+  KS+R+LP +  +E   +D+E++  + ++  Y +++ +  +L  + ++R+ +F KP Q
  S:     2 DIKVKDFEGPLDLLLHLVSKYEVDVYQVPIVDVIEQYLAYIET-LQAMRLELAGEYMLMASQLMLIKSRRLLPKLVDKEPDEEDLEQE-LLGKIEEYSRFKALSQELASQHDKRALLFSKPKQ 122
>gi|193216439|ref|YP_001999681.1| segregation and condensation protein A [Mycoplasma arthritidis 158L3-1] >gi|193001762|gb|ACF06977.1| segregation and condensation protein A [Mycoplasma arthritidis 158L3-1] (273 aa)
Score = 153, Expect = 1.7e-08, Identities = 66/257 (25%), Positives = 130/257 (50%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAM-QKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           +F+GP +L  +LIKE+ +DI +++L E+   Y++ I  +L   +ID  +EYL+MA  LL+ K++ +L   D   +     E+ + ++++  Y+++++I   L ++   R   F K  +     E  + E   + +  +  L V L+ M ++ Y +++ +            I +S +++   E++ R  +  F     + F + F N+P    T  +FV+  +A+L L R   + +EQ+  D NI   +  K VE  E
  S:    40 DFDGPLDLLVTLIKEKNIDIFDVDLFELSTQYLNII-KHLQTYEIDLASEYLVMAATLLQLKARMVL--QDPTIEEEIKEEKKRLLEQIAEYEKFKQISQVLRQQELIRDNFFTKEPEETGQYEREIDETVLDGHANSSRLVVALRKMFERTYAEMIRS------------IKISTVAVSPEEQKER-IIALFKTKDSLDFREVF-NVP----TIGHFVITLLAVLDLARQQIVVIEQDGEDANI---RFKKGVEYEE 273
>gi|88798247|ref|ZP_01113833.1| chromosome segregation and condensation protein ScpA [Reinekea sp. MED297] >gi|88779023|gb|EAR10212.1| chromosome segregation and condensation protein ScpA [Reinekea sp. MED297] (359 aa)
Score = 153, Expect = 1.7e-08, Identities = 35/101 (34%), Positives = 63/101 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LI+++ +DILNIN+ E+   Y++YI   +  ++++  +EYL+MA+ L E KS+ +LP    ++   ++  R + I+RL  Y+Q++E    L
  S:   134 FEGPLDLLLYLIRKQNLDILNINVFEITNQYMEYI-ELMQGMQLELASEYLVMASMLAEIKSRMLLPRTKQDDDEEEEDPRAELIRRLQEYEQFKEAAENL 233
>gi|162450299|ref|YP_001612666.1| hypothetical protein sce2027 [Sorangium cellulosum 'So ce 56'] >gi|161160881|emb|CAN92186.1| hypothetical protein [Sorangium cellulosum 'So ce 56'] (659 aa)
Score = 153, Expect = 1.8e-08, Identities = 38/109 (34%), Positives = 65/109 (59%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSM-----DTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEK 138
           +T   F GP +L   LI++ ++DIL+I +  V + Y++Y+   +  L ID  +EYL+MA  L   KSK +LPS+     D      ++  R++ ++RLL Y++Y+     L E+
  S:    74 VTLPTFEGPLDLLLHLIQQHELDILDIPVSFVTEKYLEYL-KIMRSLSIDLASEYLVMAATLTHIKSKMLLPSVPAGQDDDGMPGEEEDPREELVRRLLEYQKYKVAAADLAER 186
>gi|21113347|gb|AAM41492.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66573559|gb|AAY48969.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] (279 aa)
Score = 153, Expect = 1.8e-08, Identities = 48/150 (32%), Positives = 81/150 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYV---PAMDLDVILKAMQKV 184
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP   ++E   +D  R + ++RL  Y+++++      E L+   RM       G D   +     + + V   P +DL  +L A+  V
  S:    32 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQEG-EEDDPRAELVRRLQEYERFKQAA----EDLDTLPRM-------GRDSAPVQAHLPERAAVKLPPPVDLKEMLMALYDV 171
>gi|167037542|ref|YP_001665120.1| chromosome segregation and condensation protein ScpA [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040204|ref|YP_001663189.1| chromosome segregation and condensation protein ScpA [Thermoanaerobacter sp. X514] >gi|166854444|gb|ABY92853.1| chromosome segregation and condensation protein ScpA [Thermoanaerobacter sp. X514] >gi|166856376|gb|ABY94784.1| chromosome segregation and condensation protein ScpA [Thermoanaerobacter pseudethanolicus ATCC 33223] (243 aa)
Score = 153, Expect = 1.8e-08, Identities = 66/245 (26%), Positives = 124/245 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEK---ISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF-EKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GPF+L + LI++ ++D+++I +  ++  Y++YI   L ++ ++  +E+++MA  LLE KSK +LP    E +   + +   R++ + +L+ YK+Y+ I     E  +  SR F E+P     DK+       ++ Y              K YLK+++    K  +  +K  + +      VE +I+E L        + F ++ K    +   K   +V+F+A+L LVR   I  EQ ++  +I I
  S:     9 FEGPFDLLFHLIEKNEIDLMDIPISVILDQYMEYIKT-LQEMDLNVASEFIVMAATLLEIKSKMLLPKQKFEGQQLEMEEVDPREELVTKLIEYKKYKIIAQTFKEMCKIGSRFFREEPEVKYIDKKIAFNYSSEDIY--------------KAYLKVISKNNAKEDEIEIKKDEYT------VESKIKELLVKLVKKTVLWFSEFIK----KSRAKGEIIVSFIAVLELVRLNKIIAEQKTTYGDILI 232
>gi|157150800|ref|YP_001450948.1| segregation and condensation protein A [Streptococcus gordonii str. Challis substr. CH1] >gi|189046141|sp|A8AYT8|SCPA_STRGC Segregation and condensation protein A >gi|157075594|gb|ABV10277.1| Uncharacterised ACR, COG1354 [Streptococcus gordonii str. Challis substr. CH1] (233 aa)
Score = 153, Expect = 2.0e-08, Identities = 36/121 (29%), Positives = 76/121 (62%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           DI  K+F GP +L   L+ + +MDI ++ + EVI+ Y+ Y+   L  ++++   EY++MA+ L+  KS+++LP +  +  + +D+E D  + +++ Y++++ +  K+ E+ E R+  + KP
  S:     2 DIKIKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVAT-LQAMRLEVAGEYMVMASQLMLIKSRKLLPKVVDDADLEEDLEHD-LLSQIVEYRKFKLLGEKMAEQHEERALYYSKP 120
>gi|168180435|ref|ZP_02615099.1| segregation and condensation protein A [Clostridium botulinum NCTC 2916] >gi|168184529|ref|ZP_02619193.1| segregation and condensation protein A [Clostridium botulinum Bf] >gi|182668673|gb|EDT80651.1| segregation and condensation protein A [Clostridium botulinum NCTC 2916] >gi|182672358|gb|EDT84319.1| segregation and condensation protein A [Clostridium botulinum Bf] (248 aa)
Score = 152, Expect = 2.1e-08, Identities = 64/245 (26%), Positives = 128/245 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE--DKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F+GPF+L   LIK+ KM+I ++++ E+   Y+ Y+N  + +L ++  +E+++MA  L+E KSK +LP ++ E++  ++  + + + +LL YK+++        + +     F K  +  E  +KE+  +E            DV + ++   Y  L+ +K +    +NV+     ++    +E +I+   +      K  F D+ K    E   K   VV F+AIL L++   IQ+ Q+++  +I+I
  S:    10 FDGPFDLLLHLIKKNKMEIYDVSIYEITNQYLQYLNQ-MEELDLEITSEFIVMAATLIEIKSKYLLPKVEEEKEEEENDPQKELLNKLLEYKKFKAAAEFFKNRQQISGTSFSKKPEIIEVKNKETTTEELLK---------DVTMLSLYNTYNDLI-SKYSNKMNENVEFKGEIQLDKYKIEDKIKYIGKKINSKEKWLFSDFIK----ECSCKMEIVVTFLAILELIKLKTIQVYQSNNFNDIYI 241
>gi|153888344|ref|ZP_02009488.1| chromosome segregation and condensation protein ScpA [Ralstonia pickettii 12D] >gi|151575258|gb|EDN39670.1| chromosome segregation and condensation protein ScpA [Ralstonia pickettii 12D] (293 aa)
Score = 152, Expect = 2.1e-08, Identities = 61/245 (24%), Positives = 111/245 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+ +  ++L+I L +V + Y+ YI   +    ++   EYLLMA  L+E KS+ +LP   T+E +  +  R + ++RLL Y+Q +    KL + + +  R F +     E  +SL   +      P ++ D +  A   V  +   T+  K  ++ +            V + + + L    H   + F + F++           VV FVA+L L R   +++ Q      I++
  S:    63 FEGPLDLLLYLIRRQNFNVLDIPLAQVTRQYLAYIEQ-IRATNLELAAEYLLMAAMLIEIKSRMLLPVKKTDEGVEPEDPRAELVRRLLEYEQMKLAAQKL-DTVPQLGRDFLRAQVYIE--QSLAPRY------PDVNSDDLRAAWADVLRRAKLTQHHKISREELS-----------VREHMSQILRRLQHARFMEFTELFEDAIQSGKGAPIVVVNFVAMLELSRESLLEITQAEPYAPIYV 286
>gi|172040770|ref|YP_001800484.1| segregation and condensation protein A [Corynebacterium urealyticum DSM 7109] >gi|171852074|emb|CAQ05050.1| segregation and condensation protein A [Corynebacterium urealyticum DSM 7109] (268 aa)
Score = 152, Expect = 2.1e-08, Identities = 35/103 (33%), Positives = 60/103 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLK-IDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKLME 137
           F+GPF+L   LI   K+DI  I L EV   ++ Y        + +D++TE+LL+A+ LL+ K+ R++P  + +++   ++   RD    RLL YK Y+++     E
  S:    19 FDGPFDLLLQLIHSHKLDITEIALAEVTDEFIAYTRGLSQSAEDLDEVTEFLLVASTLLDLKAARLVPRGEVDDEADLELLESRDLLFARLLQYKAYKQVADLFAE 124
>gi|47459312|ref|YP_016174.1| segregation and condensation protein A [Mycoplasma mobile 163K] >gi|56749595|sp|Q6KHG7|SCPA_MYCMO Segregation and condensation protein A >gi|47458642|gb|AAT27963.1| expressed protein [Mycoplasma mobile 163K] (247 aa)
Score = 152, Expect = 2.6e-08, Identities = 67/250 (26%), Positives = 127/250 (50%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKI 282
           + F+GP +L  SL+K++K D+  I+L ++   Y++ I N+L    +D  +EYL+MA  L+  K+K +L +   EE      +++  +++L+ Y+Q++E+  KL ++   RS +F K P+   E      +   D        ++ + K  ++V+ + +   K          I+   ++ +   KEIR+  + F    ++ F   F N+P    T  +FV+ F+ +L L R   I+L Q+     I I+KI
  S:     9 ENFDGPLDLLLSLVKDKKADLFTIDLADLATQYLEII-NHLEDSNVDVASEYLVMAATLIHIKAKMLLLN-PEEEDEEIKEDKEMLLKQLIEYQQFKEVAKKLRQQESIRSEIFIKDPSNYDEYYRETDETLLDGRSNSLSLMNTLRKMFERVHAENLRQTK----------IEAVHVNPEQRIKEIRDLFDEFGE--EVDFAKIF-NVP----TITHFVITFLVLLDLARKQEIKLIQDKEFGEIRIIKI 240
>gi|53803498|ref|YP_114627.1| segregation and condensation protein A [Methylococcus capsulatus str. Bath] >gi|53757259|gb|AAU91550.1| segregation and condensation protein A [Methylococcus capsulatus str. Bath] (271 aa)
Score = 151, Expect = 2.8e-08, Identities = 49/158 (31%), Positives = 85/158 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR-MFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTK 192
           F GP +L   LI+++  DIL+I + E+ + Y+ YI   +  L+++   EYLLMA  L E KS+ +LP     E   +D  R + ++RL  Y++++    +L ++L R  R +FE    +G D   + K +      P++ +  +L A Q V  +L  T+
  S:    43 FEGPLDLLLYLIRKQNFDILDIPIAEISRQYIGYI-EMMDSLRMELAAEYLLMAAILAEIKSRMLLPRPKETEAEEED-PRAELVRRLQEYERFKAAAERL-DRLPRLERDLFE--AGAGSDDIPVPKVY------PSIAMKDLLSAFQDVLKRLNHTR 190
>gi|134101743|ref|YP_001107404.1| segregation and condensation protein A [Saccharopolyspora erythraea NRRL 2338] >gi|133914366|emb|CAM04479.1| segregation and condensation protein A [Saccharopolyspora erythraea NRRL 2338] (286 aa)
Score = 151, Expect = 2.9e-08, Identities = 32/99 (32%), Positives = 57/99 (57%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDT--EEKISKDIERDKYIQRLLVYKQYQEI 131
           + F GPF+L   LI + ++D+  + L +V   ++ Y         +D+ TE+L++A  LL+ K+ R+LP+ D   EE ++    RD    RLL Y+ Y+++
  S:    29 ENFEGPFDLLLQLISQHQLDVTEVALHKVTDEFIAYTKALGEHWDLDETTEFLVVAATLLDLKAARLLPAADVEDEEDLALLEARDLLFARLLQYRAYKQV 129
>gi|167948925|ref|ZP_02535999.1| hypothetical protein Epers_21389 [Endoriftia persephone 'Hot96_1+Hot96_2'] (234 aa)
Score = 151, Expect = 3.1e-08, Identities = 63/237 (26%), Positives = 115/237 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LIK + +DILNI + E+ + Y+ YI   + +L+++   EYL+MA  L E KS+ +LP   +E++   D  R + I+RL  Y++Y++      E +++ SR+     Q     ++ L E +     P + L  +L A + V  +       +  ++ + + +     ++ V  E              SF D F  + D +  +   VV F+A+L L++   ++L QN
  S:    10 FEGPLDLLLYLIKRQNLDILNIPIAEITEQYIQYI-EMMEELRLELAAEYLVMAAMLAEIKSRMLLPRQSSEDEDEAD-PRAELIRRLQEYERYKQAA----EDIDQLSRIGRDNFQG----QAELIERKQEVREPDISLQELLLAFKDVLQRADMFTSHRVEREALSVRERMSQILERVNGE--------------SFCD-FSTLFDVEEGRPGVVVTFLAVLELIKGSLLELVQN 221
>gi|118727478|ref|ZP_01576077.1| chromosome segregation and condensation protein ScpA [Clostridium cellulolyticum H10] >gi|118663121|gb|EAV69783.1| chromosome segregation and condensation protein ScpA [Clostridium cellulolyticum H10] (267 aa)
Score = 151, Expect = 3.1e-08, Identities = 72/256 (28%), Positives = 137/256 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRM-FEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTK---SPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV-KIDKEVESNE 290
           F GPF+L + L ++ ++DI +I +  +   Y+DY+   + +L ++  +E+L+MA  LL  KS+ +LPS   E +  KD  R++ ++RL+ Y++Y+E   +L E  ++  R+ F  P       E+L    ++      M++D  L  +++ YL L+   K K     K+  KL++  ++S+    +E+ + L     +YK+SF  + +    +  +K   V  F+AIL L +   +++ QN    +I ++     E E NE
  S:    16 FEGPFDLLFHLFEKNQVDIYDIPISIITDQYLDYLYA-MQQLDLEVASEFLIMAATLLHIKSRTLLPSKKEEIQEEKD-PREELVRRLVEYRRYKEFTQELKEMEKKWGRVTFRLP-------ETLDLPVREE----IMEIDPQL--LRQQYLALLDRNKKKMNLGAKNITKLVEHEKVSLRSKMREVVKHL-----IYKVSF-KFSELFSFKTKSKTEVVTGFMAILELAKMKKVKIVQNQQFSDIHVISNTQNEKEDNE 255
>gi|95931322|ref|ZP_01314037.1| chromosome segregation and condensation protein ScpA [Desulfuromonas acetoxidans DSM 684] >gi|95132623|gb|EAT14307.1| chromosome segregation and condensation protein ScpA [Desulfuromonas acetoxidans DSM 684] (266 aa)
Score = 151, Expect = 3.2e-08, Identities = 34/117 (29%), Positives = 72/117 (61%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           + F+GP +L   L+ + +MDI +I++ ++ + Y++Y++  + +  +D  +E+L+MA  L+  KS+ +LP  D +E    +I+ R + +QRLL Y++Y++   +L    +    +F +P
  S:    18 ESFDGPLDLLLHLVHKNEMDIYDISMAQITRQYLEYLDQ-MKEHNLDIASEFLVMAATLMHIKSRMLLPRRDPDEGEEDEIDPRAELVQRLLEYRRYKDGAEQLEGYPQLNRDVFVRP 134
>gi|167766350|ref|ZP_02438403.1| hypothetical protein CLOSS21_00854 [Clostridium sp. SS2/1] >gi|167711941|gb|EDS22520.1| hypothetical protein CLOSS21_00854 [Clostridium sp. SS2/1] (246 aa)
Score = 151, Expect = 3.3e-08, Identities = 67/251 (26%), Positives = 132/251 (52%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTK--SPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           DI    F GP +L   LI++ K+DI +I + E+   Y+DYI + + +  +D ++++L+MA  LL+ K+K +LP    EE+  +   R++ ++RL+ YK Y+    +L E    R  M EK      D    +  +++      M  +V L+ + +V+  ++  ++ K    +     I   EI ++D   E+  ++  +  +        F ++ +E+ TK   +V F+A+L L++ G I ++Q + +++IFI
  S:     4 DIKVNAFEGPLDLLLHLIEKNKVDIYDIPISEITSQYLDYIRS-MEEEDLDVMSDFLVMAATLLKIKAKMLLPV--KEEEEEEGDPREELVRRLIEYKIYKYASLQLKE----REMMAEKSFFRSPDIPPQVLAYREEIDPVQMLSEVTLQRISEVFQFVMRKRQDKLDPIRSEFGEIKQEEIKLEDKITEVYNYIIQYKEV-------NFYDLLNEQETKEAVIVTFLAVLELMKTGKIYVQQENIEDDIFI 242
>gi|122879162|ref|YP_200802.6| hypothetical protein XOO2163 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|166712397|ref|ZP_02243604.1| hypothetical protein Xoryp_13315 [Xanthomonas oryzae pv. oryzicola BLS256] (301 aa)
Score = 151, Expect = 3.3e-08, Identities = 42/110 (38%), Positives = 66/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL---PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +L   PS D EE    D  R + ++RL  Y+++++    L + L R  R
  S:    54 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQDGEE----DDPRAELVRRLQEYERFKQAAEDL-DTLPRMGR 160
>gi|170760873|ref|YP_001787183.1| segregation and condensation protein A [Clostridium botulinum A3 str. Loch Maree] >gi|169407862|gb|ACA56273.1| segregation and condensation protein A [Clostridium botulinum A3 str. Loch Maree] (248 aa)
Score = 150, Expect = 3.7e-08, Identities = 64/245 (26%), Positives = 127/245 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE--DKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F+GPF+L   LIK+ KM+I ++++ E+   Y+ Y+N  + +L ++  +E+++MA  L+E KSK +LP ++ E++  ++  + + + +LL YK+++          +     F K  +  E  +KE+  +E   N         V + ++   Y  L+ +K +    +NV+     ++    +E +I+   +      K  F D+ K    E   K   VV F+AIL L++   IQ+ Q+++  +I+I
  S:    10 FDGPFDLLLHLIKKNKMEIYDVSIYEITNQYLQYLNQ-MEELDLEITSEFIVMAATLIEIKSKYLLPKVEEEKEEEENDPQKELLNKLLEYKKFKAAAEFFKNCQQISGTSFSKKPEIIEVKNKETTTEELLKN---------VTMLSLYNTYNDLI-SKYSNKMNENVEFKGEIQLDKYKIEDKIKYIGKKITSKEKWLFSDFIK----ECSCKMEIVVTFLAILELIKLKTIQVYQSNNFNDIYI 241
>gi|158316821|ref|YP_001509329.1| chromosome segregation and condensation protein ScpA [Frankia sp. EAN1pec] >gi|158112226|gb|ABW14423.1| chromosome segregation and condensation protein ScpA [Frankia sp. EAN1pec] (354 aa)
Score = 150, Expect = 3.7e-08, Identities = 35/116 (30%), Positives = 60/116 (51%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP---SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           + F+GPF+L  SLI + ++D+  + L +V   ++ +I        +   TE+L++A  LL+ K+ R+LP   S D  E ++    RD    RLL Y+ Y+E        +   SR   +
  S:    53 ENFSGPFDLLLSLIAKHRLDVTEVALSQVTDEFIAHIRRLGKHFDLGQATEFLVIAATLLDLKAARLLPGAISDDEAEDLALLEARDLLFARLLQYRAYKEAAAIFTAMMALESRFVPR 171
>gi|160871930|ref|ZP_02062062.1| ScpA/B protein [Rickettsiella grylli] >gi|159120729|gb|EDP46067.1| ScpA/B protein [Rickettsiella grylli] (266 aa)
Score = 150, Expect = 3.8e-08, Identities = 61/236 (25%), Positives = 110/236 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR-MFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           F GP +L   LIK++  DIL+I + E+ + Y+ YI   +  L+I+   EYL+MA  L E KSK +LP     +   +   R + I RL  Y++ ++    L ++L R  R +F    ++         +F  N+++  + L+ ++ A Q V  +          ++ +            +E+ I +         +I F++ FK     +  +R  V+ F+A+L L R   I+L Q
  S:    44 FTGPLDLLLYLIKKQNFDILDIPVAEITRQYIRYI-ELMQNLEIELAAEYLVMAAVLTELKSKLLLPKPVEIQATDETDPRAELISRLQEYERTKQAAQNL-DQLPRLGRDVFLAMVEA---------KFSSNTHISHLVLEELVVAFQSVLARAALKTHHAIAEEPLS-----------IEERIVQIKRQLATRSEIKFIELFK----REEGRRGVVITFMALLELWRQAFIELSQ 254
>gi|124266349|ref|YP_001020353.1| condensin subunit ScpA [Methylibium petroleiphilum PM1] >gi|124259124|gb|ABM94118.1| condensin subunit ScpA [Methylibium petroleiphilum PM1] (283 aa)
Score = 150, Expect = 3.9e-08, Identities = 64/245 (26%), Positives = 120/245 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD--LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  +IL+I + +V + Y+ Y++    +  ++   EYLLMA  L+E KS+ +LP   +EE    +  R + ++RLL Y+Q +    +L ++L +  R F +     E  +SL   F D +     D  LD++ +A      +LV   K    + +V+      +S+     + R F+E             F+++ + +   +  VV F+A+L L R   I+L Q  +   +++
  S:    57 FEGPLDLLLYLIRKQNFNILDIPMADVTRQYLAYVDQIRDR-NLELAAEYLLMAAMLIEIKSRMLLPPKRSEEGKEAEDPRAELVRRLLEYEQIKAAAARL-DQLPQLGRDFLRAQVHIE--QSLTPRFPDVNVEELRDAWLDILKRA------RLVQHHKITREELSVR----EHMSLVLRRLQGRRFVE-------------FEDLFETQRGPQVMVVTFIAMLELAREHLIELTQAEAFAPLYV 276
>gi|170691992|ref|ZP_02883156.1| chromosome segregation and condensation protein ScpA [Burkholderia graminis C4D1M] >gi|170143276|gb|EDT11440.1| chromosome segregation and condensation protein ScpA [Burkholderia graminis C4D1M] (449 aa)
Score = 150, Expect = 3.9e-08, Identities = 65/245 (26%), Positives = 115/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDL-----DVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V   Y+ Y++  L +  ++  +EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V + DL     DVI +A      KLV   K          I   E+S+ +    I   L+    +      D  K +P         VV F+A+L L R   +++ Q      I++
  S:   131 FEGPLDLLLYLIRKQNFNVLDIPMADVTVQYLGYVDQ-LRQTNLELASEYLLMAAMLIEIKSRMLLPVKKVDSGEEAEDPRAELVRRLLEYEQ-MKLAAQRIDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNSEDLRAAWADVIKRA------KLVQHHK----------ISREELSVREHMSSILRQLQSARFMEFAELFDTGKGVP-------VVVVNFIAVLELCRESLVEITQAEPFAPIYV 350
>gi|119716721|ref|YP_923686.1| condensin subunit ScpA [Nocardioides sp. JS614] >gi|119537382|gb|ABL81999.1| condensin subunit ScpA [Nocardioides sp. JS614] (309 aa)
Score = 150, Expect = 4.4e-08, Identities = 39/128 (30%), Positives = 68/128 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYIN-----NYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDT--EEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKE 162
           F GPF+L  +LI + K+DI  ++L  V   ++ ++      +   +  ++  T +LL+A+ LL+ K+ R+LP  D   EE ++    RD    RLL Y+ ++++   L  +L   SR   +     E    LL E
  S:    22 FEGPFDLLLNLIAKHKLDITEVSLSTVTDEFIAHVRAGGSPDNPAQWDLEQTTSFLLVASTLLDLKAARLLPQGDVEDEEDLALLEARDLLFARLLQYRAFKQVAAVLATRLASESRRHPRAVGLEERYAGLLPE 156
>gi|73662566|ref|YP_301347.1| hypothetical protein SSP1257 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581640|sp|Q49XU3|SCPA_STAS1 Segregation and condensation protein A >gi|72495081|dbj|BAE18402.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (244 aa)
Score = 149, Expect = 4.5e-08, Identities = 71/247 (28%), Positives = 120/247 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKL-VTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ YI+  + +L+I+  +EYL+MA+ LL  KSK +LP  +  E +  D  RD+ + RL+ Y+ Y+     L E+   R+  F K        ES      DN+    +DL  ++ A QKV  ++   T KT   +     I  +   + D  K+         H     F  +    P E       V  F+AIL + ++G + +EQ  S ++I I++
  S:     9 FNGPLDLLLHLIQKIEIDIYDIPMKALTEQYMQYIHT-MNQLEINIASEYLVMASELLMIKSKMLLPQTNEVEDLDDD-PRDELVDRLIEYQNYKAYTEFLNERKVERALYFSKHPTDLSHLESNETWSPDNT----IDLTELIIAYQKVKNRVEFHTPKTVDIRKETFTIQQATSQVTDKLKQ---------HESFNFFSLFNFTEPIE-----MVVTHFLAILEMSKSGIVNIEQAKSFDDINILR 236
>gi|56749562|sp|Q6GGK3|SCPA_STAAR Segregation and condensation protein A (243 aa)
Score = 149, Expect = 4.6e-08, Identities = 68/247 (27%), Positives = 122/247 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVP--AMDLDVILKAMQKV--YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL++A+ LL  KSK +LP   ++  +  D  R+  + RL+ Y+ Y+E    L +  E R   F K        E+      D S+ P   +DL  ++ A Q+V   ++L T K  +  K+          +I    +++   L+   H    S   + + I          V  F+AIL + + G I +EQ  + E+I IV+
  S:     9 FNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHA-MKQLEINIASEYLVLASELLMIKSKMLLPQSTSDIDVDDD-PREDLVGRLIEYQNYKEYTAILNDMKEERDFYFTKRPTELSHLET------DESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKET--------FTIQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQ-------VVTHFLAILEMSKAGIINIEQQRNFEDINIVR 236
>gi|57650451|ref|YP_186380.1| hypothetical protein SACOL1538 [Staphylococcus aureus subsp. aureus COL] >gi|87162142|ref|YP_494141.1| hypothetical protein SAUSA300_1445 [Staphylococcus aureus subsp. aureus USA300] >gi|88195300|ref|YP_500104.1| hypothetical protein SAOUHSC_01589 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267979|ref|YP_001246922.1| hypothetical protein SaurJH9_1552 [Staphylococcus aureus subsp. aureus JH9] >gi|150394044|ref|YP_001316719.1| hypothetical protein SaurJH1_1583 [Staphylococcus aureus subsp. aureus JH1] >gi|168726918|ref|ZP_02759195.1| chromosome segregation and condensation protein ScpA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122539458|sp|Q2FY76|SCPA_STAA8 Segregation and condensation protein A >gi|123485740|sp|Q2FGN7|SCPA_STAA3 Segregation and condensation protein A >gi|189046139|sp|A6U1W4|SCPA_STAA2 Segregation and condensation protein A >gi|189046140|sp|A5IT23|SCPA_STAA9 Segregation and condensation protein A >gi|41017862|sp|P60223|SCPA_STAAM Segregation and condensation protein A >gi|41017863|sp|P60224|SCPA_STAAN Segregation and condensation protein A >gi|41017864|sp|P60225|SCPA_STAAW Segregation and condensation protein A >gi|56749515|sp|Q6G969|SCPA_STAAS Segregation and condensation protein A >gi|81694451|sp|Q5HFS7|SCPA_STAAC Segregation and condensation protein A >gi|57284637|gb|AAW36731.1| segregation and condensation protein A [Staphylococcus aureus subsp. aureus COL] >gi|87128116|gb|ABD22630.1| segregation and condensation protein A [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202858|gb|ABD30668.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741048|gb|ABQ49346.1| condensin subunit ScpA [Staphylococcus aureus subsp. aureus JH9] >gi|149946496|gb|ABR52432.1| chromosome segregation and condensation protein ScpA [Staphylococcus aureus subsp. aureus JH1] (243 aa)
Score = 149, Expect = 4.6e-08, Identities = 67/247 (27%), Positives = 122/247 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVP--AMDLDVILKAMQKV--YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL++A+ LL  KSK +LP   ++  +  D  R+  + RL+ Y+ Y+E    L +  E R   F K        E+      D S+ P   +DL  ++ A Q+V   ++L T K  +  K+          +I    +++   L+   H    S   + + I          V  F+AIL + + G I +EQ  + E+I I++
  S:     9 FNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHA-MKQLEINIASEYLVLASELLMIKSKMLLPQSTSDMDVDDD-PREDLVGRLIEYQNYKEYTAILNDMKEERDFYFTKRPTDLSHLET------DESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKET--------FTIQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQ-------VVTHFLAILEMSKAGIINIEQQRNFEDINIIR 236
>gi|149374980|ref|ZP_01892753.1| Excinuclease ABC, B subunit [Marinobacter algicola DG893] >gi|149360869|gb|EDM49320.1| Excinuclease ABC, B subunit [Marinobacter algicola DG893] (277 aa)
Score = 149, Expect = 4.9e-08, Identities = 47/150 (31%), Positives = 85/150 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKL--MEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKV 184
           F GP +L   LI+ + MDIL+I++ E+ + Y+DYI   +  ++ +   EYL+MA  L E KS+ +LP  ++E++  +DI+ R + I+RL  Y+++++    +  + +LER + +            + L     +   P +DL  IL A+Q V
  S:    53 FEGPLDLLLYLIRRQNMDILDIDVSEITKQYMDYIGA-VEAMRFELAAEYLVMAATLAEIKSRMLLPRQESEDE--EDIDPRAELIRRLQQYERFKQAAEDIDDLPRLERDNFV----------ASAALPRMPSSQPHPDVDLREILFALQGV 192
>gi|84623689|ref|YP_451061.1| hypothetical protein XOO_2032 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367629|dbj|BAE68787.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] (279 aa)
Score = 149, Expect = 4.9e-08, Identities = 42/110 (38%), Positives = 66/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL---PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +L   PS D EE    D  R + ++RL  Y+++++    L + L R  R
  S:    32 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQDGEE----DDPRAELVRRLQEYERFKQAAEDL-DTLPRMGR 138
>gi|77748646|ref|NP_642633.2| hypothetical protein XAC2316 [Xanthomonas axonopodis pv. citri str. 306] (301 aa)
Score = 149, Expect = 5.2e-08, Identities = 38/110 (34%), Positives = 66/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP   +++   +D  R + ++RL  Y+++++    L + L R  R
  S:    54 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQDGEEED-PRAELVRRLQEYERFKQAAEDL-DTLPRMGR 160
>gi|92112977|ref|YP_572905.1| condensin subunit ScpA [Chromohalobacter salexigens DSM 3043] >gi|91796067|gb|ABE58206.1| condensin subunit ScpA [Chromohalobacter salexigens DSM 3043] (304 aa)
Score = 148, Expect = 5.9e-08, Identities = 59/238 (24%), Positives = 112/238 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNS 272
           F GP +L   LI+ + +DIL+I++  +   Y++Y+   +  L+ID   EYLLMA  L E KS+ +LP     +    +  R + I+RL  Y+Q + +  + ++ L R  R +          ++ L   +     P ++LD +L A+  +   L   +  +S + + +++   E  +  +E+   +   PF  L+ +            +  +   VV F+AIL L +   I + QN+
  S:    51 FEGPLDLLLYLIRRQNLDILSIDVAAITHQYIEYVE-LMRALEIDLAGEYLLMAAMLAEIKSRSLLPRPPKGDDEDDEDPRAELIRRLQEYEQLK-LAAEGLDALPREGRDWVV-------AQAALPSLETRVIHPEVELDELLHALSGL---LKRAEFQQSHQISREVLSTRERMLRIMERLEGQRYVPFEALFTL------------EEGRAGVVVTFMAILELAKEAMIDITQNA 264
>gi|29376102|ref|NP_815256.1| segregation and condensation protein A [Enterococcus faecalis V583] >gi|41017981|sp|Q834U4|SCPA_ENTFA Segregation and condensation protein A >gi|29343564|gb|AAO81326.1| conserved hypothetical protein [Enterococcus faecalis V583] (264 aa)
Score = 148, Expect = 5.9e-08, Identities = 62/253 (24%), Positives = 126/253 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD-----TEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVE 287
           F GP +L   LI++ ++DI +I +  V + Y+ YI+   T L+++   EYL+MA  L+  KS+ +LP  +      E+   ++  R+  + +LL Y++++     L EK E R   + K     +D +      ++++ +P   ++ I   +   +  ++  KK + P +     D  ++SI++    I E +        +SF  +F     + ++K+  V  F+A+L L++ G I  EQ ++   I +   + + E
  S:    14 FEGPLDLLLHLIQKLEIDIYDIPITAVTEQYMSYIHAMQT-LELEVAGEYLVMAATLMAIKSQMLLPKQELEIIDDEDFFEEEDPREALVAQLLEYRKFKYAATVLHEKEEERKLYYTKEPMDMDDYK------EEDTTLPPNQINTI--DLFLAFHAMLEKKKNRQPVETTVASD--DVSIEEKISAISERMRQVQKGKAVSFDSFF-----DSYSKQEIVTTFMALLELMKTGAIYAEQENNYSEILLFNTETQQE 255
>gi|170017035|ref|YP_001727954.1| segregation and condensation protein A [Leuconostoc citreum KM20] >gi|169803892|gb|ACA82510.1| Segregation and condensation protein A [Leuconostoc citreum KM20] (258 aa)
Score = 148, Expect = 6.0e-08, Identities = 63/246 (25%), Positives = 122/246 (49%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           EF GP +L   LIK+ ++DI ++ +  + + Y+ +I    + +++D  +EYL+MA  L++ KS  +LP+ DT E    +++    ++  + +LL YKQ+Q     L E+     + F + P  S E  +  +K        P ++    L  +Q  +  L+  K+ + P    + +   + ++      I + L+  P    I+F D F+N+ D    K   V+ F+A+L + +   I   Q  +  +IF+
  S:    16 EFEGPLDLLLHLIKKAELDIFDLPIAVITEQYLSFIQKQQS-MQLDVTSEYLVMAATLVQIKSSDLLPN-DTIEVNDIEVDFLDPKETLMLQLLTYKQFQVASESLRERENTNQQSFSRLPALSPEFNQMAIKPL-----APGLE----LIDLQVAFEHLLRKKRQQQPIS--RRVVSEKFTLTMAFDYIAQQLQGQPRGAVIAFDDLFENMAD----KEAMVMIFLALLEMAKETKISFHQADASADIFL 249
>gi|49483745|ref|YP_040969.1| hypothetical protein SAR1571 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241874|emb|CAG40567.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] (251 aa)
Score = 148, Expect = 6.6e-08, Identities = 68/247 (27%), Positives = 122/247 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVP--AMDLDVILKAMQKV--YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL++A+ LL  KSK +LP   ++  +  D  R+  + RL+ Y+ Y+E    L +  E R   F K        E+      D S+ P   +DL  ++ A Q+V   ++L T K  +  K+          +I    +++   L+   H    S   + + I          V  F+AIL + + G I +EQ  + E+I IV+
  S:    17 FNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHA-MKQLEINIASEYLVLASELLMIKSKMLLPQSTSDIDVDDD-PREDLVGRLIEYQNYKEYTAILNDMKEERDFYFTKRPTELSHLET------DESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKET--------FTIQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQ-------VVTHFLAILEMSKAGIINIEQQRNFEDINIVR 244
>gi|15924485|ref|NP_372019.1| hypothetical protein SAV1495 [Staphylococcus aureus subsp. aureus Mu50] >gi|15927076|ref|NP_374609.1| hypothetical protein SA1326 [Staphylococcus aureus subsp. aureus N315] >gi|21283178|ref|NP_646266.1| hypothetical protein MW1449 [Staphylococcus aureus subsp. aureus MW2] >gi|49486333|ref|YP_043554.1| hypothetical protein SAS1435 [Staphylococcus aureus subsp. aureus MSSA476] >gi|151221615|ref|YP_001332437.1| hypothetical protein NWMN_1403 [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979814|ref|YP_001442073.1| hypothetical protein SAHV_1483 [Staphylococcus aureus subsp. aureus Mu3] >gi|161509723|ref|YP_001575382.1| hypothetical protein USA300HOU_1496 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|13701294|dbj|BAB42588.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247266|dbj|BAB57657.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|21204618|dbj|BAB95314.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49244776|emb|CAG43212.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|150374415|dbj|BAF67675.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156721949|dbj|BAF78366.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160368532|gb|ABX29503.1| possible segregation and condensation protein A [Staphylococcus aureus subsp. aureus USA300_TCH1516] (251 aa)
Score = 148, Expect = 6.9e-08, Identities = 67/247 (27%), Positives = 122/247 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVP--AMDLDVILKAMQKV--YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL++A+ LL  KSK +LP   ++  +  D  R+  + RL+ Y+ Y+E    L +  E R   F K        E+      D S+ P   +DL  ++ A Q+V   ++L T K  +  K+          +I    +++   L+   H    S   + + I          V  F+AIL + + G I +EQ  + E+I I++
  S:    17 FNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHA-MKQLEINIASEYLVLASELLMIKSKMLLPQSTSDMDVDDD-PREDLVGRLIEYQNYKEYTAILNDMKEERDFYFTKRPTDLSHLET------DESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKET--------FTIQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQ-------VVTHFLAILEMSKAGIINIEQQRNFEDINIIR 244
>gi|82751088|ref|YP_416829.1| hypothetical protein SAB1356c [Staphylococcus aureus RF122] >gi|82656619|emb|CAI81045.1| conserved hypothetical protein [Staphylococcus aureus RF122] (251 aa)
Score = 148, Expect = 7.0e-08, Identities = 68/247 (27%), Positives = 122/247 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVP--AMDLDVILKAMQKV--YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL++A+ LL  KSK +LP   ++  +  D  R+  + RL+ Y+ Y+E    L +  E R   F K        E+      D S+ P   +DL  ++ A Q+V   ++L T K  +  K+          +I    +++   L+   H    S   + + I          V  F+AIL + + G I +EQ  + E+I IV+
  S:    17 FNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHA-MKQLEINIASEYLVLASELLMIKSKMLLPQSTSDMDVDDD-PREDLVGRLIEYQNYKEYTAILNDMKEERDFYFTKRPTDLSHLET------DESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKET--------FTIQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQ-------VVTHFLAILEMSKAGIINIEQQRNFEDINIVR 244
>gi|9107647|gb|AAF85250.1|AE004054_2 conserved hypothetical protein [Xylella fastidiosa 9a5c] (338 aa)
Score = 148, Expect = 7.1e-08, Identities = 36/107 (33%), Positives = 64/107 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           F GP +L   LI+ + ++IL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP     E    +  R + ++RL  Y+++++    L  + +L+R
  S:    90 FEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPNIENEEGEDPRAELVRRLQEYERFKQAAEDLDALPRLDR 197
>gi|21108563|gb|AAM37169.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] (279 aa)
Score = 147, Expect = 8.0e-08, Identities = 38/110 (34%), Positives = 66/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP   +++   +D  R + ++RL  Y+++++    L + L R  R
  S:    32 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQDGEEED-PRAELVRRLQEYERFKQAAEDL-DTLPRMGR 138
>gi|27468097|ref|NP_764734.1| hypothetical protein SE1179 [Staphylococcus epidermidis ATCC 12228] >gi|27315643|gb|AAO04778.1|AE016748_12 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] (266 aa)
Score = 147, Expect = 8.1e-08, Identities = 66/247 (26%), Positives = 121/247 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVP--AMDLDVILKAMQKV--YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL+MA+ LL  KSK +LP    EE I +D  R+  + RL+ Y+ Y+E    L    E R   F K        E+      + S+ P   +DL  ++ A Q+V   ++L T K  +  K+          +I     ++ E L+        S   + + +          V  F+AIL + ++G + ++Q    ++I I++
  S:    32 FNGPLDLLLHLIQKYEIDIYDIPMKALTEQYMQYVHA-MNQLEINVASEYLVMASELLMIKSKLLLPQTSIEEDIEED-PREDLVGRLIEYQNYKEYTEILNTMKEERDLYFTKHPTDLTHLET------NESWDPNQTIDLTELIVAYQRVKNRVELNTPKSVEIKKET--------FTIQQATAQVTERLKQHESFNFFSLFTFHEPVEQ-------VVTHFLAILEMSKSGIVNIKQTKQFDDIDIIR 259
>gi|78048071|ref|YP_364246.1| hypothetical protein XCV2515 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78036501|emb|CAJ24192.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] (279 aa)
Score = 147, Expect = 8.2e-08, Identities = 38/110 (34%), Positives = 66/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +DIL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP   +++   +D  R + ++RL  Y+++++    L + L R  R
  S:    32 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQDGEEED-PRAELVRRLQEYERFKQAAEDL-DTLPRMGR 138
>gi|187779542|ref|ZP_02996015.1| hypothetical protein CLOSPO_03138 [Clostridium sporogenes ATCC 15579] >gi|187773167|gb|EDU36969.1| hypothetical protein CLOSPO_03138 [Clostridium sporogenes ATCC 15579] (248 aa)
Score = 147, Expect = 9.4e-08, Identities = 64/245 (26%), Positives = 126/245 (51%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE--DKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F+GPF+L   LIK+ KM+I ++++ E+   Y+ Y+N  + +L ++  +E+++MA  L+E KSK +LP ++ E++  ++  + + + +LL YK+++        + +     F K  +  E  +KE+  +E   N         V + ++   Y  L+ +K +    +NV+     ++    +E +I    +      K  F D+ K    E   K   VV F+AIL L++   IQ+ Q+++  +I I
  S:    10 FDGPFDLLLHLIKKNKMEIYDVSIYEITNQYLQYLNR-MEELDLEITSEFIVMAATLIEIKSKYLLPKVEEEKEEEENDPQKELLDKLLEYKKFKAAAEFFKTRQKISGTSFSKKPEIIEVKNKETTTEELLKN---------VTMLSLYNTYNDLI-SKYSNKMNENVEFKGEIQLDKYKIEDKIEYIGKKISSKEKWLFSDFIK----ECSCKMEIVVTFLAILELIKLKTIQVYQSNNFNDIHI 241
>gi|57866962|ref|YP_188635.1| segregation and condensation protein A [Staphylococcus epidermidis RP62A] >gi|41018017|sp|Q8CSH0|SCPA_STAES Segregation and condensation protein A >gi|81674521|sp|Q5HP55|SCPA_STAEQ Segregation and condensation protein A >gi|57637620|gb|AAW54408.1| segregation and condensation protein A [Staphylococcus epidermidis RP62A] (243 aa)
Score = 147, Expect = 9.6e-08, Identities = 66/247 (26%), Positives = 121/247 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVP--AMDLDVILKAMQKV--YLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           FNGP +L   LI++ ++DI +I +  + + Y+ Y++  + +L+I+  +EYL+MA+ LL  KSK +LP    EE I +D  R+  + RL+ Y+ Y+E    L    E R   F K        E+      + S+ P   +DL  ++ A Q+V   ++L T K  +  K+          +I     ++ E L+        S   + + +          V  F+AIL + ++G + ++Q    ++I I++
