>gi|26553491|ref|NP_757425.1| segregation and condensation protein B [Mycoplasma penetrans HF-2] >gi|41018048|sp|Q8EX11|SCPB_MYCPE Segregation and condensation protein B >gi|26453497|dbj|BAC43829.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (197 aa)
Score = 952, Expect = 1.8e-101, Identities = 197/197 (100%), Positives = 197/197 (100%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE
  S:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
>gi|31544606|ref|NP_853184.1| hypothetical protein MGA_0035 [Mycoplasma gallisepticum R] >gi|41017914|sp|Q7NB77|SCPB_MYCGA Segregation and condensation protein B >gi|31541451|gb|AAP56752.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (291 aa)
Score = 348, Expect = 2.0e-31, Identities = 74/194 (38%), Positives = 126/194 (64%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKL-KSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGD 196
           ++ K++I+AAL++AG  G+   +L K + ++        +EEMI+ Y+++   GL ++  G  YK+ TK  + K +      + KNPLN+ ++E LAI+AYN PCTR +I+E+R  D   +++ L+E GL+ E GR++  G+P+LY V+ KF+D+FG++SI DLP+I    +  +  +Y+E  +FFD+NR D  +
  S:   102 LSAKAIIQAALYVAGRNGMTLQELNKILPKIHQDQLFKELEEMIYSYDQNLNFGLTIKNYGGRYKILTKAAVKKDMQRYVSERFKNPLNKSLMEVLAIVAYNQPCTRVRINEIRGVDSLSLVDNLLEKGLIVEVGRADTPGRPFLYNVSEKFFDLFGIESIDDLPQI----KHFDPDSYQEG-DFFDSNRYDENE 291
>gi|13508040|ref|NP_109989.1| segregation and condensation protein B [Mycoplasma pneumoniae M129] >gi|2496331|sp|P75477|SCPB_MYCPN Segregation and condensation protein B >gi|1674231|gb|AAB96183.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (208 aa)
Score = 304, Expect = 2.3e-26, Identities = 66/188 (35%), Positives = 117/188 (62%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISR-LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEE--EINFFDTNR 191
           N+ + I   LF++G +G+   +L  + R + ++  +A + ++  +   D + G+ ++K G +++L TK +I   +      K KNPLN   +E LAIIAYN PCTR +I+E+R  D   +++ L+E  L+ E GR +  G+P++Y+V+PKFYD+FG++S+ +LP       K+E    ++  + +FFD+NR
  S:    21 NLVAAIYGLLFVSGEKGLTLAELNRVLRKVGLEKIKAALVQLERKLSLDDESGIEIKKFGHSFRLVTKMEIKDFIHRYLPNKIKNPLNSKTMEVLAIIAYNQPCTRPRINEIRGADSFQIVDDLLEKELIVELGRKDTPGRPFIYEVSPKFYDLFGINSLDELP-------KVENFDLDKFRQGSFFDSNR 204
>gi|13357906|ref|NP_078180.1| hypothetical protein UU346 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762299|ref|YP_001752429.1| segregation and condensation protein B [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920365|ref|ZP_02931695.1| segregation and condensation protein B [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508676|ref|ZP_02958169.1| segregation and condensation protein B [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701632|ref|ZP_02971336.1| segregation and condensation protein B [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|41018151|sp|Q9PQE5|SCPB_UREPA Segregation and condensation protein B >gi|11356802|pir||G82903 conserved hypothetical UU346 [imported] - Ureaplasma urealyticum >gi|6899325|gb|AAF30755.1|AE002131_9 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827876|gb|ACA33138.1| segregation and condensation protein B [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902793|gb|EDT49082.1| segregation and condensation protein B [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675592|gb|EDT87497.1| segregation and condensation protein B [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700865|gb|EDU19147.1| segregation and condensation protein B [Ureaplasma parvum serovar 6 str. ATCC 27818] (364 aa)