  S:     9 FNGPLDLLLHLIQKYEIDIYDIPMKALTEQYMQYVHA-MNQLEINVASEYLVMASELLMIKSKLLLPQTSIEEDIEED-PREDLVGRLIEYQNYKEYTEILNTMKEERDLYFTKHPTDLTHLET------NESWDPNQTIDLTELIVAYQRVKNRVELNTPKSVEIKKET--------FTIQQATAQVTERLKQHESFNFFSLFTFHEPVEQ-------VVTHFLAILEMSKSGIVNIKQTKQFDDIDIIR 236
>gi|163841328|ref|YP_001625733.1| segregation and condensation protein [Renibacterium salmoninarum ATCC 33209] >gi|162954804|gb|ABY24319.1| segregation and condensation protein [Renibacterium salmoninarum ATCC 33209] (286 aa)
Score = 147, Expect = 9.7e-08, Identities = 66/257 (25%), Positives = 114/257 (44%)
  Q:    16 ESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNY----------LTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNS 272
           E ++ T F + + +     F GPF+L   LI + ++DI  + L  V   ++ YI             LT   +D+ +E+L++A  LL+ K+ R+LP   ++ EE I+    RD    RLL YK  +++            R FE+  Q    + SL   F       A+  ++I K   + +  L    K   P++ +   +V    +      ++E  E      K      F+ +  +  T    V  F+A+L + R+  I  EQ S
  S:     7 EPVSKTRFEVRLNN-----FTGPFDLLLGLIGKHELDITEVALATVTDEFISYIRAMQRADGETGAGLTIGALDEASEFLVIAATLLDLKAARLLPQGEVEDEEDIALLEARDLLFARLLQYKALKQVATLF-------GRTFEQEGQCSPRQVSLEAPFA------ALLPELIWKYTPEQFATLAA--KALMPREPLP-TEVGLAHLHAPAVSVKEQAEIIGGRLKAGKALSFRTLVQDAETTLVVVARFLALLEMFRDAVIAFEQAS 254
>gi|167745573|ref|ZP_02417700.1| hypothetical protein ANACAC_00264 [Anaerostipes caccae DSM 14662] >gi|167654885|gb|EDR99014.1| hypothetical protein ANACAC_00264 [Anaerostipes caccae DSM 14662] (268 aa)
Score = 146, Expect = 1.1e-07, Identities = 63/262 (24%), Positives = 131/262 (50%)
  Q:    23 FHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           F+++  DI    F GP +L   LI++ K+DI +I + E+ + Y+ YI   + +  +D ++++L+MA  LL  K+K +LP+ + +E+  +   R++ + RLL YK Y+    +L  +     ++F K     E+    +  ++    V  +  DV ++ + +++ + V  K+    +D +  I      I   E  + + +E   +L        F+ + + + TK   VV F+++L L++ G I+  Q    + I I  +++
  S:    11 FNMAAIDIKLNVFEGPLDLLLHLIEKNKVDIYDIPISEITEQYLAYIRE-MEEEDLDVMSDFLVMAATLLRIKAKMLLPAKEDDEE--EGDPREELVLRLLEYKIYKYASKELKAREYEAEKIFFKERAVPEE----VLRYRRPVDVREITRDVTMEDLNRIF-QFVMRKR----EDKIDPIRSKFGEIKQEEVRLEDKMEEVEYLISSRRRMSFRQLLEGQMTKEKVVVTFLSVLELMKVGKIRAVQEKIGQEIIIEVLER 260
>gi|76799031|ref|ZP_00781226.1| segregation and condensation protein A [Streptococcus agalactiae 18RS21] >gi|76585617|gb|EAO62180.1| segregation and condensation protein A [Streptococcus agalactiae 18RS21] (146 aa)
Score = 146, Expect = 1.2e-07, Identities = 39/123 (31%), Positives = 73/123 (59%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ 151
           DI  K+F GP +L   L+ + ++DI ++ +VEVI+ Y+ YI   L  ++++   EY+LMA+ L+  KS+ +LP +     I  D E +  + +L  Y++++ +  +L  + + R++ F KP Q
  S:     2 DIKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIAT-LQAMRLEVAGEYMLMASQLMLIKSRNLLPKVVESNPIEDDPEME-LLSQLEEYRRFKVLSEELANQHQERAKYFSKPKQ 122
>gi|118618584|ref|YP_906916.1| hypothetical protein MUL_3236 [Mycobacterium ulcerans Agy99] >gi|183982539|ref|YP_001850830.1| hypothetical protein MMAR_2524 [Mycobacterium marinum M] >gi|118570694|gb|ABL05445.1| conserved hypothetical protein [Mycobacterium ulcerans Agy99] >gi|183175865|gb|ACC40975.1| conserved hypothetical protein [Mycobacterium marinum M] (275 aa)
Score = 146, Expect = 1.2e-07, Identities = 36/128 (28%), Positives = 65/128 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKE 162
           F GPF+L   LI   ++D+  + L +V   ++ Y      +L +++ T +L++A  LL+ K+ R+LP+  MD EE ++    RD    RLL Y+ ++ +     E      R + +     +   +LL E
  S:    26 FEGPFDLLLQLIFAHRLDVTEVALHQVTDDFIAYTKAIGAQLDLEETTAFLVVAATLLDLKAARLLPAGRMDDEEDLALLEVRDLLFARLLQYRAFKHVAEMFAELEATALRSYPRGVSLEDRYATLLPE 155
>gi|83647426|ref|YP_435861.1| hypothetical protein HCH_04738 [Hahella chejuensis KCTC 2396] >gi|83635469|gb|ABC31436.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396] (292 aa)
Score = 145, Expect = 1.3e-07, Identities = 46/152 (30%), Positives = 81/152 (53%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKV 184
           + F GP +L   LI+ + MDIL+IN+ +V + Y+DYI   +  ++ +   EYL+MA  L E KS+ +LP    +++  +D  R + I+RL  Y++++    + M++L R  R F             + + Q     P + L  +L A+Q+V
  S:    50 ESFEGPLDLLLYLIRRQNMDILDINVSDVTRQYMDYI-RVMEDMRFELAAEYLVMAAMLAEIKSRFLLPRRKDDDQEEED-PRAELIRRLQEYERFKTAAER-MDELPRMDRDFYTANPE-------IPKLQREKKHPDVSLTEVLLALQEV 191
>gi|71901986|ref|ZP_00684035.1| Protein of unknown function DUF173 [Xylella fastidiosa Ann-1] >gi|71728253|gb|EAO30435.1| Protein of unknown function DUF173 [Xylella fastidiosa Ann-1] (302 aa)
Score = 145, Expect = 1.3e-07, Identities = 37/110 (33%), Positives = 63/110 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + ++IL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP     E    +  R + ++RL  Y+++++    L + L R  R
  S:    54 FEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPDIENEEGEDPRAELVRRLQEYERFKQAAEDL-DTLPRMDR 161
>gi|28199350|ref|NP_779664.1| hypothetical protein PD1469 [Xylella fastidiosa Temecula1] >gi|71276224|ref|ZP_00652503.1| Protein of unknown function DUF173 [Xylella fastidiosa Dixon] >gi|71898737|ref|ZP_00680906.1| Protein of unknown function DUF173 [Xylella fastidiosa Ann-1] >gi|170730716|ref|YP_001776149.1| segregation and condensation protein A [Xylella fastidiosa M12] >gi|182682076|ref|YP_001830236.1| chromosome segregation and condensation protein ScpA [Xylella fastidiosa M23] >gi|81438522|sp|Q87BI4|SCPA_XYLFT Segregation and condensation protein A >gi|28057456|gb|AAO29313.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] >gi|71162985|gb|EAO12708.1| Protein of unknown function DUF173 [Xylella fastidiosa Dixon] >gi|71731502|gb|EAO33564.1| Protein of unknown function DUF173 [Xylella fastidiosa Ann-1] >gi|167965509|gb|ACA12519.1| segregation and condensation protein A [Xylella fastidiosa M12] >gi|182632186|gb|ACB92962.1| chromosome segregation and condensation protein ScpA [Xylella fastidiosa M23] (302 aa)
Score = 145, Expect = 1.3e-07, Identities = 37/110 (33%), Positives = 63/110 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + ++IL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP     E    +  R + ++RL  Y+++++    L + L R  R
  S:    54 FEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPDIENEEGEDPRAELVRRLQEYERFKQAAEDL-DALPRMDR 161
>gi|77747605|ref|NP_299730.2| hypothetical protein XF2451 [Xylella fastidiosa 9a5c] >gi|158706360|sp|Q9PAP4|SCPA_XYLFA Segregation and condensation protein A (302 aa)
Score = 145, Expect = 1.3e-07, Identities = 36/107 (33%), Positives = 64/107 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           F GP +L   LI+ + ++IL+I + E+ + YVDYI N + +L+ +   EYL+MA  L E KS+ +LP     E    +  R + ++RL  Y+++++    L  + +L+R
  S:    54 FEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPNIENEEGEDPRAELVRRLQEYERFKQAAEDLDALPRLDR 161
>gi|191162844|ref|ZP_03024722.1| chromosome segregation and condensation protein ScpA [Geobacter sp. M21] >gi|190995959|gb|EDV71409.1| chromosome segregation and condensation protein ScpA [Geobacter sp. M21] (285 aa)
Score = 145, Expect = 1.4e-07, Identities = 65/247 (26%), Positives = 118/247 (47%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE--RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           +EF GP +L   LIK+ ++DI NI +  + + Y++Y+   + +L +D   E+L+MA  LL+ KS+ +LP+   EE    ++E  R + ++RLL Y++Y++    L  +      +F +   S E     L   +       ++L  +++A Q+V  ++          D    +    ISI D   E+   L    H  K    D    +     T+   VV F++IL L +   I++ Q  S  +I++
  S:    24 EEFEGPLDLLLHLIKKNELDIYNIPIAAITRQYLEYM-ELMKELNLDIAGEFLVMAATLLQIKSRMLLPATQ-EEDGEAEVEDPRAELVRRLLEYQRYRDASQLLSARNLLGRDVFARSFDSPE-----LAAMEPQEEPADVELFELIEAFQRVLARVSV--------DTFHDVVADGISIADRIGEVLSVL----HAEKTVCFDALFTV---GMTRDLLVVTFLSILELAKMKLIRVTQVESLGSIWL 250
>gi|15895331|ref|NP_348680.1| segregation and condensation protein A [Clostridium acetobutylicum ATCC 824] >gi|41018111|sp|Q97HF0|SCPA_CLOAB Segregation and condensation protein A >gi|15025048|gb|AAK80020.1|AE007709_4 Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum ATCC 824] (249 aa)
Score = 145, Expect = 1.4e-07, Identities = 68/254 (26%), Positives = 133/254 (52%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDK-YIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKI 282
           +I    F GPF+L   LI++ KMDI +I + ++   Y+ Y+N  + ++ ++  +E+++MA  L+E KSK +LP    EE+  ++ +  K  + +L+ YK+++     L  +      +F K  +  +D+     E  DN  +     D+ L  M K++ KL+   +++   +N  L D     I  +E ++ E  E      +I    YF NI ++   K   VV F+A+L L++   I++ Q+++ ++I+I ++
  S:     4 NINIDNFQGPFDLLLHLIRKNKMDIYDIKIFDITNQYIQYLNE-MKEMDLEITSEFIVMAATLIEIKSKYLLPKTKEEEEEKEESDPTKELVSKLVEYKKFKLAADFLKNRELDYGEVFSKKPEIIDDR----TEDADNKDILK---DITLLDMYKLFEKLMEMYRSRINTNN-SLPDKIAPDIYKIEDKMDEISEIIKSNKEI----YFSNIINKCSNKIEVVVTFLALLELIKLKDIKVYQSNNFKDIYIERV 245
>gi|121535747|ref|ZP_01667549.1| chromosome segregation and condensation protein ScpA [Thermosinus carboxydivorans Nor1] >gi|121305646|gb|EAX46586.1| chromosome segregation and condensation protein ScpA [Thermosinus carboxydivorans Nor1] (234 aa)
Score = 145, Expect = 1.5e-07, Identities = 47/188 (25%), Positives = 92/188 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTE-EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFL 222
           F GP  L   LI++ ++DI +I + +V + Y+ Y+  +  +  +D  +E+L+MA  LL+ KS+ +LP      E   ++  R + +++L+ Y++++++   L    E+R + F +P Q  +    L +          + LD ++ A   +          +S  DN  L+   EIS+ D   +I   L
  S:    11 FEGPLALLLHLIEKDQIDIYDIPIAQVTEQYIAYLKAW-EEFNLDIASEFLVMAATLLQIKSRMLLPRPPAAVETAEEEDPRQELVEKLVEYRKFKQLAALLQSMAEKRLKYFTRPPQELDVTPPLPQ---------GLKLDDLIMAFATIL---------ESAVDNYALVARDEISVQDKMYDIIHLL 180
>gi|118580109|ref|YP_901359.1| chromosome segregation and condensation protein ScpA [Pelobacter propionicus DSM 2379] >gi|118502819|gb|ABK99301.1| condensin subunit ScpA [Pelobacter propionicus DSM 2379] (272 aa)
Score = 145, Expect = 1.5e-07, Identities = 66/257 (25%), Positives = 128/257 (49%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           +F+GP +L   LI++ ++DI +I + ++ + Y++YI   +  L +D   ++LLMA+ LL+ KS  +LP  + E++  ++ + R + ++RLL Y++Y+E    +  +      +F +P    E    ++   Q+        L++ L  +   +  L++    +S  + V   DV  +SI D   EI   L+          M  F  +  + FT+   +V F+A+L L R   I++ QN    +I+ +    EV  +E
  S:    27 KFDGPLDLLLHLIRKNELDIRDIPIADITRQYLEYI-RLMKDLNLDVAGDFLLMASTLLQIKSAMLLPLDEQEQEGDEEADPRAELVRRLLEYQRYKEAGTLMGARALLGREVFTRPFCESE----IVAAHQEEG-----PLELELFDLVDAFRSLLSRIPVESFHE-VAAADV--LSIADSINEILGLLQERE-------MIAFDELVRDDFTRERVIVTFLALLELCRLRMIRIYQNRDQGSIWFLPAVVEVADDE 264
>gi|121997384|ref|YP_001002171.1| chromosome segregation and condensation protein ScpA [Halorhodospira halophila SL1] >gi|121588789|gb|ABM61369.1| condensin subunit ScpA [Halorhodospira halophila SL1] (275 aa)
Score = 145, Expect = 1.5e-07, Identities = 61/245 (24%), Positives = 122/245 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL--PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR-MFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+ + +DIL+I + E+ + Y++Y+   + +++++   EYL+MA  L E KS+ +L  P+   E++      R + I+RL  Y++++++  ++ ++L R  R +F    ++           Q  +  PA+ L  ++ A  +V  +    +  +  ++    I + E   D + +   E   PF  L+++          +E  T    VV F+A+L LVR   ++L Q  +   I+I
  S:    50 FEGPLDLLLYLIRRQNLDILDIPIAEITRQYMEYV-ELMREMRLELAAEYLVMAAMLAEIKSRMLLPRPAAAEEDEEEDHDPRAELIRRLQEYERFKKVAEQI-DELPRVGRDIFPAAAEA--------PACQPQAQPPAVSLRELVLAFSEVMRRAQLNENHQVERE---AISIRERMSDTLSRLNNERYTPFQALFQV----------EEGRTG--VVVTFLALLELVRESMVELVQADAFAPIYI 272
>gi|189424942|ref|YP_001952119.1| chromosome segregation and condensation protein ScpA [Geobacter lovleyi SZ] >gi|189421201|gb|ACD95599.1| chromosome segregation and condensation protein ScpA [Geobacter lovleyi SZ] (273 aa)
Score = 144, Expect = 1.7e-07, Identities = 59/245 (24%), Positives = 119/245 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTK-SPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI++ ++DI +I +  + + Y+DY+   + +L +D   ++L+MA+ LL+ KS+ +LP    +  E   ++  R + ++RL+ Y++Y++   +L  +      +F +P   G      L+ F  +     +DL  + +A  ++  K+   +  + + +D + ++D            I E L        + F   F+    E   K   +V F+A+L L R   +++ QNS    I+I
  S:    27 FEGPLDLLLHLIRKNEVDIYDIPIALITRQYLDYL-KLMKELNLDLAGDFLVMASTLLQIKSRMLLPLPDPEEGEGEEQEDPRAELVRRLIEYQRYRDAGLELGARELLGREVFVRPCADG----CCLEGFAGDDGPFELDLFELSEAFNRLLAKIPMARAHEVAGQDTLSIVDA-----------INEILTRLDGQDSMEFESLFQ----EDMGKERMIVTFLALLELCRIKLLKVIQNSRYGTIYI 254
>gi|54023977|ref|YP_118219.1| hypothetical protein nfa20090 [Nocardia farcinica IFM 10152] >gi|54015485|dbj|BAD56855.1| hypothetical protein [Nocardia farcinica IFM 10152] (306 aa)
Score = 144, Expect = 1.8e-07, Identities = 37/106 (34%), Positives = 66/106 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLK----------IDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLE 140
           F GPF+L  +LI  RK+D+  + L +V   ++ Y       ++          +D  TE+L++A  LL+ K+ R+LPS +  +  ++D+E    RD    RLL Y+ +++ V +L+ +LE
  S:    45 FEGPFDLLLTLISSRKLDVTEVALHQVTDEFIAYTKALTASMETTAGLRADKILDQTTEFLVVAATLLDLKAARLLPSGEMTD--AEDLELLEARDLLFARLLQYRAFKQ-VAELLGELE 161
>gi|148377983|ref|YP_001256859.1| segregation and condensation protein A [Mycoplasma agalactiae PG2] >gi|148292029|emb|CAL59421.1| Segregation and condensation protein A [Mycoplasma agalactiae PG2] (253 aa)
Score = 144, Expect = 2.0e-07, Identities = 55/190 (28%), Positives = 105/190 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTK----SPKDNVKLIDVSEISIDDVEKEI 218
           DI  + F+GP +L  +L++E+ ++I+++++ E+   Y+  I + L + +ID  ++YL+MA  LL  K+K +L + + + +I +D  + + ++RL  Y+Q +E+   L E+ E R  +F K P+   E      K   D S  P   + V+ K  ++ Y + +   K +    +PKD +  I     S D+V  E+
  S:    15 DIKLENFDGPLDLLLALVQEKNVNIMDVDVFELATAYLKIIED-LQENEIDVASDYLVMAATLLALKTKMLLFTPEQKPEIEED--KRELLRRLYEYQQIKEVTKVLREQEESRKEIFIKSPSNIDEFLVDDDKSALDGSSNPLKLITVLRKMFERTYAQQLRRTKLETFNLTPKDQIPFILNLFDSCDEVTFEM 206
>gi|83816607|ref|YP_445888.1| segregation and condensation protein A [Salinibacter ruber DSM 13855] >gi|83758001|gb|ABC46114.1| segregation and condensation protein A [Salinibacter ruber DSM 13855] (273 aa)
Score = 144, Expect = 2.0e-07, Identities = 55/242 (22%), Positives = 123/242 (50%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVA-FVAILVLVRNGHIQL--EQNSSD 274
           ++F GP +L    IK  ++DI +I +  +   Y+ Y+   + ++ +D + +++ MA  L+  K++ +LPS + +E       R + ++RLL Y +++E   +L  + ERR   F +   S  D+E + +  +       +++D  +  + +   +++   +     + +  ++  E ++++ ++ + E L   P   ++SF    +         R FV+A F+A+L L R  H++L  E+ +SD
  S:     7 EQFEGPMDLLLFFIKRDEIDIYDIPIARIADEYLAYVR-VMEEIDLDGVGDFIYMAALLINIKARMLLPSQEADEDGESVDPRRELVERLLEYVRFKEAADQLSTRRERRREHFVRGDAS-SDRERIEESHE-------VEVDASVYELVEALGRVLEADEEDEDDEPIHEVEPLEYTVEEQQQYVIERLRREP---QVSFRALIQG------ESRGFVIATFLALLELTRQQHLRLRIEERASD 233
>gi|169824531|ref|YP_001692142.1| hypothetical protein FMG_0834 [Finegoldia magna ATCC 29328] >gi|167831336|dbj|BAG08252.1| conserved hypothetical protein [Finegoldia magna ATCC 29328] (235 aa)
Score = 144, Expect = 2.0e-07, Identities = 42/119 (35%), Positives = 73/119 (61%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           I  +EFNGP +L  +L+++ K+DI N++L ++   +++ + N L      DLT+++ +A+ LL  KSK++LP  D +E     I+ D   QRL+ YK+++EI  +L+E     S+ F K
  S:     5 IETEEFNGPMDLLLNLVEKEKIDIENVDLAKITNKFIEEVEN-LKNHSTKDLTDFIYLASTLLYIKSKKLLPKNDFDE--DDQIDEDLIKQRLIEYKKFKEISKQLIELENISSKHFRK 120
>gi|84496361|ref|ZP_00995215.1| hypothetical protein JNB_02540 [Janibacter sp. HTCC2649] >gi|84383129|gb|EAP99010.1| hypothetical protein JNB_02540 [Janibacter sp. HTCC2649] (316 aa)
Score = 144, Expect = 2.0e-07, Identities = 59/236 (25%), Positives = 107/236 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTK----LKIDDLTEYLLMATYLLEQKSKRILPSM--DTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           F+GPF+L   LI + K+DI  I L +V   ++ +I     K      +   +++LL+A  LL+ K+ R+LP    + EE ++    RD    RLL Y+ +++I     E++    RM  +  Q+G        E Q    +P + + +  +A+  +  + +T K      D V L  +   ++      +RE         +   +  F+++  +       V  F+A+L L R   I  EQ
  S:    32 FSGPFDLLLGLISKHKLDITEIALSKVTDEFISHIKAEQAKGGDVWDLSQASDFLLVAATLLDIKAARLLPQTGPEDEEDLALIEARDLLFARLLQYRAFKDIARTFDERMTTAGRMTAR--QAG-------IEPQFAKLLPELIMTITPEALAMIAAQALTPKI----PDTVGLGHLHAPAV-----SVREQASIIGERLRREGVSSFRSLVRDADNTLVIVARFLALLELFRESSISFEQ 255
>gi|120598425|ref|YP_962999.1| chromosome segregation and condensation protein ScpA [Shewanella sp. W3-18-1] >gi|124548930|ref|ZP_01707398.1| chromosome segregation and condensation protein ScpA [Shewanella putrefaciens 200] >gi|146293496|ref|YP_001183920.1| chromosome segregation and condensation protein ScpA [Shewanella putrefaciens CN-32] >gi|120558518|gb|ABM24445.1| chromosome segregation and condensation protein ScpA [Shewanella sp. W3-18-1] >gi|124508194|gb|EAY52296.1| chromosome segregation and condensation protein ScpA [Shewanella putrefaciens 200] >gi|145565186|gb|ABP76121.1| chromosome segregation and condensation protein ScpA [Shewanella putrefaciens CN-32] (262 aa)
Score = 144, Expect = 2.1e-07, Identities = 37/109 (33%), Positives = 70/109 (64%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+   +YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+  +E   KL  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPIQQITAQYLEYIT-LLTQARIELAADYLVMAATLAEIKSRLLLPRMVAEDEVEED-PRAQLIRQLKAYEVIKEASQKLDDLPRLER 145
>gi|126174906|ref|YP_001051055.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS155] >gi|153001235|ref|YP_001366916.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS185] >gi|125998111|gb|ABN62186.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS155] >gi|151365853|gb|ABS08853.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS185] (262 aa)
Score = 144, Expect = 2.1e-07, Identities = 37/109 (33%), Positives = 70/109 (64%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+   +YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+  +E   KL  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPIQQITAQYLEYIT-LLTQARIELAADYLVMAATLAEIKSRLLLPRMVAEDEVEED-PRAQLIRQLKAYEVIKEASQKLDDLPRLER 145
>gi|15608847|ref|NP_216225.1| hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] >gi|15841169|ref|NP_336206.1| segregation and condensation protein A [Mycobacterium tuberculosis CDC1551] >gi|31792896|ref|NP_855389.1| hypothetical protein Mb1736 [Mycobacterium bovis AF2122/97] >gi|121637617|ref|YP_977840.1| hypothetical protein BCG_1748 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148661507|ref|YP_001283030.1| segregation and condensation protein [Mycobacterium tuberculosis H37Ra] >gi|148822915|ref|YP_001287669.1| hypothetical protein TBFG_11724 [Mycobacterium tuberculosis F11] >gi|167967187|ref|ZP_02549464.1| hypothetical protein MtubH3_03747 [Mycobacterium tuberculosis H37Ra] >gi|194543957|ref|YP_002078986.1| conserved hypothetical protein [Mycobacterium tuberculosis C] >gi|2326752|emb|CAB10966.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv] >gi|13881390|gb|AAK46020.1| segregation and condensation protein A [Mycobacterium tuberculosis CDC1551] >gi|31618487|emb|CAD94439.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] >gi|121493264|emb|CAL71735.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600964|gb|EAY59974.1| conserved hypothetical protein [Mycobacterium tuberculosis C] >gi|134150062|gb|EBA42107.1| conserved hypothetical protein [Mycobacterium tuberculosis str. Haarlem] >gi|148505659|gb|ABQ73468.1| segregation and condensation protein [Mycobacterium tuberculosis H37Ra] >gi|148721442|gb|ABR06067.1| conserved hypothetical protein [Mycobacterium tuberculosis F11] (278 aa)
Score = 144, Expect = 2.1e-07, Identities = 31/103 (30%), Positives = 58/103 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           F GPF+L   LI   ++D+  + L +V   ++ Y      +L++++ T +L++A  LL+ K+ R+LP+  +D EE ++    RD    RLL Y+ ++ +     E
  S:    30 FEGPFDLLLQLIFAHQLDVTEVALHQVTDDFIAYTKAIGARLELEETTAFLVIAATLLDLKAARLLPAGQVDDEEDLALLEVRDLLFARLLQYRAFKHVAEMFAE 134
>gi|139439677|ref|ZP_01773090.1| Hypothetical protein COLAER_02118 [Collinsella aerofaciens ATCC 25986] >gi|133775018|gb|EBA38838.1| Hypothetical protein COLAER_02118 [Collinsella aerofaciens ATCC 25986] (269 aa)
Score = 143, Expect = 2.2e-07, Identities = 59/254 (23%), Positives = 121/254 (47%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS---------------MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIR-EFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           ++ + ++GPF+L   L+  +K+DI  I++ EV + Y+      +  L +D  +++LL+A  LL+ K+  ++P                ++    +  D  R+  IQRL+ YKQ++     L  +++  SRM   P  +G D E L         +P     + L+ +  +   L   ++T        L++   ++   V  ++    ++ F   ++      F+ + D   +    VV F+A+L L + G + L Q+     I I +++
  S:     5 VSTQVYSGPFDLLLQLVTRQKVDIGAISISEVAEQYLAEAER-IEALDLDVASDFLLVAATLLDIKAASLVPQEAPRKADDDDEFDEDLEELSTLDGDALREVLIQRLIAYKQFKGAAAALGARMQAESRM--HPRVAGPDPEFL-------GLMPDYLAGITLRGLAVICADLDGKRQT-------FLLEAEHVAPHRVPLDLTVASVDRFTMAHQTC---TFRELLDGDASTEQLVVTFLAMLELAKRGSLTLSQDEIFGTISINRVE 254
>gi|184201171|ref|YP_001855378.1| putative chromosome segregation and condensation protein ScpA [Kocuria rhizophila DC2201] >gi|183581401|dbj|BAG29872.1| putative chromosome segregation and condensation protein ScpA [Kocuria rhizophila DC2201] (294 aa)
Score = 143, Expect = 2.3e-07, Identities = 32/103 (31%), Positives = 62/103 (60%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNY---LTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI--ERDKYIQRLLVYKQYQEIVPKL 135
           + F GPF++  SLI + ++DI  ++L  V   ++ Y+       +   +D+ +E+L++A  LL+ K+ R+LP  + E++   ++   RD    RLL YK ++E+  +L
  S:    24 ENFQGPFDVLLSLIAKHELDITQVSLSVVTDEFIQYVRALQEDASPKALDEASEFLVVAATLLDLKAARLLPRGEVEDEYDVELLEARDLLFARLLQYKAFKEVAGQL 131
>gi|163791507|ref|ZP_02185913.1| segregation and condensation protein A [Carnobacterium sp. AT7] >gi|159873230|gb|EDP67328.1| segregation and condensation protein A [Carnobacterium sp. AT7] (257 aa)
Score = 143, Expect = 2.3e-07, Identities = 72/256 (28%), Positives = 124/256 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKI---SKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           F GP +L   LIK  ++DI +I + EV   Y++YI   +  L++D   +YL+MA  L+  KSK +LP    + D+E+++   S +  RD  +++LL Y++Y+     L  K E RS+ F K PT         L+  Q+   VP   L +    +   +  +   K  K P      I   E +I++    I   L+       + F   F +IP    TK   V  F+A+L L++   + ++Q  +  +I +   + +   +E
  S:    12 FEGPLDLLLQLIKHLEIDIYDIPIAEVTAQYLNYIRA-MKVLQLDVAGDYLVMAATLMAIKSKLLLPKQEMTADSEDEVFFESGEDPRDALVEQLLEYRKYKSAAALLKVKEEERSQYFSKEPTN--------LESLQEK--VPMEPLQISTFDLVAAFQDMFNKKLKKIPLQTT--IRAEETTINEKMDFIMGKLKSAKANQGVLFTRLF-DIP----TKNEMVTTFMALLELIKEKDVFIQQEITYGDIIVYPSESKETGDE 257
>gi|160875909|ref|YP_001555225.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS195] >gi|160861431|gb|ABX49965.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS195] (262 aa)
Score = 143, Expect = 2.3e-07, Identities = 37/109 (33%), Positives = 70/109 (64%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+   +YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+  +E   KL  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPIQQITAQYLEYIT-LLTQARIELAADYLVMAATLAEIKSRLLLPRMVVEDEVEED-PRAQLIRQLKAYEVIKEASQKLDDLPRLER 145
>gi|187606063|ref|ZP_02992239.1| chromosome segregation and condensation protein ScpA [Exiguobacterium sp. AT1b] >gi|187481887|gb|EDU19915.1| chromosome segregation and condensation protein ScpA [Exiguobacterium sp. AT1b] (255 aa)
Score = 143, Expect = 2.4e-07, Identities = 69/251 (27%), Positives = 131/251 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEK----ISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKE 285
           F GP +L   LI + ++DI++I++ EV   YV YI   + K ++D  +EYL+MA  LL+ KSK++LP +  E++     S++  R+  I++L+ YK Y+E V  + E+ E R  ++ +P   GED  + + E + + Y   ++   +L A  K+   +   +  +  K  +K  + +      +E+++    E      + SF  +F   P+        VV F+A+L L++   ++ +Q   D  I  ++  K+
  S:    11 FEGPLDLLLHLIGKMEIDIVDISVAEVTDQYVGYIRT-MQKFELDVASEYLVMAATLLQLKSKQLLPPVPVEDEEVPDFSEEPTREGLIRQLIEYKAYKEAVVFMREQEEHRLELYTRP---GEDLTTYMSE-EVSKYDGPLNFSDLLHAYSKM---IERKRWKERRKKTIKREERT------LEEQMTRLHEHVSSTRQTSFFAFFVERPNVS----DLVVTFMALLELIKLRIVETKQLDQDIQISFIEASKK 247
>gi|15673259|ref|NP_267433.1| segregation and condensation protein A [Lactococcus lactis subsp. lactis Il1403] >gi|41018128|sp|Q9CG33|SCPA_LACLA Segregation and condensation protein A >gi|12724253|gb|AAK05375.1|AE006360_4 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (242 aa)
Score = 143, Expect = 2.4e-07, Identities = 66/242 (27%), Positives = 119/242 (49%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKY--IQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLID-VSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           +I  K F GP +L   L+ + +MDI  + LV VI+ Y+ YI   + +L+++   EY+LMA+ L+  KS+R+LP++   E   +D E+ +Y  + ++  Y++Y+ +   L E  + RS  + K        E++L   QD S   A+DL +    + ++  +    + TK   +   + D + E+S    E++I +F + F                     K   V  F+A+L L++N  I   Q
  S:     6 NIKIKNFEGPLDLLLHLVSQYEMDIFEVPLVPVIEQYLIYIQT-MKELELEVAGEYMLMASQLMLIKSRRLLPTV--TETFIEDTEQLEYDLLAQIDEYRKYKMLSQDLDELHQERSHFYSKAKTEIITDETVL--LQDKS---ALDLFLAFTKILELQRQHFQDENTKIAAEKFTIADKILELSTRFTEQKICKFSDLF----------------SSSTNKDELVTTFMALLELIKNQQISFSQ 226
>gi|183221759|ref|YP_001839755.1| chromosome segregation and condensation protein ScpA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911834|ref|YP_001963389.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167776510|gb|ABZ94811.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167780181|gb|ABZ98479.1| Chromosome segregation and condensation protein ScpA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (247 aa)
Score = 143, Expect = 2.5e-07, Identities = 64/261 (24%), Positives = 127/261 (48%)
  Q:    22 EFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLID-VSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKI 282
           EF +  ++  G    GP  + +SLI   K+DI  ++L  +   ++ ++    + L I+  +E+ +MA +L+  KSK +LP    EE+  +     + + +LL +K++Q    +L E     + MF + T    D+  +              LDV L  +   +  ++  + +   ++ + + + VS+ S++D    ++  LE      +I FMD F+N   +K  K+  V AF+A+L +V+    ++ Q++    I IVK+
  S:     6 EFIVRWQNQDGGLTEGPLTVLWSLIDSYKVDIFEVSLSRITSDFIQFLRTSQS-LSIELTSEFAVMAAHLVYLKSKALLPDPGFEEEDYEPPLPKELVDKLLEHKKFQMAGQRLAELDRLTAGMFTRETNQVLDETEVW-------------LDVSLVDLISAFNSILEQESSNEEEEQIPIYEGVSQYSVEDKMAYLQNLLE---KTGEIHFMDLFEN---DKPEKKEIVAAFLAVLEVVKIRVCKVIQHAVFGEIKIVKV 247
>gi|125973205|ref|YP_001037115.1| condensin subunit ScpA [Clostridium thermocellum ATCC 27405] >gi|196252010|ref|ZP_03150674.1| chromosome segregation and condensation protein ScpA [Clostridium thermocellum DSM 4150] >gi|125713430|gb|ABN51922.1| condensin subunit ScpA [Clostridium thermocellum ATCC 27405] >gi|196198599|gb|EDX93432.1| chromosome segregation and condensation protein ScpA [Clostridium thermocellum DSM 4150] (264 aa)
Score = 143, Expect = 2.5e-07, Identities = 61/251 (24%), Positives = 125/251 (49%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           + F GPF+L + LI++ +++I +I + E+   Y+DY+   + +L ++  +E+L+MA  LL  KSK +LPS   E++  +   R++ + +L+ YK+Y+    +  E L+ R +  EK    G +   +  E +         L++    +++VY++L+   + K  K+  K+  + +     +  +IR+ +     L K     + +    +  ++   V  F+AIL L +   I L Q     +I + K +
  S:    14 QNFEGPFDLLFHLIEKNQINIYDIPIHEITDQYMDYLFA-MQELDLEIASEFLVMAATLLHIKSKLLLPSPKREKEEDEPDPREELVLKLIEYKKYK----RFTEILKTREKECEKYFYRGPEDIDIKCEDE--------PLELSYDELKRVYVELIERNERKMNKNTGKMTQIVQHEKVTLRSKIRDIIRT---LLKKPIFKFSELFSPKTRSRLEIVTGFLAILELAKLKKITLIQPKPFADITVCKCE 248
>gi|169629454|ref|YP_001703103.1| hypothetical protein MAB_2368 [Mycobacterium abscessus] >gi|169241421|emb|CAM62449.1| Conserved hypothetical protein [Mycobacterium abscessus] (293 aa)
Score = 143, Expect = 2.6e-07, Identities = 30/103 (29%), Positives = 58/103 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           F GPF+L   LI + ++D+  + L +V   ++ Y  +      +D++T +L++A  LL+ K+ R+LPS  +D ++ ++    RD    RLL Y+ ++ +     E
  S:    43 FEGPFDLLLQLISQHRLDVTEVALHQVTDEFIAYTKSLGDTYSLDEVTAFLVVAATLLDLKAARLLPSGQVDNDDDLALLEIRDLLFARLLQYRAFKHVAEMFAE 147
>gi|187933873|ref|YP_001886555.1| ScpA/B protein [Clostridium botulinum B str. Eklund 17B] >gi|187722026|gb|ACD23247.1| ScpA/B protein [Clostridium botulinum B str. Eklund 17B] (251 aa)
Score = 143, Expect = 2.6e-07, Identities = 64/255 (25%), Positives = 130/255 (50%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV--KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVE 287
           K+F GPF+L   LIK+ +MDI N+ + ++   Y+ YI++ +  + ++  +E++++A  L+E KSK +LP +  +E   ++ +    I++L++YK+ + +     ++      ++ K       K  +++E    +    +  ++ L  +  +Y  L+     K  K NV  K I V +  I+D        LE    L + + +  F  I D+   K   +V+F+A+L +V+   +++ Q+ S +NI I +   E E
  S:     9 KDFEGPFDLLLHLIKKNQMDIYNVEISKITNQYLKYIDD-MKFMDLEITSEFIVVAATLIEIKSKHLLPKIKKDEDEDEEDQEKNLIEKLILYKKIKRVAEFFKDRYVNSGELYTK-------KPEIIEEINLPNNNEDIFKNLTLLELYNMYNNLLEIYNNKQNKANVIQKRIYVDKYKIEDK-------LEYLLGLIENNEVSKFSEIIDKCECKLECIVSFLALLEMVKLKKVRVYQSDSFDNILIERRQDEGE 250
>gi|114047036|ref|YP_737586.1| condensin subunit ScpA [Shewanella sp. MR-7] >gi|113888478|gb|ABI42529.1| chromosome segregation and condensation protein ScpA [Shewanella sp. MR-7] (262 aa)
Score = 143, Expect = 2.9e-07, Identities = 36/109 (33%), Positives = 71/109 (65%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+  ++YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+  +E   K+  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIA-MLTQARIELASDYLVMAATLAEIKSRLLLPRMVAEDEVEED-PRAQLIRQLKAYEVIKEASQKIDDLPRLER 145
>gi|114319882|ref|YP_741565.1| condensin subunit ScpA [Alkalilimnicola ehrlichei MLHE-1] >gi|114226276|gb|ABI56075.1| condensin subunit ScpA [Alkalilimnicola ehrlichei MLHE-1] (276 aa)
Score = 142, Expect = 3.1e-07, Identities = 58/245 (23%), Positives = 112/245 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+ + +D+ +I + E+ + Y+ Y+   + +L+++   EYL+MA  L E KS+ +LP     E+   D  R + ++RL  Y++Y++    L ++L R +R       + E  +   +E       P + +  +L A  +V  +    +  +  K+ +            V + + E L      +   F   F      +  +   VV+F+A+L LV+   I+L QN     I++
  S:    54 FEGPLDLLLYLIRRQNLDVRDIPIAEITRQYMRYV-ELMHELRLELAAEYLVMAAMLAEIKSRMLLPRPPASEEEEAD-PRAELVRRLQEYERYKQAAEDL-DQLPRLARDVFPVRVAAEGCQPRQRE-------PEVSMQELLLAFAEVLRRSSHYEHHQVQKEALS-----------VRERMTEVLGRLDTEHYCCFTQLFP----RREGRMGLVVSFLAVLELVKEALIELTQNEPYAPIYV 273
>gi|50365367|ref|YP_053792.1| chromosomal segregation/condensation protein [Mesoplasma florum L1] >gi|50363923|gb|AAT75908.1| chromosomal segregation/condensation protein [Mesoplasma florum L1] (277 aa)
Score = 142, Expect = 3.2e-07, Identities = 37/115 (32%), Positives = 70/115 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           F+GP +L ++++K++K+DI  INL E+I  Y+ YI     KL I+  +EYL++A  ++E KS+ +LP+ D + +  +++  +  ++++  Y Q +E+      K E   + F KP
  S:    12 FSGPLDLLWNMVKDKKIDIFEINLSEIIDQYLKYIEGQ-QKLDIELASEYLVLAAQMIEMKSRILLPNDDDDSE--EELMFEDLLEQINQYGQIKEVSEYFYNKQEEYLKTFSKP 123
>gi|62424882|ref|ZP_00380022.1| COG1354: Uncharacterized conserved protein [Brevibacterium linens BL2] (294 aa)
Score = 142, Expect = 3.2e-07, Identities = 63/251 (25%), Positives = 116/251 (46%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKL------KIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE--RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKE----SLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           + F+GPF+L   LI +R++D+  I L EV   ++ Y  +   +        + +++++LL+A  LL+ K+ R+LP+ D EE++  ++   RD    RLL Y+ Y+ +           SR F +   +G  +      L  EFQD   +P + + +    +  +Y  ++    T  P   V  I +  +S+ +    I   L       +   +D F+ + D        V  F+A+L L + G     Q      + I + D
  S:    10 ENFSGPFDLLLGLISKRRLDVTEIALAEVTDEFIAYTTSLSERTGAKAGSSLAEISQFLLVAATLLDLKTARLLPNEDGEEELDLELLEARDLLFARLLQYRAYKSV-----------SRFFAEAMAAGSVRAPRSVGLEPEFQD--VLPPLQMHIGPGELAGLYATVLQRDHT-PPSVAVDHIHLPLVSVSEQRGHILSLL-------RAGDLD-FQKLLDTADNTLVVVARFLALLELFKVGLCDFAQEEPLGPLLISRTD 250
>gi|42560925|ref|NP_975376.1| hypothetical protein MSC_0385 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492422|emb|CAE77018.1| Conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (278 aa)
Score = 142, Expect = 3.3e-07, Identities = 41/135 (30%), Positives = 78/135 (57%)
  Q:    28 KDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKE 162
           +++T  +F+GP EL + +IKE+K+DI+ ++L+E++  Y+ YI     +L I+  +EYL++A+ L+E KS+ +L   D +    + ++ D  + ++  Y Q +EI  +L    E   + F K       K+ L+ E
  S:     5 QELTIDQFSGPIELLWLMIKEKKLDIIELSLIEIVDQYLAYIKQN-QQLDIEIASEYLIIASQLIELKSRHLL-FKDQQVDQKQAVDYDDLVYQISQYNQIKEISDRLFNAQETYLQTFSKKRSKQNFKKDLVFE 137
>gi|188576660|ref|YP_001913589.1| segregation and condensation protein A [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188521112|gb|ACD59057.1| segregation and condensation protein A [Xanthomonas oryzae pv. oryzae PXO99A] (279 aa)
Score = 142, Expect = 3.3e-07, Identities = 41/110 (37%), Positives = 65/110 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL---PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +DIL+I + E+ + YV YI N + +L+ +   EYL+MA  L E KS+ +L   PS D EE    D  R + ++RL  Y+++++    L + L R  R
  S:    32 FEGPLDLLLYLIRRQNLDILDIPVAEITRQYVAYI-NVMQELRFELAAEYLVMAAILAEIKSRMLLPRPPSQDGEE----DDPRAELVRRLQEYERFKQAAEDL-DTLPRMGR 138
>gi|125624022|ref|YP_001032505.1| segregation and condensation protein A [Lactococcus lactis subsp. cremoris MG1363] >gi|167016552|sp|A2RKH5|SCPA_LACLM Segregation and condensation protein A >gi|124492830|emb|CAL97785.1| segregation and condensation protein A [Lactococcus lactis subsp. cremoris MG1363] (242 aa)
Score = 142, Expect = 3.3e-07, Identities = 68/242 (28%), Positives = 122/242 (50%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKY--IQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           +I  K F GP +L   L+ + +MDI  + LV VI+ Y+ YI   + +L+++   EY+LMA+ L+  KS+R+LP++   E   +D E+ +Y  + ++  Y++Y+ +   L E  + RS  + K        E++L   QD +   A+DL +        + K++  ++ +   DN  +I   + +I D   +I E  + F       F D F     +K  K   V  F+A+L L++N  +   Q
  S:     6 NIKIKNFEGPLDLLLHLVSQYEMDIFEVPLVPVIEQYLIYIQT-MKELELELAGEYMLMASQLMLIKSRRLLPTV--TETFIEDTEQLEYDLLAQIDEYRKYKMLSEDLDELHQERSHYYSKSKTEIITDETVL--LQDKT---ALDLFL-------AFSKILELQRQQIEDDNT-MIAAEKFTIAD---KIFELNQKFTEQKICKFTDLFS----DKTNKDELVTTFMALLELIKNQQVSFSQ 226
>gi|117919971|ref|YP_869163.1| condensin subunit ScpA [Shewanella sp. ANA-3] >gi|117612303|gb|ABK47757.1| chromosome segregation and condensation protein ScpA [Shewanella sp. ANA-3] (262 aa)
Score = 142, Expect = 3.3e-07, Identities = 36/109 (33%), Positives = 71/109 (65%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+  ++YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+  +E   K+  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIA-MLTQARIELASDYLVMAATLAEIKSRLLLPRMVAEDEVEED-PRAQLIRQLKAYEVIKEASQKIDDLPRLER 145
>gi|189499105|ref|YP_001958575.1| chromosome segregation and condensation protein ScpA [Chlorobium phaeobacteroides BS1] >gi|189494546|gb|ACE03094.1| chromosome segregation and condensation protein ScpA [Chlorobium phaeobacteroides BS1] (245 aa)
Score = 142, Expect = 3.3e-07, Identities = 62/237 (26%), Positives = 111/237 (46%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKS--PKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHI 266
           I+  EF GP +L    IK  ++DI NI +  + + ++ Y+   +  L ++   E++ MA+ L+  K++ +LP+  +EE  + + + R + ++RL+ YK+ +E   K+    E RS MF +        ES   E  D    P             +Y  ++T K      PK +V+ +D + +++D+    I   L       +ISF    K + +        VV F+A+L L R   I
  S:     4 ISLDEFEGPLDLLLFFIKRDELDIYNIPISRITKDFIGYLEA-MQSLNLEVAAEFIYMASLLMSIKARMLLPNETSEEGDASEFDPRTELVERLMEYKRIKEGAEKMRSLEETRSAMFARGYY-----ESFEPEVIDELDEPV--------NRSTLYHLIMTYKSVMENMPKVHVQNVDEAPVTVDEQSALI---LSKLRETIQISFRTILKEVGE----PLVLVVTFLAVLELCRRQKI 222
>gi|41407509|ref|NP_960345.1| hypothetical protein MAP1411 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118466102|ref|YP_882251.1| segregation and condensation protein A [Mycobacterium avium 104] >gi|41395862|gb|AAS03728.1| hypothetical protein MAP_1411 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|118167389|gb|ABK68286.1| segregation and condensation protein A [Mycobacterium avium 104] (272 aa)
Score = 142, Expect = 3.4e-07, Identities = 35/124 (28%), Positives = 66/124 (53%)
  Q:    14 NLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           N E+   T F + + +     F GPF+L   LI   ++D+  + L +V   ++ Y      KL++++ T +L++A  LL+ K+ R+LP+  +D +E ++    RD    RLL Y+ ++ +     E
  S:     6 NGEAQPQTGFQVRLTN-----FEGPFDLLLQLIFAHRLDVTEVALHQVTDDFIAYTREIGPKLELEETTAFLVVAATLLDLKAARLLPAGQVDDDEDLALLEVRDLLFARLLQYRAFKHVAEMFAE 126
>gi|113969807|ref|YP_733600.1| condensin subunit ScpA [Shewanella sp. MR-4] >gi|113884491|gb|ABI38543.1| chromosome segregation and condensation protein ScpA [Shewanella sp. MR-4] (262 aa)
Score = 142, Expect = 3.5e-07, Identities = 36/109 (33%), Positives = 71/109 (65%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+  ++YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+  +E   K+  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIA-MLTQARIELASDYLVMAATLAEIKSRLLLPRMVAEDEVEED-PRAQLIRQLKAYEVIKEASQKIDDLPRLER 145
>gi|24374540|ref|NP_718583.1| hypothetical protein SO_3015 [Shewanella oneidensis MR-1] >gi|24349132|gb|AAN56027.1|AE015738_2 conserved hypothetical protein [Shewanella oneidensis MR-1] (262 aa)
Score = 142, Expect = 3.6e-07, Identities = 36/109 (33%), Positives = 71/109 (65%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+  ++YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+  +E   K+  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIA-MLTQARIELASDYLVMAATLAEIKSRLLLPRMVAEDEVEED-PRAQLIRQLKAYEVIKEASQKIDDLPRLER 145
>gi|77918903|ref|YP_356718.1| hypothetical protein Pcar_1299 [Pelobacter carbinolicus DSM 2380] >gi|77544986|gb|ABA88548.1| condensin subunit ScpA [Pelobacter carbinolicus DSM 2380] (254 aa)
Score = 142, Expect = 3.7e-07, Identities = 60/237 (25%), Positives = 111/237 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LIK+ +MDI +I + E+   Y+  ++  +  L +D   E+L+MA+ L+  KS+ +LP     E    D++ R + +QRLL Y++Y+E+   L E       +F +        E+      D    P    +++  A+Q++          +SP + V  +    ++   V + +   L+       ++F      +PD    +   VV F+A+L LV+   I++ QN
  S:    10 FKGPLDLLLHLIKKHEMDIYDIPIAEITAQYLAALDT-MKSLNLDIAGEFLVMASTLVHIKSRMLLPLEVDPELEEDDVDPRAELVQRLLEYQRYKEVAVALDEYDMLGRDVFNRSCHDAAADEA-----NDGPLQPVGVFELV-NALQELL--------KESPPERVHEVVRERLT---VAERVSMLLKLLKDNQSLAFDALLPELPD----REELVVTFLAMLELVKLRMIRIMQN 225
>gi|145619862|ref|ZP_01775906.1| chromosome segregation and condensation protein ScpA [Geobacter bemidjiensis Bem] >gi|144943867|gb|EDJ78948.1| chromosome segregation and condensation protein ScpA [Geobacter bemidjiensis Bem] >gi|197088038|gb|ACH39309.1| chromosome segregation and condensation protein ScpA [Geobacter bemidjiensis Bem] (285 aa)
Score = 141, Expect = 4.2e-07, Identities = 35/98 (35%), Positives = 64/98 (65%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE--RDKYIQRLLVYKQYQE 130
           +EF GP +L   LIK+ ++DI NI +  + + Y++Y+   + +L +D   E+L+MA  LL+ KS+ +LP+   EE    ++E  R + ++RLL Y++Y++
  S:    24 EEFEGPLDLLLHLIKKNEVDIYNIPIAAITRQYLEYM-ELMKELNLDIAGEFLVMAATLLQIKSRMLLPATQ-EEDGEAEVEDPRAELVRRLLEYQRYRD 121
>gi|171780253|ref|ZP_02921157.1| hypothetical protein STRINF_02041 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281601|gb|EDT47036.1| hypothetical protein STRINF_02041 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (234 aa)
Score = 141, Expect = 4.3e-07, Identities = 61/251 (24%), Positives = 126/251 (50%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKL--VTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           DI  K+F GP +L   L+ + +MDI ++ +VEVI+ Y+ YI+  L  +K++   EY++MA+ L+  KS+++LP +  E +  +D    + + ++  Y++++ I  ++  + + R++ + KP Q          E      V A D     K +  ++L    V  +K +  K++  +++  +  I+D+   I E L     L         ++IP+        +  F+A L L++   +++EQ  +  +I +
  S:     2 DIKLKDFEGPLDLLLHLVSKYQMDIYDVPIVEVIEQYLTYIST-LQAMKLEVAGEYMVMASQLMLIKSRKLLPKI-VETEPEEDDPEQELLAQIEEYRRFKAISEEMSAQHDERAKFYSKPKQ----------ELIFEDAVLAHD-----KTIMDLFLSFSHVMAEKRRELKNSHTVVERDDYRIEDMMTVISERLSQSKKLVLNKVFKECQSIPE-------MITLFLATLELIKVHEVEVEQKENFGDIVL 230
>gi|120554087|ref|YP_958438.1| chromosome segregation and condensation protein ScpA [Marinobacter aquaeolei VT8] >gi|120323936|gb|ABM18251.1| condensin subunit ScpA [Marinobacter aquaeolei VT8] (275 aa)
Score = 141, Expect = 4.3e-07, Identities = 45/150 (30%), Positives = 83/150 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKV 184
           F GP +L   LI+ + M+IL+I++ E+ + Y+DYI   +  ++ +   EYL+MA  L E KS+ +LP  +++++   D  R + I+RL  Y++++    K  E ++   RM E+ T       + L +   +   P +D+  +L A+Q V
  S:    50 FEGPLDLLLYLIRRQNMNILDIDVSEITRQYMDYIGA-VEAMRFELAAEYLVMAATLAEIKSRMLLPRQESDDEDDID-PRAELIRRLQQYERFK----KAAEDIDEIPRM-ERDTYPA---SAALPKLPSSQPHPDVDMKELLLALQGV 189
>gi|188159575|ref|ZP_02998750.1| hypothetical protein Mmycm_02951 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (278 aa)
Score = 141, Expect = 4.6e-07, Identities = 41/135 (30%), Positives = 78/135 (57%)
  Q:    28 KDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKE 162
           +++T  +F+GP EL + +IKE+K+DI+ ++L+E++  Y+ YI     +L I+  +EYL++A+ L+E KS+ +L   D +    + ++ D  + ++  Y Q +EI  +L    E   + F K       K+ L+ E
  S:     5 QELTIDQFSGPIELLWLMIKEKKLDIIELSLIEIVDQYLAYIKQN-QQLDIEIASEYLIIASQLIELKSRHLL-FKDQQVDQEQVVDYDDLVYQISQYNQIKEISDRLFNAQEAYLQTFSKKRSKQNFKKDLVFE 137
>gi|118049214|ref|ZP_01517765.1| chromosome segregation and condensation protein ScpA [Comamonas testosteroni KF-1] >gi|118003081|gb|EAV17234.1| chromosome segregation and condensation protein ScpA [Comamonas testosteroni KF-1] (285 aa)
Score = 140, Expect = 5.2e-07, Identities = 60/245 (24%), Positives = 116/245 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  +IL+I +++V + Y+ Y++   ++  ++   EYLLMA  L+E KS+ +LP    E+    +  R + ++RLL Y+Q  ++  + + +L    R F K T   E  +SL   F           DV +  +Q  +  ++            KL+   +I+ +  E  +RE++       +      F+ I + +      VV F+A+L L +   I++ Q  +   I++
  S:    59 FEGPLDLLLYLIRKQNFNILDIPMLDVTRQYMTYVDEVRSR-NLELAAEYLLMAAMLIEIKSRMLLPPKKQEDGEEAEDPRAELVRRLLEYEQ-MKLAAQQLGQLPTYGRDFLKATVYIE--QSLQPRFP----------DVEIGELQAAWRDILK---------RAKLVQSHKITRE--ELSVREYMSQILKQLQGQRFVEFERIFNPEKGSTVLVVTFIAMLELAKETLIEITQAEAYAPIYV 278
>gi|12045067|ref|NP_072878.1| fused segregation and condensation protein A/unknown domain-containing protein [Mycoplasma genitalium G37] >gi|1723127|sp|P47455|SCPA_MYCGE Segregation and condensation protein A >gi|3844813|gb|AAC71432.1| segregation and condensation protein A [Mycoplasma genitalium G37] >gi|166078768|gb|ABY79386.1| segregation and condensation protein A [synthetic Mycoplasma genitalium JCVI-1.0] (471 aa)
Score = 140, Expect = 5.5e-07, Identities = 61/255 (23%), Positives = 125/255 (49%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE-----DKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           +    F G     +SL+ ++K+ + ++++  +   Y++ I NY  K  I+ +T+YL++ + +L +K+  +L     E  +  D+     RDK I  L+ +K+Y + + +  +    R   F K  +  +     + + +  E Q  +Y+  + L   +  + ++ L  + T K          I + E+S++ V+KE+   ++ F   Y+   +       +   +  YFV AFVA+LVL+ N  I LEQ      ++I  +D+
  S:   152 VVTDHFFGNLTDLFSLLVDKKVSVNDVDIGLISLQYLNIIANYTNKKAIEKITDYLVITSKILAKKADNLLNDHQEESVLEYDLATNNFRDKMIANLVEHKRYCDSLGEFEKLRVNRLAYFSKANEMEQFIKTANDQLVTVEDQLPNYISVLKLFHAMNKLLEMRLSSLLTNKN---------ITIKELSVEQVQKELVLAIKQFN--YQTVSLKRVLLKLNHPISLMYFVTAFVALLVLLNNQVIGLEQKDYHSELYIFLLDE 404
>gi|83319619|ref|YP_424570.1| chromosomal segregation and condensation protein A [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283505|gb|ABC01437.1| chromosomal segregation and condensation protein A [Mycoplasma capricolum subsp. capricolum ATCC 27343] (278 aa)
Score = 140, Expect = 5.7e-07, Identities = 69/263 (26%), Positives = 136/263 (51%)
  Q:    28 KDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKL------------IDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           +++T  +F+GP EL + +IKE+K+DI+ ++L+E++  Y+ YI     +L I+  +EYL++A+ L+E KS+ +L     +E++ + I+ D  + ++  Y Q +E   +L    E   + F K       K+ L+ +   N        D+ L  + +++  ++T  K+ + + + +L            + V E+ +D V K     L+ +     +  ++         F  + F+V F+AIL LVR   ++++    D     V + KEV  NE
  S:     5 QELTIDQFSGPIELLWLMIKEKKLDIVELSLLEIVDQYLAYIKQN-QQLDIEIASEYLIIASQLIELKSRYLLFKDQQDEQVDQ-IDYDDLVYQISQYNQIKEFSDQLFNAQEVYLQTFSKKRSKQTFKKDLIFK---NPEPLIDLNDLDLDKLTEIFYNVITNSKSLNYQTDFELETEIYQTLTTPSLSVHEVILDVVNKVTSNKLKEWKLEELLDILE---------FNLKNFIVIFLAILDLVRYQILEIDTRGKD---IYVCLRKEVIENE 262
>gi|116333416|ref|YP_794943.1| hypothetical protein LVIS_0769 [Lactobacillus brevis ATCC 367] >gi|116098763|gb|ABJ63912.1| condensin subunit ScpA [Lactobacillus brevis ATCC 367] (257 aa)
Score = 140, Expect = 6.1e-07, Identities = 33/119 (27%), Positives = 66/119 (55%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKD---IERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQS 152
           +F GP +L   LIK  +MDI +I +  +   Y+ Y++  +  +++D   EY +MA  L+  K+K +LP   +   + +D     R++ + +LL Y++Y++    L ++   R + F +P  +
  S:    11 DFEGPLDLLLHLIKTNEMDIYDIRISTITSQYLTYLHQ-MQLVRLDVAGEYFVMAANLMAIKAKLLLPKPQSVVPVDEDEPADPREELVNQLLEYQRYKQAAQALKQRALERQQHFTRPAMA 131
>gi|190575144|ref|YP_001972989.1| putative chromosome segregation and condensation protein, scpA family [Stenotrophomonas maltophilia K279a] >gi|190013066|emb|CAQ46698.1| putative chromosome segregation and condensation protein, scpA family [Stenotrophomonas maltophilia K279a] (279 aa)
Score = 140, Expect = 6.2e-07, Identities = 36/110 (32%), Positives = 65/110 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +D+L+I + E+ + YV+YI   + +L+ +   EYL+MA  L E KS+ +LP   +EE    D  R + ++RL  Y+++++    + + L R+ R
  S:    32 FEGPLDLLLYLIRRQNLDVLDIPVAEITRQYVEYI-TVMRELRFELAAEYLVMAAILAEVKSRMLLPRPVSEEGDEAD-PRAELVRRLQEYERFKQAAEDI-DALPRQDR 138
>gi|145224081|ref|YP_001134759.1| chromosome segregation and condensation protein ScpA [Mycobacterium gilvum PYR-GCK] >gi|145216567|gb|ABP45971.1| condensin subunit ScpA [Mycobacterium gilvum PYR-GCK] (275 aa)
Score = 140, Expect = 6.2e-07, Identities = 35/128 (27%), Positives = 63/128 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKE 162
           F GPF+L   LI   ++D+  + L +V   ++ Y      +L +D+ T +L++A  LL+ K+ R+LP+  +  EE ++    RD    RLL Y+ ++ +     E      R + +     +    LL E
  S:    26 FEGPFDLLLQLIFGHRLDVTEVALHQVTDEFIAYTKQIGPQLGLDETTSFLVVAATLLDLKAARLLPAGEIHDEEDLALLEVRDLLFARLLQYRAFKHVAEMFAELEAAAMRSYPRAVSLEDRYSDLLPE 155
>gi|50954351|ref|YP_061639.1| hypothetical protein Lxx05690 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950833|gb|AAT88534.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str. CTCB07] (279 aa)
Score = 139, Expect = 6.4e-07, Identities = 35/109 (32%), Positives = 57/109 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRS 143
           F GPF+L  SLI + ++DI  I+L  V   ++ Y+        +D+ +E+LL+A  LL+ K   +LP   +   E ++    RD    RLL Y+ ++E       +LE  S
  S:    30 FEGPFDLLLSLIAKHELDITEISLSTVTDEFIAYLRELDADESLDEASEFLLVAATLLDLKVAGLLPQGELVDAEDVALLEARDLLFARLLQYRAFKEASEWFSGRLEAES 140
>gi|41152676|gb|AAR35209.2| conserved hypothetical protein [Geobacter sulfurreducens PCA] (268 aa)
Score = 139, Expect = 6.6e-07, Identities = 35/104 (33%), Positives = 68/104 (65%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERD---KYIQRLLVYKQYQEIVPKLMEK 138
           F GP +L   LIK+ ++DI +I +  + + Y++YI   + +L ++   ++++MA+ L++ KS+ +LP+ D EE  ++D E D   + ++RLL Y++Y+E    L E+
  S:    25 FEGPLDLLLHLIKKNEVDIYDIPVSTITRQYLEYI-RMMKELNLEVAGDFIVMASTLIQIKSRMLLPAPD-EEPGAEDEEADPRAELVRRLLEYQRYKEAALTLSER 129
>gi|88705953|ref|ZP_01103661.1| segregation and condensation protein A [gamma proteobacterium KT 71] >gi|88699667|gb|EAQ96778.1| segregation and condensation protein A [Congregibacter litoralis KT71] (256 aa)
Score = 139, Expect = 7.0e-07, Identities = 38/111 (34%), Positives = 63/111 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRM 145
           F GP +L   LI+ + +DIL I++  + + Y+ Y+ + +  ++ +   EYLLMA  L E KS+ +LP   TEE   +D  R + I+RL  Y++++    K  E +E   RM
  S:    32 FEGPLDLLLYLIRRQNLDILEIDVSRITEQYMHYV-DLMDAMQFELAAEYLLMAAMLAEIKSRMLLPRATTEEDDEED-PRAQLIRRLQEYERFK----KAAEDIEELPRM 136
>gi|194290520|ref|YP_002006427.1| Segregation and condensation protein [Cupriavidus taiwanensis] >gi|193224355|emb|CAQ70366.1| Segregation and condensation protein [Cupriavidus taiwanensis] (296 aa)
Score = 139, Expect = 7.3e-07, Identities = 61/245 (24%), Positives = 108/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ------EIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V + Y+ YI   + K  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q +      + VP+L     R     E         +SL   F D   V  +DL      + K           ++  +    I   E+S   V + + + L    H   + F + F++           VV F+A+L L R   +++ Q      I++
  S:    66 FEGPLDLLLYLIRKQNFNVLDIPMSQVTRQYLSYIEQ-IRKTNLELAAEYLLMAAMLIEIKSRMLLPVKKADSDEEAEDPRAELVRRLLEYEQMKLAAQRLDTVPQLGRDFLRSQVYIE---------QSLAPRFPD---VETVDLQAAWADVLK-----------RAKLNQHHKISREELS---VREHMSQILRRLQHARFMEFSELFEDAVRSGKGVPVVVVNFIAMLELSRESLVEITQAEPFAPIYV 289
>gi|73540375|ref|YP_294895.1| condensin subunit ScpA [Ralstonia eutropha JMP134] >gi|72117788|gb|AAZ60051.1| condensin subunit ScpA [Ralstonia eutropha JMP134] (296 aa)
Score = 139, Expect = 7.3e-07, Identities = 63/245 (25%), Positives = 108/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ------EIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V + Y+ YI   + K  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q +      + VP+L     R     E         +SL   F D   V A+DL       Q  +  ++   K          I   E+S   V + + + L    H   + F + F +           VV F+A+L L R   +++ Q      I++
  S:    66 FEGPLDLLLYLIRKQNFNVLDIPMSQVTRQYLSYIEQ-IRKTNLELAAEYLLMAAMLIEIKSRMLLPVKKADSDEDAEDPRAELVRRLLEYEQMKLAAQRLDTVPQLGRDFLRSQVYIE---------QSLAPRFPD---VEAVDL-------QSAWADVLKRAKLNQHHK----ISREELS---VREHMSQILRRLQHARFMEFTELFDDAIRSGKGVPIVVVNFIAMLELSRESLVEITQAEPFAPIYV 289
>gi|116512120|ref|YP_809336.1| segregation and condensation protein A [Lactococcus lactis subsp. cremoris SK11] >gi|122940143|sp|Q02YQ8|SCPA_LACLS Segregation and condensation protein A >gi|116107774|gb|ABJ72914.1| condensin subunit ScpA [Lactococcus lactis subsp. cremoris SK11] (242 aa)
Score = 139, Expect = 7.8e-07, Identities = 68/242 (28%), Positives = 121/242 (50%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKY--IQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           +I  K F GP +L   L+ + +MDI  + LV VI+ Y+ YI   + +L+++   EY+LMA+ L+  KS+R+LP++   E   +D E+ +Y  + ++  Y++Y+ +   L E  + RS  + K        E++L   QD +   A+DL +        + K++  ++ +   DN   I   + +I D   +I E  + F       F D F     +K  K   V  F+A+L L++N  +   Q
  S:     6 NIKIKNFEGPLDLLLHLVSQYEMDIFEVPLVPVIEQYLIYIQT-MKELELELAGEYMLMASQLMLIKSRRLLPTV--TETFIEDTEQLEYDLLAQIDEYRKYKMLSEDLDELHQERSHYYSKSKTEIITDETVL--LQDKT---ALDLFL-------AFSKILELQRQQIEDDNTT-IAAEKFTIAD---KIFELNQRFTEQKICKFTDLFS----DKTKKDELVTTFMALLELIKNQQVSFSQ 226
>gi|192813838|ref|ZP_03042494.1| chromosome segregation and condensation protein ScpA [Geobacillus sp. Y412MC10] >gi|192797320|gb|EDV73844.1| chromosome segregation and condensation protein ScpA [Geobacillus sp. Y412MC10] (263 aa)
Score = 139, Expect = 7.9e-07, Identities = 70/245 (28%), Positives = 122/245 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-------MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + ++DI +I + E+ + Y+ Y++N + +L+++  +E+L+MA  LL  KSK +LP             +      R + I +L+ Y++Y+ I   L EK   RS ++ K     ED    + E ++N  V  + +  ++ A QK   K V  K+T   +     I   EIS+ D  +++ + LE      +I     F  +  E+  +   VV F+AIL L++   I   Q    E+I +
  S:    10 FEGPLDLLLHLIDKAEIDIQDIPVSEITEQYMAYLHN-MQELELEITSEFLVMAATLLSIKSKLLLPKPPVIEMDEFDFFEEDDMDPRAELIAKLIEYRKYKGIARHLHEKEWERSMIYSK---EAEDLTPYMPEVEENP-VQGLHISDLIAAFQKALSKAV--KRTSYAR-----IQRDEISVKDRIRQVMDALEQVGPGGRI----LFSKLLHEEMERHEIVVTFLAILELMKMKQILCYQEKLFEDIVM 245
>gi|119358432|ref|YP_913076.1| condensin subunit ScpA [Chlorobium phaeobacteroides DSM 266] >gi|119355781|gb|ABL66652.1| condensin subunit ScpA [Chlorobium phaeobacteroides DSM 266] (239 aa)
Score = 139, Expect = 8.0e-07, Identities = 59/244 (24%), Positives = 114/244 (46%)
  Q:    23 FHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHI 266
           F IS++D     F GP +L    I+  ++DI NI +  +   ++ YI   +  + ++   E++ MA+ L+  K++ +LP    EE   ++ + R + +QRLL YK+ +E   K+ E    R+ +F +     E +  ++ E  +  + P       L  +   Y  ++     KSP +  + +  + +S+++    I   L+      ++SF   F   P+        VV F+A+L L +N  I
  S:     2 FRISLED-----FEGPLDLLLFFIRRDELDIYNIPISRITADFIGYIAG-MQVMNLEIAAEFIYMASMLMSIKARMLLPRPSMEENEQEEYDPRAELVQRLLEYKRIKEAALKMQELEMERASLFARGYIE-EIEPEVIDELDEELHRPT------LYQLMMAYRSVI----NKSPAELTRNVSDAPVSVEEQSALIFSRLQ---ERVQVSFRSLFSEAPEHII----LVVTFLAVLELCKNRKI 222
>gi|187929671|ref|YP_001900158.1| chromosome segregation and condensation protein ScpA [Ralstonia pickettii 12J] >gi|187726561|gb|ACD27726.1| chromosome segregation and condensation protein ScpA [Ralstonia pickettii 12J] (293 aa)
Score = 139, Expect = 8.2e-07, Identities = 63/245 (25%), Positives = 109/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+ +  ++L+I L +V + Y+ YI   +    ++   EYLLMA  L+E KS+ +LP   T+     +  R + ++RLL Y+Q +    KL + + +  R F +     E  +SL   + D   V + DL V   A   V  +   T+  K  ++ +            V + + + L    H   + F + F+            VV FVA+L L R   +++ Q      I++
  S:    63 FEGPLDLLLYLIRRQNFNVLDIPLAQVTRQYLAYIEQ-IRATNLELAAEYLLMAAMLIEIKSRMLLPVKKTDSGDEPEDPRAELVRRLLEYEQMKLAAQKL-DTVPQLGRDFLRAQVYIE--QSLAPRYPD---VNSDDLRV---AWADVLRRAKLTQHHKISREELS-----------VREHMSQILRRLQHARFMEFTELFEEAIQSGKGAPIVVVNFVAMLELSRESLLEITQAEPYAPIYV 286
>gi|17547105|ref|NP_520507.1| hypothetical protein RSc2386 [Ralstonia solanacearum GMI1000] >gi|17429406|emb|CAD16093.1| putative segregation and condensation protein a. [Ralstonia solanacearum] (293 aa)
Score = 139, Expect = 8.2e-07, Identities = 59/245 (24%), Positives = 108/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+ +  ++L+I + +V + Y+ YI   +    ++   EYLLMA  L+E KS+ +LP   T+     +  R + ++RLL Y+Q +    KL + +    R F +     E  +SL   +      P ++ D +  A   V  +   T+  K  ++ +            V + + + L    H   + F + F ++          VV FVA+L L R   +++ Q      I++
  S:    63 FEGPLDLLLYLIRRQNFNVLDIPMAQVTRQYLAYIEQ-IRATNLELAAEYLLMAAMLIEIKSRMLLPVKKTDSGEEPEDPRAELVRRLLEYEQMKLAAQKL-DTVPVLGRDFLRAQVYIE--QSLAPRY------PDVNADDLRAAWADVLRRAKLTQHHKISREELS-----------VREHMSQILRRLQHARFMEFTELFDDVIRSGKGAPIVVVNFVAMLELSRESLLEITQAEPYAPIYV 286
>gi|194366462|ref|YP_002029072.1| chromosome segregation and condensation protein ScpA [Stenotrophomonas maltophilia R551-3] >gi|194349266|gb|ACF52389.1| chromosome segregation and condensation protein ScpA [Stenotrophomonas maltophilia R551-3] (301 aa)
Score = 139, Expect = 8.2e-07, Identities = 36/110 (32%), Positives = 64/110 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + +D+L+I + E+ + YV+YI   + +L+ +   EYL+MA  L E KS+ +LP   +EE    D  R + ++RL  Y++++     + + L R+ R
  S:    54 FEGPLDLLLYLIRRQNLDVLDIPVAEITRQYVEYI-TVMRELRFELAAEYLVMAAILAEVKSRMLLPRPVSEEGDEAD-PRAELVRRLQEYERFKRAAEDI-DALPRQDR 160
>gi|121608066|ref|YP_995873.1| chromosome segregation and condensation protein ScpA [Verminephrobacter eiseniae EF01-2] >gi|121552706|gb|ABM56855.1| condensin subunit ScpA [Verminephrobacter eiseniae EF01-2] (276 aa)
Score = 138, Expect = 8.5e-07, Identities = 56/245 (22%), Positives = 111/245 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  +IL+I +  V + Y+ Y+    ++  ++   EYLLMA  L+E KS+ +LP    E     +  R + ++RLL Y+Q  ++  + + ++ +  R F K     E  +SL   F      PA+ +  + +A + +  +    +  K               I   E  +RE++       +      F+++ +    +   VV F+A+L L +   I++ Q  +   I++
  S:    50 FEGPLDLLLYLIRKQNFNILDIPMAGVTRQYLAYVEEIRSR-NLELAAEYLLMAAMLIEIKSRMLLPPRKQEGGAEPEDPRAELVRRLLEYEQ-MKLAAQRLSQMPQHGRDFLKAQVFIE--QSLQPRF------PAVQVRQLQQAWRDILQRAQLVQHHK---------------ITRAELSVREYMSRVLKTLQGRRFVAFEDLFEPGQGRSVLVVIFIALLELAKEALIEITQAEAFAPIYL 269
>gi|119775261|ref|YP_928001.1| putative segregation and condensation protein A [Shewanella amazonensis SB2B] >gi|119767761|gb|ABM00332.1| putative segregation and condensation protein A [Shewanella amazonensis SB2B] (262 aa)
Score = 138, Expect = 9.0e-07, Identities = 39/107 (36%), Positives = 64/107 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME--KLER 141
           F GP +L   LI+++K+D++ + L  +   Y++YI   LT  +I+   +YL+MA  L E KS+ +LP M  E+   +D  R + I++L  Y+  +E   KL E  +LER
  S:    39 FEGPLDLLLYLIRKQKLDVIELPLTLIAAQYLEYI-RLLTDARIELAADYLVMAATLAEIKSRLLLPKMAVEDDEEED-PRVRLIKQLKAYESIREAAFKLDELPRLER 145
>gi|149117550|ref|ZP_01844234.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS223] >gi|146862370|gb|EDK48065.1| chromosome segregation and condensation protein ScpA [Shewanella baltica OS223] (160 aa)
Score = 138, Expect = 9.1e-07, Identities = 31/94 (32%), Positives = 61/94 (64%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYK 126
           + F GP +L   LI+++K+D++++ + ++   Y++YI   LT+ +I+   +YL+MA  L E KS+ +LP M  E+++ +D  R + I++L  Y+
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPIQQITAQYLEYIT-LLTQARIELAADYLVMAATLAEIKSRLLLPRMVAEDEVEED-PRAQLIRQLKAYE 128
>gi|42523453|ref|NP_968833.1| hypothetical protein Bd1976 [Bdellovibrio bacteriovorus HD100] >gi|39575659|emb|CAE79826.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100] (332 aa)
Score = 138, Expect = 9.6e-07, Identities = 35/105 (33%), Positives = 64/105 (60%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTE-EKISKDIERDKYIQRLLVYKQYQEIVPKLMEK 138
           +F GP  L   LI++ +MDI++I + E+ + Y++YI   + +L ++   E++ MA  L++ KS+ +LP  D   E I  +  R + +Q+LL Y++YQE    L ++
  S:     9 KFEGPLGLLLYLIRKEEMDIMDIKVHEITKQYLEYI-KLMKELDLEVAGEFVAMAATLIQIKSRMLLPQYDENGEAIEVEDPRKELVQKLLEYQKYQEAAKLLYDR 113
>gi|77457716|ref|YP_347221.1| condensin subunit ScpA [Pseudomonas fluorescens PfO-1] >gi|77381719|gb|ABA73232.1| condensin subunit ScpA [Pseudomonas fluorescens PfO-1] (272 aa)
Score = 138, Expect = 1.0e-06, Identities = 63/237 (26%), Positives = 113/237 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ ++IL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP  +T E   +D  R + I+RL  Y++++     + + L R  R    P            E +    +P + L+ IL +M +V  +           D  +   VS  ++   E+ + + LE       + F++ F      +  K   VV F+AIL LV+   I+L QN
  S:    48 FEGPLDLLLYLIRKQNINILDIPVAEITRQYMGYVE-LMQSVRLELAAEYLVMAAMLAEIKSRMLLPRAETVED-EEDDPRAELIRRLQEYERFKAAAEGI-DGLSRVGRDVIVPKLDA-------PEARARKLLPDVALEEILMSMAEVLRR----------GDMFESHQVSREALSTRER-MSDVLERLKGGGFVPFIELFT----AEEGKLGVVVTFMAILELVKESLIELVQN 259
>gi|88810633|ref|ZP_01125890.1| hypothetical protein NB231_16173 [Nitrococcus mobilis Nb-231] >gi|88792263|gb|EAR23373.1| hypothetical protein NB231_16173 [Nitrococcus mobilis Nb-231] (294 aa)
Score = 138, Expect = 1.0e-06, Identities = 33/104 (31%), Positives = 58/104 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEK 138
           F GP +L   LI+ + +D+L+I + E+ + Y+ Y+   +  L+++   EYL+MA  L   KS+ +LP    +E    D  R +  +RL  Y+Q++E    L E+
  S:    54 FEGPLDLLLYLIRRQNLDVLDIPIAEITRQYMRYV-ELMQDLRLELAAEYLVMAAVLAHIKSRMLLPQPAVQEPEEAD-PRVELARRLQEYEQFKEAAQALDEQ 155
>gi|154707025|ref|YP_001424362.1| segregation and condensation protein A [Coxiella burnetii Dugway 5J108-111] >gi|154356311|gb|ABS77773.1| segregation and condensation protein A [Coxiella burnetii Dugway 5J108-111] (266 aa)
Score = 138, Expect = 1.1e-06, Identities = 38/110 (34%), Positives = 67/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LIK+  +DIL+I + E+ + Y+ +I + + +++I+   EYL+MA  L E KS+ +LP    EE+  +D  R + ++RL  Y++Y++    L ++L R  R
  S:    43 FEGPLDLLLYLIKKHNIDILDIPIAEITRQYMQFI-DLMREMRIELAAEYLVMAAMLAEIKSRLLLPRPVVEEENEQD-PRAELVRRLQEYERYKKAAYDL-DQLPRVGR 149
>gi|121595785|ref|YP_987681.1| condensin subunit ScpA [Acidovorax sp. JS42] >gi|120607865|gb|ABM43605.1| condensin subunit ScpA [Acidovorax sp. JS42] (286 aa)
Score = 137, Expect = 1.1e-06, Identities = 63/245 (25%), Positives = 117/245 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYK-------ISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  +IL+I +++V + Y+ Y+    ++  ++   EYLLMA  L+E KS+ +LP    E     +  R + ++RLL Y+Q +    +L  ++ +  R F +   + E  +SL   F           DV L  +Q+ +  ++   K            V    I   E  +RE++    H+ K       + F + F+  P++  T    VV F+A+L L +   I++ Q  +   I++
  S:    60 FEGPLDLLLYLIRKQNFNILDIPMLDVTRQYLGYVEEIRSR-NLELAAEYLLMAAMLIEIKSRMLLPPKKQEGSAEPEDPRAELVRRLLEYEQIKLAAMRL-NQVPQYGRDFLRAQVTIE--QSLQPRFP----------DVSLTDLQEAWRDILKRAKL-----------VQHHKITREELSVREYMS---HVLKALQGRRFVEFEELFQ--PEKGGT--VLVVTFIALLELAKETLIEITQAEAFAPIYV 279
>gi|15827713|ref|NP_301976.1| hypothetical protein ML1368 [Mycobacterium leprae TN] >gi|467146|gb|AAA50910.1| unknown [Mycobacterium leprae] >gi|2065216|emb|CAB08281.1| hypothetical protein MLC1351.05c [Mycobacterium leprae] >gi|13093264|emb|CAC31749.1| conserved hypothetical protein [Mycobacterium leprae] (268 aa)
Score = 137, Expect = 1.1e-06, Identities = 35/127 (27%), Positives = 70/127 (55%)
  Q:    14 NLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLE 140
           N E+ +   F + + +     F GPF+L   LI   ++D+  + L +V   ++ YI     +L +++ T +L++A  L++ K+ R+LP+  ++ EE ++    RD    RLL Y+ ++  V ++  +LE
  S:     2 NSEAPHQNGFQVRLTN-----FEGPFDLLLHLICAHRLDVTEVALHQVTDDFIAYIRRLGPQLGLEETTAFLVIAATLIDLKAARLLPAGRVEDEEDLALLEGRDLLFARLLQYRAFKR-VAQIFAELE 124
>gi|39996931|ref|NP_952882.1| hypothetical protein GSU1832 [Geobacter sulfurreducens PCA] (245 aa)
Score = 137, Expect = 1.1e-06, Identities = 35/104 (33%), Positives = 68/104 (65%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERD---KYIQRLLVYKQYQEIVPKLMEK 138
           F GP +L   LIK+ ++DI +I +  + + Y++YI   + +L ++   ++++MA+ L++ KS+ +LP+ D EE  ++D E D   + ++RLL Y++Y+E    L E+
  S:     2 FEGPLDLLLHLIKKNEVDIYDIPVSTITRQYLEYI-RMMKELNLEVAGDFIVMASTLIQIKSRMLLPAPD-EEPGAEDEEADPRAELVRRLLEYQRYKEAALTLSER 106
>gi|108799897|ref|YP_640094.1| condensin subunit ScpA [Mycobacterium sp. MCS] >gi|119869007|ref|YP_938959.1| condensin subunit ScpA [Mycobacterium sp. KMS] >gi|126435525|ref|YP_001071216.1| condensin subunit ScpA [Mycobacterium sp. JLS] >gi|108770316|gb|ABG09038.1| condensin subunit ScpA [Mycobacterium sp. MCS] >gi|119695096|gb|ABL92169.1| condensin subunit ScpA [Mycobacterium sp. KMS] >gi|126235325|gb|ABN98725.1| condensin subunit ScpA [Mycobacterium sp. JLS] (275 aa)
Score = 137, Expect = 1.1e-06, Identities = 31/103 (30%), Positives = 57/103 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDT--EEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           F GPF+L   LI   ++D+  + L +V   ++ Y      +L++D+ T +L++A  LL+ K+ R+LP+ +   EE ++    RD    RLL Y+ ++ +     E
  S:    21 FEGPFDLLLQLIFAHRLDVTEVALHQVTDDFIAYTKAIGRQLELDETTAFLVIAATLLDLKAARLLPAGEVHDEEDLALLEVRDLLFARLLQYRAFKHVAVMFAE 125
>gi|145295556|ref|YP_001138377.1| hypothetical protein cgR_1483 [Corynebacterium glutamicum R] >gi|140845476|dbj|BAF54475.1| hypothetical protein [Corynebacterium glutamicum R] (321 aa)
Score = 137, Expect = 1.1e-06, Identities = 34/110 (30%), Positives = 63/110 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GPF+L   LI ++K+D+  + L +V   ++ Y         +D+ TE+L++A  LL+ K+ R+LP   +D E+ +     +D    RLL Y+ Y++ V ++  + +R +R
  S:    72 FEGPFDLLLQLITKKKLDVTEVALAQVTDEFIAYTRKLGETSDLDETTEFLVVAATLLDLKTARLLPRGEVDDEDDLELLEVKDLLFARLLQYRAYKQ-VAEMFAQWQRDAR 182
>gi|125718579|ref|YP_001035712.1| segregation and condensation protein A [Streptococcus sanguinis SK36] >gi|167016580|sp|A3CPQ7|SCPA_STRSV Segregation and condensation protein A >gi|125498496|gb|ABN45162.1| Segregation and condensation protein A, putative [Streptococcus sanguinis SK36] (236 aa)
Score = 137, Expect = 1.2e-06, Identities = 34/121 (28%), Positives = 74/121 (61%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           DI  K+F GP +L   L+ + ++DI ++ + EVI+ Y+ Y+   L  +K++   EY++MA+ L+  KS+++LP +    ++  D+E+D  + ++  Y++++ +  K+  + + R+  + KP
  S:     2 DIKLKDFEGPLDLLLHLVSKYQVDIYDVPITEVIEQYLAYVAT-LQAMKLEVTGEYMVMASQLMLIKSRKLLPKVADNAELEDDLEQD-LLSQIEEYRRFKLLGEKMSLQHDDRALYYSKP 120
>gi|118467410|ref|YP_888041.1| segregation and condensation protein A [Mycobacterium smegmatis str. MC2 155] >gi|118168697|gb|ABK69593.1| segregation and condensation protein A [Mycobacterium smegmatis str. MC2 155] (300 aa)
Score = 137, Expect = 1.2e-06, Identities = 36/128 (28%), Positives = 63/128 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDT--EEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKE 162
           F GPF+L   LI   ++D+  + L +V   ++ Y      +L +D+ T +L++A  LL+ K+ R+LPS +   EE ++    RD    RLL Y+ ++ +     E      R + +     +    LL E
  S:    50 FEGPFDLLLQLIFAHRLDVTEVALHQVTDDFIAYTKEIGPQLGLDETTAFLVIAATLLDLKAARLLPSGEVHDEEDLALLEVRDLLFARLLQYRAFKHVAQMFAELEAAALRSYPRAVSLEDRYSDLLPE 179
>gi|90416538|ref|ZP_01224469.1| hypothetical protein GB2207_05032 [marine gamma proteobacterium HTCC2207] >gi|90331737|gb|EAS46965.1| hypothetical protein GB2207_05032 [marine gamma proteobacterium HTCC2207] (300 aa)
Score = 137, Expect = 1.3e-06, Identities = 43/150 (28%), Positives = 78/150 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKV 184
           F GP +L   LI+ + +DIL IN+ E+ + Y+ YI   +  ++++   EYL+MA  L E KS+ +LP    +E   +D  R + I+RL  Y++++    K  + ++   R+     Q+        +E Q     P +D+  +L A+ +V
  S:    76 FEGPLDLLLYLIRRQNLDILEINVAEITRQYMGYI-GLMESIQLELAAEYLVMAAMLAEIKSRMLLPRQVMDEDSEED-PRAELIRRLQEYERFK----KAADDIDEMPRLGRDIHQASAHAPERNQEVQH----PDVDMRELLTALSEV 215
>gi|29654369|ref|NP_820061.1| segregation and condensation protein A [Coxiella burnetii RSA 493] >gi|81629001|sp|Q83CP8|SCPA_COXBU Segregation and condensation protein A >gi|29541636|gb|AAO90575.1| segregation and condensation protein A [Coxiella burnetii RSA 493] (266 aa)
Score = 137, Expect = 1.3e-06, Identities = 37/110 (33%), Positives = 67/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LIK+  +DIL+I + E+ + Y+ ++ + + +++I+   EYL+MA  L E KS+ +LP    EE+  +D  R + ++RL  Y++Y++    L ++L R  R
  S:    43 FEGPLDLLLYLIKKHNIDILDIPIAEITRQYMQFV-DLMREMRIELAAEYLVMAAMLAEIKSRLLLPRPVVEEENEQD-PRAELVRRLQEYERYKKAAYDL-DQLPRVGR 149
>gi|23308849|ref|NP_600640.2| hypothetical protein NCgl1367 [Corynebacterium glutamicum ATCC 13032] >gi|62390306|ref|YP_225708.1| hypothetical protein cg1611 [Corynebacterium glutamicum ATCC 13032] >gi|21324190|dbj|BAB98815.1| Uncharacterized ACR [Corynebacterium glutamicum ATCC 13032] >gi|41325643|emb|CAF21432.1| CONSERVED HYPOTHETICAL PROTEIN [Corynebacterium glutamicum ATCC 13032] (255 aa)
Score = 137, Expect = 1.3e-06, Identities = 32/110 (29%), Positives = 64/110 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE--RDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GPF+L   LI ++K+D+  + L +V   ++ Y         +D+ TE+L++A  LL+ K+ R+LP  + +++   ++   +D    RLL Y+ Y++ V ++  + +R +R
  S:     6 FEGPFDLLLQLITKKKLDVTEVALAQVTDEFIAYTRKLGETSDLDETTEFLVVAATLLDLKTARLLPRGEVDDEDDLELLEIKDLLFARLLQYRAYKQ-VAEMFAQWQRDAR 116
>gi|171463855|ref|YP_001797968.1| chromosome segregation and condensation protein ScpA [Polynucleobacter necessarius STIR1] >gi|171193393|gb|ACB44354.1| chromosome segregation and condensation protein ScpA [Polynucleobacter necessarius STIR1] (291 aa)
Score = 137, Expect = 1.4e-06, Identities = 35/113 (30%), Positives = 71/113 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFE 147
           F GP +L   LI+++  ++L+I + +V Q Y+ YI+  +    ++ + EYLLMA  L+E KS+ +LP    D+EE++     R + ++RLL Y++  ++  + ++++ ++ R F+
  S:    60 FEGPLDLLLYLIRKQNFNVLDIPMAQVTQQYLSYIDQ-IRHHNLELVAEYLLMAAMLIEIKSRMLLPMKKADSEEEVED--PRAELVRRLLEYER-MKLAAQELDQIPQQGRDFQ 170
>gi|187479519|ref|YP_787544.1| hypothetical protein BAV3049 [Bordetella avium 197N] >gi|115424106|emb|CAJ50659.1| conserved hypothetical protein [Bordetella avium 197N] (293 aa)
Score = 137, Expect = 1.4e-06, Identities = 33/114 (28%), Positives = 66/114 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           F GP +L   LI+++  ++L+I + +V + Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP   ++     +  R + ++RLL Y+Q  ++  + ++ L +  R F++
  S:    59 FEGPLDLLLYLIRKQNFNVLDIPMADVTRQYLSYVDQIRTH-NLELAAEYLLMAAMLIEIKSRMLLPVKKSDTGEEPEDPRAELVRRLLEYEQ-MKLAARRLDALPQLGRDFQR 170
>gi|55820357|ref|YP_138799.1| segregation and condensation protein A [Streptococcus thermophilus LMG 18311] >gi|81561027|sp|Q5M622|SCPA_STRT2 Segregation and condensation protein A >gi|55736342|gb|AAV59984.1| conserved hypothetical protein [Streptococcus thermophilus LMG 18311] (237 aa)
Score = 137, Expect = 1.4e-06, Identities = 39/121 (32%), Positives = 72/121 (59%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           DI  K+F GP +L   L+ + ++DI ++ +VEVI+ Y+ Y+   L  +K++   EY+LMA+ L+  KS+++LP++  E++   D    + + +L  Y  ++     L +K E R++ F KP
  S:     2 DIKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYLAT-LQAMKLEVAGEYMLMASQLMLIKSRKLLPTV-VEDEPEADDPELELLSQLEEYAHFKAASQVLAKKHEVRAQYFSKP 120
>gi|41018136|sp|Q9EUR2|SCPA_STRMT Segregation and condensation protein A >gi|11967873|emb|CAC19444.1| hypothetical protein [Streptococcus mitis] (242 aa)
Score = 136, Expect = 1.4e-06, Identities = 35/120 (29%), Positives = 73/120 (60%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           DI  K+F GP +L   L+ + KMDI ++ + EVI+ Y+ Y++  L  ++++   EY++MA+ L+  KS+++LP +     +  D+E+D  + ++  Y++++ +   L  K + R++ + K
  S:     2 DIKLKDFEGPLDLLLHLVSKYKMDIYDVPITEVIEQYLAYVST-LQAMRLEVTGEYMVMASQLMLIKSRKLLPKVAEVTDLEDDLEQD-LLSQIEEYRKFKLLGEHLEAKHQERAQYYSK 119
>gi|153206817|ref|ZP_01945658.1| segregation and condensation protein A [Coxiella burnetii 'MSU Goat Q177'] >gi|165918520|ref|ZP_02218606.1| segregation and condensation protein A [Coxiella burnetii RSA 334] >gi|120577180|gb|EAX33804.1| segregation and condensation protein A [Coxiella burnetii 'MSU Goat Q177'] >gi|165917766|gb|EDR36370.1| segregation and condensation protein A [Coxiella burnetii RSA 334] (266 aa)
Score = 136, Expect = 1.5e-06, Identities = 37/110 (33%), Positives = 67/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LIK+  +DIL+I + E+ + Y+ ++ + + +++I+   EYL+MA  L E KS+ +LP    EE+  +D  R + ++RL  Y++Y++    L ++L R  R
  S:    43 FEGPLDLLLYLIKKHNIDILDIPIAEITRQYMQFV-DLMREMRIELAAEYLVMAAMLAEIKSRLLLPRPVVEEENEQD-PRAELVRRLQEYERYKKAAYDL-DQLPRVGR 149
>gi|82703435|ref|YP_413001.1| chromosome segregation and condensation protein ScpA [Nitrosospira multiformis ATCC 25196] >gi|82411500|gb|ABB75609.1| condensin subunit ScpA [Nitrosospira multiformis ATCC 25196] (303 aa)
Score = 136, Expect = 1.5e-06, Identities = 36/112 (32%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI++  +D+L+I + E+ + Y+ YI   +   K++   EYLLMA  L+E KS+ +LP    +    +   R + ++RLL Y+Q  ++  + + KL +  R F
  S:    75 FQGPLDLLLYLIRKHNLDVLDIAMAELTRQYLAYIE-MMRANKLELAAEYLLMAAVLIEIKSRMLLPKPVAKGNEDEVDPRAELVRRLLEYEQ-MKVAGQKLNKLPQAERDF 184
>gi|56460846|ref|YP_156127.1| hypothetical protein IL1745 [Idiomarina loihiensis L2TR] >gi|56179856|gb|AAV82578.1| Uncharacterized conserved protein [Idiomarina loihiensis L2TR] (271 aa)