Score = 295, Expect = 2.7e-25, Identities = 68/165 (41%), Positives = 107/165 (64%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLS-VQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFT----KPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           N+KS+I++ LF+AG EGV    LK  + L+     + ++ ++  +Y+ D   GLV+ + GE +KL T    K  +SK V + F    + PL+Q  +ETLAIIAYN P TR++I  +R  DP P ++ L+++ L+ EAGR +  G P LY V+ KFYD+FG+ ++ +LP +
  S:   185 NIKSIIDSTLFLAGEEGVSLQDLKRTTGLNESSQLKTILNQLQKDYDVD-DSGLVLVQFGEKFKLLTQSKNKDALSKFVTTSF----RTPLSQRNLETLAIIAYNQPTTRAKIQAIRDRDPKPAIDALLKLNLIIEAGRQDTPGHPILYTVSQKFYDLFGIRNLTELPRL 349
>gi|12045068|ref|NP_072879.1| segregation and condensation protein B [Mycoplasma genitalium G37] >gi|66880202|ref|ZP_00405186.1| COG1386: Predicted transcriptional regulator containing the HTH domain [Mycoplasma genitalium G-37] >gi|1351512|sp|P47456|SCPB_MYCGE Segregation and condensation protein B >gi|3844814|gb|AAC71433.1| segregation and condensation protein B [Mycoplasma genitalium G37] >gi|166078858|gb|ABY79476.1| segregation and condensation protein B [synthetic Mycoplasma genitalium JCVI-1.0] (207 aa)
Score = 293, Expect = 4.3e-25, Identities = 69/194 (35%), Positives = 114/194 (58%)
  Q:     4 NVKSVIEAALFIAGNEGVH-KDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE--EEINFFDTNREDNGDE 197
           N+ + I   LF+ G +G+  ++ ++   +  ++  +  +  +  +   D Q G+ ++K G ++ L TKP I   +      K KNPLN   +E LAIIAYN PCTR +I+E+R  D   +++ LI   L+ E GR++  G+P++Y+V+ KFYD+FG+DS+  LP       KIE    +  ++ +FFD+NR   GDE
  S:    20 NLVASIYGLLFVCGAKGITLRELIRIFKKAGIEKVKLALLALERKLADDEQSGVELKKFGNSFSLVTKPIIKDYLHLLLAHKVKNPLNSKAMEVLAIIAYNQPCTRPRINEIRGVDSFQIVDDLIAKELIVELGRTDKPGRPFIYEVSAKFYDLFGIDSLDQLP-------KIEHFDLDKFKQGSFFDSNRY--GDE 207
>gi|196252011|ref|ZP_03150675.1| segregation and condensation protein B [Clostridium thermocellum DSM 4150] >gi|196198600|gb|EDX93433.1| segregation and condensation protein B [Clostridium thermocellum DSM 4150] (213 aa)
Score = 290, Expect = 1.2e-24, Identities = 62/162 (38%), Positives = 100/162 (61%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++ + E  LF +G++ V  +KL SI+ +  +  + V+  MI +Y  DP RG+ +R++   Y+L +KP+    +   F  KQ++ L+Q  +ETLAIIAYN P T+++I ++R  +    + KL+E  L+ EAGR +A GKP LY+ T +F+  FG  S  DLP
  S:    21 LEGIFEGMLFASGDK-VSIEKLSSITGIDKKTVKLVINNMIVKYNNDPSRGITIREINNGYQLCSKPEYYDYIKQLFEPKQRSGLSQAALETLAIIAYNRPITKAKIEQIRGVNSDSAITKLLEKNLIREAGRLDAPGKPVLYETTDEFFRSFGFKSDADLP 181
>gi|125973206|ref|YP_001037116.1| condensin subunit ScpB [Clostridium thermocellum ATCC 27405] >gi|167016590|sp|A3DD94|SCPB_CLOTH Segregation and condensation protein B >gi|125713431|gb|ABN51923.1| condensin subunit ScpB [Clostridium thermocellum ATCC 27405] (198 aa)
Score = 287, Expect = 2.2e-24, Identities = 62/162 (38%), Positives = 100/162 (61%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++ + E  LF +G++ V  +KL SI+ +  +  + V+  MI +Y  DP RG+ +R++   Y+L +KP+    +   F  KQ++ L+Q  +ETLAIIAYN P T+++I ++R  +    + KL+E  L+ EAGR +A GKP LY+ T +F+  FG  S  DLP
  S:     6 LEGIFEGMLFASGDK-VSIEKLSSITGIDKKTVKLVINNMIVKYNNDPSRGITIREINNGYQLCSKPEYYDYIKQLFEPKQRSGLSQAALETLAIIAYNRPITKAKIEQIRGVNSDSAITKLLEKNLIREAGRLDAPGKPVLYETTDEFFRSFGFKSDADLP 166