Score = 135, Expect = 1.9e-06, Identities = 61/236 (25%), Positives = 119/236 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNS--YVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           F+GP +L   LI+++K+DI+++ ++ + + YV+Y+ + + +LK++   +YL+MA  L E KS+ +LP    +E+  ++  R + I+RL  Y           E + + +   ++  Q G D   LL E   N+  ++ A   +V L+ +   + +++   + K+       I   ++S       + + LE   H   +SF   F      K  +   VV+F+AIL LV+   ++L Q
  S:    38 FSGPMDLLLYLIRKQKLDIVDMPILAITRQYVEYV-DMMQELKLELAADYLVMAAILAEIKSRLLLPK-PPQEEDEEEDPRAELIRRLQEY-----------EAIRQGAEYIDQQPQVGRD--ILLSEVGSNAREWLTAAPPEVTLEDLTLAFSRVLQQVELKAHHQ----IKREQLS---TRARMSQVLELLSHKKYVSFSQLFT----RKEGRAGAVVSFLAILELVKESMVELSQ 249
>gi|94311705|ref|YP_584915.1| condensin subunit ScpA [Ralstonia metallidurans CH34] >gi|93355557|gb|ABF09646.1| condensin subunit ScpA [Ralstonia metallidurans CH34] (301 aa)
Score = 135, Expect = 1.9e-06, Identities = 62/245 (25%), Positives = 108/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ------EIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V + Y+ YI   + K  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q +      + VP+L     R     E         +SL   F D   V  +DL       Q  +  ++   K          I   E+S   V + + + L    H   + F + F++           VV F+A+L L R   +++ Q      I++
  S:    71 FEGPLDLLLYLIRKQNFNVLDIPMAQVTRQYLSYIEQ-IRKRNLELAAEYLLMAAMLIEIKSRMLLPVKKADSDEEAEDPRAELVRRLLEYEQMKLAAQRLDTVPQLGRDFLRSQVFIE---------QSLAPRFPD---VETLDL-------QSAWADVLRRAKLNQHHK----ISREELS---VREHMSQILRRLQHARFMEFSELFEDAIRSGKGVPVVVVNFIAMLELSRESLVEITQAEPFAPIYV 294
>gi|192360883|ref|YP_001982273.1| segregation and condensation protein A [Cellvibrio japonicus Ueda107] >gi|190687048|gb|ACE84726.1| segregation and condensation protein A [Cellvibrio japonicus Ueda107] (256 aa)
Score = 135, Expect = 2.0e-06, Identities = 57/239 (23%), Positives = 114/239 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LI+ + +DIL+IN+ E+   Y+ Y+ + +   + +   EYL+MA  L E KS+ +LP    + +  +D  R   I+RL  Y+++++    L + L R +R       +  D+     +       P ++L  IL A+ +V  +           D  +   VS   +   E+ + + L+   H + + F+  FK + + +      VV F+A++ L++   +++ Q+ +
  S:    32 FEGPLDLLLYLIRRQNIDILDINVSEITSQYMAYV-DLMESHQFELAAEYLVMAAMLAEIKSRMLLPRSQEQAEEEED-PRASLIRRLQEYERFKQAAEDL-DALPRMARNIYTAAANAPDRALTRPD-------PDVELHEILLALSEVLRR----------ADMFESHHVSRERLSTRER-MAQVLDKLAHQHFVPFVSLFK-VEEGRLG---VVVTFLAVMELIKESLVEIVQSDA 245
>gi|15903733|ref|NP_359283.1| segregation and condensation protein A [Streptococcus pneumoniae R6] >gi|116516005|ref|YP_817106.1| segregation and condensation protein A [Streptococcus pneumoniae D39] >gi|148989669|ref|ZP_01821001.1| segregation and condensation protein A [Streptococcus pneumoniae SP6-BS73] >gi|148993334|ref|ZP_01822874.1| segregation and condensation protein A [Streptococcus pneumoniae SP9-BS68] >gi|148998740|ref|ZP_01826178.1| segregation and condensation protein A [Streptococcus pneumoniae SP11-BS70] >gi|149003917|ref|ZP_01828731.1| segregation and condensation protein A [Streptococcus pneumoniae SP14-BS69] >gi|149006469|ref|ZP_01830168.1| segregation and condensation protein A [Streptococcus pneumoniae SP18-BS74] >gi|149011259|ref|ZP_01832506.1| segregation and condensation protein A [Streptococcus pneumoniae SP19-BS75] >gi|149025000|ref|ZP_01836380.1| segregation and condensation protein A [Streptococcus pneumoniae SP23-BS72] >gi|168483408|ref|ZP_02708360.1| ScpA/B protein [Streptococcus pneumoniae CDC1873-00] >gi|168487316|ref|ZP_02711824.1| ScpA/B protein [Streptococcus pneumoniae CDC1087-00] >gi|168489846|ref|ZP_02714045.1| ScpA/B protein [Streptococcus pneumoniae SP195] >gi|168491809|ref|ZP_02715952.1| ScpA/B protein [Streptococcus pneumoniae CDC0288-04] >gi|168494208|ref|ZP_02718351.1| ScpA/B protein [Streptococcus pneumoniae CDC3059-06] >gi|168574935|ref|ZP_02720898.1| ScpA/B protein [Streptococcus pneumoniae MLV-016] >gi|169834420|ref|YP_001695242.1| ScpA/B protein [Streptococcus pneumoniae Hungary19A-6] >gi|122278048|sp|Q04IT2|SCPA_STRP2 Segregation and condensation protein A >gi|41018134|sp|Q9EUQ7|SCPA_STRR6 Segregation and condensation protein A >gi|11967879|emb|CAC19449.1| hypothetical protein [Streptococcus pneumoniae] >gi|15459366|gb|AAL00494.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116076581|gb|ABJ54301.1| segregation and condensation protein A [Streptococcus pneumoniae D39] >gi|147755434|gb|EDK62483.1| segregation and condensation protein A [Streptococcus pneumoniae SP11-BS70] >gi|147758057|gb|EDK65062.1| segregation and condensation protein A [Streptococcus pneumoniae SP14-BS69] >gi|147761767|gb|EDK68730.1| segregation and condensation protein A [Streptococcus pneumoniae SP18-BS74] >gi|147764249|gb|EDK71180.1| segregation and condensation protein A [Streptococcus pneumoniae SP19-BS75] >gi|147924986|gb|EDK76068.1| segregation and condensation protein A [Streptococcus pneumoniae SP6-BS73] >gi|147928101|gb|EDK79120.1| segregation and condensation protein A [Streptococcus pneumoniae SP9-BS68] >gi|147929493|gb|EDK80488.1| segregation and condensation protein A [Streptococcus pneumoniae SP23-BS72] >gi|168996922|gb|ACA37534.1| ScpA/B protein [Streptococcus pneumoniae Hungary19A-6] >gi|172043203|gb|EDT51249.1| ScpA/B protein [Streptococcus pneumoniae CDC1873-00] >gi|183569825|gb|EDT90353.1| ScpA/B protein [Streptococcus pneumoniae CDC1087-00] >gi|183571697|gb|EDT92225.1| ScpA/B protein [Streptococcus pneumoniae SP195] >gi|183573877|gb|EDT94405.1| ScpA/B protein [Streptococcus pneumoniae CDC0288-04] >gi|183575776|gb|EDT96304.1| ScpA/B protein [Streptococcus pneumoniae CDC3059-06] >gi|183578804|gb|EDT99332.1| ScpA/B protein [Streptococcus pneumoniae MLV-016] (242 aa)
Score = 135, Expect = 2.0e-06, Identities = 36/123 (29%), Positives = 76/123 (61%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQ 151
           DI  K+F GP +L   L+ + +MDI ++ + EVI+ Y+ Y++  L  ++++   EY++MA+ L+  KS+++LP +     +  D+E+D  + ++  Y++++ +   L  K + R++ + K PT+
  S:     2 DIKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVST-LQAMRLEVTGEYMVMASQLMLIKSRKLLPKVAEVTDLGDDLEQD-LLSQIEEYRKFKLLGEHLEAKHQERAQYYSKAPTE 123
>gi|91782344|ref|YP_557550.1| condensin subunit ScpA [Burkholderia xenovorans LB400] >gi|91686298|gb|ABE29498.1| condensin subunit ScpA [Burkholderia xenovorans LB400] (291 aa)
Score = 135, Expect = 2.0e-06, Identities = 67/245 (27%), Positives = 117/245 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDL-----DVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYF---KNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V   Y+ Y++  L +  ++  +EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V + DL     DVI +A      KLV   +          I   E+S   V + +   L    +   I F D F   K +P         VV F+A+L L R   +++ Q      I++
  S:    65 FEGPLDLLLYLIRKQNFNVLDIPMADVTVQYLGYVDQ-LRQTNLELASEYLLMAAMLIEIKSRMLLPVKKADSGDEAEDPRAELVRRLLEYEQ-MKLAAQRIDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNSEDLRAAWADVIKRA------KLVQHHR----------ISREELS---VREHMSSILRQLQNARFIEFSDLFDTSKGVP-------VVVVNFIAVLELCRESLVEITQAEPFAPIYV 284
>gi|119476915|ref|ZP_01617196.1| chromosome segregation and condensation protein ScpA [marine gamma proteobacterium HTCC2143] >gi|119449722|gb|EAW30959.1| chromosome segregation and condensation protein ScpA [marine gamma proteobacterium HTCC2143] (316 aa)
Score = 135, Expect = 2.1e-06, Identities = 43/151 (28%), Positives = 79/151 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVY 185
           F GP +L   LIK + +DIL IN+  + Q Y+ Y+ + +  ++ +   EYLLMA  L E KS+ +LP  +  E   +D  R + I+RL  Y++++    K  E ++   R+  +  ++      + KE       P +++  +L A+ +V+
  S:    92 FEGPLDLLLYLIKRQNIDILEINVANITQQYMQYV-SMMDSMQFELAAEYLLMAAMLAEIKSRMLLPRSNELEDDEED-PRAQLIRRLQEYERFK----KAAEDIDNMPRLGREIFEASAAPPDIKKE----RPAPVVEMKELLLALGEVF 232
>gi|33415342|gb|AAQ18194.1| hypothetical protein csv004 [uncultured bacterium] (265 aa)
Score = 135, Expect = 2.1e-06, Identities = 30/95 (31%), Positives = 59/95 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ 129
           F GP +L   LI+++  +IL+I L +V + Y+ Y++  + K  ++  ++YLLMA  L+E KS+ +LP   +++    +  R + ++RL+ Y+Q +
  S:    39 FEGPLDLLLYLIRKQNFNILDIPLADVTRQYLAYVDQ-IRKSNLELASDYLLMAAMLIEIKSRMLLPPKKSDDGEEAEDPRAELVRRLIEYEQMK 132
>gi|194398080|ref|YP_002038465.1| segregation and condensation protein A [Streptococcus pneumoniae G54] >gi|194357747|gb|ACF56195.1| segregation and condensation protein A [Streptococcus pneumoniae G54] (242 aa)
Score = 135, Expect = 2.2e-06, Identities = 36/123 (29%), Positives = 76/123 (61%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQ 151
           DI  K+F GP +L   L+ + +MDI ++ + EVI+ Y+ Y++  L  ++++   EY++MA+ L+  KS+++LP +     +  D+E+D  + ++  Y++++ +   L  K + R++ + K PT+
  S:     2 DIKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVST-LQAMRLEVTGEYMVMASQLMLIKSRKLLPKVAEVTDLGDDLEQD-LLSQIEEYRKFKLLGEHLEAKHQERAQYYSKAPTE 123
>gi|190343185|gb|ACE75573.1| segregation and condensation protein A [Candidatus Nitrospira defluvii] (259 aa)
Score = 135, Expect = 2.2e-06, Identities = 49/140 (35%), Positives = 82/140 (58%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLERR--SRMFEKPTQSGEDKESLLKEFQDNSYVPAM 172
           + F GP +L   LIK+ +++I +I +  + Q Y+DY+ + + +L +    E+L+MA  LL  KS+ +LP   +  +E+   D  R++ ++RLL YKQ++E   +L   E+L R   SR    P +  +D ESLL E      V A+
  S:    13 ENFEGPLDLLLHLIKKNEINIYDIPIALIAQQYLDYL-SVMKELNLAVAGEFLVMAATLLHIKSRMLLPVDEVAVDEEDGPD-PREELVRRLLEYKQFKEAASQLDYKERLWRDVFSREPGPPVEVTKD-ESLLDEISLFDLVDAL 155
>gi|15901704|ref|NP_346308.1| segregation and condensation protein A [Streptococcus pneumoniae TIGR4] >gi|111657284|ref|ZP_01408049.1| hypothetical protein SpneT_02001501 [Streptococcus pneumoniae TIGR4] >gi|182684819|ref|YP_001836566.1| segregation and condensation protein A [Streptococcus pneumoniae CGSP14] >gi|41018115|sp|Q97NX5|SCPA_STRPN Segregation and condensation protein A >gi|14973379|gb|AAK75948.1| segregation and condensation protein A [Streptococcus pneumoniae TIGR4] >gi|182630153|gb|ACB91101.1| segregation and condensation protein A [Streptococcus pneumoniae CGSP14] (242 aa)
Score = 135, Expect = 2.2e-06, Identities = 36/123 (29%), Positives = 76/123 (61%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQ 151
           DI  K+F GP +L   L+ + +MDI ++ + EVI+ Y+ Y++  L  ++++   EY++MA+ L+  KS+++LP +     +  D+E+D  + ++  Y++++ +   L  K + R++ + K PT+
  S:     2 DIKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVST-LQAMRLEVTGEYMVMASQLMLIKSRKLLPKVAEVTDLGDDLEQD-LLSQIEEYRKFKLLGEHLEAKHQERAQYYSKAPTE 123
>gi|146282787|ref|YP_001172940.1| hypothetical protein PST_2446 [Pseudomonas stutzeri A1501] >gi|145570992|gb|ABP80098.1| conserved hypothetical protein [Pseudomonas stutzeri A1501] (246 aa)
Score = 135, Expect = 2.2e-06, Identities = 42/150 (28%), Positives = 78/150 (52%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKV 184
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP    E    +D  R + I+RL  Y++++     L ++L R  R  + P     D  +          +P + L+ +L +M +V
  S:    22 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKSVRLELAAEYLVMAAMLAEIKSRMLLPR-SAEAAEEEDDPRAELIRRLQEYERFKAAAEDL-DELPRVGRDLQVPRLDAPDARA-------RKLLPDVSLEELLVSMAEV 161
>gi|110834250|ref|YP_693109.1| hypothetical protein ABO_1389 [Alcanivorax borkumensis SK2] >gi|110647361|emb|CAL16837.1| conserved hypothetical protein [Alcanivorax borkumensis SK2] (328 aa)
Score = 135, Expect = 2.3e-06, Identities = 64/239 (26%), Positives = 115/239 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LIK + +DIL+I +  +   Y++Y+   +  +  +   EYL+MA  L E KS+ +LP    EE+   +  R + I+RL  Y++++    K  E +++  R+ E+     E K     E+      P +D+  +L A+++V  +    +  +  ++ +   +     +D ++   REF+ PF  L+           P+E   K   VV F+A L LV+   I+L Q  S
  S:    63 FEGPLDLLLYLIKRQNLDILDIPVATITAQYMEYVE-LMKAMNFELAAEYLVMAAMLSEIKSRMLLPRPKAEEEEEGEDPRAELIRRLQEYERFK----KAAEDIDQLPRL-ERDVFPAEAKRP---EYTREKAQPDVDMRELLLALKEVMHRADMFESHQISREKLSTRERMANVLDKLKG--REFV-PFIELFN----------PEEG--KLGVVVTFLATLELVKGALIELVQTES 277
>gi|55822247|ref|YP_140688.1| segregation and condensation protein A [Streptococcus thermophilus CNRZ1066] >gi|116627193|ref|YP_819812.1| segregation and condensation protein A [Streptococcus thermophilus LMD-9] >gi|81559851|sp|Q5M1I0|SCPA_STRT1 Segregation and condensation protein A >gi|122268204|sp|Q03MF6|SCPA_STRTD Segregation and condensation protein A >gi|55738232|gb|AAV61873.1| conserved hypothetical protein [Streptococcus thermophilus CNRZ1066] >gi|116100470|gb|ABJ65616.1| condensin subunit ScpA [Streptococcus thermophilus LMD-9] (237 aa)
Score = 135, Expect = 2.4e-06, Identities = 39/121 (32%), Positives = 72/121 (59%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           DI  K+F GP +L   L+ + ++DI ++ +VEVI+ Y+ Y+   L  +K++   EY+LMA+ L+  KS+++LP++  E++   D    + + +L  Y  ++     L +K E R++ F KP
  S:     2 DIKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYLAT-LQAMKLEVAGEYMLMASQLMLIKSRKLLPTV-VEDEPEVDDPELELLSQLEEYAHFKAASQVLAKKHEVRAQYFSKP 120
>gi|167624538|ref|YP_001674832.1| chromosome segregation and condensation protein ScpA [Shewanella halifaxensis HAW-EB4] >gi|167354560|gb|ABZ77173.1| chromosome segregation and condensation protein ScpA [Shewanella halifaxensis HAW-EB4] (262 aa)
Score = 135, Expect = 2.4e-06, Identities = 35/113 (30%), Positives = 67/113 (59%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRM 145
           + F GP +L   LI+++K+D++++ +  + Q Y++Y+ N L   +++   +YL+MA  L E KS+ +LP  + E++  +D  R + I++L  Y    E++    EKL+   RM
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPVFSITQQYLEYV-NLLQGARVELAADYLVMAATLAEIKSRLLLPRPEIEQEDEED-PRAQLIRQLKAY----EVIKDAQEKLDELPRM 143
>gi|148984328|ref|ZP_01817623.1| segregation and condensation protein A [Streptococcus pneumoniae SP3-BS71] >gi|147923617|gb|EDK74730.1| segregation and condensation protein A [Streptococcus pneumoniae SP3-BS71] (242 aa)
Score = 135, Expect = 2.4e-06, Identities = 34/120 (28%), Positives = 73/120 (60%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           DI  K+F GP +L   L+ + +MDI ++ + EVI+ Y+ Y++  L  ++++   EY++MA+ L+  KS+++LP +     +  D+E+D  + ++  Y++++ +   L  K + R++ + K
  S:     2 DIKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVST-LQAMRLEVTGEYMVMASQLMLIKSRKLLPKVAEVTDLGDDLEQD-LLSQIEEYRKFKLLGEHLEAKHQERAQYYSK 119
>gi|196195776|gb|EDX90735.1| segregation and condensation protein A, putative [Alcanivorax sp. DG881] (332 aa)
Score = 134, Expect = 2.4e-06, Identities = 63/239 (26%), Positives = 114/239 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LIK + +DIL+I +  +   Y++Y+   +  +  +   EYL+MA  L E KS+ +LP    +E+   +  R + I+RL  Y++++    K  E ++   R+ E+     E K     EF      P +D+  +L A+++V  +    +  +  ++ +   +     +D ++   R+F+ PF  L+           P+E   K   VV F+A L LV+   I+L Q  S
  S:    63 FEGPLDLLLYLIKRQNLDILDIPVATITVQYMEYVE-LMKAMNFELAAEYLVMAAMLSEIKSRMLLPRPKDDEEEEGEDPRAELIRRLQEYERFK----KAAEDIDELPRL-ERDVFPAEAKRP---EFTREKAQPDVDMRELLLALKEVMHRADMFESHQISREKLSTRERMASVLDKLKG--RDFV-PFIELFN----------PEEG--KLGVVVTFLATLELVKGSLIELVQTES 277
>gi|146328794|ref|YP_001209389.1| hypothetical protein DNO_0477 [Dichelobacter nodosus VCS1703A] >gi|146232264|gb|ABQ13242.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A] (257 aa)
Score = 134, Expect = 2.5e-06, Identities = 38/103 (36%), Positives = 58/103 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           F GP +L   L+++ KMDIL I + E+ + Y+ YI   +  L I   +EYLLMA  L E KS+ +LP ++ E++  ++       +RLL Y Q  +   KL E
  S:    33 FEGPLDLLLYLVRKAKMDILAIPISEITEQYLVYIR-MMQTLDITLASEYLLMAATLSEMKSRLLLPVLEREDEPEEEDMAFDLSERLLAYAQLVDAAEKLSE 134
>gi|78185983|ref|YP_374026.1| putative segregation and condensation protein A [Pelodictyon luteolum DSM 273] >gi|78165885|gb|ABB22983.1| condensin subunit ScpA [Pelodictyon luteolum DSM 273] (255 aa)
Score = 134, Expect = 2.5e-06, Identities = 37/119 (31%), Positives = 66/119 (55%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           I+ +EF GP +L    IK  ++DI NI + ++   +V +I+   T L ++   E++ MA+ L+  K+  +LP    E   + + + R + +QRLL YK+ +E   +L E  E R  +F +
  S:     4 ISLEEFEGPLDLLLFFIKRDELDIYNIPISKITNDFVTHIHGART-LNLEVAAEFIYMASMLMSIKAAMLLPRPSMENGDTDEFDPRTELVQRLLEYKRIKEASLQLAEMAEARHELFAR 122
>gi|194562674|ref|YP_002097697.1| hypothetical protein BDAG_00883 [Burkholderia dolosa AUO158] >gi|124894298|gb|EAY68178.1| hypothetical protein BDAG_00883 [Burkholderia dolosa AUO158] (290 aa)
Score = 134, Expect = 2.6e-06, Identities = 63/245 (25%), Positives = 114/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSY--VPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V   Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D S   + A   DV+ +A                     KL+   +IS +  E  +RE +      L    FM+ F ++ D        VV F+A+L L R   +++ Q      I++
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQIRTS-NLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDFLRAEVYIE--QSITPRFPDVSSDDLRAAWADVLKRA---------------------KLVQHHKISRE--ELSVREHMSLILRRLQNARFME-FADLFDTSRGVPVVVVNFIAMLELARESLVEITQAEPFAPIYV 283
>gi|88859930|ref|ZP_01134569.1| hypothetical protein PTD2_18000 [Pseudoalteromonas tunicata D2] >gi|88817924|gb|EAR27740.1| hypothetical protein PTD2_18000 [Pseudoalteromonas tunicata D2] (274 aa)
Score = 134, Expect = 2.6e-06, Identities = 62/251 (24%), Positives = 123/251 (49%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           ++  + F GP +L   LIK  K+DIL +++  +   YV YI + + + K++   EYL+MA  L + KS+ +LP +  E    ++  R + I+RL  Y+Q+++   +L  + + ER   + +       + E  L   +    + A+  DV+ +A  K++     T +  S ++ +         I ++ +   EF+  F  L++I            K  +   VV+F+AIL L++ G I+  Q + +  +++
  S:    34 EVALEAFEGPLDLLLYLIKRHKLDILELSIHTITCQYVQYI-DLMQEFKLELAAEYLVMAALLAQIKSRLLLP-VHQELAGEEEDPRAELIRRLQEYEQFKQAAEQLDDIPRFERDFFIAQAAMPQEPEYEKPLPSVELKDLLLALS-DVMARA--KIFTHHQITAEVLSTRERMS-------HILNLLQSRTEFVG-FNELFEI------------KEGRSGVVVSFIAILELIKEGLIECMQTAFNSPVYV 261
>gi|169827287|ref|YP_001697445.1| segregation and condensation protein A [Lysinibacillus sphaericus C3-41] >gi|168991775|gb|ACA39315.1| Segregation and condensation protein A [Lysinibacillus sphaericus C3-41] (236 aa)
Score = 134, Expect = 2.8e-06, Identities = 35/100 (35%), Positives = 64/100 (64%)
  Q:    50 KMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           ++DI +I + E+ Q Y+D+I+  +  L++++ +EYL+MA  LL  KS+ +LP       D E ++     R++ +QRL+ YK+Y+E    L E    R+++F +P
  S:     2 EIDIYDIPMAEITQQYIDHIHA-MQVLELNEASEYLVMAATLLAIKSRMLLPIHEGEMEDAELEVDGPDPREELVQRLIEYKKYKEAASNLQELETDRAQVFTRP 105
>gi|160897281|ref|YP_001562863.1| chromosome segregation and condensation protein ScpA [Delftia acidovorans SPH-1] >gi|160362865|gb|ABX34478.1| chromosome segregation and condensation protein ScpA [Delftia acidovorans SPH-1] (297 aa)
Score = 134, Expect = 2.8e-06, Identities = 31/93 (33%), Positives = 56/93 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQ 127
           F GP +L   LI+++  +IL+I +++V + Y+ Y++   ++  ++   EYLLMA  L+E KS+ +LP    E     +  R + ++RLL Y+Q
  S:    71 FEGPLDLLLYLIRKQNFNILDIPMLDVTRQYMRYVDEIRSR-NLELAAEYLLMAAMLIEIKSRMLLPPKKQEGGEEAEDPRAELVRRLLEYEQ 162
>gi|120404253|ref|YP_954082.1| chromosome segregation and condensation protein ScpA [Mycobacterium vanbaalenii PYR-1] >gi|119957071|gb|ABM14076.1| condensin subunit ScpA [Mycobacterium vanbaalenii PYR-1] (274 aa)
Score = 134, Expect = 2.8e-06, Identities = 34/128 (26%), Positives = 63/128 (49%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKE 162
           F GPF+L   LI   ++D+  + L +V   ++ Y      +L +D+ T +L++A  LL+ K+ R+LP+  +  E+ ++    RD    RLL Y+ ++ +     E      R + +     +    LL E
  S:    25 FEGPFDLLLQLIFAHRLDVTEVALHQVTDEFIAYTKEIGPQLGLDETTSFLVVAATLLDLKAARLLPAGEIHDEDDLALLEVRDLLFARLLQYRAFKHVAEMFAELEAAALRSYPRAVSLEDTYSDLLPE 154
>gi|134094210|ref|YP_001099285.1| putative segregation and condensation protein A [Herminiimonas arsenicoxydans] >gi|133738113|emb|CAL61158.1| Conserved hypothetical protein, putative segregation and condensation protein A [Herminiimonas arsenicoxydans] (292 aa)
Score = 134, Expect = 2.9e-06, Identities = 57/245 (23%), Positives = 110/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDL---TEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  +IL+I + +V + Y+ Y++    ++++ +L    EYLLMA  L+E KS+ +LP    +        R + ++RLL Y           E+++  S+  +   Q G D        + N+     ++D++   +Q  +  L+   K  +      +I   E+S+ +    I   L+    +      D  + +P         VV FVA+L L +   I++ Q      I++
  S:    66 FEGPLDLLLYLIRKQNFNILDIPMAQVTKQYLQYVD----QIRLHNLELAAEYLLMAAMLIEIKSRMLLPVRKADTGEEAGDPRAELVRRLLEY-----------EQMKLASQQIDALPQLGRDYVRTQIYIEQNTVTRWPEVDIV--DLQAAWADLIKRAKLTAH----HMISREELSVREHMTSILRRLQSTKFVEFADLFDPTRGVP-------VIVVNFVALLELAKETLIEITQAEPFAPIYV 285
>gi|187923012|ref|YP_001894654.1| chromosome segregation and condensation protein ScpA [Burkholderia phytofirmans PsJN] >gi|187714206|gb|ACD15430.1| chromosome segregation and condensation protein ScpA [Burkholderia phytofirmans PsJN] (291 aa)
Score = 134, Expect = 3.0e-06, Identities = 67/245 (27%), Positives = 117/245 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDL-----DVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYF---KNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V   Y+ Y++  L +  ++  +EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V + DL     DVI +A      KLV   K          I   E+S   V + +   L    +   + F D F   K +P         VV F+A+L L R   +++ Q      I++
  S:    65 FEGPLDLLLYLIRKQNFNVLDIPMADVTVQYLGYVDQ-LRQTNLELASEYLLMAAMLIEIKSRMLLPVKKADSGEEAEDPRAELVRRLLEYEQ-MKLAAQRIDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNSEDLRAAWADVIKRA------KLVQHHK----------ISREELS---VREHMSSILRQLQNARFVEFSDLFDTSKGVP-------VVVVNFIAVLELCRETLVEITQAEPFAPIYV 284
>gi|145588830|ref|YP_001155427.1| chromosome segregation and condensation protein ScpA [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145047236|gb|ABP33863.1| condensin subunit ScpA [Polynucleobacter sp. QLW-P1DMWA-1] (287 aa)
Score = 134, Expect = 3.0e-06, Identities = 35/113 (30%), Positives = 70/113 (61%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP--SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFE 147
           F GP +L   LI+++  ++L+I + +V Q Y+ YI+  +    ++   EYLLMA  L+E KS+ +LP    D+EE++     R + ++RLL Y++  ++  + ++++ ++ R F+
  S:    56 FEGPLDLLLYLIRKQNFNVLDIPMAQVTQQYLSYIDQ-IRHHNLELAAEYLLMAAMLIEIKSRMLLPMKKADSEEEVED--PRAELVRRLLEYER-MKLAAQELDQIPQQGRDFQ 166
>gi|53718634|ref|YP_107620.1| hypothetical protein BPSL0992 [Burkholderia pseudomallei K96243] >gi|53725224|ref|YP_102474.1| segregation and condensation protein A [Burkholderia mallei ATCC 23344] >gi|67639744|ref|ZP_00438580.1| COG1354: Uncharacterized conserved protein [Burkholderia mallei GB8 horse 4] >gi|76811700|ref|YP_332616.1| segregation and condensation protein A [Burkholderia pseudomallei 1710b] >gi|121600217|ref|YP_993619.1| segregation and condensation protein A [Burkholderia mallei SAVP1] >gi|124384825|ref|YP_001028920.1| segregation and condensation protein A [Burkholderia mallei NCTC 10229] >gi|126439895|ref|YP_001058094.1| segregation and condensation protein A [Burkholderia pseudomallei 668] >gi|126449669|ref|YP_001081167.1| segregation and condensation protein A [Burkholderia mallei NCTC 10247] >gi|126455189|ref|YP_001065331.1| segregation and condensation protein A [Burkholderia pseudomallei 1106a] >gi|161357211|ref|ZP_02103087.1| segregation and condensation protein A [Burkholderia pseudomallei 1106b] >gi|161370845|ref|ZP_02110411.1| segregation and condensation protein A [Burkholderia pseudomallei 1710a] >gi|167003055|ref|ZP_02268845.1| segregation and condensation protein A [Burkholderia mallei PRL-20] >gi|167718564|ref|ZP_02401800.1| segregation and condensation protein A [Burkholderia pseudomallei DM98] >gi|167737592|ref|ZP_02410366.1| segregation and condensation protein A [Burkholderia pseudomallei 14] >gi|167814727|ref|ZP_02446407.1| segregation and condensation protein A [Burkholderia pseudomallei 91] >gi|167823181|ref|ZP_02454652.1| segregation and condensation protein A [Burkholderia pseudomallei 9] >gi|167844744|ref|ZP_02470252.1| segregation and condensation protein A [Burkholderia pseudomallei B7210] >gi|167893280|ref|ZP_02480682.1| segregation and condensation protein A [Burkholderia pseudomallei 7894] >gi|167901738|ref|ZP_02488943.1| segregation and condensation protein A [Burkholderia pseudomallei NCTC 13177] >gi|167909978|ref|ZP_02497069.1| segregation and condensation protein A [Burkholderia pseudomallei 112] >gi|167918012|ref|ZP_02505103.1| segregation and condensation protein A [Burkholderia pseudomallei BCC215] >gi|194313693|ref|YP_002009238.1| segregation and condensation protein A [Burkholderia mallei ATCC 10399] >gi|194504112|ref|YP_002033684.1| segregation and condensation protein A [Burkholderia pseudomallei 1655] >gi|194508506|ref|YP_002021040.1| segregation and condensation protein A [Burkholderia pseudomallei Pasteur 52237] >gi|194515783|ref|YP_002051358.1| segregation and condensation protein A [Burkholderia pseudomallei S13] >gi|194524963|ref|YP_002060493.1| segregation and condensation protein A [Burkholderia mallei FMH] >gi|194529125|ref|YP_002064646.1| segregation and condensation protein A [Burkholderia mallei JHU] >gi|194570050|ref|YP_002105051.1| segregation and condensation protein A [Burkholderia pseudomallei 406e] >gi|194574728|ref|YP_002109612.1| segregation and condensation protein A [Burkholderia mallei 2002721280] >gi|52209048|emb|CAH34988.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] >gi|52428647|gb|AAU49240.1| segregation and condensation protein A [Burkholderia mallei ATCC 23344] >gi|76581153|gb|ABA50628.1| segregation and condensation protein A [Burkholderia pseudomallei 1710b] >gi|121229027|gb|ABM51545.1| segregation and condensation protein A [Burkholderia mallei SAVP1] >gi|124292845|gb|ABN02114.1| segregation and condensation protein A [Burkholderia mallei NCTC 10229] >gi|126219388|gb|ABN82894.1| segregation and condensation protein A [Burkholderia pseudomallei 668] >gi|126228831|gb|ABN92371.1| segregation and condensation protein A [Burkholderia pseudomallei 1106a] >gi|126242539|gb|ABO05632.1| segregation and condensation protein A [Burkholderia mallei NCTC 10247] >gi|147748973|gb|EDK56047.1| segregation and condensation protein A [Burkholderia mallei FMH] >gi|147753135|gb|EDK60200.1| segregation and condensation protein A [Burkholderia mallei JHU] >gi|148026980|gb|EDK85001.1| segregation and condensation protein A [Burkholderia mallei 2002721280] >gi|157808467|gb|EDO85637.1| segregation and condensation protein A [Burkholderia pseudomallei 406e] >gi|157938485|gb|EDO94155.1| segregation and condensation protein A [Burkholderia pseudomallei Pasteur 52237] >gi|160699069|gb|EDP89039.1| segregation and condensation protein A [Burkholderia mallei ATCC 10399] >gi|169653016|gb|EDS85709.1| segregation and condensation protein A [Burkholderia pseudomallei S13] >gi|184211949|gb|EDU08992.1| segregation and condensation protein A [Burkholderia pseudomallei 1655] (291 aa)
Score = 134, Expect = 3.0e-06, Identities = 63/245 (25%), Positives = 113/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + EV   Y+ Y++  + +  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V A DL      + K                  KL+   +IS +  E  +RE +      L    FM+ F ++ D        VV F+A+L L R   +++ Q      I++
  S:    65 FEGPLDLLLYLIRKQNFNVLDIPMAEVTAQYLGYVDQ-IRESNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEDAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNADDLRAAWADVLK----------------RAKLVQHHKISRE--ELSVREHMSLILRKLQNARFME-FADLFDTTRGVPVVVVNFIAMLELARESLVEITQAEPFAPIYV 284
>gi|149907887|ref|ZP_01896555.1| hypothetical protein PE36_19505 [Moritella sp. PE36] >gi|149808893|gb|EDM68824.1| hypothetical protein PE36_19505 [Moritella sp. PE36] (261 aa)
Score = 134, Expect = 3.1e-06, Identities = 65/245 (26%), Positives = 112/245 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ--EIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKI---SFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LIK++K+DIL + + ++   Y++Y+ + +T LKI+   EYL+MA  L E KS+ +LP +   E+  +D        RL++ +Q Q  EI     E L+   R+         D      +  +N     +  +V L+ +     KL              L          +++E+    E   H+  +     +  F  + D K  +R  VV+F+AIL L++   I L QN+    I++
  S:    37 FEGPLDLLLYLIKKQKLDILQLPMQQITAQYMEYV-DLMTTLKIELAGEYLVMAALLAEIKSRLLLPKLVVAEEELED-------PRLVLIRQLQEYEIFKNAAEDLDLHPRI-------QRDIFVANAQLPENITTTPLLAEVSLRDLAYNLQKL--------------LKKAEHFEHHQIQREVLTTREKMTHILALLQDGKVRTFYQVLDPKEGRRGIVVSFLAILELLKESLISLIQNNPLGEIYL 257
>gi|171321156|ref|ZP_02910130.1| chromosome segregation and condensation protein ScpA [Burkholderia ambifaria MEX-5] >gi|171093568|gb|EDT38732.1| chromosome segregation and condensation protein ScpA [Burkholderia ambifaria MEX-5] (290 aa)
Score = 134, Expect = 3.1e-06, Identities = 60/245 (24%), Positives = 110/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V   Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +          +  E       P +D D +  A   V  +              KL+   +IS +  E  +RE +      L    FM+ F ++ D        VV F+A+L L R   +++ Q      I++
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQIRTS-NLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDFLRA--------DVYIEQSTTPRFPDVDSDDLRAAWADVLKR-------------AKLVQHHKISRE--ELSVREHMSLILRRLQNARFME-FADLFDTSRGVPVVVVNFIAMLELARESLLEITQAEPFAPIYV 283
>gi|120612480|ref|YP_972158.1| condensin subunit ScpA [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120590944|gb|ABM34384.1| condensin subunit ScpA [Acidovorax avenae subsp. citrulli AAC00-1] (283 aa)
Score = 133, Expect = 3.4e-06, Identities = 31/93 (33%), Positives = 56/93 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQ 127
           F GP +L   LI+++  +IL+I +++V + Y+ Y++   ++  ++   EYLLMA  L+E KS+ +LP    E     +  R + ++RLL Y+Q
  S:    57 FEGPLDLLLYLIRKQNFNILDIPMLDVTRQYLGYVDEIRSR-NLELAAEYLLMAAMLIEIKSRMLLPPKKQEGAQEPEDPRAELVRRLLEYEQ 148
>gi|161830522|ref|YP_001596669.1| segregation and condensation protein A [Coxiella burnetii RSA 331] >gi|161762389|gb|ABX78031.1| segregation and condensation protein A [Coxiella burnetii RSA 331] (266 aa)
Score = 133, Expect = 3.7e-06, Identities = 36/110 (32%), Positives = 66/110 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LIK+  +DIL+I + E+ + Y+ ++ + + +++I+   EYL+MA    E KS+ +LP    EE+  +D  R + ++RL  Y++Y++    L ++L R  R
  S:    43 FEGPLDLLLYLIKKHNIDILDIPIAEITRQYMQFV-DLMREMRIELAAEYLVMAAMFAEIKSRLLLPRPVVEEENEQD-PRAELVRRLQEYERYKKAAYDL-DQLPRVGR 149
>gi|186476947|ref|YP_001858417.1| chromosome segregation and condensation protein ScpA [Burkholderia phymatum STM815] >gi|184193406|gb|ACC71371.1| chromosome segregation and condensation protein ScpA [Burkholderia phymatum STM815] (290 aa)
Score = 133, Expect = 3.8e-06, Identities = 34/112 (30%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y+   L K  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMADVTAQYLGYVEQ-LRKTNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDF 173
>gi|83718529|ref|YP_441405.1| segregation and condensation protein A [Burkholderia thailandensis E264] >gi|167580173|ref|ZP_02373047.1| segregation and condensation protein A [Burkholderia thailandensis TXDOH] >gi|167618275|ref|ZP_02386906.1| segregation and condensation protein A [Burkholderia thailandensis Bt4] >gi|167835823|ref|ZP_02462706.1| segregation and condensation protein A [Burkholderia thailandensis MSMB43] >gi|83652354|gb|ABC36417.1| segregation and condensation protein A [Burkholderia thailandensis E264] (291 aa)
Score = 133, Expect = 4.0e-06, Identities = 63/245 (25%), Positives = 113/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + EV   Y+ Y++  + +  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V A DL      + K                  KL+   +IS +  E  +RE +      L    FM+ F ++ D        VV F+A+L L R   +++ Q      I++
  S:    65 FEGPLDLLLYLIRKQNFNVLDIPMAEVTAQYLGYVDQ-IRESNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNADDLRAAWADVLK----------------RAKLVQHHKISRE--ELSVREHMSLILRKLQNARFME-FADLFDTSRGVPVVVVNFIAMLELARESLVEITQAEPFAPIYV 284
>gi|169343595|ref|ZP_02864594.1| segregation and condensation protein A [Clostridium perfringens C str. JGS1495] >gi|169298155|gb|EDS80245.1| segregation and condensation protein A [Clostridium perfringens C str. JGS1495] (248 aa)
Score = 133, Expect = 4.0e-06, Identities = 36/119 (30%), Positives = 71/119 (59%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ 151
           K F+GPF+L   LIK+ +M I  I + E+ + Y++YI   + +L ++  +E+++MA  L+E KSK +LP +  E++  ++  +   +++L  YK++++I   L E+      +F K  +
  S:     9 KNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIA-LMKELDLEITSEFIVMAATLIEIKSKSLLPKVKVEDETCEEDLQKILMEKLQEYKKFKKISAYLRERELSTGEVFTKKAE 126
>gi|110801677|ref|YP_699089.1| segregation and condensation protein A [Clostridium perfringens SM101] >gi|123047289|sp|Q0SS18|SCPA_CLOPS Segregation and condensation protein A >gi|110682178|gb|ABG85548.1| segregation and condensation protein A [Clostridium perfringens SM101] (248 aa)
Score = 133, Expect = 4.0e-06, Identities = 36/119 (30%), Positives = 71/119 (59%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ 151
           K F+GPF+L   LIK+ +M I  I + E+ + Y++YI   + +L ++  +E+++MA  L+E KSK +LP +  E++  ++  +   +++L  YK++++I   L E+      +F K  +
  S:     9 KNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIA-LMKELDLEITSEFIVMAATLIEIKSKSLLPKVKVEDETCEEDLQKILMEKLQEYKKFKKISAYLRERELSTGEVFTKKAE 126
>gi|160880716|ref|YP_001559684.1| chromosome segregation and condensation protein ScpA [Clostridium phytofermentans ISDg] >gi|160429382|gb|ABX42945.1| chromosome segregation and condensation protein ScpA [Clostridium phytofermentans ISDg] (259 aa)
Score = 133, Expect = 4.0e-06, Identities = 64/245 (26%), Positives = 118/245 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI + K++I +I +V + + Y++YI     K  ++ ++E+L+MA  LL  KS+ +LP    EE+   D  R + ++RLL YK Y+ +  +L +K      +  KP+    +     +E   +  +  + L  +    Q V  + V   K    +     I+  EI++     EI+++      L   +F   F+ + + +  K   +V F+ IL L++   I++ QN   E+I I
  S:    10 FEGPLDLLLHLIDKNKVNIYDIPIVTITEQYMEYIKAMEEK-NLEIMSEFLVMAATLLRIKSQMLLPVEVKEEEEVVD-PRQELVERLLEYKMYKYVSYELKDKQMDAQLLMFKPSTIPLEISDYKEEIDISELLSDLTLAKLHTIFQSVMKRQV--DKVDPIRSKFGKIEKEEINLSQKILEIQQY-----GLEHRTFS--FRRLLERQTGKMDVIVTFLGILELMKMQRIEICQNDLFEDIMI 243
>gi|23335399|ref|ZP_00120635.1| COG1354: Uncharacterized conserved protein [Bifidobacterium longum DJO10A] >gi|189439101|ref|YP_001954182.1| Hypothetical protein BLD_0238 [Bifidobacterium longum DJO10A] >gi|189427536|gb|ACD97684.1| Hypothetical protein BLD_0238 [Bifidobacterium longum DJO10A] (304 aa)
Score = 133, Expect = 4.0e-06, Identities = 32/129 (24%), Positives = 63/129 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEF 163
           ++GPF+    +I   K+++  ++L  + + ++ Y+        +D+ + +L +A+ L+E KS  ILP    S   E+ +    ERD    RLL Y+ Y++       ++   +  F  P    E   ++L E 
  S:    47 YSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLDIASILVEAKSVAILPGGEDSQHDEQSLEALRERDLLFARLLQYRAYKQAAGDFRARIAANAGRFPHPAAMDEGIAAMLPEL 179
>gi|134281158|ref|ZP_01767867.1| segregation and condensation protein A [Burkholderia pseudomallei 305] >gi|134247464|gb|EBA47549.1| segregation and condensation protein A [Burkholderia pseudomallei 305] (291 aa)
Score = 133, Expect = 4.1e-06, Identities = 63/245 (25%), Positives = 113/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + EV   Y+ Y++  + +  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V A DL      + K                  KL+   +IS +  E  +RE +      L    FM+ F ++ D        VV F+A+L L R   +++ Q      I++
  S:    65 FEGPLDLLLYLIRKQNFNVLDIPMAEVTAQYLGYVDQ-IRESNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEDAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNADDLRAAWADVLK----------------RAKLVQHHKISRE--ELSVREHMSLILRKLQNARFME-FADLFDTTRGVPVVVVNFIAMLELARESLVEITQAEPFAPIYV 284
>gi|91786808|ref|YP_547760.1| condensin subunit ScpA [Polaromonas sp. JS666] >gi|91696033|gb|ABE42862.1| condensin subunit ScpA [Polaromonas sp. JS666] (293 aa)
Score = 133, Expect = 4.1e-06, Identities = 33/101 (32%), Positives = 56/101 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LI+++  +IL+I +  V + Y+ Y++  +    ++   EYLLMA  L+E KS+ +LP     E    +  R + ++RLL Y+Q +    KL
  S:    67 FEGPLDLLLYLIRKQNFNILDIPMAAVTRQYLTYVDE-IRATNLELAAEYLLMAAMLIEIKSRMLLPPKKVAEGQEAEDPRAELVRRLLEYEQIKLAAHKL 166
>gi|18310787|ref|NP_562721.1| segregation and condensation protein A [Clostridium perfringens str. 13] >gi|110800277|ref|YP_696489.1| segregation and condensation protein A [Clostridium perfringens ATCC 13124] >gi|168210831|ref|ZP_02636456.1| segregation and condensation protein A [Clostridium perfringens B str. ATCC 3626] >gi|168214380|ref|ZP_02640005.1| segregation and condensation protein A [Clostridium perfringens CPE str. F4969] >gi|168215434|ref|ZP_02641059.1| segregation and condensation protein A [Clostridium perfringens NCTC 8239] >gi|182625643|ref|ZP_02953412.1| segregation and condensation protein A [Clostridium perfringens D str. JGS1721] >gi|123344655|sp|Q0TPF1|SCPA_CLOP1 Segregation and condensation protein A >gi|41018092|sp|Q8XJF4|SCPA_CLOPE Segregation and condensation protein A >gi|18145468|dbj|BAB81511.1| conserved hypothetical protein [Clostridium perfringens str. 13] >gi|110674924|gb|ABG83911.1| segregation and condensation protein A [Clostridium perfringens ATCC 13124] >gi|170711132|gb|EDT23314.1| segregation and condensation protein A [Clostridium perfringens B str. ATCC 3626] >gi|170714148|gb|EDT26330.1| segregation and condensation protein A [Clostridium perfringens CPE str. F4969] >gi|177909045|gb|EDT71520.1| segregation and condensation protein A [Clostridium perfringens D str. JGS1721] >gi|182382056|gb|EDT79535.1| segregation and condensation protein A [Clostridium perfringens NCTC 8239] (248 aa)
Score = 133, Expect = 4.1e-06, Identities = 36/119 (30%), Positives = 71/119 (59%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ 151
           K F+GPF+L   LIK+ +M I  I + E+ + Y++YI   + +L ++  +E+++MA  L+E KSK +LP +  E++  ++  +   +++L  YK++++I   L E+      +F K  +
  S:     9 KNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIA-LMKELDLEITSEFIVMAATLIEIKSKSLLPKVKVEDETCEEDLQKILMEKLQEYKKFKKISAYLRERELSTGEVFTKKAE 126
>gi|163854832|ref|YP_001629130.1| hypothetical protein Bpet0527 [Bordetella petrii DSM 12804] >gi|163258560|emb|CAP40859.1| conserved hypothetical protein [Bordetella petrii] (295 aa)
Score = 132, Expect = 4.2e-06, Identities = 33/101 (32%), Positives = 60/101 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDL---TEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LI+++  ++L+I + +V + Y+ Y+     ++++ +L    EYLLMA  L+E KS+ +LP   T+     +  R + ++RLL Y+Q +    KL
  S:    61 FEGPLDLLLYLIRKQNFNVLDIPMADVTRQYLSYVE----QIRLHNLELAAEYLLMAAMLIEIKSRMLLPVKKTDTGEEPEDPRAELVRRLLEYEQMKLAAQKL 160
>gi|23465933|ref|NP_696536.1| hypothetical protein BL1371 [Bifidobacterium longum NCC2705] >gi|23326643|gb|AAN25172.1| narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] (304 aa)
Score = 132, Expect = 4.3e-06, Identities = 32/129 (24%), Positives = 63/129 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP----SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEF 163
           ++GPF+    +I   K+++  ++L  + + ++ Y+        +D+ + +L +A+ L+E KS  ILP    S   E+ +    ERD    RLL Y+ Y++       ++   +  F  P    E   ++L E 
  S:    47 YSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLDIASILVEAKSVAILPGGEDSQHDEQSLEALRERDLLFARLLQYRAYKQAAGDFRARIAANAGRFPHPAAMDEGIAAMLPEL 179
>gi|77164552|ref|YP_343077.1| chromosome segregation and condensation protein ScpA [Nitrosococcus oceani ATCC 19707] >gi|76882866|gb|ABA57547.1| condensin subunit ScpA [Nitrosococcus oceani ATCC 19707] (269 aa)
Score = 132, Expect = 4.4e-06, Identities = 37/113 (32%), Positives = 65/113 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR-MFE 147
           F GP +L   LI+ + +D+L+I +  +   Y++YI   L +L+++   EYL+MA +L E KS+ +LP      +   D  R + ++RL  Y++Y++    L + L R  R +FE
  S:    45 FEGPLDLLLYLIRRQNLDVLDIPIAVITHQYMEYI-EILGELRLELAAEYLVMAAWLAEIKSRMLLPRPQESAEEEGD-PRMELVRRLQEYERYKKAAEDL-DSLPRVGRDIFE 155
>gi|145218983|ref|YP_001129692.1| condensin subunit ScpA [Prosthecochloris vibrioformis DSM 265] >gi|145205147|gb|ABP36190.1| condensin subunit ScpA [Prosthecochloris vibrioformis DSM 265] (248 aa)
Score = 132, Expect = 4.4e-06, Identities = 61/237 (25%), Positives = 111/237 (46%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDV---ILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHI 266
           I+ +EF GP +L    IK  ++DI NI + ++   +V YI++   + K++   E++ MA+ L+  K+  +LP     ++ + + + R + +QRLL YKQ +E    L +    R ++F +          L +EF     V  +D  V    L  +   Y + V     K    NV    V+      V+++I   +       ++SF D  + +      +   VV F+A+L + +NG I
  S:     4 ISLEEFEGPLDLLLFFIKRDELDIYNIPISKITTDFVSYIHD-ARRFKLEVAAEFIYMASLLMSIKASMLLPRQTANDEDTDEFDPRTELVQRLLEYKQIKEASEILDQCAFEREQLFAR---------GLFEEFMP-EVVDELDEQVNRPTLYHLMSAY-RAVLDNMPKPMSRNVMDAPVT------VKEQIELIISKLQDRVQVSFSDVLEGVSQ----RIILVVTFLAVLEMCKNGRI 222
>gi|170702426|ref|ZP_02893313.1| chromosome segregation and condensation protein ScpA [Burkholderia ambifaria IOP40-10] >gi|172061398|ref|YP_001809050.1| chromosome segregation and condensation protein ScpA [Burkholderia ambifaria MC40-6] >gi|170132674|gb|EDT01115.1| chromosome segregation and condensation protein ScpA [Burkholderia ambifaria IOP40-10] >gi|171993915|gb|ACB64834.1| chromosome segregation and condensation protein ScpA [Burkholderia ambifaria MC40-6] (290 aa)
Score = 132, Expect = 4.5e-06, Identities = 33/112 (29%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQIRTS-NLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDF 173
>gi|170733782|ref|YP_001765729.1| chromosome segregation and condensation protein ScpA [Burkholderia cenocepacia MC0-3] >gi|169817024|gb|ACA91607.1| chromosome segregation and condensation protein ScpA [Burkholderia cenocepacia MC0-3] (290 aa)
Score = 132, Expect = 4.7e-06, Identities = 33/112 (29%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQIRTS-NLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDF 173
>gi|115352539|ref|YP_774378.1| chromosome segregation and condensation protein ScpA [Burkholderia ambifaria AMMD] >gi|115282527|gb|ABI88044.1| condensin subunit ScpA [Burkholderia ambifaria AMMD] (290 aa)
Score = 132, Expect = 4.7e-06, Identities = 33/112 (29%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQIRTS-NLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDF 173
>gi|78067241|ref|YP_370010.1| condensin subunit ScpA [Burkholderia sp. 383] >gi|77967986|gb|ABB09366.1| condensin subunit ScpA [Burkholderia sp. 383] (290 aa)
Score = 132, Expect = 4.7e-06, Identities = 33/112 (29%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQIRTS-NLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDF 173
>gi|119898403|ref|YP_933616.1| hypothetical protein azo2112 [Azoarcus sp. BH72] >gi|119670816|emb|CAL94729.1| conserved hypothetical protein [Azoarcus sp. BH72] (276 aa)
Score = 132, Expect = 4.8e-06, Identities = 60/245 (24%), Positives = 112/245 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI++  +++L+I +  +   Y++Y+   +    ++   EYLLMA  LLE KS+ +LP    E +  +D  R + ++RLL Y+Q +    +L + L R  R FE       +K            V     +V L  +Q  +L+++  KK K  + +          +   +  +RE +     +        F+ + D        VV+F+A+L LV+   +++ QN +   I++
  S:    48 FEGPLDLLLYLIRKANLNVLDIPMAPLTAQYLEYVEA-MRASNLELAAEYLLMAAMLLEIKSRMLLPRPPREHEDEED-PRAELVRRLLEYEQMKLAAGRL-DLLPRAERDFEWVGVFVAEK------------VVERQPEVSLHDLQVAWLRIM--KKAKLTQHH---------RVGREQLSVREHMTAILRMLGDGEFVAFERLFDLALGTPGLVVSFLAVLELVKEKLVEVTQNEAFAPIYV 266
>gi|134296623|ref|YP_001120358.1| condensin subunit ScpA [Burkholderia vietnamiensis G4] >gi|134139780|gb|ABO55523.1| condensin subunit ScpA [Burkholderia vietnamiensis G4] (290 aa)
Score = 132, Expect = 5.0e-06, Identities = 33/112 (29%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y++   T   ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQIRTS-NLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDF 173
>gi|109899135|ref|YP_662390.1| chromosome segregation and condensation protein ScpA [Pseudoalteromonas atlantica T6c] >gi|109701416|gb|ABG41336.1| condensin subunit ScpA [Pseudoalteromonas atlantica T6c] (285 aa)
Score = 132, Expect = 5.1e-06, Identities = 42/120 (35%), Positives = 70/120 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS-MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLERRSRMFEKPTQSGE 154
           F GP +L   LI+++K D++N+ + E+ + Y+ Y+ + +  LK++   EYLLMA  L E KS+ +LP   D EE   +D  R + I+RL  Y+  +    +L  + +LER   +F    Q+ E
  S:    57 FEGPLDLLLYLIRKQKFDLVNLPVYEITKQYMLYV-DMMKDLKLELAAEYLLMAAILAEIKSRLLLPKRTDAEE--DEDDPRAELIRRLQEYELIKSAAQELDALPRLER--DVFSAQAQTSE 174
>gi|116629541|ref|YP_814713.1| hypothetical protein LGAS_0886 [Lactobacillus gasseri ATCC 33323] >gi|122273521|sp|Q043U7|SCPA_LACGA Segregation and condensation protein A >gi|116095123|gb|ABJ60275.1| condensin subunit ScpA [Lactobacillus gasseri ATCC 33323] (247 aa)
Score = 132, Expect = 5.1e-06, Identities = 66/249 (26%), Positives = 116/249 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD-TEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           F GP +L   LI+ +K+DI +I + ++   Y+  +  + T L +    EY +MA+ LL  KS+ +LP  D  EE   ++  R + +++L+ Y  +Q I     ++ E       K P+ S + K   L   +  S   A    V+L             ++ K  K  V  I+V E SI+++   +++ L    H    SF D  KN  D        +  F+A+L L R+  I ++QN    ++ + K++
  S:    14 FTGPLDLLLHLIRSQKIDIYDIPIAKITGQYLANLARWQT-LDLQIAGEYFVMASTLLRIKSQYLLPKNDFVEEDQYQEDPRAELVEQLVQYSVFQRIAEYFKKRDEEMPITVAKDPSVSPKKKVEPLPLGEITSDELANTFKVVL-------------ERFKLRKPQVGQIEVHEASIEEMTTFLKDKLH---HRKSTSFFDCIKNFQDLD----QVIGLFLAVLELCRDHKILVKQNRDFGDLELEKVE 243
>gi|71908075|ref|YP_285662.1| condensin subunit ScpA [Dechloromonas aromatica RCB] >gi|71847696|gb|AAZ47192.1| condensin subunit ScpA [Dechloromonas aromatica RCB] (283 aa)
Score = 132, Expect = 5.1e-06, Identities = 35/112 (31%), Positives = 60/112 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI++  +DIL+I +  + + Y+DYI + +    ++   EYL+MA  L+E KS+ +LP     E    +  R + ++RL+ Y+Q +    KL E  +     F
  S:    49 FEGPLDLLLYLIRKANVDILDIPMAPLTRQYLDYIES-MHASNLELAAEYLVMAAMLIEIKSRMLLPRPKLGEGDEAEDPRAELVRRLMEYEQIKLAGQKLNEMPQAEREFF 159
>gi|157961472|ref|YP_001501506.1| chromosome segregation and condensation protein ScpA [Shewanella pealeana ATCC 700345] >gi|157846472|gb|ABV86971.1| chromosome segregation and condensation protein ScpA [Shewanella pealeana ATCC 700345] (262 aa)
Score = 132, Expect = 5.3e-06, Identities = 36/113 (31%), Positives = 67/113 (59%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRM 145
           + F GP +L   LI+++K+D++++ +  V Q Y++Y+ N L   +++   +YL+MA  L E KS+ +LP  + E +  +D  R + I++L  Y    E++ +  EKL+   RM
  S:    37 ESFEGPLDLLLYLIRKQKLDVVDLPIFSVTQQYLEYV-NLLQGARVELAADYLVMAATLAEIKSRLLLPRPEIELEDEED-PRAQLIRQLKAY----EVIKEAQEKLDELPRM 143
>gi|113868913|ref|YP_727402.1| hypothetical protein H16_A2958 [Ralstonia eutropha H16] >gi|113527689|emb|CAJ94034.1| conserved hypothetical protein [Ralstonia eutropha H16] (297 aa)
Score = 131, Expect = 5.5e-06, Identities = 36/114 (31%), Positives = 63/114 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ------EIVPKLMEKLERRSRMFEK 148
           F GP +L   LI+++  ++L+I + +V + Y+ YI   + K  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q +      + VP+L     R     E+
  S:    67 FEGPLDLLLYLIRKQNFNVLDIPMSQVTRQYLSYIEQ-IRKTNLELAAEYLLMAAMLIEIKSRMLLPVKKADSDDEAEDPRAELVRRLLEYEQMKLAAQRLDTVPQLGRDFLRSQVYIEQ 185
>gi|104782898|ref|YP_609396.1| hypothetical protein PSEEN3902 [Pseudomonas entomophila L48] >gi|95111885|emb|CAK16609.1| conserved hypothetical protein [Pseudomonas entomophila L48] (272 aa)
Score = 131, Expect = 5.7e-06, Identities = 61/237 (25%), Positives = 112/237 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+   D  R + I+RL  Y++++     + ++L R  R    P       ++          +P + L+ IL +M +V  +           D  +   ++  ++   E+ + E LE       + F++ F      +  K   VV F+AIL LV+   I+L QN
  S:    48 FEGPLDLLLYLIRKQNVDILDIPVAEITRQYMSYV-ELMKSVRLELAAEYLVMAAMLAEIKSRMLLPRSSEVEEEEGD-PRAELIRRLQEYERFKAAAEGI-DELPRVGREVVVPRLEAPQAKA-------RKLLPEVALEEILLSMAEVMRR----------NDLFESHQITRETLSTRER-MSEVLERLKGGAFVPFVELFT----REEGKLGVVVTFMAILELVKESLIELVQN 259
>gi|161524032|ref|YP_001579044.1| chromosome segregation and condensation protein ScpA [Burkholderia multivorans ATCC 17616] >gi|189351207|ref|YP_001946835.1| segregation and condensation protein A [Burkholderia multivorans ATCC 17616] >gi|160341461|gb|ABX14547.1| chromosome segregation and condensation protein ScpA [Burkholderia multivorans ATCC 17616] >gi|189335229|dbj|BAG44299.1| segregation and condensation protein A [Burkholderia multivorans ATCC 17616] (290 aa)
Score = 131, Expect = 5.7e-06, Identities = 62/245 (25%), Positives = 112/245 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V   Y+ Y++  +    ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V A DL      + K                  KL+   +IS +  E  +RE +      L    FM+ F ++ D        VV F+A+L L R   +++ Q      I++
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQ-IRASNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNADDLRAAWADVLK----------------RAKLVQHHKISRE--ELSVREHMSLILRRLQNARFME-FADLFDTSRGVPVVVVNFIAMLELARESLVEITQAEPFAPIYV 283
>gi|126668317|ref|ZP_01739276.1| hypothetical protein MELB17_11520 [Marinobacter sp. ELB17] >gi|126627234|gb|EAZ97872.1| hypothetical protein MELB17_11520 [Marinobacter sp. ELB17] (277 aa)
Score = 131, Expect = 6.0e-06, Identities = 34/110 (30%), Positives = 64/110 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+ + M+IL I++  + + Y++YI   +  ++ +   EYL+MA  L E KS+ +LP    EE   +D  R + I+RL  Y+++++    + +++ R+ R
  S:    52 FEGPLDLLLYLIRRQNMNILEIDVSAITRQYMEYI-AVVESMRFELAGEYLVMAATLAEIKSRMLLPRQQIEED-EEDDPRAELIRRLQQYERFKKAAEDI-DQMPRQER 158
>gi|172057047|ref|YP_001813507.1| chromosome segregation and condensation protein ScpA [Exiguobacterium sibiricum 255-15] >gi|171989568|gb|ACB60490.1| chromosome segregation and condensation protein ScpA [Exiguobacterium sibiricum 255-15] (251 aa)
Score = 131, Expect = 6.0e-06, Identities = 71/240 (29%), Positives = 120/240 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLV-TTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMD---YFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSD 274
           F GP +L   LI + ++D+ +I++  V   YV YI   +  L++D  +EYL+MA  LL+ KSK++LP   T+ +   D E    R+  IQ+L+ YK Y+E    L EK E R  +F K     ED  + L    +  +   +    +L+A +K+  ++    +++K+                 V++E R   +   H+ +  F +    F     E+ T    VV+F+A+L LV+   +  EQ S D
  S:    11 FEGPLDLLLHLIGKLEIDLYDISVSIVTDQYVSYIRA-MQHLELDVASEYLVMAATLLQLKSKQLLPVEQTDFEDVPDFEEDPTREGLIQQLIEYKAYKEAALVLKEKEEARLELFSK---QPEDLMTYLDP-DNQDFSGNLSFSDLLRAYEKMRQRVAWKVRRSKT-----------------VKREERTLEQQMIHVSEYVFANEGTTFFGFFTEQPTVEELVVSFLAVLELVKQCVVACEQMSDD 236
>gi|114776455|ref|ZP_01451500.1| chromosome segregation and condensation protein ScpA [Mariprofundus ferrooxydans PV-1] >gi|114553285|gb|EAU55683.1| chromosome segregation and condensation protein ScpA [Mariprofundus ferrooxydans PV-1] (263 aa)
Score = 131, Expect = 6.3e-06, Identities = 38/151 (25%), Positives = 82/151 (54%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTK--------LKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKV 184
           +F GP ++   LI+ +KMDI N+ + E+ + Y+  +     +        L +D   +YL+MA+ L++ KS+ +LP  + +++ ++   R +   +L+ Y+QY+ +  +L E+      +F +      +  ++++       +P  DLD +L A + V
  S:    27 QFEGPLDVLLHLIRSQKMDIFNVPIAELTRQYLTLLQQPSDQQSEDDEISLDLDIAGDYLVMASTLMQLKSRMLLPRPELDDEGNEIDPRAELAAQLIAYEQYRLLAEQLGERPRLGRDLFARSVFP--EAANIVRP------LPEGDLDALLMAFRHV 177
>gi|153810798|ref|ZP_01963466.1| hypothetical protein RUMOBE_01182 [Ruminococcus obeum ATCC 29174] >gi|149833194|gb|EDM88276.1| hypothetical protein RUMOBE_01182 [Ruminococcus obeum ATCC 29174] (261 aa)
Score = 131, Expect = 6.4e-06, Identities = 57/243 (23%), Positives = 129/243 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKL--IDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENI 277
           F GP +L   LI++ K+DI +I +VE+   Y++Y+++ + +  +  ++E+++MA  LL+ K K +LP     E+  ++  R++ +Q+LL YK Y+ +  +L + ++  + +F K   S  D+    +E  D + + A    + L+ +  +Y  ++  +++K      K   I+  E+S+ D    ++ +               F+ +   + ++   +V F++IL L++ G+I ++Q+   ++I
  S:    10 FEGPLDLLLHLIEKNKIDIYDIPIVEITDQYMEYLHS-MEQEDLGTMSEFMVMAATLLDIKCKMLLPKE-VNEEGEEEDPREELVQKLLEYKMYKYMSYELKDYMDNAAGVFYK-NPSIPDEVLKYREPVDPAELLA---GLTLEKLNNIYQSILKKQESKIDPIRSKFGTIEKEEVSLSDKMLAMKSYAAEHRKF-------SFRQLLTSQSSRVQVIVTFLSILELMKMGYIHVQQDELFDDI 241
>gi|121603866|ref|YP_981195.1| chromosome segregation and condensation protein ScpA [Polaromonas naphthalenivorans CJ2] >gi|120592835|gb|ABM36274.1| condensin subunit ScpA [Polaromonas naphthalenivorans CJ2] (283 aa)
Score = 131, Expect = 6.7e-06, Identities = 62/245 (25%), Positives = 110/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEI------REFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  +IL+I +  V + Y+ Y++  +    ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y           EK++  +       Q G D   LL              DV L  +Q+ +  +V  K+ K  +++V  I   E+S+ +    +      R+FLE             F+ + D        VV F+A+L L +   +++ Q  S   I++
  S:    57 FEGPLDLLLYLIRKQNFNILDIPMAAVTRQYLAYVDE-IRATNLELAAEYLLMAAMLIEIKSRMLLPPKKQDASQEAEDPRAELVRRLLEY-----------EKIKLAAHKLNTVPQLGRD--FLLAHVHAEQSTQPRLPDVTLVELQEAWQGIV--KRAKLVQNHV--ITREELSVREHMSIVLRRLQGRKFLE-------------FEELFDAPGGMPVLVVTFIALLELAKECLLEITQAESFAPIYV 276
>gi|117620018|ref|YP_857423.1| segregation and condensation protein A [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117561425|gb|ABK38373.1| segregation and condensation protein A [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (318 aa)
Score = 131, Expect = 6.7e-06, Identities = 35/107 (32%), Positives = 64/107 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLME--KLER 141
           F GP +L   LI+ ++++ILN+ ++++   Y++Y+   +  L ++   EYLLMA +L E KS+ +LP     E   +  + R   I+RL  Y++Y+    ++ E  +LER
  S:    81 FEGPLDLLLYLIRRQQLEILNLPILQITAQYMEYV-ELMQGLNLELAAEYLLMAAWLAEIKSRLLLPKAPELEDEEEGEDPRVTLIRRLQEYERYKVGAERVNELPRLER 189
>gi|134298997|ref|YP_001112493.1| chromosome segregation and condensation protein ScpA [Desulfotomaculum reducens MI-1] >gi|134051697|gb|ABO49668.1| condensin subunit ScpA [Desulfotomaculum reducens MI-1] (251 aa)
Score = 131, Expect = 6.9e-06, Identities = 56/247 (22%), Positives = 118/247 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDI---ERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           F GP +L   LI + +++I +I + ++   Y+ YI    T L +D  +E+L+MA+ L+  K++ +LP      +  ++     R++ +Q+LL YK+++E+   L  +  +  +++ +        +     F+    +  + ++ +L ++Q V  +         P +    I   EI + +  +++   L  +P    + F   F N      +    VV F+AIL L++ G I + QN +   I I++
  S:    10 FEGPLDLLLHLIDKDQINIYDIPIAQITSQYLTYIEQMQT-LDMDVASEFLVMASSLVSIKARMLLPRTKVGPETEEEEGPDPREELVQKLLEYKKFKEVASFLKNQERQAGKVYTRNNHI----DMYQHLFRPMDPLCGVTIEKLLTSLQSVLQR--AGANLTIPGE----ITREEIQVPEKMRQLLAMLVLYPE--GMVFSRLFANTA----SPTEIVVTFMAILELLKGGQISVVQNETFGEITILR 242
>gi|28211199|ref|NP_782143.1| segregation and condensation protein A [Clostridium tetani E88] >gi|41018006|sp|Q894L2|SCPA_CLOTE Segregation and condensation protein A >gi|28203639|gb|AAO36080.1| dihydrofolate reductase [Clostridium tetani E88] (254 aa)
Score = 130, Expect = 7.5e-06, Identities = 67/252 (26%), Positives = 133/252 (52%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYI--QRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV--KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           + F GPF+L   LIK+ ++DI NIN+ E+   Y++YI + L ++ ++  +E++++A+ LL+ KS+ +LP +  EE+     E  + I   +L+ YK+++ +   L  +LE+   +F K  +  E KE   K+         + +DV +  +  +Y +L+T  K K    N   + I++ E  I D    ++  +    +L        F  I  E   K   +V F+A+L L+R   +++ Q  + + I++ ++++
  S:     8 QNFQGPFDLLLHLIKKNQLDIYNINISEITGQYMEYIES-LKEMDLEVTSEFIVIASTLLQIKSRELLPKIQDEEEEEISEENPEKILLDKLIEYKKFKNVASYLKGRLEKGFTVFSKKPEIIEKKEEEDKD---------IFIDVTILELYNLYNELITKYKDKINLSNTIPEEIELEEFKIGDKMNYLKSRIIENKNL-------SFSQISKECSCKGEVIVTFLALLELIRIKIVKVVQEGNFKEIYLERMEE 246
>gi|77360239|ref|YP_339814.1| hypothetical protein PSHAa1296 [Pseudoalteromonas haloplanktis TAC125] >gi|76875150|emb|CAI86371.1| conserved protein of unknown function [Pseudoalteromonas haloplanktis TAC125] (280 aa)
Score = 130, Expect = 9.0e-06, Identities = 62/251 (24%), Positives = 122/251 (48%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE------PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           +I  + F GP +L   LIK+ K+D+L +++  + + Y+ Y+   +T+ +++   EYL+MA  L + KS+ +LP     E+  ++  R + I+RL  Y+Q+++    L +++ R  R       +    E++ ++      +P + L  +L A+  +  +  T +          LI    +S  +   +I + L       PF  L+ ++              +   VV+F+AIL LV+ G I   Q +SD  I++
  S:    46 EIILETFEGPLDLLLYLIKKHKLDVLELSIFSITEQYMSYV-EMMTEFQLELAGEYLVMAALLAQIKSRLLLPVHKELEE--EEDPRAELIKRLQEYEQFKKAAENL-DEIPRVGRDIFVAHAAMPVAENITEQ------LPEVQLKDLLFALSDIMARAKTLEH--------HLISAEVLSTRERMSQILQQLSHTQSALPFSALFTVN------------EGRSGAVVSFIAILELVKEGLITCLQVTSDSLIYV 272
>gi|21672977|ref|NP_661042.1| hypothetical protein CT0136 [Chlorobium tepidum TLS] >gi|21646037|gb|AAM71384.1| segregation and condensation protein A [Chlorobium tepidum TLS] (242 aa)
Score = 130, Expect = 9.1e-06, Identities = 35/119 (29%), Positives = 68/119 (57%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           I+ +EF GP +L    IK  ++DI NI + ++   ++ YI+  + +L ++   E++ MA+ L+  K++ +LP  +  +  + + + R + +QRLL YK+ +E   +L      R RMF +
  S:     4 ISLEEFEGPLDLLLFFIKRDELDIYNIPISKITGDFIAYIHA-MRRLNLEVAAEFIYMASMLMSIKARMLLPRAEPVDGEADEFDPRTELVQRLLEYKRIKEGASELELMALDRERMFPR 122
>gi|91776226|ref|YP_545982.1| condensin subunit ScpA [Methylobacillus flagellatus KT] >gi|91710213|gb|ABE50141.1| condensin subunit ScpA [Methylobacillus flagellatus KT] (266 aa)
Score = 130, Expect = 9.2e-06, Identities = 30/92 (32%), Positives = 59/92 (64%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYK 126
           F GP +L   LI++  +DIL+I + ++ + Y+DY+   + + K++   EYLLM+  L+E KS+ +LP  ++ E+  ++  R + ++RL+ Y+
  S:    37 FEGPLDLLLYLIRKHNLDILDIPMAQLTRQYMDYVEK-MRESKLELAAEYLLMSAMLIEIKSRMLLPKPESIEQ--EEDPRAELVRRLMEYE 125
>gi|67155815|ref|ZP_00417442.1| Protein of unknown function DUF173 [Azotobacter vinelandii AvOP] >gi|67086759|gb|EAM06227.1| Protein of unknown function DUF173 [Azotobacter vinelandii AvOP] (268 aa)
Score = 129, Expect = 1.1e-05, Identities = 47/150 (31%), Positives = 80/150 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLK--EFQDNSYVPAMDLDVILKAMQKV 184
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +   +++   EYL+MA  L E KS  +LP     E+  +D  R + I+RL  Y++Y+    +L + L R  R         E   +LL+  + Q    +P + LD +L AM +V
  S:    37 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKAARLELAAEYLVMAAMLAEIKSHMLLPRSVAAEEEEED-PRAELIRRLQEYERYKRAAEEL-DDLPRVGR---------ELHPALLEAPQAQMRRRLPMVGLDELLLAMAEV 176
>gi|167561945|ref|ZP_02354861.1| segregation and condensation protein A [Burkholderia oklahomensis EO147] >gi|167569196|ref|ZP_02362070.1| segregation and condensation protein A [Burkholderia oklahomensis C6786] (291 aa)
Score = 129, Expect = 1.1e-05, Identities = 62/245 (25%), Positives = 113/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLE-PFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  ++L+I + +V   Y+ Y++  + +  ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F +     E  +S+   F D   V A DL      + K                  KL+   +IS +  E  +RE +      L    FM+ F ++ D        VV F+A+L L R   +++ Q      I++
  S:    65 FEGPLDLLLYLIRKQNFNVLDIPMADVTAQYLGYVDQ-IRESNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDFLRAEVYIE--QSITPRFPD---VNADDLRAAWADVLK----------------RAKLVQHHKISRE--ELSVREHMSLILRKLQNARFME-FADLFDTSRGVPVVVVNFIAMLELARESLVEITQAEPFAPIYV 284
>gi|196157086|ref|YP_002126575.1| chromosome segregation and condensation protein ScpA [Alteromonas macleodii 'Deep ecotype'] >gi|88773983|gb|EAR05242.1| hypothetical protein MADE_17702 [Alteromonas macleodii 'Deep ecotype'] >gi|196112865|gb|ACG66581.1| chromosome segregation and condensation protein ScpA [Alteromonas macleodii 'Deep ecotype'] (287 aa)
Score = 129, Expect = 1.1e-05, Identities = 37/111 (33%), Positives = 63/111 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRM 145
           F GP +L   LI+++K DI  + + +V + Y++Y++  +  LK++   EYLLMA  L E KS+ +LP    +    +D  R + I+RL  Y    E+V +  E L+ + R+
  S:    59 FEGPLDLLLYLIRKQKFDITTLPIADVTKQYMEYVDAMMA-LKLELAAEYLLMAAILAEIKSRLLLPKRSDDNDEEED-PRAELIRRLKEY----ELVKQAAEDLDTQPRL 163
>gi|24380087|ref|NP_722042.1| segregation and condensation protein A [Streptococcus mutans UA159] >gi|41017950|sp|Q7ZAK8|SCPA_STRMU Segregation and condensation protein A >gi|24378082|gb|AAN59348.1|AE015000_6 conserved hypothetical protein [Streptococcus mutans UA159] (235 aa)
Score = 129, Expect = 1.1e-05, Identities = 36/121 (29%), Positives = 72/121 (59%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKP 149
           DI  K+F GP +L   L+ + ++DI ++ +V++I+ Y+ YI   L  +K++   EY++MA+ L+  KS+++LP +    +  +D E  + + ++  Y+ Y+ +  +L  K   R++ F KP
  S:     2 DIKLKDFEGPLDLLLHLVSKYEVDIYDVPIVDIIEQYLAYIAT-LQAMKLEVAGEYMVMASQLMLIKSRKLLPKVVETIEAEEDPEL-QLLHQIEEYRTYKLLGEELALKHNERAQRFSKP 120
>gi|167585779|ref|ZP_02378167.1| chromosome segregation and condensation protein ScpA [Burkholderia ubonensis Bu] (283 aa)
Score = 129, Expect = 1.2e-05, Identities = 32/112 (28%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y++  +    ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    57 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQ-IRASNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDRLPQLGRDF 166
>gi|107023379|ref|YP_621706.1| chromosome segregation and condensation protein ScpA [Burkholderia cenocepacia AU 1054] >gi|116690461|ref|YP_836084.1| chromosome segregation and condensation protein ScpA [Burkholderia cenocepacia HI2424] >gi|194558481|ref|YP_002093507.1| hypothetical protein BCPG_02295 [Burkholderia cenocepacia PC184] >gi|105893568|gb|ABF76733.1| condensin subunit ScpA [Burkholderia cenocepacia AU 1054] >gi|116648550|gb|ABK09191.1| condensin subunit ScpA [Burkholderia cenocepacia HI2424] >gi|124872272|gb|EAY63988.1| hypothetical protein BCPG_02295 [Burkholderia cenocepacia PC184] (290 aa)
Score = 129, Expect = 1.2e-05, Identities = 32/112 (28%), Positives = 63/112 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           F GP +L   LI+++  ++L+I + +V   Y+ Y++  +    ++   EYLLMA  L+E KS+ +LP    +     +  R + ++RLL Y+Q  ++  + +++L +  R F
  S:    64 FEGPLDLLLYLIRKQNFNVLDIPMAQVTAQYLGYVDQ-IRASNLELAAEYLLMAAMLIEIKSRMLLPVKKADTGEEAEDPRAELVRRLLEYEQ-MKLAAQRLDQLPQLGRDF 173
>gi|85712442|ref|ZP_01043491.1| hypothetical protein OS145_10530 [Idiomarina baltica OS145] >gi|85693720|gb|EAQ31669.1| hypothetical protein OS145_10530 [Idiomarina baltica OS145] (274 aa)
Score = 129, Expect = 1.2e-05, Identities = 59/236 (25%), Positives = 113/236 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNS--YVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           F+GP +L   LI+ +K D+++I ++ + + YV Y+   + +LK++   +YL+MA  L E KS+ +LP    E+   +D  R + ++RL  Y           E +   +   ++  Q G D    L E   N+  +V     +V L+ +   + +++   K  +       I   ++S  +   +I + L+  P+L        F  + ++   +   VV+F+AIL LV+   I+L Q
  S:    38 FSGPMDLLLYLIRRQKFDVVDIPVLTITRQYVHYV-EMMKELKLELAADYLVMAAMLAEIKSRLLLPKPPQEDD-EEDDPRAELVRRLREY-----------EAIRHGAEYIDEQPQIGRDM--WLSEVSSNARDHVTTAPPEVSLEDLTLAFSRILNQIKLNAHHH----IQREQLSTRERMSQILQRLQTQPYL-------RFGQLFNKSEGRAGAVVSFLAILELVKESMIELSQ 249
>gi|150016748|ref|YP_001309002.1| segregation and condensation protein A [Clostridium beijerinckii NCIMB 8052] >gi|149903213|gb|ABR34046.1| chromosome segregation and condensation protein ScpA [Clostridium beijerinckii NCIMB 8052] (255 aa)
Score = 129, Expect = 1.2e-05, Identities = 63/258 (24%), Positives = 131/258 (50%)
  Q:    22 EFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV--KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           + ++ +  I   +F GPF+L   LI++ +M I N+ + E+   Y++YIN  + K+ ++  +E++++A  L+E KSK +LP +  +E   +D E+    + +L YK+ + +   L ++      ++ K       K  +++E +D++    +  ++ L  +  +Y  L+     K  ++N+  K I V +  I+D  + I + L       K   +  F  I +    K   VV F+A+L +++   I++ Q+ +  NI I
  S:     5 KIYMELPKIKINDFEGPFDLLLHLIRKNQMSIYNVKIYEITNQYLNYINE-MKKMDLEITSEFIVVAATLIEIKSKNLLPKLKKQEDDEEDDEKKLLEKLIL-YKKIKGVSVFLKDRYTSAGEIYGK-------KPEVIEEKRDDTDKKDLLKNISLIELFNIYNNLLEIYNNKQNRNNIIQKKIYVDKYKIEDKLEYIMDKL-------KTEKVSSFHKIIENCECKLECVVTFLALLEMIKQRMIKVYQSENFSNILI 248
>gi|161507452|ref|YP_001577406.1| hypothetical protein lhv_1054 [Lactobacillus helveticus DPC 4571] >gi|160348441|gb|ABX27115.1| hypothetical protein lhv_1054 [Lactobacillus helveticus DPC 4571] (246 aa)
Score = 129, Expect = 1.2e-05, Identities = 33/106 (31%), Positives = 62/106 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKIS-KDIERDKYIQRLLVYKQYQEIVPKLMEKLE 140
           F GP +L   LI+ +K+DI +I + ++   Y++Y+   +  L +    EY +M++ LL  KS+ +LP  D  ++I  +D  RD+ +Q+L+ Y  +++I     E+ E
  S:    13 FEGPLDLLLHLIQSQKIDIYDIPIAQITSQYLEYLRQ-MQSLNLQIAGEYFMMSSTLLRIKSQYLLPQNDFVDEIEPEDDPRDELVQQLVQYSIFKKISAYFKERNE 118
>gi|168206140|ref|ZP_02632145.1| segregation and condensation protein A [Clostridium perfringens E str. JGS1987] >gi|170662418|gb|EDT15101.1| segregation and condensation protein A [Clostridium perfringens E str. JGS1987] (248 aa)
Score = 128, Expect = 1.2e-05, Identities = 36/119 (30%), Positives = 70/119 (58%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ 151
           K F+GPF+L   LIK+ +M I  I + E+ + Y++YI   + +L ++  +E+++MA  L+E KSK +LP +  E++  ++  +   +++L  YK++++I   L E       +F K  +
  S:     9 KNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYI-ALMKELDLEITSEFIVMAATLIEIKSKSLLPKVKVEDETCEEDLQKILMEKLQEYKKFKKISAYLREIELSTGEVFTKKAE 126
>gi|193211766|ref|YP_001997719.1| chromosome segregation and condensation protein ScpA [Chlorobaculum parvum NCIB 8327] >gi|193085243|gb|ACF10519.1| chromosome segregation and condensation protein ScpA [Chlorobaculum parvum NCIB 8327] (242 aa)
Score = 128, Expect = 1.3e-05, Identities = 61/239 (25%), Positives = 112/239 (46%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQL 268
           I+ +EF GP +L    IK  ++DI NI + ++   ++ YI+  + +L ++   E++ MA+ L+  K++ +LP  + E     + + R + +QRLL YK+ +E   +L      R RMF +     E +  ++ E  +    P   L  ++ A Q V   +        PK   + +  + ++I   E++    +       ++SF   F    DE       VV F+A+L L RN  I +
  S:     4 ISLEEFEGPLDLLLFFIKRDELDIYNIPVSKITGDFIAYIHA-MQRLNLEVAAEFIYMASMLMSIKARMLLPRPEPEAGDDGEFDPRTELVQRLLEYKRIKEGASELELLGLDRERMFPRGVFE-ELEPEVIDEMDEPVNRPT--LYHLMLAYQSVIDNM--------PKTRTQNVSDAPVTI---EQQSALIMTRLGERVQVSFTSLF----DELREAIVIVVTFLAVLELCRNNKISV 224
>gi|149177974|ref|ZP_01856571.1| hypothetical protein PM8797T_32185 [Planctomyces maris DSM 8797] >gi|148843167|gb|EDL57533.1| hypothetical protein PM8797T_32185 [Planctomyces maris DSM 8797] (287 aa)
Score = 128, Expect = 1.3e-05, Identities = 60/246 (24%), Positives = 119/246 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKL----ERRSRMFEKPTQSGED-KESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV 280
           ++GP +L   LI+  ++DIL++ +  +   + D+++  L  + +D + +++LMA+ L E KS+ +LP + + E     D  R   IQ+LL YK++++    L E      E   R+ ++  +SG+D  E L+KE +    V A+   V  K ++                      + S I+ DD    I  ++E      ++     F +  + +  +   +  F+AIL L+R+ H + +Q      I+++
  S:    13 YSGPLDLLLYLIRRNELDILDLPVASITASFNDFLD-VLELIDLDLVGDFILMASTLAEIKSRMVLPRAEEEEIAEVIDDPRSDLIQQLLEYKKFKDAANALEEHAAEWQEHYPRLSDERPKSGKDPSEDLIKEVELWDLVSALARVVKRKEVE----------------------EHSSITYDDT--PISTYVERIGSRVRVEQRVTFSSFFEGEKVRSRIIGIFLAILELLRHHHFRADQPVEHGEIWVM 239
>gi|33598471|ref|NP_886114.1| hypothetical protein BPP3966 [Bordetella parapertussis 12822] >gi|33574600|emb|CAE39249.1| conserved hypothetical protein [Bordetella parapertussis] (295 aa)
Score = 128, Expect = 1.3e-05, Identities = 32/101 (31%), Positives = 60/101 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDL---TEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LI+++  ++L+I + +V + Y+ Y+     ++++ +L    EYLLMA  L+E KS+ +LP   ++     +  R + ++RLL Y+Q +    KL
  S:    61 FEGPLDLLLYLIRKQNFNVLDIPMADVTRQYLSYVE----QIRVHNLELAAEYLLMAAMLIEIKSRMLLPVKKSDTGEEPEDPRAELVRRLLEYEQMKLAAQKL 160
>gi|33594676|ref|NP_882320.1| hypothetical protein BP3822 [Bordetella pertussis Tohama I] >gi|33603413|ref|NP_890973.1| hypothetical protein BB4439 [Bordetella bronchiseptica RB50] >gi|33564752|emb|CAE44077.1| conserved hypothetical protein [Bordetella pertussis Tohama I] >gi|33577537|emb|CAE34802.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] (295 aa)
Score = 128, Expect = 1.3e-05, Identities = 32/101 (31%), Positives = 60/101 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDL---TEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LI+++  ++L+I + +V + Y+ Y+     ++++ +L    EYLLMA  L+E KS+ +LP   ++     +  R + ++RLL Y+Q +    KL
  S:    61 FEGPLDLLLYLIRKQNFNVLDIPMADVTRQYLSYVE----QIRVHNLELAAEYLLMAAMLIEIKSRMLLPVKKSDTGEEPEDPRAELVRRLLEYEQMKLAAQKL 160
>gi|31789456|gb|AAP58570.1| conserved hypothetical protein [uncultured Acidobacteria bacterium] (269 aa)
Score = 128, Expect = 1.4e-05, Identities = 57/240 (23%), Positives = 110/240 (45%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           +F GP +L   LI++ ++ I +I +  +   Y+ Y+   +  + I    ++L+MA  L+E K+K +LP          D  R   + +LL Y++Y+     L  +      +F         K + L+  + N  V A+ L  +LK  Q++          +  ++ +  I+  EIS+ ++ + +R  +     L    F +  +       ++R  VVAF+++L LVRN  I+L Q  +
  S:    46 DFEGPLDLLLHLIRQEQVSIYDIPVARIADEYLRYLT-LMQDMDIAVAGDFLVMAATLIELKTKMLLPRDPFAAPEEDDDPRRDLVDQLLEYQKYKAAAQMLWSRATVERAVF---------KRAELETDKTNPEV-AVGLFDLLKVFQEIL--------ARHKEEVMMEIEREEISMAEMLERLRNMVMSAGELNLRVFFERAR-------SRRELVVAFLSVLELVRNTEIKLIQRET 259
>gi|58337259|ref|YP_193844.1| hypothetical protein LBA0961 [Lactobacillus acidophilus NCFM] >gi|58254576|gb|AAV42813.1| hypothetical protein LBA0961 [Lactobacillus acidophilus NCFM] (246 aa)
Score = 128, Expect = 1.5e-05, Identities = 32/107 (29%), Positives = 63/107 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLER 141
           F GP +L   LI+ +K+DI +I + ++   Y++Y+   +  L +    EY +M++ LL  KS+ +LP  D  ++I  + + RD+ +Q+L+ Y  +++I     E+ E+
  S:    13 FEGPLDLLLHLIQSQKIDIYDIPIAQITSQYLEYLKR-MQSLNLQLAGEYFVMSSTLLRIKSQYLLPQNDFVDEIGPEEDPRDELVQQLVQYSVFKKISAYFKERNEK 119
>gi|194332979|ref|YP_002014839.1| chromosome segregation and condensation protein ScpA [Prosthecochloris aestuarii DSM 271] >gi|194310797|gb|ACF45192.1| chromosome segregation and condensation protein ScpA [Prosthecochloris aestuarii DSM 271] (242 aa)
Score = 128, Expect = 1.5e-05, Identities = 57/249 (22%), Positives = 117/249 (46%)
  Q:    18 LNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHI 266
           ++N+ F IS+ D     F GP +L    IK  ++DI NI + ++   ++ YI+  +  L ++   E++ MA+ L+  K K +LP    ++  + + + R   + RLL YK+ +E   +L    E+R  MF +      + E +L E  +    P +  ++++  M  +          K P+  ++ ++ + +++D+   +    L+      ++SF    + + +        VV F+A+L L R   I
  S:     1 MSNSIFRISLDD-----FEGPLDLLLFFIKRDELDIYNIPISKITNDFIAYIDA-MQSLNLEVAAEFIYMASLLMSIKVKMLLPRELPDDSDADEFDPRSDLVDRLLEYKRIKEGAEQLRPFEEQRLSMFSRGCYEDAEPE-VLDEMDEPLNRPTL-YNLMMAYMAAM---------DKRPQTRIQNVEEAPVTVDE---QCAFILDSLNRQVQVSFRTILEGVQETLIV----VVTFLAVLELCRRNSI 226
>gi|74317274|ref|YP_315014.1| condensin subunit ScpA [Thiobacillus denitrificans ATCC 25259] >gi|74056769|gb|AAZ97209.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC 25259] (274 aa)
Score = 128, Expect = 1.5e-05, Identities = 60/245 (24%), Positives = 114/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD-TEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKK----TKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++ +D+L+I +  + Q Y+ Y+       +++   EYLLMA  L++ KS+ +LP  +  +E    D  R + ++RLL Y           E+++R  +  +   Q+G D +++      + ++PA       K +  V+ + +        +++       I   E+SI +    I + L P        FM+ FK +  E  T    VV F+A+L L +   + + Q      I++
  S:    47 FEGPLDLLLYLIRKQNLDVLDIPMAALTQQYMAYVEA-ARATRLELAAEYLLMAAVLIDIKSRMLLPRREQADEPGEADDPRAELVRRLLEY-----------EQMKRAGQQLDALPQAGRDFDTV------SVFLPAA-----AKRLPSVHAEELAAAWLAILSRAKNRTHHRIGRQELSIREHMSRILKRLTPG------EFME-FKELFPEASTVHELVVTFLAVLELSKETLLDVTQAEPFAPIYV 266
>gi|66046813|ref|YP_236654.1| hypothetical protein Psyr_3584 [Pseudomonas syringae pv. syringae B728a] >gi|63257520|gb|AAY38616.1| Protein of unknown function DUF173 [Pseudomonas syringae pv. syringae B728a] (272 aa)
Score = 127, Expect = 1.7e-05, Identities = 59/237 (24%), Positives = 109/237 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+   D  R + I+RL  Y++++     + + L R  R    P            E +    +P + L+ +L +M +V   L      +S + + + +   E   D +E+       PF  L+              +  +   VV F+A+L LV+   ++L QN
  S:    48 FEGPLDLLLYLIRKQNIDILDIPVAEITKQYMGYV-ELMKTVRLELAAEYLVMAAMLAEIKSRMLLPRSAEVEEEEGD-PRAELIRRLQEYERFKAAAEGI-DGLSRVGRDVIVPKLDA-------PEARARKLLPDVSLEEVLMSMAEV---LHRGDMFESHQVSREALSTRERMSDVLERLKGGGFVPFAELFT------------AEEGRLGVVVTFMAVLELVKESLVELVQN 259
>gi|15643259|ref|NP_228303.1| hypothetical protein TM0493 [Thermotoga maritima MSB8] >gi|4981004|gb|AAD35578.1|AE001726_12 conserved hypothetical protein [Thermotoga maritima MSB8] (229 aa)
Score = 127, Expect = 1.7e-05, Identities = 37/111 (33%), Positives = 70/111 (63%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVP--KLMEKLERRSRM 145
           F GP +L   L++++K+DI  I + ++   +V+Y+  ++ KL +   +++L MA+ L+E KSK ++P +  EEK S D ++++  +R+  Y + +EIV   K  E L +R R+
  S:    10 FEGPLDLLLYLVRKKKVDIREIPISQLADEFVEYLE-HMKKLDMKITSDFLEMASTLMELKSKMLIPRVREEEKESIDRKKEELYRRIEEYSKVKEIVSILKKEENLLKRKRV 121
>gi|28869018|ref|NP_791637.1| hypothetical protein PSPTO_1812 [Pseudomonas syringae pv. tomato str. DC3000] >gi|28852258|gb|AAO55332.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato str. DC3000] (272 aa)
Score = 127, Expect = 1.8e-05, Identities = 59/237 (24%), Positives = 110/237 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+   D  R + I+RL  Y++++     + + L+R  R    P            E +    +P + L+ +L +M +V   L      +S + + + +   E   D +E+       PF  L+              +  +   VV F+A+L LV+   ++L QN
  S:    48 FEGPLDLLLYLIRKQNIDILDIPVAEITKQYMGYV-ELMKTVRLELAAEYLVMAAMLAEIKSRMLLPRSAEIEEEEGD-PRAELIRRLQEYERFKAAAEGI-DGLKRVGRDVIVPKLDA-------PEARARKLLPDVSLEEVLMSMAEV---LHRGDMFESHQVSREALSTRERMSDVLERLKGGGFVPFAELFT------------AEEGRLGVVVTFMAVLELVKESLVELVQN 259
>gi|26991183|ref|NP_746608.1| chromosome segregation and condensation protein ScpA [Pseudomonas putida KT2440] >gi|24986230|gb|AAN70072.1|AE016647_2 conserved hypothetical protein [Pseudomonas putida KT2440] (295 aa)
Score = 127, Expect = 1.9e-05, Identities = 33/95 (34%), Positives = 60/95 (63%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-SMDTEEKISKDIERDKYIQRLLVYKQYQ 129
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP S D EE+  +   R + I+RL  Y++++
  S:    62 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKSVRLELAAEYLVMAAMLAEIKSRMLLPRSADVEEE--EGDPRAELIRRLQEYERFK 154
>gi|160947162|ref|ZP_02094329.1| hypothetical protein PEPMIC_01094 [Peptostreptococcus micros ATCC 33270] >gi|158446296|gb|EDP23291.1| hypothetical protein PEPMIC_01094 [Peptostreptococcus micros ATCC 33270] (244 aa)
Score = 127, Expect = 1.9e-05, Identities = 60/253 (23%), Positives = 136/253 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEF--QDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV-KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVE 287
           ++GP +L   LI ++K+DI +I + ++ + Y++ I N +   +  D++ +LLM++ L+E KS+ ++P  +T+E   + + +++ ++RL+ Y++++++           S+ + K        +S + E+  +D   +   D+DV+L  M+ +    +   + KS +D+  K+I+     I+     I++ +     L       YF+++     TK   +  F+++L LV+N  I++ Q+  D+NI +  +  +VE
  S:    10 YSGPLDLLLDLISKQKVDIYDIEISKITKHYLEAIENSVYS-EDTDISAFLLMSSTLVEIKSRSLIPK-NTDEDEDEIVTKEQLVERLIEYRKFKKVGEYFKNLEIEGSKAYSK-------MQSDITEYMTEDKEIILNTDVDVLLSLMENI----INQYRNKSDEDSFEKIIEKDLFPIEKYISMIKDKMYEEKEL-------YFEDLVFYNGTKSELITIFISVLELVKNNFIKIFQD-KDKNIKLNLVGGKVE 244
>gi|71735283|ref|YP_275689.1| segregation and condensation protein A [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555836|gb|AAZ35047.1| segregation and condensation protein A [Pseudomonas syringae pv. phaseolicola 1448A] (243 aa)
Score = 127, Expect = 2.0e-05, Identities = 59/237 (24%), Positives = 109/237 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+   D  R + I+RL  Y++++     + + L R  R    P            E +    +P + L+ +L +M +V   L      +S + + + +   E   D +E+       PF  L+              +  +   VV F+A+L LV+   ++L QN
  S:    19 FEGPLDLLLYLIRKQNIDILDIPVAEITKQYMGYV-ELMKTVRLELAAEYLVMAAMLAEIKSRMLLPRSAEVEEEEGD-PRAELIRRLQEYERFKAAAEGI-DGLSRVGRDVIVPKLDA-------PEARARKLLPDVSLEEVLMSMAEV---LHRGDMFESHQVSREALSTRERMSDVLERLKGSGFVPFAELFT------------AEEGRLGVVVTFMAVLELVKESLVELVQN 230
>gi|167034999|ref|YP_001670230.1| chromosome segregation and condensation protein ScpA [Pseudomonas putida GB-1] >gi|166861487|gb|ABY99894.1| chromosome segregation and condensation protein ScpA [Pseudomonas putida GB-1] (281 aa)
Score = 126, Expect = 2.2e-05, Identities = 62/237 (26%), Positives = 119/237 (50%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-SMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP S D EE+  +   R + I+RL  Y++++     + ++L R  R    P    E  ++ +++      +P + L+ +L +M +V  +           D  +   +S  ++   E+ + + LE       + F++ F      +  K   VV F+A+L LV+   I+L QN
  S:    48 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKSVRLELAAEYLVMAAMLAEIKSRMLLPRSADVEEE--EGDPRAELIRRLQEYERFKAAAEGI-DELPRVGRDVVVPRL--EAPQAKVRKL-----LPQVSLEELLMSMAEVMRR----------NDLFESHQISRETLSTRER-MSQVLERLKGGAFVPFVELFA----AEEGKLGVVVTFMAVLELVKESLIELVQN 259
>gi|116513912|ref|YP_812818.1| hypothetical protein LBUL_0769 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093227|gb|ABJ58380.1| condensin subunit ScpA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (244 aa)
Score = 126, Expect = 2.2e-05, Identities = 32/97 (32%), Positives = 60/97 (61%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD---TEEKISKDIERDKYIQRLLVYKQYQEI 131
           F GP +L   LI+ +++DI +I +  + Q Y+DY+   + +L +  + EY +MA  LL  KS+ +LP  D   TEE+ +    R++ +++L+ Y  +++I
  S:    13 FEGPLDLLLHLIRSQELDIYDIPIARITQQYLDYLQQ-MQRLNLQLVGEYFVMAATLLRIKSQYLLPKNDFVETEEEFAD--PREELVEQLVQYSVFKKI 109
>gi|145298418|ref|YP_001141259.1| segregation and condensation protein A [Aeromonas salmonicida subsp. salmonicida A449] >gi|142851190|gb|ABO89511.1| Segregation and condensation protein A [Aeromonas salmonicida subsp. salmonicida A449] (276 aa)
Score = 126, Expect = 2.3e-05, Identities = 25/67 (37%), Positives = 44/67 (65%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP 101
           F GP +L   LI+ +++DILN+ ++++   Y++Y+   +  L ++   EYLLMA +L E KS+ +LP
  S:    39 FEGPLDLLLYLIRRQQLDILNLPILQITAQYMEYV-ELMQGLNLELAAEYLLMAAWLAEIKSRLLLP 104
>gi|157374828|ref|YP_001473428.1| chromosome segregation and condensation protein ScpA [Shewanella sediminis HAW-EB3] >gi|157317202|gb|ABV36300.1| chromosome segregation and condensation protein ScpA [Shewanella sediminis HAW-EB3] (262 aa)
Score = 126, Expect = 2.4e-05, Identities = 57/247 (23%), Positives = 117/247 (47%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           + F GP +L   LI+++K+D++ + +  V + Y++YI N L   +++   +YL+MA  L E KS+ +LP    E++  +D  R + I++L  Y+  +E   +L E       +F+      ++ + +L         P + L  I +A   V  ++  T+     ++ +   +     +  ++ E  E+L PF  L+ +S              +   VV+F+A++ L++   + L QN     I++
  S:    37 ESFEGPLDLLLYLIRKQKLDVVELPIWPVTEQYLEYI-NLLQGSRVELAADYLVMAATLAEIKSRLLLPRPVLEDEDEED-PRAQLIRQLKAYEVIKEAQERLDELPRLERDVFQAKATPADNIKPIL-------LPPQVSLTDIARAFGSVLKRIEATEHHHVKREVLSTRERMSQILAMLDGE--EYL-PFEALFDVS------------EGRSGVVVSFLALMELIKELLVDLRQNEPFSTIYV 259
>gi|171059443|ref|YP_001791792.1| chromosome segregation and condensation protein ScpA [Leptothrix cholodnii SP-6] >gi|170776888|gb|ACB35027.1| chromosome segregation and condensation protein ScpA [Leptothrix cholodnii SP-6] (303 aa)
Score = 126, Expect = 2.5e-05, Identities = 35/114 (30%), Positives = 61/114 (53%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ------EIVPKLMEKLERRSRMFEK 148
           F GP +L   LI+ +  +IL+I + +V + Y+ Y+     +  ++   EYLLMA  L+E KS+ +LP    E     +  R + ++RLL Y++ +      + +P L     R   M E+
  S:    65 FQGPLDLLLYLIRRQNFNILDIPMADVTRQYLAYVEQIRDR-NLELAAEYLLMAAMLIEIKSRMLLPPKRAEGGDEAEDPRAELVRRLLEYERIKLGAAHLDALPVLGRDFLRAQVMIEQ 183
>gi|149926206|ref|ZP_01914468.1| chromosome segregation and condensation protein ScpA [Limnobacter sp. MED105] >gi|149825024|gb|EDM84236.1| chromosome segregation and condensation protein ScpA [Limnobacter sp. MED105] (292 aa)
Score = 126, Expect = 2.5e-05, Identities = 58/245 (23%), Positives = 110/245 (44%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYV---PAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI+++  +IL+I + E+ + Y+ YI    T+  ++   EYLLMA  L+E KS+ +LP +  + +   +  R +  +RL+ Y+Q  ++  + ++K+    R F            +   F D + V   P ++ + +  A Q +  +    K           I   E+S+ +    I   L+    +      D  + +P         VV F+A+L L R G +++ Q      I++
  S:    55 FEGPLDLLLYLIRKQNFNILDIPMAELTRQYLTYIEEIRTR-NLELAAEYLLMAAMLIEIKSRMLLPVIPKDGEEEAEDPRAELARRLIEYEQ-MKLAAQELDKVPLVGRDF-----------WIAHAFHDPNTVERFPDVNPEELRDAWQAILRRASLVK--------AHTISREELSVREHMTMILRRLQTQKFVEFFDMFDIERGVP-------VVVVNFIAMLELTREGLVKVTQAEPFAPIYV 274
>gi|152981409|ref|YP_001352796.1| segregation and condensation protein A [Janthinobacterium sp. Marseille] >gi|151281486|gb|ABR89896.1| Segregation and condensation protein A [Janthinobacterium sp. Marseille] (292 aa)
Score = 126, Expect = 2.6e-05, Identities = 31/95 (32%), Positives = 57/95 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDL---TEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQ 129
           F GP +L   LI+++  +IL+I + +V + Y+ Y++    ++++ +L    EYLLMA  L+E KS+ +LP    +        R + ++RLL Y+Q +
  S:    66 FEGPLDLLLYLIRKQNFNILDIPMAQVTKQYLQYVD----QIRLHNLELAAEYLLMAAMLIEIKSRMLLPVRKADTGEEAADPRAELVRRLLEYEQMK 159
>gi|114562609|ref|YP_750122.1| chromosome segregation and condensation protein ScpA [Shewanella frigidimarina NCIMB 400] >gi|114333902|gb|ABI71284.1| chromosome segregation and condensation protein ScpA [Shewanella frigidimarina NCIMB 400] (262 aa)
Score = 126, Expect = 2.6e-05, Identities = 33/97 (34%), Positives = 58/97 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEI 131
           F GP +L   LI+++K+D++++ + ++ Q Y+ YI   LT+ +I+   +YL+MA  L E KS+ +LP M +E+    D E D  +  +   K Y+ I
  S:    39 FEGPLDLLLYLIRKQKLDVVDLPIQQITQQYLLYI-EILTEARIELAADYLVMAATLAEIKSRLLLPKMASED----DEEEDPRVVLIRQLKAYEVI 130
>gi|148546654|ref|YP_001266756.1| chromosome segregation and condensation protein ScpA [Pseudomonas putida F1] >gi|148510712|gb|ABQ77572.1| condensin subunit ScpA [Pseudomonas putida F1] (284 aa)
Score = 125, Expect = 2.8e-05, Identities = 33/95 (34%), Positives = 60/95 (63%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-SMDTEEKISKDIERDKYIQRLLVYKQYQ 129
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP S D EE+  +   R + I+RL  Y++++
  S:    51 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKSVRLELAAEYLVMAAMLAEIKSRMLLPRSADVEEE--EGDPRAELIRRLQEYERFK 143
>gi|70728991|ref|YP_258725.1| segregation and condensation protein A [Pseudomonas fluorescens Pf-5] >gi|68343290|gb|AAY90896.1| segregation and condensation protein A [Pseudomonas fluorescens Pf-5] (243 aa)
Score = 125, Expect = 2.9e-05, Identities = 32/95 (33%), Positives = 61/95 (64%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-SMDTEEKISKDIERDKYIQRLLVYKQYQ 129
           F GP +L   LI+++ ++IL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP S + EE+  +D  R + I+RL  Y++++
  S:    19 FEGPLDLLLYLIRKQNINILDIPVAEITRQYMGYVE-LMQSVRLELAAEYLVMAAMLAEIKSRMLLPRSAEVEEE--EDDPRAELIRRLQEYERFK 111
>gi|107102728|ref|ZP_01366646.1| hypothetical protein PaerPA_01003795 [Pseudomonas aeruginosa PACS2] >gi|194547145|ref|YP_002082173.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|126168091|gb|EAZ53602.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] (296 aa)
Score = 125, Expect = 3.0e-05, Identities = 59/239 (24%), Positives = 113/239 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+  +D  R + I+RL  Y+++++    L ++L R  R    P  +         E +    +P + L  ++  M ++   L      +S +   +++   E   + +E+       PF  L+ +            +  K   VV F+AIL LV+   ++L QN +
  S:    54 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKAVRLELAAEYLVMAAMLAEIKSRMLLPRSAEAEEEEED-PRAELIRRLQEYERFKKAAEDL-DELPRVGRDVLVPAVAA-------PEARARKLLPELALQELMLVMGEM---LRRADLFESHQVTREVLSTRERMSEVLERLKGGAFVPFIQLFTL------------EEGKLGVVVTFMAILELVKEQMVELVQNEA 267
>gi|152988866|ref|YP_001347309.1| hypothetical protein PSPA7_1928 [Pseudomonas aeruginosa PA7] >gi|150964024|gb|ABR86049.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] (296 aa)
Score = 125, Expect = 3.5e-05, Identities = 33/103 (32%), Positives = 61/103 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+  +D  R + I+RL  Y+++++    L E
  S:    54 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKAVRLELAAEYLVMAAMLAEIKSRMLLPRSAEAEEEEED-PRAELIRRLQEYERFKKAAEDLDE 154
>gi|124005094|ref|ZP_01689936.1| segregation and condensation protein A [Microscilla marina ATCC 23134] >gi|123989346|gb|EAY28907.1| segregation and condensation protein A [Microscilla marina ATCC 23134] (253 aa)
Score = 124, Expect = 3.6e-05, Identities = 64/256 (25%), Positives = 123/256 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           F GPF+L    I+ +++DI +I +  + Q ++DY++  + ++ I+  +E++++A  L+  K+K +LP  +  ++      R + +  LL YK+Y+ ++ K  E LE R  M EK      + E +   ++ +  +  +DL  +L    +VY K +T  +++      K++     ++   +  +   LE  P L        F  I     TK   +  F+AIL L++NG + L       N +I K   E +  E
  S:    10 FEGPFDLLLFFIERQEVDIYDIPISTITQDFLDYMHQ-MEQMNIELASEFIVVAATLMRIKAKMLLPRDEESDEDDD--PRQELVDFLLEYKKYKSVL-KEFEALEDRQLMREKRGNVIVEIERVAGTYEVDIEMHRLDLYKLL----QVYEKAMTRYESRIEHVVHKVVPYP-YTVAQQKTMLISLLEQKPKL-------EFNEIVLSYKTKIAVIFNFLAILELLQNGLVSLHIEPGYNNFWIEKKASEQQVTE 249
>gi|49082256|gb|AAT50528.1| PA3198 [synthetic construct] (251 aa)
Score = 124, Expect = 3.6e-05, Identities = 59/239 (24%), Positives = 113/239 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+  +D  R + I+RL  Y+++++    L ++L R  R    P  +         E +    +P + L  ++  M ++   L      +S +   +++   E   + +E+       PF  L+ +            +  K   VV F+AIL LV+   ++L QN +
  S:     8 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKAVRLELAAEYLVMAAMLAEIKSRMLLPRSAEAEEEEED-PRAELIRRLQEYERFKKAAEDL-DELPRVGRDVLVPAVAA-------PEARARKLLPELALQELMLVMGEM---LRRADLFESHQVTREVLSTRERMSEVLERLKGGAFVPFIQLFTL------------EEGKLGVVVTFMAILELVKEQMVELVQNEA 221
>gi|194552871|ref|YP_002087898.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] >gi|126195264|gb|EAZ59327.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] (296 aa)
Score = 124, Expect = 3.6e-05, Identities = 33/103 (32%), Positives = 61/103 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+  +D  R + I+RL  Y+++++    L E
  S:    54 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKAVRLELAAEYLVMAAMLAEIKSRMLLPRSAEAEEEEED-PRAELIRRLQEYERFKKAAEDLDE 154
>gi|158522768|ref|YP_001530638.1| chromosome segregation and condensation protein ScpA [Desulfococcus oleovorans Hxd3] >gi|158511594|gb|ABW68561.1| chromosome segregation and condensation protein ScpA [Desulfococcus oleovorans Hxd3] (248 aa)
Score = 124, Expect = 3.8e-05, Identities = 58/240 (24%), Positives = 109/240 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSD 274
           F GP +L   LIK+ ++ I +I + ++ + +++YI  +L  + ID   ++L MA  L   KS+ +LPS +       D + D  ++     ++Y +I     E L  R  + E       D+++L  E  D   V  + L  ++ A Q +  +L        P      +    ISI +   +I + LE    +        F  + +E +TK   VV F+A+L +V+   + + Q++ +
  S:    25 FEGPMDLLVHLIKKNEVSIYDIPIADITRQFLEYI-EWLKLMNIDVAGDFLYMAAILTNIKSRTLLPSHN-----GPDDDEDPRMEITRALEEYMQI-KNAAETLSSRDILNEDTFVRASDRKALTAEADDGMIV--VGLFELIDAFQNILDRL--------PSSTTLSLSAEVISIKERISQIVDILEKNRSV-------TFDQLFEENYTKSDIVVTFLALLEMVKLSIVAVRQHTHN 240
>gi|91202842|emb|CAJ72481.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (245 aa)
Score = 124, Expect = 3.9e-05, Identities = 34/123 (27%), Positives = 71/123 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR-----MFEKPTQSGEDKE 157
           +NGP +L   LIK+ +++I +I +  + + Y+ Y++  L  L ++++ ++L+MA  L+  KS  +LP  + +++   +  R   +++LL YK+Y+E    L  K +   R      +E P ++  + E
  S:    14 YNGPVDLLLYLIKKDEVNIYDIPISRITEHYLHYVDA-LQTLDMNNIGDFLIMAATLMYIKSYMLLPKTEMKDEDEIEDPRTSLVKQLLEYKKYKETSIVLSHKADHWGRKWKRLYYENPLETATENE 140
>gi|119505056|ref|ZP_01627132.1| Excinuclease ABC, B subunit [marine gamma proteobacterium HTCC2080] >gi|119459038|gb|EAW40137.1| Excinuclease ABC, B subunit [marine gamma proteobacterium HTCC2080] (305 aa)
Score = 124, Expect = 4.0e-05, Identities = 33/107 (30%), Positives = 63/107 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           F GP +L   LI+ + +DIL+I + ++   Y++Y+   +  ++ +   EYLLMA  L E KS+ +LP     E+  +D  R   I+RL  Y+++++   ++  + ++ER
  S:    81 FEGPLDLLLYLIRRQNLDILDIGVSQITTQYMEYV-ELMDAMQFELAAEYLLMAAMLAEIKSRMLLPRAADIEEDEED-PRANLIRRLQEYERFKQAAEEIDGLPRVER 187
>gi|170722950|ref|YP_001750638.1| chromosome segregation and condensation protein ScpA [Pseudomonas putida W619] >gi|169760953|gb|ACA74269.1| chromosome segregation and condensation protein ScpA [Pseudomonas putida W619] (281 aa)
Score = 124, Expect = 4.5e-05, Identities = 62/237 (26%), Positives = 114/237 (48%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+   D  R + I+RL  Y++++     + ++L R  R    P    E  ++ +++      +P + L+ +L +M +V  +               L +  +I+ + +    R   E    L    FM + +    E+  K   VV F+AIL LV+   I+L QN
  S:    48 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVE-LMKSVRLELAAEYLVMAAMLAEIKSRMLLPRSAEVEEEEGD-PRAELIRRLQEYERFKAAAEGI-DELPRVGRDVVVPRL--EAPQAKVRKL-----LPQVSLEELLVSMAEVMRR-------------NDLFESHQITRETLSTRER-MSEVLARLKGGGFMPFVELFTAEE-GKLGVVVTFMAILELVKESLIELVQN 259
>gi|149920282|ref|ZP_01908753.1| segregation and condensation protein A [Plesiocystis pacifica SIR-1] >gi|149818869|gb|EDM78309.1| segregation and condensation protein A [Plesiocystis pacifica SIR-1] (495 aa)
Score = 123, Expect = 5.2e-05, Identities = 61/241 (25%), Positives = 112/241 (46%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEI--REFLEPFPHLYKISFMDYF--KNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           +T ++F GP +L   L++  ++DIL+I +  + + Y++YI  +   L I+   EYL+MA  L   KS+ +LP    EE   +D E     R + I+RL+ Y           E+     +  +    SG D      + +  +  P +   + L  + + Y +++         D  K+    E+ ++ V   I  R+  E      K SF   F  +   +EK  ++  VV  +++L +V+ G I + Q
  S:    56 VTLEQFEGPLDLLLHLVRRHELDILDIPIAFITEKYIEYI-TFARALDIEVAGEYLVMAATLAFLKSRELLPPSPEEEGEDEDEEDGVDPRQELIRRLIEY-----------ERFRTAGQDLDGRPLSGRDVFPRGGKLRVEAPEPGL-APITLFKLAEAYNRIL---------DRAKINQEHEVVLEPVTVRIRMRQLSEQLGREPKFSFESLFLDRTWSNEKELRQMLVVTLMSVLEMVKMGIIGVHQ 283
>gi|114332009|ref|YP_748231.1| chromosome segregation and condensation protein ScpA [Nitrosomonas eutropha C91] >gi|114309023|gb|ABI60266.1| condensin subunit ScpA [Nitrosomonas eutropha C91] (281 aa)
Score = 123, Expect = 5.3e-05, Identities = 62/245 (25%), Positives = 113/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGED--KESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI++  +DIL+I + E+ + Y+ Y+   +   +++   EYLLM   L++ KS+ +LP     ++   D  R + +QRLL Y           E++++ +         G+D    S+  +F      P    DV  + +   +L L  T++ K  +++   I    IS+     EI + L+P       SF + F NI +        V +F+A+L L R   + + Q+     I++
  S:    54 FEGPLDLLLYLIRKHNLDILDIPMAELTRQYIAYVET-MRADQLELAAEYLLMTALLIDIKSRMLLPHPAIIQEEEAD-PRAELVQRLLEY-----------ERIKQAAIHLHNLPLVGKDFMLTSVWTDFIAERQFP----DVNPQDLCDTWLAL--TERLKLNRNHT--IRYEAISVRACMSEILKNLQPRG---SASFTELFSNISN----IHKLVASFLALLELAREALVDIVQSDRFGTIYV 272
>gi|15598394|ref|NP_251888.1| hypothetical protein PA3198 [Pseudomonas aeruginosa PAO1] >gi|9949318|gb|AAG06586.1|AE004744_1 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] (250 aa)
Score = 123, Expect = 5.4e-05, Identities = 59/239 (24%), Positives = 113/239 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+  +D  R + I+RL  Y+++++    L ++L R  R    P  +         E +    +P + L  ++  M ++   L      +S +   +++   E   + +E+       PF  L+ +            +  K   VV F+AIL LV+   ++L QN +
  S:     8 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKAVRLELAAEYLVMAAMLAEIKSRMLLPRSAEAEEEEED-PRAELIRRLQEYERFKKAAEDL-DELPRVGRDVLVPAVAA-------PEARARKLLPELALQELMLVMGEM---LRRADLFESHQVTREVLSTRERMSEVLERLKGGAFVPFIQLFTL------------EEGKLGVVVTFMAILELVKEQMVELVQNEA 221
>gi|188475829|gb|ACD50091.1| chromosome segregation and condensation protein [uncultured crenarchaeote MCG] (256 aa)
Score = 123, Expect = 5.5e-05, Identities = 57/256 (22%), Positives = 118/256 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           + GP +L   LI+  ++DI  ++L  V   Y+ Y+++ L +   DD++ +L++A  LL+ KS+ +LP     E+  +D+  +  +++L +YK+++EI   L  + +   R + +                     P   +D  L       LKL+   +    +   K    S I+   V   IRE ++      +      F+ +  ++ T+   VV F+A+L L++   +Q+ Q +   +I I ++++  +  E
  S:    18 YEGPLDLLLDLIERAELDITAVSLAVVTDQYLAYLHS-LQESSADDISAFLIIAARLLQIKSEALLPRPPQREQGDEDLG-ESLVEQLRLYKRFKEIGAWLDSRQQAEMRTYLR-------------------VAPPPRIDPKLDPSSLTLLKLMAAAERAFARAADKEPLGSVIAPPTV--TIREKIDLIARALRQLRRASFRGLVGDQSTRLEVVVTFLALLELIKRYRVQVRQETLFSDIEIDRLEEWSDDAE 250
>gi|56478940|ref|YP_160529.1| hypothetical protein ebA6132 [Azoarcus sp. EbN1] >gi|56314983|emb|CAI09628.1| conserved hypothetical protein [Azoarcus sp. EbN1] (276 aa)
Score = 123, Expect = 5.8e-05, Identities = 56/245 (22%), Positives = 105/245 (42%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI++  +++L+I +  +   Y+ Y+   + +  ++   +YLLMA  LLE KS+ +LP    E        R + ++RLL Y+Q  ++    +E L R  R +E+         S+    +    +P + L  +  A  K+  K   T+  +  +D               E  +RE +              F  + +        VV+F+A+L LV+   +++ QN     I++
  S:    48 FEGPLDLLLYLIRKSNLNVLDIPMAALTAQYLVYVEA-MRRHNLELAADYLLMAATLLEIKSRMLLPRPQREGADDDSDPRAELVRRLLDYEQ-MKLAGARLELLPRAERDYERV--------SIFVAEKVVERLPEVSLHDLQLAWLKIMKKARLTQHHQVRRD---------------ELSVREHMSAILRKLADGVFVVFDTLFEPARGPAGLVVSFLAVLELVKERLVEVAQNEPFAPIYV 267
>gi|15639678|ref|NP_219128.1| hypothetical protein TP0691 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025916|ref|YP_001933688.1| hypothetical protein TPASS_0691 [Treponema pallidum subsp. pallidum SS14] >gi|3322994|gb|AAC65659.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018491|gb|ACD71109.1| hypothetical protein TPASS_0691 [Treponema pallidum subsp. pallidum SS14] (252 aa)
Score = 122, Expect = 7.5e-05, Identities = 37/119 (31%), Positives = 68/119 (57%)
  Q:    22 EFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP-SMDTEEKISKDIE--RDKYIQRLLVYKQYQEIVPKLMEKLE 140
           E  + +++    +F GP +L   LIK+ ++ I +I + E+   Y+ Y++  ++   +  LTE+  MA  LL  KS  +LP  +D +    +DIE  R   ++ L+ Y++Y+++  KLME  E
  S:     5 ESPVPVQEFKLSQFEGPLDLLLFLIKKNELSIYDIPICEITAQYLQYVDQTVSP-DLRGLTEFYAMAAVLLYIKSCMLLPMELDLD---GEDIEDPRQSLVEHLIEYQKYKQLC-KLMELYE 121
>gi|27379864|ref|NP_771393.1| hypothetical protein bll4753 [Bradyrhizobium japonicum USDA 110] >gi|27353017|dbj|BAC50018.1| bll4753 [Bradyrhizobium japonicum USDA 110] (279 aa)
Score = 121, Expect = 7.9e-05, Identities = 55/255 (21%), Positives = 112/255 (43%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAM-DLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYF--KNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           + D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP   + E  S +        RL   +  +E   +LM + + +  +F +    GE ++  + E +   Y   + DL           L    +++      +V L   +  S+ +    +   +           +D F  +++ D       F  +F A L LVR G ++L Q  +   I+  K
  S:    24 VVDVEGYE--GPLDLLLALARQQKVDLAKISILALADQYLHFIEA-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPSAEGPSAEEMATALANRLRRLEAIREAANRLMNRPQLQRDIFPR----GEPEQ--IAEIKHPKYTATLYDL-----------LTAYASQRQSRVLASVHLAKRTVWSLAEARATLERLVGSISEQDDWGVLDDFLIRHVADPTQRATVFASSFAAALELVREGQLELNQKEAFAPIYFRK 261
>gi|90021365|ref|YP_527192.1| condensin subunit ScpA [Saccharophagus degradans 2-40] >gi|89950965|gb|ABD80980.1| condensin subunit ScpA [Saccharophagus degradans 2-40] (320 aa)
Score = 121, Expect = 8.2e-05, Identities = 34/113 (30%), Positives = 64/113 (56%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME--KLERRSRM 145
           + F GP +L   LI+++ +DIL I++  +   YV Y+   +  +  +   EYL+MA  L E KS+ +LP     E+  +D  R + I+RL  Y+++++    + E  +L R +++
  S:    90 ESFAGPLDLLLYLIRKQNIDILEIDVSAITHQYVAYVE-MMEAVHFELAAEYLVMAAMLAEIKSRMLLPRSSDSEEEEEDDPRAQLIRRLQEYERFKQAAEDIDELPRLHRDTQI 203
>gi|163750230|ref|ZP_02157472.1| hypothetical protein KT99_10228 [Shewanella benthica KT99] >gi|161330086|gb|EDQ01070.1| hypothetical protein KT99_10228 [Shewanella benthica KT99] (262 aa)
Score = 121, Expect = 8.6e-05, Identities = 36/109 (33%), Positives = 65/109 (59%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++ + +  V + Y++YI   L   K++   +YL+MA  L E KS+ +LP   TE +  +D  R + I++L  Y+  +E   +L  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVELPIWPVTKQYLEYI-ELLQGAKVELAADYLVMAATLAEIKSRLLLPRPVTEVEEEED-PRARLIRQLKAYEVIREAQQQLDDLPRLER 145
>gi|184155348|ref|YP_001843688.1| hypothetical protein LAF_0872 [Lactobacillus fermentum IFO 3956] >gi|183226692|dbj|BAG27208.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956] (262 aa)
Score = 121, Expect = 8.7e-05, Identities = 56/238 (23%), Positives = 118/238 (49%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS---MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISI-DDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           +F GP +L   LIK+ ++DI +I + ++   YV++++    + +++   EY +MA  L+  KS  +LPS   ++ E    ++  R + + +LL Y++Y++    L +K E R R + +      +  ++ K   +  + P + ++ + +A + V       K+    +   + +D   +++ + +E  I    +P        F D F+N     +TK   V  F+A+L L ++  I L Q+
  S:    19 DFEGPLDLLLHLIKKAEVDIYDIPIAKITNQYVEFLHQQ-EQNQLNIAGEYFVMAATLMSIKSAMLLPSPPVVEDELPPEEEDPRAELVAQLLEYQRYKKAAAALKDKEEYRQREYTR------EAMAVPKNLVETRFAPGVGIEELQRAFEDV------VKRHHFHEPITQTVDPDPVTVAERIEHVITVVNKP------TRFEDLFEN----DWTKDSLVTTFLAVLDLTKHQVIALAQS 237
>gi|91793799|ref|YP_563450.1| chromosome segregation and condensation protein ScpA [Shewanella denitrificans OS217] >gi|91715801|gb|ABE55727.1| chromosome segregation and condensation protein ScpA [Shewanella denitrificans OS217] (262 aa)
Score = 121, Expect = 8.8e-05, Identities = 32/97 (32%), Positives = 55/97 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEI 131
           F GP +L   LI+++K++++++ + ++   Y+ YI   LT+ +I+   +YL+MA  L E KS+ +LP M   E    D E D  +  L   K Y+ I
  S:    39 FEGPLDLLLYLIRKQKLEVVDLAIAQITSQYLAYI-EVLTEARIELAADYLVMAATLAEIKSRLLLPQMVNSE----DEEYDPRLMLLRQLKAYEVI 130
>gi|108763535|ref|YP_632023.1| segregation and condensation protein A [Myxococcus xanthus DK 1622] >gi|108467415|gb|ABF92600.1| segregation and condensation protein A [Myxococcus xanthus DK 1622] (289 aa)
Score = 121, Expect = 9.0e-05, Identities = 32/101 (31%), Positives = 63/101 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE--------KISKDIE--RDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LIKE ++DI +I L  + + Y++++   + ++ +D   E+L+MA+ L   KS+ +LP  D            ++++ E  R + ++RLL Y++Y++   +L
  S:    33 FEGPLDLLLHLIKEHRVDIFDIPLALITEKYLEHLER-MREINLDIAGEFLVMASTLAHLKSRMLLPRQDVASAQEGAEVLAVAEETEDPRAELVRRLLEYQKYKDAAEQL 142
>gi|30249690|ref|NP_841760.1| hypothetical protein NE1728 [Nitrosomonas europaea ATCC 19718] >gi|30180727|emb|CAD85639.1| DUF173 [Nitrosomonas europaea ATCC 19718] (266 aa)
Score = 121, Expect = 9.4e-05, Identities = 30/96 (31%), Positives = 55/96 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQE 130
           F GP +L   LI++  +DIL+I + E+ + Y+ Y+   +   + +   EYLLM   L++ KS+ +LP   T  +   D  R + ++RLL Y++ ++
  S:    39 FEGPLDLLLYLIRKHNLDILDIPMAELTRQYIAYVET-MRADQFELAAEYLLMTALLIDIKSRMLLPRPVTPREDDAD-PRAELVRRLLEYERIKQ 132
>gi|88855487|ref|ZP_01130151.1| hypothetical protein A20C1_01651 [marine actinobacterium PHSC20C1] >gi|88815394|gb|EAR25252.1| hypothetical protein A20C1_01651 [marine actinobacterium PHSC20C1] (282 aa)
Score = 121, Expect = 9.4e-05, Identities = 31/96 (32%), Positives = 58/96 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTK--------LKIDDLTEYLLMATYLLEQKSKRILPS---MDTEEKISKDIERDKYIQRLLVYKQYQE 130
           FNGPF+L  SLI + ++DI  ++L  +   ++ Y+ N+ +          ++D  +E+L++A  LL+ K   +LP    +D E+    +  RD    RLL Y+ +++
  S:    25 FNGPFDLLLSLITKHELDITEVSLSRITDEFIAYLRNFESAGDGAGDGIDELDQASEFLVVAATLLDLKVAGLLPQGELVDAEDFALLE-ARDLLFARLLQYRAFKQ 130
>gi|78043146|ref|YP_360765.1| segregation and condensation protein A [Carboxydothermus hydrogenoformans Z-2901] >gi|77995261|gb|ABB14160.1| segregation and condensation protein A [Carboxydothermus hydrogenoformans Z-2901] (239 aa)
Score = 120, Expect = 1.1e-04, Identities = 33/103 (32%), Positives = 61/103 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           F GP +L   L+++ K+DI +I + E+ + Y+ Y+  Y  K  ++  +E+L+MA++LL  K K +    + EE       R + ++RL+VY++++EI   L E
  S:     9 FEGPLDLLLHLVEKNKIDIYDIPIAEITRQYLWYLEQY-QKHNLEIKSEFLVMASHLLYLKVKMLFGKKEEEED-----PRTELVERLVVYQKFREIAQYLKE 105
>gi|116618397|ref|YP_818768.1| condensin subunit ScpA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097244|gb|ABJ62395.1| condensin subunit ScpA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (225 aa)
Score = 120, Expect = 1.2e-04, Identities = 48/229 (20%), Positives = 107/229 (46%)
  Q:    51 MDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKD---IERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           M+I ++ + ++   Y+D+I+     +++D  +EYL+MA  L++ KS  +LP  + ++    +     R++ + +LL YKQ+Q     L E+ + + + F +      D           +  P + L      +Q  + +L+  KK + P    + +     S+++    I +          I F  +F    D+ + + + VV F+A+L + ++  ++L Q    + I++
  S:     1 MNIFDLKIADITSQYLDFIHAQ-QAMQLDVASEYLVMAATLVKIKSADLLPEEEPDDYAVDEEYADPREELMLQLLTYKQFQVASESLREREQLKQQSFPRTQMKAPDNLK-----HPITLAPGLSLG----DLQTAFAQLLRRKKQEKPIR--RHVTAETYSLEEAVNNINKHFLQHQTGDMIPFASFF----DDIYEREHLVVTFLALLEMAKDKRLKLHQEHQQQEIYV 216
>gi|190891510|ref|YP_001978052.1| chromosome segregation and condensation protein A [Rhizobium etli CIAT 652] >gi|190696789|gb|ACE90874.1| chromosome segregation and condensation protein A [Rhizobium etli CIAT 652] (270 aa)
Score = 120, Expect = 1.2e-04, Identities = 55/251 (21%), Positives = 123/251 (49%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYK-QYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAM-DLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+ G  F GP +L   L + +K+D+  I+++ + + Y+ ++ +   +++I+   +YL+MA +L   KS+ ++P     +++  D    + +   L ++ +  E + +  E L  R+R+       G  +   + + Q ++YV ++ DL   L A   +  +   T+ T   ++   L D  E+ +  +  E+ ++     +L +      +   P+E+ T      AF A L LVR G +++ Q+ + + I++
  S:    22 DVAG--FEGPLDLLLYLARNQKVDLSRISVLALAEQYLQFVES-ARRIRIELAADYLVMAAWLAYLKSRLLIP-----QQVKDDGPSGEEMAATLAFRLKRLEAMRQAAEGLVNRNRLGRDIFARGAPEH--IPDRQQSAYVASLYDL---LTAYAALRQRHAITQVTIERRNVWSLTDAREL-LTQMIGEVGDWTAMEHYLLR------YLAAPEERVTA--IASAFAASLELVREGKLEIRQDGAFQPIYM 252
>gi|126462353|ref|YP_001043467.1| chromosome segregation and condensation protein ScpA [Rhodobacter sphaeroides ATCC 17029] >gi|126104017|gb|ABN76695.1| condensin subunit ScpA [Rhodobacter sphaeroides ATCC 17029] (264 aa)
Score = 119, Expect = 1.4e-04, Identities = 28/86 (32%), Positives = 54/86 (62%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKD 112
           I D+ G  F GP +L  +L + +K+D+  I+++++ + Y+ ++N +  +L+I+   +YL+MA +L   KS+ +LP   TEE  S +
  S:    25 IVDVEG--FEGPLDLLLTLSRTQKVDLRRISVLKLSEQYLLFVN-HAKQLRIELAADYLVMAAWLAYLKSRLLLPPDPTEEGPSAE 107
>gi|66880201|ref|ZP_00405185.1| COG1354: Uncharacterized conserved protein [Mycoplasma genitalium G-37] (294 aa)
Score = 119, Expect = 1.4e-04, Identities = 56/220 (25%), Positives = 108/220 (49%)
  Q:    65 YVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE----RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE-----DKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDK 284
           Y++ I NY  K  I+ +T+YL++ + +L +K+  +L     E  +  D+     RDK I  L+ +K+Y + + +  +    R   F K  +  +     + + +  E Q  +Y+  + L   +  + ++ L  + T K          I + E+S++ V+KE+   ++ F   Y+   +       +   +  YFV AFVA+LVL+ N  I LEQ      ++I  +D+
  S:    10 YLNIIANYTNKKAIEKITDYLVITSKILAKKADNLLNDHQEESVLEYDLATNNFRDKMIANLVEHKRYCDSLGEFEKLRVNRLAYFSKANEMEQFIKTANDQLVTVEDQLPNYISVLKLFHAMNKLLEMRLSSLLTNKN---------ITIKELSVEQVQKELVLAIKQFN--YQTVSLKRVLLKLNHPISLMYFVTAFVALLVLLNNQVIGLEQKDYHSELYIFLLDE 227
>gi|77463497|ref|YP_353001.1| condensin subunit ScpA [Rhodobacter sphaeroides 2.4.1] >gi|77387915|gb|ABA79100.1| condensin subunit ScpA [Rhodobacter sphaeroides 2.4.1] (262 aa)
Score = 119, Expect = 1.5e-04, Identities = 28/86 (32%), Positives = 54/86 (62%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKD 112
           I D+ G  F GP +L  +L + +K+D+  I+++++ + Y+ ++N +  +L+I+   +YL+MA +L   KS+ +LP   TEE  S +
  S:    23 IVDVEG--FEGPLDLLLTLSRTQKVDLRRISVLKLSEQYLLFVN-HAKQLRIELAADYLVMAAWLAYLKSRLLLPPDPTEEGPSAE 105
>gi|116328729|ref|YP_798449.1| hypothetical protein LBL_2103 [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116330614|ref|YP_800332.1| hypothetical protein LBJ_0930 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116121473|gb|ABJ79516.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124303|gb|ABJ75574.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (261 aa)
Score = 119, Expect = 1.5e-04, Identities = 41/145 (28%), Positives = 78/145 (53%)
  Q:    13 ENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKE 157
           EN ES N+  F +   +  G    GP  + +SLI+  K+DI +++L  + + +++++    T L ++   EY LMA  L+  KSK +LP    EE+  +     + +++LL +K++Q    KL E  + ++ +F + +    D+E
  S:     2 ENEESGNS--FVVQWNNSEGGLSEGPLSVLWSLIESYKVDIFDVSLSRITRDFLNFLRISET-LSLELSAEYALMAANLIYLKSKALLPDPGFEEEDYEPPLPPELVEKLLEHKKFQLTAKKLSEMDQIQTGVFRRESDVTLDEE 143
>gi|116051188|ref|YP_789981.1| hypothetical protein PA14_22840 [Pseudomonas aeruginosa UCBPP-PA14] >gi|115586409|gb|ABJ12424.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14] (250 aa)
Score = 119, Expect = 1.7e-04, Identities = 59/239 (24%), Positives = 113/239 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP    E +  +D  R + I+RL  Y+++++    L ++L R  R    P  +         E +    +P + L  ++  M ++   L      +S +   +++   E   + +E+       PF  L+ +            +  K   VV F+AIL LV+   ++L QN +
  S:     8 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMKAVRLELAAEYLVMAAMLAEIKSRMLLPR-SAEAEEEEDDPRAELIRRLQEYERFKKAAEDL-DELPRVGRDVLVPAVAA-------PEARARKLLPELALQELMLVMGEM---LRRADLFESHQVTREVLSTRERMSEVLERLKGGAFVPFIQLFTL------------EEGKLGVVVTFMAILELVKEQMVELVQNEA 221
>gi|71894120|ref|YP_278228.1| segregation and condensation protein A [Mycoplasma synoviae 53] >gi|71850908|gb|AAZ43517.1| conserved hypothetical protein [Mycoplasma synoviae 53] (247 aa)
Score = 119, Expect = 1.7e-04, Identities = 60/249 (24%), Positives = 120/249 (48%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD----LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVK 281
           + ++GP +L   L+K++K+ IL+IN++E+   Y+  IN  +    +D   EYL  AT  +  K+K +    +  E +++  E+ K I  L+ YKQ++EI   L    + R  ++ K       K S + EF   S    +D    +  ++  ++K++ ++   +  K+    VK+         +   +I+     F    ++ F + F      + +  +FV+  +A+L L R   + L+Q+S    I I++
  S:    12 QNYSGPLDLLLELVKDKKISILDINVLELANQYLKIINE-IKNTNLDIAAEYLNYATIFIYMKAKYLSNKPEDIEIVTQ--EKQKLINDLIEYKQFKEIKDALSTFQKSRQEIYIK-------KPSNVDEFIIESDSSRLDGHSSITTLISTLRKMFERVFAQELRKANFSTVKI---------NSADQIKFIKNVFGQRSEVKFEEIFI-----QSSLTHFVITLIALLDLARQQFLTLKQDSQYGEIKILR 240
>gi|127513176|ref|YP_001094373.1| chromosome segregation and condensation protein ScpA [Shewanella loihica PV-4] >gi|126638471|gb|ABO24114.1| chromosome segregation and condensation protein ScpA [Shewanella loihica PV-4] (262 aa)
Score = 119, Expect = 1.7e-04, Identities = 33/109 (30%), Positives = 63/109 (57%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLER 141
           + F GP +L   LI+++K+D++ + +  V   Y++YI   L   +++   +YL+MA  L E KS+ +LP  +  E+   D  R + I++L  Y+  ++   +L  + +LER
  S:    37 ESFEGPLDLLLYLIRKQKLDVVEMAIAPVTDQYLEYI-ELLQGARVELAADYLVMAATLAEIKSRLLLPRPELAEEDEAD-PRAQLIRQLKAYEVIKDAQQRLDALPRLER 145
>gi|193214443|ref|YP_001995642.1| chromosome segregation and condensation protein ScpA [Chloroherpeton thalassium ATCC 35110] >gi|193087920|gb|ACF13195.1| chromosome segregation and condensation protein ScpA [Chloroherpeton thalassium ATCC 35110] (244 aa)
Score = 118, Expect = 1.8e-04, Identities = 58/254 (22%), Positives = 123/254 (48%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVE 287
           EF GP +L    IK  +++I +I + ++ Q ++ Y++  +  L +D + E++ MA+ L+  K+K +LP  +  +    + + R + +++LL YK+++++  ++    E R +  E+     +    ++ E  D +  P +   +IL A ++V   +        PK  V  I    +SI   E++++  L+      +ISF +   +  D    +   VV F+AIL + R+  I +       + +I +   + E
  S:     8 EFEGPLDLLLFFIKRDELNIYDIPISKITQDFMAYLDA-MQSLSLDVVAEFIYMASVLMSIKAKMLLPRPEALDGDPNEFDPRTELVEKLLEYKRFKKMAGEIRILEEHRRQQHERRLFE-QIAAPVVDEMNDPTLRPTL-FHLIL-AYKRVLDHM--------PKKTVHEIRKVPVSI---EEQMQFILKKLDKSVQISFFESVADFQD----RIILVVTFLAILEMARSRQISIVTKDDYNDFWISRRQADYE 243
>gi|94499319|ref|ZP_01305857.1| hypothetical protein RED65_11034 [Oceanobacter sp. RED65] >gi|94428951|gb|EAT13923.1| hypothetical protein RED65_11034 [Oceanobacter sp. RED65] (295 aa)
Score = 118, Expect = 1.9e-04, Identities = 32/105 (30%), Positives = 63/105 (60%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLME 137
           ++F GP +L   LI+++ +D+L I++ E+ + Y+ Y+   +  ++++   EYL+MA  L E KS+ +LP     E+  +D  R + I+RL  Y+++++    L E
  S:    69 EQFEGPLDLLLYLIRKQNLDVLEIDVFEITKQYMQYV-ELMKVIQLELAAEYLVMAAMLAEIKSRILLPRPKEVEEEEED-PRAELIRRLQDYERFKQAAEDLDE 171
>gi|170789577|gb|EDT30621.1| ScpA/B protein [Oligotropha carboxidovorans OM5] (277 aa)
Score = 118, Expect = 2.0e-04, Identities = 35/130 (26%), Positives = 68/130 (52%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK--PTQSGEDK 156
           + D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     KL+++   +YL+MA +L   KS+ +LP   T +  S +        RL   +Q +E   +LM + +    +F +  P Q  + K
  S:    27 VVDVEGYE--GPLDLLLALARQQKVDLAKISILALADQYLVFIEA-ARKLRLELAADYLVMAAWLAYLKSRLLLPEPPTPDGPSAEDMASALANRLRRLEQIREASKRLMTRPQLNRDIFPRGLPEQIAQIK 155
>gi|42526385|ref|NP_971483.1| hypothetical protein TDE0873 [Treponema denticola ATCC 35405] >gi|41816497|gb|AAS11364.1| conserved hypothetical protein [Treponema denticola ATCC 35405] (258 aa)
Score = 118, Expect = 2.0e-04, Identities = 34/132 (25%), Positives = 71/132 (53%)
  Q:    17 SLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           S +NTEF +         F GP +L   LI + +++I +I + E+ + Y++Y++ Y  +  +D+L ++  MA  L+  KS+ +LP   + +    +  R + + +L+ Y++Y+++   + EK       FE+
  S:    15 SYSNTEFKV-------HNFEGPLDLLLFLINKNEVNIYDIPIAEITEQYLEYLD-YAIEPDLDNLVDFYSMAANLIYIKSRMLLPVEVSVDDEDIEDPRSELVDKLIEYQKYKKLSELMEEKESEAEWFFER 138
>gi|169198211|ref|ZP_02857522.1| chromosome segregation and condensation protein ScpA [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169089128|gb|EDS67842.1| chromosome segregation and condensation protein ScpA [Rhizobium leguminosarum bv. trifolii WSM2304] (285 aa)
Score = 118, Expect = 2.3e-04, Identities = 55/251 (21%), Positives = 121/251 (48%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYK-QYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+ G  F GP +L   L + +K+D+  I+++ + + Y+ ++ +   +++I+   +YL+MA +L   KS+ ++P     ++I  D    + +   L ++ +  E + +  E L  R+R+       G  +   + + Q ++Y  A  L  +L A   +  +   T+ T   ++   L D  E+ +  +  E+ ++     +L +      +   P+E+ T      AF A L LVR G +++ Q+ + + I++
  S:    37 DVAG--FEGPLDLLLYLARNQKVDLSRISVLALAEQYLQFVES-ARRIRIELAADYLVMAAWLAYLKSRLLIP-----QQIKDDGPSGEEMAATLAFRLKRLEAMRQAAEGLVNRNRLGRDIFVRGAPEH--IPDRQQSAY--AASLYDLLTAYAALRQRNAVTQVTIERRNVWSLTDAREL-LTQMIGEVGDWTAMEHYLLR------YLATPEERVTA--IASAFAASLELVREGKLEIRQDGAFQPIYM 267
>gi|110598876|ref|ZP_01387128.1| Prokaryotic chromosome segregation and condensation protein ScpA [Chlorobium ferrooxidans DSM 13031] >gi|110339513|gb|EAT58036.1| Prokaryotic chromosome segregation and condensation protein ScpA [Chlorobium ferrooxidans DSM 13031] (241 aa)
Score = 117, Expect = 2.3e-04, Identities = 34/119 (28%), Positives = 63/119 (52%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-RDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           I+  EF GP +L    IK  ++DI NI + ++   ++ YI+  +  L ++   E++ MA+ L+  K+  +LP    +   S + + R + +QRLL YK+ +E    L +    R  +F +
  S:     4 ISLDEFEGPLDLLLFFIKRDELDIYNIPVSKITSDFISYISE-VRILNLEIAAEFIYMASMLMSIKANMLLPRPAEDGTPSDEFDPRTELVQRLLEYKRIKEASTALDQLARERETLFAR 122
>gi|158423357|ref|YP_001524649.1| chromosome segregation and condensation protein [Azorhizobium caulinodans ORS 571] >gi|158330246|dbj|BAF87731.1| prokaryotic chromosome segregation and condensation protein [Azorhizobium caulinodans ORS 571] (298 aa)
Score = 117, Expect = 2.4e-04, Identities = 56/246 (22%), Positives = 110/246 (44%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRM----FEK--PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFL-EPFPHLYKI-SFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNS 272
           + D+ G  F GP +L  +L + +K+D+  I+++ +   Y+ +I     +++++   +YL+MA +L   KS+ +LP+   E+  S +     + +RL    ++ E + K  E+L  R R+    F +  P +S  D                    V+  A     L    T++ K     V L      S+ D  + +   L        ++  F+  +   P++K T      +F A L +VR G + + Q++
  S:    35 VVDLDG--FEGPLDLLLTLARTQKVDLHRISILALADQYLAFIEE-ARRVRLELAADYLVMAAWLAYLKSRLLLPAPPKEDGPSAEELAAAFTRRL----RHLERIRKAAEQLMARERLGVTVFPRTPPDESNPDTRP-----------------VVFTATLYDLLSAYATQRQKQALSFVTLKTRMVWSLADARERLERLLGTTLGDWMRLDEFLIDYMTTPEQKATA--LASSFSATLEMVREGKLDIRQDA 262
>gi|187251628|ref|YP_001876110.1| chromosome segregation and condensation protein ScpA [Elusimicrobium minutum Pei191] >gi|186971788|gb|ACC98773.1| chromosome segregation and condensation protein ScpA [Elusimicrobium minutum Pei191] (261 aa)
Score = 117, Expect = 2.4e-04, Identities = 55/245 (22%), Positives = 112/245 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LIK+  +DI +IN+ ++ + Y++Y+   +  L ++   E+L+MA+ L++ K+K++LPS     +          I +++ Y++++E    L  + E     F K     +  E +L           + +  +L A+++ + +L         K +V+L+ + E  I+    +I E L     +          +I   +  KR  +  F+A+L L++   I   Q+  +  I I
  S:    14 FEGPLDLLLHLIKKDNLDIYDINISDITKQYLEYL-EIMKSLNLEVAGEFLVMASTLMQIKAKQLLPSQAPTTEEDGPNPTQDLINKIVEYQKFKEASKYLDGRFEEFKDNFYKSAPIFDSGERVLN----------LQMFDLLAAVKRAFDRL-------DEKQHVELLKMEEFPIEKKMDKIAELLSGRSWV-------LLDDIFTGETKKRGVITCFLALLELMKIRKIMARQDERNGEIRI 233
>gi|51892941|ref|YP_075632.1| hypothetical protein STH1803 [Symbiobacterium thermophilum IAM 14863] >gi|51856630|dbj|BAD40788.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM 14863] (259 aa)
Score = 117, Expect = 2.7e-04, Identities = 37/131 (28%), Positives = 72/131 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS------MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK----------PTQSGEDKESLLKEFQD 165
           F GP +L   LI+  +M+I +I +  + + Y+  I + L  L +D  +E+L+MA  LL  KS+ +LP        +   +  ++  R+  +++L+ Y +++E    L E+     R++ +          P   G D   L++ FQ+
  S:    17 FEGPLDLLLHLIRREEMNIYDIPIARITEQYLAAIQD-LADLDLDRASEFLVMAATLLRIKSQMLLPKPPRLPADEEGPEEPEEDPREALVRQLVAYSRFKEAAELLREREREMLRVYTRGLFVEEPGGPPPLEGLDLADLVRAFQE 162
>gi|163848764|ref|YP_001636808.1| chromosome segregation and condensation protein ScpA [Chloroflexus aurantiacus J-10-fl] >gi|187601210|ref|ZP_02987440.1| chromosome segregation and condensation protein ScpA [Chloroflexus sp. Y-400-fl] >gi|163670053|gb|ABY36419.1| chromosome segregation and condensation protein ScpA [Chloroflexus aurantiacus J-10-fl] >gi|187487038|gb|EDU25009.1| chromosome segregation and condensation protein ScpA [Chloroflexus sp. Y-400-fl] (248 aa)
Score = 117, Expect = 2.8e-04, Identities = 53/241 (21%), Positives = 104/241 (43%)
  Q:    30 ITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQ 270
           +T  EF GP +L   LI+  ++DI  I L  V   Y+ ++   L +++  +L E++ MA  L+  KS+ +LP   T    + D +  + + +L +Y+++++    L    ++    F +              ++        DL   L+  +++ L L   +          ++    +++ +V + IR  LE         F D   N P    T    +V+F A+L L++   I +EQ
  S:     5 VTLPEFTGPLDLLLRLIERAELDITTIALASVADQYLAHVRT-LEEVEPRELAEFVSMAARLILIKSRALLPRSPTTPAEAGDEDAGQLVAQLELYRRFKQAAEVLRRWQDQGRSTFVRLAPPPLLPAPAPISYR------ITDLLHALERRRQLQLPLAQPE---------PIVLAPRLTVAEVAERIRARLE---RTAWFDFTDLLSNDP----TTEEVIVSFWAMLELLKRRAIVVEQ 222
>gi|118595133|ref|ZP_01552480.1| chromosome segregation and condensation protein ScpA [Methylophilales bacterium HTCC2181] >gi|118440911|gb|EAV47538.1| chromosome segregation and condensation protein ScpA [Methylophilales bacterium HTCC2181] (266 aa)
Score = 116, Expect = 3.0e-04, Identities = 59/245 (24%), Positives = 114/245 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDK---ESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           F GP +L   LI++  +DIL+I +  +   Y++Y+   + ++K++   +YLLM+  L+E KS+ +LP + +E+    D  R + + +L+ Y           E +++ +   +   Q G D+   +   K+  +   +P   ++ +  A + V  +    +  K        ID SE+S+ +    I + L     +   +F D      +EK      VV F+AIL L +   I++ Q      I+I
  S:    41 FQGPLDLLLYLIRKNNIDILDIPMALLTIQYMEYVEK-MKQIKLELAGDYLLMSAMLIEIKSRMLLPPIISEDDDDLD-PRAELVAKLIEY-----------ELMKKAAHDLDDIPQIGRDRLVAQGYFKKIVEPQSLPDASIEDLFNAWKNVVKRAGQFESHK--------IDRSELSVREHMSLILKKLASNELILFDTFFD------EEKDPIPKLVVCFLAILELTKECLIKINQQEPCSPIYI 261
>gi|148255779|ref|YP_001240364.1| condensin subunit ScpA [Bradyrhizobium sp. BTAi1] >gi|146407952|gb|ABQ36458.1| condensin subunit ScpA [Bradyrhizobium sp. BTAi1] (279 aa)
Score = 116, Expect = 3.0e-04, Identities = 56/247 (22%), Positives = 115/247 (46%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSY--VPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV-KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           + D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP    +E  S +        RL   +  +E   +LM + + +  +F +     E  E    +F    +  + A  +    + +  V++   T       +  + +L+ ++E+S D     + ++L           +DY    P +K T   F  +F A+L LVR G ++L Q  +
  S:    25 VVDVEGYE--GPLDLLLALARQQKVDLAKISILALADQYLQFIEA-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPAQEGPSAEEMATALANRLRRLEAIREAANRLMNRPQFQRDVFPRGNPE-EIAEVRRPKFTATLFDLLSAYAIQRQARVVTSVHMAKRTVWSLAEARATLERLVGMTEVSDD--WGCLDDYL-----------LDYVAE-PTQKAT--VFASSFAAVLELVREGKLELNQKQA 254
>gi|148358976|ref|YP_001250183.1| hypothetical protein LPC_0861 [Legionella pneumophila str. Corby] >gi|148280749|gb|ABQ54837.1| Segregation and condensation protein A [Legionella pneumophila str. Corby] (263 aa)
Score = 116, Expect = 3.1e-04, Identities = 35/110 (31%), Positives = 62/110 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+++ +DIL+I +  +   Y+ YI   +   +++   EYLLMA  L E KS+ +LP     E+  +D  R   +++L  Y+Q ++   +L++ L R+ R
  S:    41 FTGPLDLLLYLIRKQNIDILDIPMTSITNQYLQYI-QLMENRRMELAAEYLLMAAMLAEIKSRLLLPVTPDSEEEEED-PRMTLVRQLQAYEQIKQ-AAELLDGLPRQDR 147
>gi|89901801|ref|YP_524272.1| chromosome segregation and condensation protein ScpA [Rhodoferax ferrireducens T118] >gi|89346538|gb|ABD70741.1| condensin subunit ScpA [Rhodoferax ferrireducens T118] (282 aa)
Score = 116, Expect = 3.2e-04, Identities = 30/101 (29%), Positives = 55/101 (54%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LI+++  +IL+I +  + + Y+ Y+     +  ++   EYLLMA  L+E KS+ +LP     E    +  R + ++RLL Y++ +    +L
  S:    56 FEGPLDLLLYLIRKQNFNILDIPMAGMTRQYLVYVEEIRGR-NLELAGEYLLMAAMLIEIKSRMLLPPKKMAEGQEAEDPRAELVRRLLEYERMKLAAARL 155
>gi|52841675|ref|YP_095474.1| hypothetical protein lpg1445 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52628786|gb|AAU27527.1| hypothetical protein lpg1445 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (263 aa)
Score = 116, Expect = 3.2e-04, Identities = 35/110 (31%), Positives = 62/110 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+++ +DIL+I +  +   Y+ YI   +   +++   EYLLMA  L E KS+ +LP     E+  +D  R   +++L  Y+Q ++   +L++ L R+ R
  S:    41 FTGPLDLLLYLIRKQNIDILDIPMTSITNQYLQYI-QLMENRRMELAAEYLLMAAMLAEIKSRLLLPVTPDSEEEEED-PRMTLVRQLQAYEQIKQ-AAELLDGLPRQDR 147
>gi|188587714|ref|YP_001921476.1| ScpA/B protein [Clostridium botulinum E3 str. Alaska E43] >gi|188497995|gb|ACD51131.1| ScpA/B protein [Clostridium botulinum E3 str. Alaska E43] (251 aa)
Score = 116, Expect = 3.3e-04, Identities = 61/247 (24%), Positives = 127/247 (51%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV--KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           K+F GPF+L   LIK+ +MDI N+ + ++   Y+ YI+  +  + ++  +E++++A  L+E KSK +LP +  +E+  ++ +    I++L++YK+ ++      ++      ++ K       K  +++E    +    +  ++ L  +  +Y  L+     K  K NV  K I V +  I+D  K +   +E        + +  F  I D+   K   +V+F+A+L +V+   +++ Q+ S +NI I
  S:     9 KDFEGPFDLLLHLIKKNQMDIYNVEISKITNQYLKYIDE-MKFMDLEITSEFIVVAATLIEIKSKHLLPKIKKDEEEDEEDQEKNLIEKLILYKKIKKAAEFFKDRYVNSGELYTK-------KPEIIEEINLTNNNEDIFKNLTLLELYNMYNNLLEIYNNKQNKANVIQKRIYVDKYKIEDKLKYLLGLIEN-------NEVSKFSEIIDKCECKLECIVSFLALLEMVKLKKVRVYQSDSFDNILI 242
>gi|24213954|ref|NP_711435.1| hypothetical protein LA1254 [Leptospira interrogans serovar Lai str. 56601] >gi|45658296|ref|YP_002382.1| hypothetical protein LIC12453 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|73919290|sp|Q72PL7|SCPA_LEPIC Segregation and condensation protein A >gi|73919291|sp|Q7ZAN1|SCPA_LEPIN Segregation and condensation protein A >gi|24194813|gb|AAN48453.1|AE011307_6 conserved hypothetical protein [Leptospira interrogans serovar Lai str. 56601] >gi|45601538|gb|AAS71019.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (261 aa)
Score = 116, Expect = 3.3e-04, Identities = 40/145 (27%), Positives = 75/145 (51%)
  Q:    13 ENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKE 157
           EN ES     F +   +  G    GP  + +SLI+  K+DI +++L  + + ++ ++    T L ++   EY LMA  L+  KSK +LP    EE+  +     + +++LL +K++Q    KL E  + ++ +F + +    D+E
  S:     2 ENEES--GKSFVVQWNNSEGGLSEGPLSVLWSLIESYKVDIFDVSLSRITRDFLSFLRISET-LSLELSAEYALMAANLIYLKSKALLPDPGFEEEDYEPPLPPELVEKLLEHKKFQLTAKKLSEMDQTQTGVFRRESNVTLDEE 143
>gi|42519010|ref|NP_964940.1| hypothetical protein LJ1084 [Lactobacillus johnsonii NCC 533] >gi|56749641|sp|Q74JM3|SCPA_LACJO Segregation and condensation protein A >gi|41583297|gb|AAS08906.1| hypothetical protein LJ_1084 [Lactobacillus johnsonii NCC 533] (247 aa)
Score = 116, Expect = 3.4e-04, Identities = 61/249 (24%), Positives = 115/249 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD-TEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
           F GP +L   LI+ +K+DI +I + ++   Y+  +  + T L +    EY +MA+ LL  KS+ +LP  D  EE   ++  R + +++L+ Y  +Q I     ++ E      E P    +D     K+  +   +  +  D +    +      V  ++ K  K  V  I+V E SI+++   ++  L+        SF D  K+  D        +  F+A+L L R+  I ++QN    ++ + K++
  S:    14 FTGPLDLLLHLIRSQKIDIYDIPIAKITGQYLANLARWQT-LDLQIAGEYFVMASTLLRIKSQYLLPKNDFIEEDQYQEDPRTELVEQLVQYSVFQRIAEYFKKRDE------EMPITVAKDPSVSPKKEIEPLPLGEITSDELANTFK------VVLERFKLRKPQVGKIEVHETSIEEMTSFLKNRLQ---KKRSTSFFDCIKSFQDLD----QVIGLFLAVLELCRDHKILVKQNRDFGDLELEKVE 243
>gi|126645931|ref|ZP_01718448.1| putative segregation and condensation protein A [Algoriphagus sp. PR1] >gi|126577563|gb|EAZ81783.1| putative segregation and condensation protein A [Algoriphagus sp. PR1] (233 aa)
Score = 116, Expect = 3.8e-04, Identities = 56/239 (23%), Positives = 118/239 (49%)
  Q:    45 LIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLD---VILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKID 283
            I+  ++DI +I + ++   ++DY++ +L +++I+  +E++L A  L+  KSK +LP  +  E+  +   R++ I+ LL YK+Y+ ++ +L +  E R         S E + +L+ E Q  S V  +D +   V L  + KV+ K +    ++  +    +I         +E++    LE      ++ F ++    PD+ F     +  F+AIL L++   + +       N ++ K +
  S:     4 FIERDELDIYDIPISKITNDFLDYLH-HLEQMEIEVASEFILFAATLMRIKSKLLLPRPELNEEGEEIDPREELIRNLLEYKKYKSVIQELADLEEER--------LSKEKRGNLMFELQQLSKVEDVDAEMQHVDLYKLLKVFQKSMAKFASRRDETTHTVIQYPYT----IEQQKDFVLEKISFKKQVPFSEFITYKPDKIFV----IYTFLAILELLQLSKVTIIIGEGFNNFWVEKTE 228
>gi|182416881|ref|ZP_02948267.1| segregation and condensation protein A [Clostridium butyricum 5521] >gi|182379343|gb|EDT76842.1| segregation and condensation protein A [Clostridium butyricum 5521] (250 aa)
Score = 116, Expect = 3.9e-04, Identities = 55/255 (21%), Positives = 126/255 (49%)
  Q:    25 ISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV--KLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           + +  I   +F GPF+L   LI++ +M I N+ + E+   Y++Y+N  + ++ ++  +E++++A  L+E KSK +L     +E+ +++      +++L++YK+ + +     ++      ++ K       K  +++E +       +  ++ L  +  +Y  L+     K  + N+  K I V +  I+D        L+   +  K   ++YF+ + D    K   +V F+A+L +++   +++ QN S   I I
  S:     1 MELPKIKINDFEGPFDLLLHLIRKNQMSIYNVRIYEITNQYLNYLNE-MKEMDLEITSEFIVVAATLIEIKSKHLL-PKPKKEEENEEDVEKNLLEKLIIYKKIKGVSNFFKDRYISSGEVYGK-------KPEIIEEVKQKENHDDILKNLDLLQLYNIYNNLLEIYNNKQNRGNIIQKKIYVDKYKIEDK-------LQYIVNRMKNEQINYFEELIDTSECKLETIVTFLALLEMIKQRMVKVYQNDSFTKIII 241
>gi|54297355|ref|YP_123724.1| hypothetical protein lpp1400 [Legionella pneumophila str. Paris] >gi|53751140|emb|CAH12551.1| hypothetical protein [Legionella pneumophila str. Paris] (263 aa)
Score = 115, Expect = 3.9e-04, Identities = 35/110 (31%), Positives = 62/110 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+++ +DIL+I +  +   Y+ YI   +   +++   EYLLMA  L E KS+ +LP     E+  +D  R   +++L  Y+Q ++   +L++ L R+ R
  S:    41 FTGPLDLLLYLIRKQNIDILDIPMTSITNQYLQYI-QLMENRRMELAAEYLLMAAMLAEIKSRLLLPVTPDSEEEEED-PRMTLVRQLQAYEQIKQ-AAELLDGLPRQDR 147
>gi|54294520|ref|YP_126935.1| hypothetical protein lpl1596 [Legionella pneumophila str. Lens] >gi|53754352|emb|CAH15836.1| hypothetical protein [Legionella pneumophila str. Lens] (263 aa)
Score = 115, Expect = 4.0e-04, Identities = 35/110 (31%), Positives = 62/110 (56%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   LI+++ +DIL+I +  +   Y+ YI   +   +++   EYLLMA  L E KS+ +LP     E+  +D  R   +++L  Y+Q ++   +L++ L R+ R
  S:    41 FTGPLDLLLYLIRKQNIDILDIPMTSITNQYLQYI-QLMENRRMELAAEYLLMAAMLAEIKSRLLLPVTPDSEEEEED-PRMTLVRQLQAYEQIKQ-AAELLDGLPRQDR 147
>gi|146276954|ref|YP_001167113.1| chromosome segregation and condensation protein ScpA [Rhodobacter sphaeroides ATCC 17025] >gi|145555195|gb|ABP69808.1| condensin subunit ScpA [Rhodobacter sphaeroides ATCC 17025] (263 aa)
Score = 115, Expect = 4.1e-04, Identities = 27/86 (31%), Positives = 53/86 (61%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKD 112
           I D+ G  F GP +L  +L + +K+D+  I+++++ + Y+ ++  +  +L+I+   +YL+MA +L   KS+ +LP   TEE  S +
  S:    25 IVDVEG--FEGPLDLLLTLSRTQKVDLRRISVLKLAEQYLLFVT-HARQLRIELAADYLVMAAWLAYLKSRLLLPPDPTEEGPSAE 107
>gi|86357449|ref|YP_469341.1| hypothetical protein RHE_CH01821 [Rhizobium etli CFN 42] >gi|86281551|gb|ABC90614.1| hypothetical conserved protein [Rhizobium etli CFN 42] (270 aa)
Score = 115, Expect = 4.4e-04, Identities = 55/251 (21%), Positives = 121/251 (48%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYK-QYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAM-DLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+ G  F GP +L   L + +K+D+  I+++ + + Y+ ++ +   +++I+   +YL+MA +L   KS+ ++P     +++  D    + +   L ++ +  E + +  E L  R+R+       G  +   + + Q ++YV ++ DL   L A   +  +   T+ T   ++   L D  E+ +  +  E+ ++     +L        +   P+E+ T      AF A L LVR G +++ Q  + + I++
  S:    22 DVAG--FEGPLDLLLYLARNQKVDLSRISVLALAEQYLQFVES-ARRIRIELAADYLVMAAWLAYLKSRLLIP-----QQVKDDGPSGEEMAATLAFRLKRLEAMRQAAEGLVNRNRLGRDIFARGAPEH--IPDRQQSAYVASLYDL---LTAYAALRQRHAITQVTIERRNVWSLTDAREL-LTQMIGEVGDWTAMEHYLLP------YLAAPEERVTA--IASAFAASLELVREGKLEIRQEGAFQPIYM 252
>gi|78189949|ref|YP_380287.1| putative segregation and condensation protein A [Chlorobium chlorochromatii CaD3] >gi|78172148|gb|ABB29244.1| condensin subunit ScpA [Chlorobium chlorochromatii CaD3] (248 aa)
Score = 115, Expect = 4.4e-04, Identities = 53/246 (21%), Positives = 111/246 (45%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKD--IERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTK-SPKDNVKLIDVSEISIDDVEKEIREFLEPFPHL-YKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           EF GP +L    IK  ++DI NI +  +   ++ YI+    +L ++   E++ MA+ L+  K++ +LP    +     D    R + ++RLL Y++ +E    L  + + R+ +  +     ++  S   E +          D +L+     +L L      K  P+   + +    ++I++    I E L   P L + +    + +N+          VV F+A+L L ++  I +  N +  ++++
  S:     8 EFEGPLDLLLFFIKRDELDIYNIPIARITTDFISYIHA-ARQLDLEVAAEFIYMASMLMSIKARMLLPRPPDDPTAESDEFDPRTELVERLLEYQRIKEAAEALRLRADERALLLARGWSELQEAVSAGNEQEGE--------DELLQQPTLYHLMLACNAMLKRRPRPMTRSVADVPVTIEEQSAMILERLRYEPQLSFTVLLASFSENL--------VVVVTFLAVLELCKSQRISVLINDAYNDVWL 240
>gi|146340978|ref|YP_001206026.1| hypothetical protein BRADO4049 [Bradyrhizobium sp. ORS278] >gi|146193784|emb|CAL77801.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] (279 aa)
Score = 115, Expect = 5.0e-04, Identities = 54/247 (21%), Positives = 115/247 (46%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK--PTQSGEDKESLLKEFQDNSY--VPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNV-KLIDVSEIS-----IDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           + D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP    +E  S +        RL   +  +E   +LM + + +  +F +  P    E ++    +F    +  + A  +    + +  V++   T       +  + +L+ ++E+S     +DD               Y +S+      +P+       F  +F A+L LVR G ++L Q  +
  S:    25 VVDVEGYE--GPLDLLLALARQQKVDLAKISILALADQYLQFIEA-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPAQEGPSAEEMATALANRLRRLEAIREAANRLMNRPQFQRDVFPRGNPEAIAEVRKP---KFTATLFDLLSAYAIQRQARVVTSVHMAKRTVWSLAEARATLERLVGMTEVSDDWGCLDD---------------YLLSY------VPEPTQKATVFASSFAAVLELVREGKLELNQKQA 254
>gi|114797903|ref|YP_760745.1| segregation and condensation protein A [Hyphomonas neptunium ATCC 15444] >gi|114738077|gb|ABI76202.1| segregation and condensation protein A [Hyphomonas neptunium ATCC 15444] (277 aa)
Score = 114, Expect = 5.3e-04, Identities = 56/248 (22%), Positives = 114/248 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFE--KPTQSGE--DKESLLK-EFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKI--SFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKI 282
           + GP  L   L + +K+++L I+++ + + Y+ ++ +  TK +ID   +YLLMA++L   KS+ +LP  +        IE D+           +E+  +L  +L+R   M +  +  ++G   D+   L+ E +    V  M+    L  +      +   ++ + P    + + +         + +RE L+ +  L  I  +  D    +P+   T   F  A    L L R+G + L Q++    I++ +I
  S:    31 YEGPLHLLLELARRQKVNLLQISMLRLAEQYLSFVEDARTK-RIDIAADYLLMASWLAFMKSRLLLPKPEA-------IEEDE--------PTGEEMAARLAFRLKRLDAMRQAVRELEAGPVLDRVVFLRGETEQPKVVKHMEYTASLYDLSTALGTIRDRREKERPHRIEQQLVLPLEQARTTLRGLREQLDQWASLADIRTAMTDINPEVPERSVTASVFSAA----LELTRDGEVDLRQDTHFAPIYMRRI 265
>gi|94970887|ref|YP_592935.1| condensin subunit ScpA [Acidobacteria bacterium Ellin345] >gi|94552937|gb|ABF42861.1| condensin subunit ScpA [Acidobacteria bacterium Ellin345] (282 aa)
Score = 114, Expect = 5.3e-04, Identities = 47/191 (24%), Positives = 98/191 (51%)
  Q:     9 EFKPENLESLNNTEFHISIKDIT-GKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQD-NSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKD 199
           E KP   ++    E   S+  IT G+ ++GP +L   L++++ +DI +I + ++ + Y+ Y   ++  + +D   E++ MA+ L+  KSK +LP  D +    ++  R + + RLL +++++     L++K +    +   P+         +KEF+D     P +  DVI   + K + +++   K+K   D
  S:    12 ETKPAAPDAKRPQERDDSVFSITVGQIYDGPLDLLLDLVRKQDIDIYDIPIAKITRQYLTY-TEHIKTIDVDVAAEFIYMASLLIHIKSKMLLPR-DPDAPAGEEDPRMELVNRLLEHERFKTAAQMLLQKQQIEDAILTNPS---------MKEFRDAEGAEPELAADVI--DLVKTFREILERAKSKPTFD 191
>gi|168703047|ref|ZP_02735324.1| hypothetical protein GobsU_26191 [Gemmata obscuriglobus UQM 2246] (267 aa)
Score = 114, Expect = 5.4e-04, Identities = 57/246 (23%), Positives = 118/246 (47%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLE----RRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIRE--FLEPFPHLY-KISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIV 280
           F+GP +L   L+K  ++D+L+I +  + + ++ Y+   + +L I+   E+L+M+  L+E KS+ +LP+        +   R + +++LL Y+++++    L  + E    R +R+         D+            V A++L  ++ A    + +L+   +   P         + I++DD  + + E   LE       ++ F D F        TK   +  F+A+L L+R+  + L+Q     +IF+V
  S:    10 FHGPLDLLLYLVKRNEVDVLDIPIAAIAEQFLGYVLA-VKELDIEFAGEFLVMSATLMEIKSRTLLPADAQFAPDDQPDPRRELVRQLLEYRKFKDAAAALEARAEEAAGRLARVEPPDPNPVRDR---------TPNVRAVELWDLVSA----FARLMRETQALQP---------ATIAVDDTPQHVHEAQLLERVAAAGGRLPFRDAFP----PPHTKPRLIGIFLAVLELIRHHGLGLDQPEPTGDIFLV 235
>gi|78223166|ref|YP_384913.1| condensin subunit ScpA [Geobacter metallireducens GS-15] >gi|78194421|gb|ABB32188.1| condensin subunit ScpA [Geobacter metallireducens GS-15] (266 aa)
Score = 114, Expect = 5.5e-04, Identities = 31/96 (32%), Positives = 62/96 (64%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQE 130
           F GP +L   LI++ ++DI +I L  + + Y++YI   + +L ++   E+L+MA+ L++ KSK +LP+   +   +  ++  R + ++RLL Y++Y+E
  S:    25 FEGPLDLLLHLIRKNEVDIYDIPLSTITKEYLEYI-KMMKELNLEIAGEFLVMASTLIQIKSKTLLPTPVDEDAPEEEEEDPRAELVRRLLEYQKYKE 121
>gi|163739606|ref|ZP_02147015.1| segregation and condensation protein A [Phaeobacter gallaeciensis BS107] >gi|163741408|ref|ZP_02148799.1| segregation and condensation protein A [Phaeobacter gallaeciensis 2.10] >gi|161385142|gb|EDQ09520.1| segregation and condensation protein A [Phaeobacter gallaeciensis 2.10] >gi|161387065|gb|EDQ11425.1| segregation and condensation protein A [Phaeobacter gallaeciensis BS107] (263 aa)
Score = 114, Expect = 6.1e-04, Identities = 64/259 (24%), Positives = 122/259 (47%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHL--YKISFMDYFKNIPDEKFT---KRYFVVA--FVAILVLVRNGHIQLEQNSSDENIFIVKIDKE 285
           I D+ G E  GP ++  SL + +K+D+  I+++E+ + Y+ ++     +L+I+   +YL+MA +L   KS+ +LP   TEE  S +        +L   +  ++   +LM + ++  R F    QS           +D + +  +     L  + + Y ++ T       +D+ +   +   +I  +E      L+   HL  Y  S+ D    +P+   +   KR    A  F A L LV+ GH++L Q+ +   I +   DK+
  S:    23 IVDVDGYE--GPLDVLLSLSRTQKVDLRRISVLELARQYLSFVEK-AHELRIELAADYLVMAAWLAYLKSRLLLPPDPTEEGPSGEELAAHLAFQLERLQAMRDSAARLMAR-DQLGRNFFARGQS-----------EDVTRIRTVSYSANLLDLMQAYARIRT-------RDDFRPFVLDREAIFTMEAA----LDRMRHLIGYTGSWTDMLTYLPEGWHSDPMKRRSATASTFAASLQLVKEGHLELRQSETYAPIQLRIRDKD 262
>gi|89211799|ref|ZP_01190139.1| putative segregation and condensation protein A [Halothermothrix orenii H 168] >gi|89158598|gb|EAR78306.1| putative segregation and condensation protein A [Halothermothrix orenii H 168] (153 aa)
Score = 114, Expect = 6.3e-04, Identities = 39/153 (25%), Positives = 82/153 (53%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDV--ILKAMQKVYL 186
           +F GP EL Y L+K+ K++I  I+L  + + Y++YI +Y     ++  +E++++A+ L+E K K +LP  + +    +  +    +QRL  Y  ++++     E  +   +++ KP          L ++ DN     +D+D+  +++A +K  L
  S:     8 KFQGPLELLYQLVKKNKIEISEISLARITEQYLEYIEHY-RDFNLEMASEFMVIASELIELKVKSLLPDSEEDSTEEE--KGKTIVQRLKDYHVFKKVTELFREYEKAAGQIYSKPVN--------LDKYVDNEVNYEIDIDISELVEAFKKAML 151
>gi|167357345|ref|ZP_02292013.1| chromosome segregation and condensation protein ScpA [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167075833|gb|EDR79641.1| chromosome segregation and condensation protein ScpA [Rhizobium leguminosarum bv. trifolii WSM1325] (285 aa)
Score = 114, Expect = 6.6e-04, Identities = 56/251 (22%), Positives = 120/251 (47%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYK-QYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+ G  F GP +L   L + +K+D+  I+++ + + Y+ +I +   +++I+   +YL+MA +L   KSK ++P     ++I  D    + +   L ++ +  E + +  + L  R+R+       G  +   + + Q ++Y  A  L  +L A   +  +   T+ T   +    L D  E+ +  +  E+ ++     +L +      +   P+E+ T      AF A L LVR G +++ Q+ + + I++
  S:    37 DVAG--FEGPLDLLLYLARNQKVDLSRISVLALAEQYLLFIES-ARRIRIELAADYLVMAAWLAYLKSKLLIP-----QQIKDDSPSGEELAATLAFRLKRLEAMRQAADGLINRNRLGRDIFVRGAPEH--IPDRQQSAY--AASLYDLLTAYAALRQRHAVTQVTIERRTVWSLTDAREL-LTKMIGEVADWTAMEHYLLR------YLAAPEERVTA--IASAFAASLELVREGKLEIRQDGAFQPIYM 267
>gi|116251804|ref|YP_767642.1| putative chromosome segregation and condensation protein A [Rhizobium leguminosarum bv. viciae 3841] >gi|115256452|emb|CAK07536.1| putative chromosome segregation and condensation protein A [Rhizobium leguminosarum bv. viciae 3841] (251 aa)
Score = 113, Expect = 6.8e-04, Identities = 55/251 (21%), Positives = 120/251 (47%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYK-QYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+ G  F GP +L   L + +K+D+  I+++ + + Y+ +I +   +++I+   +YL+MA +L   KSK ++P     +++  D    + +   L ++ +  E + +  + L  R+R+       G  +   + + Q ++Y  A  L  +L A   +  +   T+ T   +    L D  E+ +  +  E+ ++     +L +      +   P+E+ T      AF A L LVR G +++ Q+ + + I++
  S:     3 DVAG--FEGPLDLLLYLARNQKVDLSRISVLALAEQYLLFIES-ARRIRIELAADYLVMAAWLAYLKSKLLIP-----QQVKDDGPSGEELAATLAFRLKRLEAMRQAADGLVNRNRLGRDIFVRGAPEH--IPDRQQSAY--AASLYDLLTAYAALRQRHAVTQVTIERRTVWSLTDAREL-LTQMIGEVADWTAMEHYLLR------YLAAPEERVTA--IASAFAASLELVREGKLEIRQDGAFQPIYM 233
>gi|58040186|ref|YP_192150.1| hypothetical protein GOX1755 [Gluconobacter oxydans 621H] >gi|58002600|gb|AAW61494.1| Hypothetical protein GOX1755 [Gluconobacter oxydans 621H] (254 aa)
Score = 113, Expect = 8.2e-04, Identities = 30/110 (27%), Positives = 63/110 (57%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTK---LKIDDLTEYLLMATYLLEQKSKRILPSM----DTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSR 144
           F GP +L   L +++K+D+  I+++++++ Y+  +     +   L+++   ++L+MA +L   KSK +LP+     D E+ I    ER   ++R+    Q+    P+L   + RR +
  S:    12 FEGPLDLLLDLARKQKVDLAKISILQLVEQYLAVVEKARAEARSLRLELAADWLVMAAWLAWLKSKLLLPAENEDPDAEDAIELLQERLIELERMRAAAQWLSEQPRLGLDVFRRGQ 128
>gi|186456049|ref|ZP_02966363.1| chromosome segregation and condensation protein ScpA [bacterium Ellin514] >gi|184208127|gb|EDU05172.1| chromosome segregation and condensation protein ScpA [bacterium Ellin514] (269 aa)
Score = 113, Expect = 8.4e-04, Identities = 30/101 (29%), Positives = 61/101 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERD---KYIQRLLVYKQYQEIVPKL 135
           F GP +L   LI++ ++DI ++NL ++   +++YI   +  L ++   E+L+MA+ L+  KSK +LP     +   +D   D   + I++L+ YK++++   +L
  S:    11 FEGPLDLLLYLIRKEEVDIYDVNLTQLATQFIEYI-EVMRLLDLEIAGEFLVMASTLMYIKSKELLPVEQQVQPEGEDEGEDPRWELIRQLVEYKKFKDAAAQL 113
>gi|160945262|ref|ZP_02092488.1| hypothetical protein FAEPRAM212_02781 [Faecalibacterium prausnitzii M21/2] >gi|158442993|gb|EDP19998.1| hypothetical protein FAEPRAM212_02781 [Faecalibacterium prausnitzii M21/2] (240 aa)
Score = 112, Expect = 9.3e-04, Identities = 49/241 (20%), Positives = 101/241 (41%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           ++F+GP EL  +L+ + KMD+ NI ++++I  Y   +         +  + ++ MA +L+E KS  +LP  +  E++ +++       +L+ Y Q + +   L  K E       +P +   D    L       + P +  D       +   + V T++   P     ++ V+   +  + + +   +     L+  S             ++   V  F+A+L LVR G I L+   +
  S:    10 EDFDGPLELLLALVAKHKMDLHNIPILQLIDQYTRTVEQ--ADPDPETASAFIEMAAHLVEMKSFLLLPRSEEGERMKQEL-----TGQLIEYDQCRRMAALLRAKGEVAPVFVRRPMEVEWDNTYALH------HAPQILADYWQALAGRTKTRRVPTQQQFEPLVTAPMVSVTSRVVYILRRMLGGTVAKMEQLFSRS------------QSRSTNVATFLALLELVRGGRIALDDRGA 225
>gi|110634160|ref|YP_674368.1| condensin subunit ScpA [Mesorhizobium sp. BNC1] >gi|110285144|gb|ABG63203.1| condensin subunit ScpA [Mesorhizobium sp. BNC1] (266 aa)
Score = 112, Expect = 9.6e-04, Identities = 54/262 (20%), Positives = 118/262 (45%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAM-DLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKIS-FMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEVESNE 290
           D+ G  F GP +L   L + +K+D+  I+++ + + Y+ +I+  + +++++   +YL+MA +L   KS+ ++P   T+ + + + E    +Q  L   +  E +     +L  R+R+       G  +  +++  + N+Y   + DL           L     ++ +    NV++      S+    + +   +   P    +  F+  +   P+E+ T       F A L LVR G +++ Q      I++ +  K +E  E
  S:    22 DVEG--FEGPLDLLLHLARNQKVDLARISVLALAEQYLRFIDQ-VRQMRLELAADYLVMAAWLAYLKSRLLIPKQRTDGEPTGE-EMAALLQFRL---KRLEAIRDAAARLVNRNRLGRDVFARGMPEHVVVE--KKNAYTATLYDL-----------LTAYAGQRQRRAITNVQIAKRGVWSLKQAREVLTRLMGDLPDWTALDRFLIRYLTGPEERATA--IASTFAASLELVREGALEIRQQEPFAPIYMRRGTKGLEQTE 263
>gi|171911417|ref|ZP_02926887.1| chromosome segregation and condensation protein ScpA [Verrucomicrobium spinosum DSM 4136] (268 aa)
Score = 112, Expect = 1.1e-03, Identities = 54/252 (21%), Positives = 114/252 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFIVKIDKEV 286
           F GP +L   LIK+ ++DI ++++  +   Y+ YI  +   L I+   E+++MA  L+  KS+ +LP      +E+  ++  R + I++L+ YK++++    L  +    +  F    +  +    +         +P + +  +++A QKV  K       +   D+             V  +I   L   P   K+ FM  F     E  ++   ++ F+A+L L++   +++EQ      I +++   +V
  S:    15 FEGPLDLLLYLIKKDEIDIYDVSIERITSQYLGYIETF-KALNIELSGEFIVMAANLMYLKSRTLLPKDVQPPDEEADEEDPRWELIRQLVEYKKFKDAAQFLHIRDSSGAEFFAANPELPDLNAPV-------EGLPQIGIFDLIRAFQKVLKKFEDVHTLREIVDDRW----------TVSDKIDYLLSVLPVGGKVPFMSLFT----EATSRSEVIITFLAMLELMKLNFLKIEQERVLGEILVLRPSDKV 246
>gi|170727251|ref|YP_001761277.1| chromosome segregation and condensation protein ScpA [Shewanella woodyi ATCC 51908] >gi|169812598|gb|ACA87182.1| chromosome segregation and condensation protein ScpA [Shewanella woodyi ATCC 51908] (262 aa)
Score = 112, Expect = 1.1e-03, Identities = 32/113 (28%), Positives = 64/113 (56%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRM 145
           + F GP +L   LI+++K+D++ + +  V + Y++YI   L   +++   +YL+MA  L E KS+ +LP   +E +  +D  R + I++L  Y    E++    ++L+   R+
  S:    37 ESFEGPLDLLLYLIRKQKLDVVELPIWPVTEQYLEYI-ELLQGARVELAADYLVMAATLAEIKSRLLLPRPKSEVEDEED-PRAQLIRQLKAY----EVIKLAQQELDSLPRL 143
>gi|86138652|ref|ZP_01057225.1| segregation and condensation protein A [Roseobacter sp. MED193] >gi|85824712|gb|EAQ44914.1| segregation and condensation protein A [Roseobacter sp. MED193] (265 aa)
Score = 111, Expect = 1.1e-03, Identities = 27/81 (33%), Positives = 51/81 (62%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           I D+ G  F GP +L  +L + +K+D+  I+++E+ + Y+ ++  +  +L+I+   +YL+MA +L   KS+ +LP   TEE
  S:    25 IVDVDG--FEGPLDLLLTLSRTQKVDLRRISVLELARQYLTFV-EHAKELRIELAADYLVMAAWLAYLKSRLLLPPDPTEE 102
>gi|15889015|ref|NP_354696.1| hypothetical protein Atu1708 [Agrobacterium tumefaciens str. C58] >gi|15156804|gb|AAK87481.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] (281 aa)
Score = 111, Expect = 1.3e-03, Identities = 54/251 (21%), Positives = 115/251 (45%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK--PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYF--KNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENIFI 279
           D+ G  F GP +L   L + +K+D+  I+++ + + Y+ ++ +   +++I+   +YL+MA +L   KSK ++P    ++  S +        RL   +  +E   +L+ + +    +F +  P        S    ++ N Y    DL   L A   +  +   T+ T   +    L++  E+ ++ +  ++ E+          + +D +  + +PD          AF A L LVR G +Q+ Q  + + I++
  S:    33 DVAG--FEGPLDLLLHLARTQKVDLSRISVLALAEQYLQFVES-ARRVRIELAADYLVMAAWLAFLKSKLLIPQQAKDDGPSGEEMAATLAFRLKRLEAMREAAERLVNRAQLGRDVFARGAPEHIPHINRS---AYEANLY----DL---LSAYANLRQRQAITQVTIEKRQVWSLVEAREL-LNSLLGDVGEW----------TVLDQYLLQYVPDPAMRVTAIASAFAASLELVREGSLQIRQEGAFQPIYM 263
>gi|114570461|ref|YP_757141.1| condensin subunit ScpA [Maricaulis maris MCS10] >gi|114340923|gb|ABI66203.1| condensin subunit ScpA [Maricaulis maris MCS10] (271 aa)
Score = 110, Expect = 1.5e-03, Identities = 28/93 (30%), Positives = 51/93 (54%)
  Q:    15 LESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
            E+  N E    + D+ G  F GP  L  +L ++RK+D+  I+++++   Y+ ++     K ++D   +YL+MA +L   KSK +LP    E+
  S:    11 FEAAENAETDALVVDLDG--FGGPLHLLLALARKRKIDLAKISILDLADQYLLFMEAARKK-RLDLAADYLVMAAWLAFLKSKLLLPKPPKED 100
>gi|118048819|ref|ZP_01517396.1| chromosome segregation and condensation protein ScpA [Chloroflexus aggregans DSM 9485] >gi|117994671|gb|EAV08935.1| chromosome segregation and condensation protein ScpA [Chloroflexus aggregans DSM 9485] (248 aa)
Score = 110, Expect = 1.5e-03, Identities = 53/244 (21%), Positives = 109/244 (44%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAM----DLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNS 272
           +IT   F GP +L   LI+  ++DI  I L  V   Y+ ++   L +++  DL E++ +A  L+  KS+ +LP          D + ++   +L +Y+++++    L    E     F + T            ++    + A+     L + L A +++ L         +P+          +++ +V   IR  LE      ++++ D F ++   + T    +V+F A+L L++   I +EQ +
  S:     4 EITLPAFTGPLDLLLRLIERAELDITAIALASVADQYLAHV-RMLEQVEPGDLAEFVSVAARLVLIKSRALLPRSPVAPTAPVDEDAEQLAAQLELYRRFKQAAEVLRVWQESGRSTFVRVTPPLLPLAPSPATYRVADLLQALARRAQLQLPLAAEERIAL---------TPR----------LTVAEVVGRIRSRLE------RVTWFD-FSDLLSVQPTAEEVIVSFWAVLELLKRQVIVVEQTT 224
>gi|84687539|ref|ZP_01015415.1| segregation and condensation protein A [Rhodobacterales bacterium HTCC2654] >gi|84664448|gb|EAQ10936.1| segregation and condensation protein A [Rhodobacterales bacterium HTCC2654] (263 aa)
Score = 110, Expect = 1.7e-03, Identities = 29/103 (28%), Positives = 57/103 (55%)
  Q:     5 NNNNEFKPENLESLNNTEFHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           ++++EF+ + L           I D+ G  F GP +L  +L + +K+D+  I+++ + + Y+ ++      L+I+   +YL+MA +L   KS+ +LP   TEE
  S:     2 SDDDEFQADVLSVSERMAAEALIVDVDG--FEGPLDLLLTLSRTQKVDLRKISVLALAEQYLAFVEK-ARHLRIELAADYLVMAAWLAFLKSRLLLPPDPTEE 101
>gi|154250139|ref|YP_001410964.1| chromosome segregation and condensation protein ScpA [Fervidobacterium nodosum Rt17-B1] >gi|154154075|gb|ABS61307.1| chromosome segregation and condensation protein ScpA [Fervidobacterium nodosum Rt17-B1] (224 aa)
Score = 110, Expect = 1.7e-03, Identities = 27/104 (25%), Positives = 63/104 (60%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEK 138
           F GP +L   L++++++DI  +++ ++   ++ YIN  + +  ++  +E++  A YLLE KSK ++PS+  +E+   + +R+   +R+  Y + +++  +L  K
  S:    10 FEGPLDLLLYLVQKKQIDIRQLSISQLADEFLYYINQ-MEEFNLNVTSEFISTAAYLLELKSKSLIPSLSDKERKEYEYKRELLFRRIEEYARLKQLAEELSRK 112
>gi|83858686|ref|ZP_00952208.1| hypothetical protein OA2633_04266 [Oceanicaulis alexandrii HTCC2633] >gi|83853509|gb|EAP91361.1| hypothetical protein OA2633_04266 [Oceanicaulis alexandrii HTCC2633] (281 aa)
Score = 110, Expect = 1.9e-03, Identities = 28/75 (37%), Positives = 45/75 (60%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP 101
           I DI G E  GP  L  +L ++ K+D+  I++VE+   Y+ +I+   T  ++D   EYL+MA +L   KS+ +LP
  S:    26 ILDIGGWE--GPLHLLLALARKNKVDLAVISMVELADQYLLFIDKARTH-RLDIAAEYLVMAAWLTYLKSRLLLP 97
>gi|149914957|ref|ZP_01903486.1| hypothetical protein RAZWK3B_16335 [Roseobacter sp. AzwK-3b] >gi|149811145|gb|EDM70982.1| hypothetical protein RAZWK3B_16335 [Roseobacter sp. AzwK-3b] (268 aa)
Score = 109, Expect = 2.2e-03, Identities = 27/81 (33%), Positives = 50/81 (61%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           I DI G  F GP ++   L + +K+D+L I+++++ + Y+ ++     +L+I+   +YL+MA +L   KS+ +LP   TEE
  S:    31 IVDIDG--FEGPLDVLLMLGRTQKVDLLKISVLDLARQYLAFVER-AKQLRIELAADYLVMAAWLAFLKSRLLLPPDPTEE 108
>gi|69934529|ref|ZP_00629607.1| Protein of unknown function DUF173 [Paracoccus denitrificans PD1222] >gi|119384604|ref|YP_915660.1| chromosome segregation and condensation protein ScpA [Paracoccus denitrificans PD1222] >gi|119374371|gb|ABL69964.1| condensin subunit ScpA [Paracoccus denitrificans PD1222] (284 aa)
Score = 109, Expect = 2.2e-03, Identities = 22/77 (28%), Positives = 48/77 (62%)
  Q:    25 ISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP 101
           + + D++G  F GP +L  +L + +K+D++ ++++E+   Y+ ++      L+I+   +YL+MA +L   KS+ +LP
  S:    44 VLVVDVSG--FEGPLDLLLTLSRTQKVDLMQVSVLELADQYLAFVEE-ARALRIELAADYLVMAAWLAYLKSRLLLP 117
>gi|91977262|ref|YP_569921.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris BisB5] >gi|91683718|gb|ABE40020.1| condensin subunit ScpA [Rhodopseudomonas palustris BisB5] (277 aa)
Score = 109, Expect = 2.3e-03, Identities = 30/120 (25%), Positives = 62/120 (51%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP     E  S +        RL   +  +E   +LM + + +  +F +
  S:    26 DVEGYE--GPLDLLLTLARQQKVDLHKISILALADQYLQFIEE-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPAAEGPSAEEMATALANRLRRLEAIREAADRLMTRPQLQRDIFPR 142
>gi|153004982|ref|YP_001379307.1| chromosome segregation and condensation protein ScpA [Anaeromyxobacter sp. Fw109-5] >gi|152028555|gb|ABS26323.1| chromosome segregation and condensation protein ScpA [Anaeromyxobacter sp. Fw109-5] (300 aa)
Score = 109, Expect = 2.4e-03, Identities = 63/253 (24%), Positives = 118/253 (46%)
  Q:    23 FHISIKDITGKE--FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIE-----RDKYIQRLLVYKQYQEIVPKLMEK-------LERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMD-LDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDE 275
           F +++  +   E  F GP +L   L+KE ++D+ +I +  + + Y+  +   + +L ID   E+L MA  L+  KSK +LP  +  E      E     R + ++RLL Y++Y+    +L E+         R++R+ E+P  + E  E L     D S    ++ LD  LK  +  +   V T +        ++ DV  +S                   + +F +      + + T+   +  F+AIL + +   +++ Q S DE
  S:    30 FRVTLPPLRAGEPPFEGPLDLILHLVKEHEVDLFDIPIARITESYLATLEA-MRELDIDIAGEFLHMAAQLMLMKSKLLLPRTEVAEDAPGADESGVDPRAELVRRLLEYQKYKAAAEELGERDILDRTVFARKARV-ERPV-AAEGPEGL----ADVSVFKLIEALDRALKHARPEHTHEVVTDRLSISDAIARVADVLRLS------------------RRATFEELLSGPAEHRHTRADVIATFLAILEMAKLKLVRIFQASLDE 272
>gi|148556833|ref|YP_001264415.1| condensin subunit ScpA [Sphingomonas wittichii RW1] >gi|148502023|gb|ABQ70277.1| condensin subunit ScpA [Sphingomonas wittichii RW1] (257 aa)
Score = 109, Expect = 2.4e-03, Identities = 26/73 (35%), Positives = 45/73 (61%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILP 101
           DI G E  GP +L  SL + +K+D+  I+++ + + Y+ +I+N    LK++   +YL+MA +L   KS  +LP
  S:    24 DIDGWE--GPLDLLLSLARAQKVDLARISILALTEQYLSFIDN-AKALKLEIAADYLVMAAWLAYLKSCLLLP 93
>gi|146306869|ref|YP_001187334.1| condensin subunit ScpA [Pseudomonas mendocina ymp] >gi|145575070|gb|ABP84602.1| condensin subunit ScpA [Pseudomonas mendocina ymp] (274 aa)
Score = 109, Expect = 2.5e-03, Identities = 56/237 (23%), Positives = 110/237 (46%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           F GP +L   LI+++ +DIL+I + E+ + Y+ Y+   +  ++++   EYL+MA  L E KS R+L     E +  +D  R + I+RL  Y++++     L ++L R  R    P            E +    +P + L+ +L +M +V  +    +  +  ++ +              + + E LE       + F++ F      +  +   VV F+A+L L++   ++L QN
  S:    50 FEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYV-ELMHTVRLELAAEYLVMAAMLAEIKS-RMLLPRSAESEEEEDDPRAELIRRLQEYERFKAAAEGL-DELPRVGRDVTVPRLDA-------PEARARKLLPDVSLEELLLSMAEVLRRADMFESHQITREALS-----------TRERMSEVLERLKGGGFVPFVELFA----AEEGRLGVVVTFMAVLELIKESLVELVQN 261
>gi|118589118|ref|ZP_01546525.1| hypothetical protein SIAM614_13738 [Stappia aggregata IAM 12614] >gi|118438447|gb|EAV45081.1| hypothetical protein SIAM614_13738 [Stappia aggregata IAM 12614] (279 aa)
Score = 108, Expect = 2.6e-03, Identities = 28/122 (22%), Positives = 66/122 (54%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           + D+ G  F GP +L   L + +K+D+  I+++E+++ Y+ ++     +++++   +YL+MA +L   KSK +LP    +++ + +        RL   +  +E+  KL+ +  +   +F +
  S:    36 VVDVEG--FEGPLDLLLGLARTQKVDLARISILELVEQYLSFVAE-ARRMRLELAADYLVMAAWLAFLKSKLLLPEQKNDDEPTGEELAAALAFRLRRLEAMREVSEKLLMRNRQGRDVFHR 154
>gi|39935916|ref|NP_948192.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris CGA009] >gi|167365279|ref|ZP_02299423.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris TIE-1] >gi|192291564|ref|YP_001992169.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris TIE-1] >gi|39649770|emb|CAE28292.1| DUF173 [Rhodopseudomonas palustris CGA009] >gi|192285313|gb|ACF01694.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris TIE-1] (277 aa)
Score = 108, Expect = 2.6e-03, Identities = 57/243 (23%), Positives = 113/243 (46%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYK-ISFMDYF--KNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQN 271
           D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP    +E  S +   +    RL   +  +E   +LM + +    +F +    G+ +E  + E +   +   +  D++     +   +++TT         V L   +  S+     E R  LE    L +  S +D +  + +PD          +F A L LVR G ++L Q+
  S:    27 DVEGYE--GPLDLLLTLARQQKVDLHKISILALADQYLLFIEE-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPAQEGPSAEDMANALANRLRRLEAIREAANRLMTRAQLNRDIFPR----GQVEE--IAEIKHPKFTATL-YDLLSAYASQRQSRVLTT---------VHLAKRTVWSL----SEARASLERLVGLAEDWSRLDEYLLRYMPDPTQRATVLASSFAAALELVREGEVELHQS 249
>gi|89054001|ref|YP_509452.1| condensin subunit ScpA [Jannaschia sp. CCS1] >gi|88863550|gb|ABD54427.1| condensin subunit ScpA [Jannaschia sp. CCS1] (270 aa)
Score = 108, Expect = 2.6e-03, Identities = 27/81 (33%), Positives = 48/81 (59%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           I D+ G  F GP +L  +L + +K+D+  I+++ + + Y+ +I     +L+I+   +YL+MA +L   KSK +LP    EE
  S:    32 IIDVDG--FEGPLDLLLTLSRTQKVDLRRISILALTEQYLVFIEK-ARQLRIELAADYLVMAAWLAFLKSKLLLPPEPGEE 109
>gi|114762849|ref|ZP_01442281.1| segregation and condensation protein A [Roseovarius sp. HTCC2601] >gi|114544459|gb|EAU47466.1| segregation and condensation protein A [Roseovarius sp. HTCC2601] (268 aa)
Score = 108, Expect = 2.7e-03, Identities = 26/81 (32%), Positives = 50/81 (61%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           I D+ G  F GP +L  +L + +K+D+  I+++E+ + Y+ +++     L+I+   +YL+MA +L   KS+ +LP   TE+
  S:    25 IVDVDG--FEGPLDLLLTLSRTQKVDLRKISVLELARQYLAFVDR-AKALRIELAADYLVMAAWLAFLKSRLLLPPDPTED 102
>gi|114566942|ref|YP_754096.1| segregation and condensation protein A [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337877|gb|ABI68725.1| condensin subunit ScpA [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (237 aa)
Score = 108, Expect = 2.8e-03, Identities = 32/104 (30%), Positives = 62/104 (59%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLM 136
           + F+GP +L   L+ E +++I +I +  +   Y++Y+     +L ++ + ++L+MATYLL  KS+ +LPS     +      R + +QRLL YK+Y+++   L+
  S:     8 ESFHGPLDLLLYLLDEEQLEIYDIPIATITDQYMEYLQQ-TGELNLEQMGDFLIMATYLLNLKSRMLLPSRVELTEEEDSDPRAELVQRLLDYKKYKKLAEYLL 110
>gi|116625542|ref|YP_827698.1| condensin subunit ScpA [Solibacter usitatus Ellin6076] >gi|116228704|gb|ABJ87413.1| condensin subunit ScpA [Solibacter usitatus Ellin6076] (263 aa)
Score = 108, Expect = 3.2e-03, Identities = 55/246 (22%), Positives = 126/246 (51%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL---PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRN-----------GHIQLEQNSSDENIF 278
           ++++GP +L   LI+++++DI +I +  +   Y++Y++    ++ ID   E++ MA  L+  KSK +L   P++  E +  +D  R + + RLL +++++     L +K     RM E+   S    ++ + E  D        L + L  + K + +++   K +     +  ++ +++++ D+ + +R+          +  M  F    + + T+R  +  F+ +L +VR            G I L+++SS + +F
  S:    11 EQYDGPLDLLLDLIRKQQIDIKDIPIATITSQYLEYMDK-AREMDIDLGAEFVYMAATLIHIKSKMLLPRDPALAPEGETPED-PRQELVDRLLEHERFKNAAEMLQQK-----RMIEENVWSNPQIKAFISEDDDPG------LAITLFDLVKAFGEMLERVKNRP----IYEVESADVTVSDMIRYLRDQFREVGEDQPVFIMRIF----EMQRTRRAMIALFLGVLEMVRMQAVIVTQKDLFGEIALKRHSSFDAVF 249
>gi|163703055|ref|ZP_02121890.1| chromosome segregation and condensation protein ScpA [Methylobacterium nodulans ORS 2060] >gi|162430740|gb|EDQ41349.1| chromosome segregation and condensation protein ScpA [Methylobacterium nodulans ORS 2060] (260 aa)
Score = 107, Expect = 3.6e-03, Identities = 22/76 (28%), Positives = 47/76 (61%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS 102
           + D+ G  F GP +L   L + +K+D+  I+++ +++ Y+ +I     +L+++   +YL+MA +L   KS+ +LP+
  S:    21 VVDVDG--FEGPLDLLLELARRQKVDLSRISILALVEQYLAFIEE-ARRLRLELAADYLVMAAWLAYLKSRLLLPA 93
>gi|154248330|ref|YP_001419288.1| chromosome segregation and condensation protein ScpA [Xanthobacter autotrophicus Py2] >gi|154162415|gb|ABS69631.1| chromosome segregation and condensation protein ScpA [Xanthobacter autotrophicus Py2] (282 aa)
Score = 107, Expect = 3.8e-03, Identities = 29/128 (22%), Positives = 65/128 (50%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDK 156
           D+ G  F GP +L  +L + +K+D+  I+++ +   Y+ +I     + +++   +YL+MA +L   KS+ +LP+   E+  S +     + +RL   ++ ++   +LM + +     F +      D+
  S:    28 DVDG--FEGPLDLLLALARTQKVDLTRISILALADQYLTFIEE-ARRGRLELAADYLVMAAWLAYLKSRLLLPAPPQEDGPSAEELAAAFTRRLRHLERIRKAAQELMARPQMGRDSFPRAVPPSSDQ 152
>gi|32476123|ref|NP_869117.1| hypothetical protein RB9874 [Rhodopirellula baltica SH 1] >gi|32446667|emb|CAD76503.1| conserved hypothetical protein [Rhodopirellula baltica SH 1] (267 aa)
Score = 107, Expect = 3.8e-03, Identities = 32/130 (24%), Positives = 72/130 (55%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERD-KYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK-----PTQSGEDKESLLKEFQ 164
           + GP +L   L++ +++ +  ++L +V+  YV +++  L +L + ++ ++L +A  L+E KS+ +LP ++ E +     +     ++RLL YK+ ++    L E   R    FE+     PT+  +  +  + E +
  S:    10 YRGPIDLLLYLVRRQELSLTEMSLAKVVDQYVAHLD-VLQELDLGEVGDFLELAATLVEMKSQAVLPKIEDETEEETVEDTHEALVERLLQYKEIRDAAAVLDEMSARWQTRFERVADDLPTRRNDPADQPIVELE 144
>gi|126729736|ref|ZP_01745549.1| segregation and condensation protein A [Sagittula stellata E-37] >gi|126709855|gb|EBA08908.1| segregation and condensation protein A [Sagittula stellata E-37] (264 aa)
Score = 106, Expect = 4.5e-03, Identities = 33/120 (27%), Positives = 65/120 (54%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMF 146
           + D+ G  F GP +L  ++ + +K+D+  I+++++ + Y+ ++      L+I+   +YL+MA +L   KS+ +LP   TEE  S +        +L   +  +E+  KLM + +R  R F
  S:    24 VVDVEG--FEGPLDLLLNMARTQKVDLRQISVLDLARQYLVFVEK-AKALRIELAADYLVMAAWLAFLKSRLLLPPDPTEEGPSGEDLAAHLAFQLERLQAMREVAAKLMAR-DRLGRDF 139
>gi|90424011|ref|YP_532381.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris BisB18] >gi|90106025|gb|ABD88062.1| condensin subunit ScpA [Rhodopseudomonas palustris BisB18] (278 aa)
Score = 106, Expect = 4.5e-03, Identities = 56/245 (22%), Positives = 111/245 (45%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAM-DLDVILKA--MQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP   T +  S +        RL   +  +E   +LM + + +  +F +    G      + E +   +   + DL     A   Q V  K+   ++T       +      + I D   ++ ++L           ++Y  + P +K T   F  +F A L LVR G ++L Q+ +
  S:    29 DVEGYE--GPLDLLLALARQQKVDLHKISILALADQYLVFIEA-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPTPDGPSAEDMATALANRLRRLEAIREASNRLMTRPQLQRDIFPRGLPEG------IAEIKHPRFTATLYDLLSAYAAQRQQSVIAKVHLARRTVWSLAEARASLERLVGIADEWAKLDDYL-----------IEYVID-PSQKAT--VFASSFAAALELVREGKLELHQSEA 253
>gi|115524700|ref|YP_781611.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris BisA53] >gi|115518647|gb|ABJ06631.1| condensin subunit ScpA [Rhodopseudomonas palustris BisA53] (279 aa)
Score = 106, Expect = 4.5e-03, Identities = 56/245 (22%), Positives = 107/245 (43%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK--PTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKI-SFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP   + E  S +        RL   +  +E   +LM + +    +F +  P    E K      F    Y    DL           L     ++ ++    V L   +  S+ +    I   +       ++ S++  +   P +K T   F  +F A L LVR G ++L Q+ +
  S:    30 DVEGYE--GPLDLLLALARQQKVDLHKISILALADQYLVFIEA-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPSAEGPSAEEMATALANRLRQLEAIREAANRLMTRPQLARDIFARGAPENIAEIKHP---RFTATLY----DL-----------LSAYAVQRQRTVIAKVHLARRTVWSLAEARASIERLIGGAEDWSRLDSYLLEYVVDPSQKAT--VFASSFAAALELVREGQLELHQSEA 254
>gi|71083665|ref|YP_266385.1| segregation and condensation protein a [Candidatus Pelagibacter ubique HTCC1062] >gi|71062778|gb|AAZ21781.1| segregation and condensation protein a [Candidatus Pelagibacter ubique HTCC1062] (246 aa)
Score = 106, Expect = 4.6e-03, Identities = 30/73 (41%), Positives = 45/73 (61%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTK---LKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           +NGP ++   L K +K+++ NI+    I L  D  +NY+T    L ++  +EYLLMAT+L   KSK +LP    EE
  S:    16 YNGPLDVLLDLAKAQKVNLENIS----ITLLADQFHNYITNEKNLNLESASEYLLMATWLTYLKSKLLLPGNPEEE 87
>gi|86749864|ref|YP_486360.1| chromosome segregation and condensation protein ScpA [Rhodopseudomonas palustris HaA2] >gi|86572892|gb|ABD07449.1| condensin subunit ScpA [Rhodopseudomonas palustris HaA2] (276 aa)
Score = 106, Expect = 4.8e-03, Identities = 30/120 (25%), Positives = 62/120 (51%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEK 148
           D+ G E  GP +L  +L +++K+D+  I+++ +   Y+ +I     K++++   +YL+MA +L   KS+ +LP     E  S +        RL   +  +E   +LM + + +  +F +
  S:    26 DVEGYE--GPLDLLLTLARQQKVDLHKISILALADQYLLFIEE-ARKIRLELAADYLVMAAWLAFLKSRLLLPEPPAAEGPSAEDMATALANRLRRLEAIREAANRLMTRPQLQREIFPR 142
>gi|167772314|ref|ZP_02444367.1| hypothetical protein ANACOL_03691 [Anaerotruncus colihominis DSM 17241] >gi|167665417|gb|EDS09547.1| hypothetical protein ANACOL_03691 [Anaerotruncus colihominis DSM 17241] (242 aa)
Score = 106, Expect = 5.0e-03, Identities = 32/102 (31%), Positives = 58/102 (56%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDL---TEYLLMATYLLEQKSKRILPSMDTEE-KISKDIERDKYIQRLLVYKQYQEIVPKL 135
           EF GP +L   LI++ K+DI +I +  +++ Y+ YI+     +  DDL   +E+L MA  L+  K+  +LP  + E  K+  +++      +LL Y+  Q +  +L
  S:    10 EFEGPLDLLLYLIQKHKLDICDIEISALLEQYLAYID----AMGQDDLEIASEFLEMAARLVYIKTAMLLPRHEEEGVKLKAELQ-----GQLLEYQVCQRVAAQL 106
>gi|83590208|ref|YP_430217.1| condensin subunit ScpA [Moorella thermoacetica ATCC 39073] >gi|83573122|gb|ABC19674.1| condensin subunit ScpA [Moorella thermoacetica ATCC 39073] (248 aa)
Score = 106, Expect = 5.1e-03, Identities = 59/243 (24%), Positives = 111/243 (45%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL--PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENI 277
           F GP +L  +LI+ +++D+  I + EV   Y++Y+   + +L ++  +E+L++   LL  K++ +L  P+   +E+  +D  R     RL  Y+ Y+E    L E     + +F +P +  E  E  L      + V  +DL    +AM +V  +    ++ + P    +LI     ++     ++R  L        +S        P    T+    + F+A+L L R G + L Q  +  NI
  S:    10 FQGPLDLLLTLIERQEIDVQAIPVAEVTAQYLEYLQE-VEELDLEWASEFLVLGAELLALKARLLLQRPAAGEQEEEGEDPAR-ALADRLQAYRCYKEAAQHLAELAATGALIFTRP-RDQEAVERALAGINPLAGVTPLDL---ARAMARVLARKEQVQEPEEP----RLIPRLAFTL---AGQVRHILRSLYRAKTLSLDRLLSTRP----TRMEVALTFLALLELARRGRVALAQEVNFGNI 237
>gi|160931614|ref|ZP_02079009.1| hypothetical protein CLOLEP_00446 [Clostridium leptum DSM 753] >gi|156869485|gb|EDO62857.1| hypothetical protein CLOLEP_00446 [Clostridium leptum DSM 753] (246 aa)
Score = 105, Expect = 5.9e-03, Identities = 57/239 (23%), Positives = 105/239 (43%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           F GP +L   LI + K++I +I + E++  Y++ I   + +  +D  +E+L MA  L+  KS  +LP  +  E + +D+       +LL Y++ + I   L ++ E     F    +  E  E       D++Y      + ++ A Q          K K P        +    I  V  +I   L     L+K   ++Y +   D +  K   V  F+A+L LV+   +++E+ S+
  S:    11 FEGPLDLLLHLITKNKLNIYDIPIAELLDQYMEQIRA-MQEEDLDIASEFLEMAARLVHLKSVSLLPKHEEAEALKQDL-----TGQLLEYQECKRIAAVLAQRAE-----FNTFVRQPEAVEF------DSAYQRKHHPEEVMAAYQNA----AGRGKRKLPPPPEAFSGIVTHRIVSVSSKIIHVLRC---LWKKHEVEYDRVFEDSR-EKSELVATFLAVLELVKGKRVRIEEEST 224
>gi|89068219|ref|ZP_01155629.1| hypothetical protein OG2516_02119 [Oceanicola granulosus HTCC2516] >gi|89046136|gb|EAR52194.1| hypothetical protein OG2516_02119 [Oceanicola granulosus HTCC2516] (258 aa)
Score = 105, Expect = 5.9e-03, Identities = 26/81 (32%), Positives = 49/81 (60%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           I D+ G E  GP +L  +L + +K+D+  I+++ + + Y+ ++     +L+I+   +YL+MA +L   KS+ +LP   TEE
  S:    20 IVDVDGYE--GPLDLLLNLSRTQKVDLREISILALAEQYLSFVER-AKELRIELAADYLVMAAWLAFLKSRLLLPPDPTEE 97
>gi|196233001|ref|ZP_03131850.1| chromosome segregation and condensation protein ScpA [Chthoniobacter flavus Ellin428] >gi|196222979|gb|EDY17500.1| chromosome segregation and condensation protein ScpA [Chthoniobacter flavus Ellin428] (240 aa)
Score = 105, Expect = 6.1e-03, Identities = 32/120 (26%), Positives = 71/120 (59%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGE 154
           F GP +L   LIK+ ++DI +I+L  +   Y+++++ +   L ++   E+++MA  L+  KS+ +LP+     +E+  ++  R   I++L+ YK++++   +L ++   +S +F +   S E
  S:    12 FEGPLDLLLYLIKKDEVDIYDISLERITAQYLEFMDAFKV-LDLELAGEFVVMAANLIYLKSRALLPASVQPPDEEAEEEDPRWDLIRQLIEYKKFKDAAAQLSQRELEQSNLFARLPDSPE 132
>gi|119469321|ref|ZP_01612260.1| hypothetical protein ATW7_07709 [Alteromonadales bacterium TW-7] >gi|119447185|gb|EAW28454.1| hypothetical protein ATW7_07709 [Alteromonadales bacterium TW-7] (274 aa)
Score = 105, Expect = 6.9e-03, Identities = 31/101 (30%), Positives = 59/101 (58%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   LIK+ K+D+L +++  + + YV Y+   +++ +++   EYL+MA  L + KS+ +LP  +  E+      R + I+RL  Y+Q+++    L
  S:    50 FEGPLDLLLYLIKKHKLDVLELSIFSITEQYVSYV-EMMSEFQLELAGEYLVMAALLAQIKSRLLLPVHEELEEEED--PRAELIKRLQEYEQFKKAAENL 147
>gi|85703267|ref|ZP_01034371.1| segregation and condensation protein A [Roseovarius sp. 217] >gi|85672195|gb|EAQ27052.1| segregation and condensation protein A [Roseovarius sp. 217] (262 aa)
Score = 105, Expect = 7.1e-03, Identities = 25/81 (30%), Positives = 49/81 (60%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           I D+ G  F GP +L  +L + +K+D+  I+++E+ + Y+ ++      L+++   +YL+MA +L   KS+ +LP   TE+
  S:    25 IVDVDG--FEGPLDLLLTLSRTQKVDLRKISVLELARQYLAFVEQ-AKALRLELAADYLVMAAWLAFLKSRLLLPPDPTED 102
>gi|93006575|ref|YP_581012.1| chromosome segregation and condensation protein ScpA [Psychrobacter cryohalolentis K5] >gi|92394253|gb|ABE75528.1| condensin subunit ScpA [Psychrobacter cryohalolentis K5] (288 aa)
Score = 105, Expect = 7.2e-03, Identities = 60/245 (24%), Positives = 113/245 (46%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLERRS--RMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSP-KDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENI 277
           ++F GP +    L+K+  +D+  + ++ + + Y+ YI+   T    +   +YLLMA+ L+  K++ +LP    E+   +   + + I+RL  Y Q +    +L  + +LER     M   P+Q   + E         SY P + +D + K   +   ++ + K    P  D +  I   ++S+D      R F E                + D+   K   VV+FVA+L L++   I +  NS+D ++
  S:    44 EQFAGPLDFLLYLVKKNNVDLTRMPILPITEQYLAYISELDTN-HFELAGDYLLMASTLIAIKTELLLPK--PEKPTDERDPKAELIERLEEYAQVKAASQRLDNLIRLERDVFLAMVSMPSQDIMNAEL-------PSYSPTLLIDSLFKMQLQPDYQMHSIKVDAVPLADRIASIS-RQLSMDGA----RSFYE----------------LLDKTQGKIGVVVSFVAVLELIKRQLIGVVANSTDNHV 262
>gi|157364369|ref|YP_001471136.1| chromosome segregation and condensation protein ScpA [Thermotoga lettingae TMO] >gi|157314973|gb|ABV34072.1| chromosome segregation and condensation protein ScpA [Thermotoga lettingae TMO] (222 aa)
Score = 104, Expect = 7.8e-03, Identities = 29/108 (26%), Positives = 68/108 (62%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE-KISKDIERDKYIQRLLVYKQYQEIVPKLMEKLE 140
           +EF GP +L   L++ RK+++  I++ ++   +++++   + KL ++  +++L  AT L+E K++ ++P++  +E K  K  E D Y +RL +Y+Q +++   L  +++
  S:     2 QEFEGPLDLLLYLVRRRKINVREISISQLADEFIEHVEQ-MKKLDLNITSDFLTTATQLMEIKARYMIPALSEKEVKELKKREEDIY-RRLELYEQIKQLSEDLQNRVK 108
>gi|148653751|ref|YP_001280844.1| chromosome segregation and condensation protein ScpA [Psychrobacter sp. PRwf-1] >gi|148572835|gb|ABQ94894.1| condensin subunit ScpA [Psychrobacter sp. PRwf-1] (315 aa)
Score = 104, Expect = 8.5e-03, Identities = 59/240 (24%), Positives = 110/240 (45%)
  Q:    34 EFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERD---KYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDD----VEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSS 273
           +F GP +    L+K+   DI +  ++ + + Y+ YI+  L     +   +YLLMA+ L+  K++ +LP+ +  E      ERD   + I RL  Y Q +E   +L + L R  R       S  D E +  +      +P+   +++++++ K+ LK         P   +  I V  I + D    + +++ E  E             F  + D+   +   VV+FVA+L L++   I + +  S
  S:    52 QFEGPLDFLLYLVKKNNFDITDTAILPITEQYLAYIDE-LDADHFELAGDYLLMASTLIAIKTELLLPAPEKLED-----ERDPKAELISRLEDYAQIKEAARRL-DNLIRLERDVFLAMASLPDPEVMAAQ------LPSYPAEILVESLLKMQLK---------PDYQMHSIKVDPIPLSDRIASISRQLSERGE-----------GAFIELLDQSQGRLGVVVSFVAVLELMKRQIIDVIETDS 265
>gi|163793128|ref|ZP_02187104.1| hypothetical protein BAL199_25104 [alpha proteobacterium BAL199] >gi|159181774|gb|EDP66286.1| hypothetical protein BAL199_25104 [alpha proteobacterium BAL199] (266 aa)
Score = 104, Expect = 8.5e-03, Identities = 22/74 (29%), Positives = 46/74 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEK 108
           F GP ++  +L +++K+D+  I+++++ + Y+ +I      L ++   +YL+MA +L   KS+ +LP   TEE+
  S:    31 FEGPIDVLLTLARDQKVDLTQISILQLAEQYIVFIREAQV-LNLELAADYLVMAAWLAYLKSRLLLPVDATEEE 103
>gi|104773904|ref|YP_618884.1| hypothetical protein Ldb0845 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422985|emb|CAI97667.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (244 aa)
Score = 104, Expect = 9.2e-03, Identities = 32/97 (32%), Positives = 60/97 (61%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMD---TEEKISKDIERDKYIQRLLVYKQYQEI 131
           F GP +L   LI+ +++DI +I +  + Q Y+DY+   + +L +  + EY +MA  LL  KS+ +LP  D   TEE+ +    R++ +++L+ Y  +++I
  S:    13 FEGPLDLLLHLIRLQELDIYDIPIARITQQYLDYLQQ-MQRLNLQLVGEYFVMAATLLRIKSQYLLPKNDFVETEEEFAD--PREELVEQLVQYSVFKKI 109
>gi|84500946|ref|ZP_00999181.1| segregation and condensation protein A [Oceanicola batsensis HTCC2597] >gi|84391013|gb|EAQ03431.1| segregation and condensation protein A [Oceanicola batsensis HTCC2597] (264 aa)
Score = 103, Expect = 9.6e-03, Identities = 25/81 (30%), Positives = 50/81 (61%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           + D+ G  F GP +L  +L + +K+D+L I+++++ + Y+ ++     +L+I+   +YL+MA +L   KS+ +LP    EE
  S:    23 VVDVDG--FEGPLDLLLNLARTQKVDLLRISVLQLARQYLFFVEK-AKELRIELAADYLVMAAWLAFLKSRLLLPPDPEEE 100
>gi|148273160|ref|YP_001222721.1| hypothetical protein CMM_1979 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831090|emb|CAN02035.1| conserved hypothetical protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (265 aa)
Score = 103, Expect = 9.7e-03, Identities = 35/121 (28%), Positives = 60/121 (49%)
  Q:    23 FHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRS 143
           F +SI +     F GPF+L  SLI   +MDI  ++L  V   ++ +I        +D+ + +L++A  LL+ K   +LP   +   E ++    RD    RLL Y+ +++      E+L   S
  S:     9 FRVSIGN-----FEGPFDLLLSLIGSHEMDITEVSLSLVTNEFIAHIRGLDGPEDLDEASSFLVVAATLLDLKLVGLLPQGELVDAEDVALLEARDLLFARLLQYRAFKQAASWFQERLAAES 126
>gi|103486629|ref|YP_616190.1| chromosome segregation and condensation protein ScpA [Sphingopyxis alaskensis RB2256] >gi|98976706|gb|ABF52857.1| condensin subunit ScpA [Sphingopyxis alaskensis RB2256] (270 aa)
Score = 103, Expect = 9.8e-03, Identities = 22/75 (29%), Positives = 45/75 (60%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           + + GP +L  +L + +K+D+  I+++ +++ Y+ +I     +LK++   +YL+MA +L   KS  +LP    EE
  S:    36 ESWEGPLDLLLALARNQKVDLREISILALVEQYLHFIAE-ARELKLEVAADYLVMAAWLAYLKSALLLPKDPLEE 109
>gi|193076587|gb|ABO11250.2| hypothetical protein A1S_0812 [Acinetobacter baumannii ATCC 17978] (255 aa)
Score = 103, Expect = 9.9e-03, Identities = 29/107 (27%), Positives = 59/107 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           +I  ++F GP +    LI++   D++ +++  +   Y+ Y+++ +  L I+   +Y++MA  L + KS+ +LP   T   I KD ++D  I RL  Y + ++   +L
  S:    29 EILLEQFEGPLDFLIYLIQKNGFDLIQLDIAPIATQYLTYMDS-MKSLNIELTADYMVMAALLADLKSRLLLPK-PTVVSIEKDPKQD-LIDRLETYLRIKQAAERL 132
>gi|184157090|ref|YP_001845429.1| hypothetical protein ACICU_00770 [Acinetobacter baumannii ACICU] >gi|183208684|gb|ACC56082.1| uncharacterized conserved protein [Acinetobacter baumannii ACICU] (255 aa)
Score = 103, Expect = 1.1e-02, Identities = 29/107 (27%), Positives = 59/107 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           +I  ++F GP +    LI++   D++ +++  +   Y+ Y+++ +  L I+   +Y++MA  L + KS+ +LP   T   I KD ++D  I RL  Y + ++   +L
  S:    29 EILLEQFEGPLDFLIYLIQKNGFDLIQLDIAPIATQYLAYMDS-MKSLNIELTADYMVMAALLADLKSRLLLPK-PTVVSIEKDPKQD-LIDRLETYLRIKQAAERL 132
>gi|169796997|ref|YP_001714790.1| hypothetical protein ABAYE2998 [Acinetobacter baumannii AYE] >gi|169149924|emb|CAM87818.1| conserved hypothetical protein [Acinetobacter baumannii] (263 aa)
Score = 103, Expect = 1.1e-02, Identities = 29/107 (27%), Positives = 59/107 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           +I  ++F GP +    LI++   D++ +++  +   Y+ Y+++ +  L I+   +Y++MA  L + KS+ +LP   T   I KD ++D  I RL  Y + ++   +L
  S:    37 EILLEQFEGPLDFLIYLIQKNGFDLIQLDIAPIATQYLAYMDS-MKSLNIELTADYMVMAALLADLKSRLLLPK-PTVVSIEKDPKQD-LIDRLETYLRIKQAAERL 140
>gi|169634120|ref|YP_001707856.1| hypothetical protein ABSDF2647 [Acinetobacter baumannii SDF] >gi|169152912|emb|CAP01953.1| conserved hypothetical protein [Acinetobacter baumannii] (263 aa)
Score = 103, Expect = 1.1e-02, Identities = 29/107 (27%), Positives = 59/107 (55%)
  Q:    29 DITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           +I  ++F GP +    LI++   D++ +++  +   Y+ Y+++ +  L I+   +Y++MA  L + KS+ +LP   T   I KD ++D  I RL  Y + ++   +L
  S:    37 EILLEQFEGPLDFLIYLIQKNGFDLIQLDIAPIATQYLAYMDS-MKSLNIELTADYMVMAALLADLKSRLLLPK-PTVVSIEKDPKQD-LIDRLETYLRIKQAAERL 140
>gi|154497952|ref|ZP_02036330.1| hypothetical protein BACCAP_01932 [Bacteroides capillosus ATCC 29799] >gi|150272942|gb|EDN00099.1| hypothetical protein BACCAP_01932 [Bacteroides capillosus ATCC 29799] (268 aa)
Score = 103, Expect = 1.2e-02, Identities = 29/119 (24%), Positives = 65/119 (54%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTE--EKISKDIERDKYIQRLLVYKQYQEIVPKLMEKLERRSRMFEKPTQ 151
           ++F GP +L  SL+ + KM+I +I +  ++  Y+D++N    ++ ++  +E++ MA  L+  K++ +L   D E   ++ + I   +  QR   + + + ++P L ++ E       KP +
  S:    23 EDFTGPLDLILSLLAKNKMEIKDIQIAVILDQYMDWMNKR-KEMDLEVASEFVAMAAQLVFIKTRMLLSIHDEEALSEMEQLIASLEEHQRHESFNRIKAVIPTLADRNEVGRDYITKPPE 142
>gi|154253465|ref|YP_001414289.1| chromosome segregation and condensation protein ScpA [Parvibaculum lavamentivorans DS-1] >gi|154157415|gb|ABS64632.1| chromosome segregation and condensation protein ScpA [Parvibaculum lavamentivorans DS-1] (352 aa)
Score = 102, Expect = 1.3e-02, Identities = 22/71 (30%), Positives = 46/71 (64%)
  Q:    27 IKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSK 97
           I D+ G  F GP ++  +L + +K+D+  I+++++ + Y+D+I     ++++D   +YL+MA++L   KSK
  S:    96 IVDLDG--FEGPLDVLLALARNQKVDLTRISILKLAEQYLDFITQ-ARRVELDLAADYLVMASWLAYLKSK 163
>gi|148259963|ref|YP_001234090.1| chromosome segregation and condensation protein ScpA [Acidiphilium cryptum JF-5] >gi|146401644|gb|ABQ30171.1| condensin subunit ScpA [Acidiphilium cryptum JF-5] (264 aa)
Score = 102, Expect = 1.4e-02, Identities = 21/79 (26%), Positives = 50/79 (63%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDT---EEKISKDI 113
           F GP +L   L + +K+D+ N++++ +++ Y+  +     +++++   ++L+MA +L   KS+ +LP  +T   E +I+ D+
  S:    23 FEGPLDLLLELARSQKVDLANVSILALVEQYLAIVEG-ARRVRLELAADWLVMAAWLAWLKSRLLLPEDETAAEEGEIAADV 103
>gi|91763294|ref|ZP_01265258.1| segregation and condensation protein a [Candidatus Pelagibacter ubique HTCC1002] >gi|91717707|gb|EAS84358.1| segregation and condensation protein a [Candidatus Pelagibacter ubique HTCC1002] (246 aa)
Score = 102, Expect = 1.4e-02, Identities = 29/73 (39%), Positives = 45/73 (61%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTK---LKIDDLTEYLLMATYLLEQKSKRILPSMDTEE 107
           +NGP ++   L K +K+++ +I+    I L  D  +NY+T    L ++  +EYLLMAT+L   KSK +LP    EE
  S:    16 YNGPLDVLLDLAKAQKVNLEDIS----ITLLADQFHNYITNEKNLNLESASEYLLMATWLTYLKSKLLLPGNPEEE 87
>gi|148269567|ref|YP_001244027.1| chromosome segregation and condensation protein ScpA [Thermotoga petrophila RKU-1] >gi|170288243|ref|YP_001738481.1| chromosome segregation and condensation protein ScpA [Thermotoga sp. RQ2] >gi|147735111|gb|ABQ46451.1| condensin subunit ScpA [Thermotoga petrophila RKU-1] >gi|170175746|gb|ACB08798.1| chromosome segregation and condensation protein ScpA [Thermotoga sp. RQ2] (229 aa)
Score = 102, Expect = 1.5e-02, Identities = 30/101 (29%), Positives = 63/101 (62%)
  Q:    35 FNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL 135
           F GP +L   L++++K+DI  I + ++   +V+Y+   + KL +   +++L MA+ L+E KSK ++P +  EEK   D ++++  +R+  Y + +EI+ ++
  S:    10 FEGPLDLLLYLVRKKKVDIREIPIAQLADEFVEYLEQ-MKKLDMKVTSDFLEMASTLMELKSKMLIPRVREEEKEEVDRKKEELYRRIEEYSKVKEIIQRI 109
>gi|170781659|ref|YP_001709991.1| hypothetical protein CMS_1253 [Clavibacter michiganensis subsp. sepedonicus] >gi|169156227|emb|CAQ01369.1| conserved hypothetical protein [Clavibacter michiganensis subsp. sepedonicus] (288 aa)
Score = 102, Expect = 1.5e-02, Identities = 34/117 (29%), Positives = 59/117 (50%)
  Q:    23 FHISIKDITGKEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRILPS--MDTEEKISKDIERDKYIQRLLVYKQYQEIVPKLMEKL 139
           F +SI +     F GPF+L  SLI   +MDI  ++L  V   ++ +I        +D+ + +L++A  LL+ K   +LP   +   E ++    RD    RLL Y+ +++      E+L
  S:    32 FRVSIGN-----FEGPFDLLLSLIGRHEMDITEVSLSLVTNEFIAHIRGLDGPEDLDEASSFLVVAATLLDLKLVGLLPQGELVDAEDVALLEARDLLFARLLQYRAFKQAASWFQERL 145
>gi|71066124|ref|YP_264851.1| condensin subunit ScpA [Psychrobacter arcticus 273-4] >gi|71039109|gb|AAZ19417.1| condensin subunit ScpA [Psychrobacter arcticus 273-4] (288 aa)
Score = 101, Expect = 1.8e-02, Identities = 59/245 (24%), Positives = 109/245 (44%)
  Q:    33 KEFNGPFELFYSLIKERKMDILNINLVEVIQLYVDYINNYLTKLKIDDLTEYLLMATYLLEQKSKRIL--PSMDTEEKISKDIERDKYIQRLLVYKQYQEIVPKL--MEKLERRS--RMFEKPTQSGEDKESLLKEFQDNSYVPAMDLDVILKAMQKVYLKLVTTKKTKSPKDNVKLIDVSEISIDDVEKEIREFLEPFPHLYKISFMDYFKNIPDEKFTKRYFVVAFVAILVLVRNGHIQLEQNSSDENI 277
           ++F GP +    L+K+  +D+  + ++ + + Y+ YI+   T    +   +YLLMA+ L+  K++ +L  P M T+E+  K     + I+RL  Y Q +    +L  + +LER     M   P Q   + E         SY P + +D + K   +   ++ + K    P  + ++  +S     D  +   E L                   D+   K   VV+FVA+L L++   I +  N+ D  +
  S:    44 EQFAGPLDFLLYLVKKNNVDLTRMPILPITEQYLAYISKLDTN-HFELAGDYLLMASTLIAIKTELLLPMPEMPTDERDPK----AELIERLEEYTQVKAASQRLDNLIRLERDVFLAMVSMPNQDIMNSEL-------PSYSPTLLIDSLFKMQLQPDYQMHSIKVDAVPLAD-RIASISRQLSTDGARSFHELL-------------------DKAQGKIGVVVSFVAVLELIKRQLIGVVANNVDSGV 262