>gi|194467809|ref|ZP_03073795.1| segregation and condensation protein B [Lactobacillus reuteri 100-23] >gi|194452662|gb|EDX41560.1| segregation and condensation protein B [Lactobacillus reuteri 100-23] (201 aa)
Score = 283, Expect = 6.9e-24, Identities = 60/174 (34%), Positives = 102/174 (58%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELT 179
           ++ IE  LF++G+EG+    L  IS        A+++E+  +YE DP    ++ +  + Y+L TKP +++++   F +    PL + ++E LAI+AY  P TR +I ++R    +  L+KL+  GLV+  GR +A G+P+LY  TP F + FGL  + +LP   LP+Q   E++
  S:     9 QAQIEGLLFVSGDEGITLGDLVKISGFMKPAVLAILQELKKKYEDDPTSAFILLESDQTYRLATKPQLAEVIKHYFEVPLTVPLTKALLEVLAIVAYRQPITRLEIDDIRGVQSSGSLQKLMVRGLVDTHGRLDAPGRPFLYSTTPAFLNYFGLSDLDELPP--LPDQDELEMS 180
>gi|118046023|ref|ZP_01514677.1| chromosome segregation and condensation protein ScpB [Chloroflexus aggregans DSM 9485] >gi|117997379|gb|EAV11566.1| chromosome segregation and condensation protein ScpB [Chloroflexus aggregans DSM 9485] (189 aa)
Score = 279, Expect = 2.1e-23, Identities = 64/164 (39%), Positives = 93/164 (56%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           IEA LF+AG E V  ++L  +  +S +  EA +EE+   Y    QRG+ +++ G+   L + P+ + ++    G +    L+   +ETLAIIAY  P TR+QI  +R  D +  L  L+   L+ E GR E +G+P LY  TP F   FGL S+ DLP I LPE
  S:    29 IEAVLFVAG-EPVTLEQLARVLEVSPEQIEAAIEELSASY---AQRGIRLQRHGDQLMLVSAPEAAPVIRRFLGSQNGQRLSHAALETLAIIAYRQPITRAQIEAIRGVDSSAALRALLARDLICEVGRLETLGRPILYATTPMFLQQFGLTSLADLPPIDLPE 188
>gi|148543987|ref|YP_001271357.1| condensin subunit ScpB [Lactobacillus reuteri F275] >gi|184153382|ref|YP_001841723.1| hypothetical protein LAR_0727 [Lactobacillus reuteri F275] >gi|148531021|gb|ABQ83020.1| condensin subunit ScpB [Lactobacillus reuteri F275] >gi|183224726|dbj|BAG25243.1| conserved hypothetical protein [Lactobacillus reuteri F275] (201 aa)
Score = 277, Expect = 3.3e-23, Identities = 60/174 (34%), Positives = 101/174 (58%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELT 179
           ++ IE  LFI+G+EG+    L  IS        A+++E+  +YE DP    ++ +  + Y+L TKP +++++   F +    PL + ++E LAI+AY  P TR +I ++R    +  L+KL+  GLV+   R +A G+P+LY  TP F + FGL  + +LP   LP+Q   E++
  S:     9 QAQIEGLLFISGDEGITLGDLAKISGFMKPAVLAILQELKKKYEDDPTSAFILLESDQTYRLATKPQLAEVIKHYFEVPLTVPLTKALLEVLAIVAYRQPITRLEIDDIRGVQSSGSLQKLMVRGLVDTHERLDAPGRPFLYSTTPAFLNYFGLSDLDELPP--LPDQDELEMS 180
>gi|23099282|ref|NP_692748.1| hypothetical protein OB1827 [Oceanobacillus iheyensis HTE831] >gi|41018044|sp|Q8EQ83|SCPB_OCEIH Segregation and condensation protein B >gi|22777511|dbj|BAC13783.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (192 aa)
Score = 270, Expect = 2.1e-22, Identities = 69/188 (36%), Positives = 105/188 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRED 193
           K VIE  LF +G+EGV   +L  I  + +   E ++EE+ FEYE++  RGL++ +    + L TKP+ S          + + ++Q  +ETLAIIAY  P TR++I E+R       ++ LI   L+EE GR + VG+P L+Q + +F   FGL ++ DLP   LPE  I+    E E + F    +D
  S:     7 KGVIEGLLFASGDEGVTAKQLSKILDIGLDTVEHILEELRFEYERE-DRGLMIIQSNNIFHLATKPEHSSYFKRLIDSPRTSKMSQAALETLAIIAYRQPITRAEIDEIRGVRSERPVQTLITRNLIEETGRKDTVGRPVLFQTSKEFLTFFGLATLDDLPP--LPEN-IDPDKEEREADLFFERFQD 190
>gi|89099067|ref|ZP_01171946.1| hypothetical protein B14911_08707 [Bacillus sp. NRRL B-14911] >gi|89086197|gb|EAR65319.1| hypothetical protein B14911_08707 [Bacillus sp. NRRL B-14911] (195 aa)
Score = 267, Expect = 4.3e-22, Identities = 67/190 (35%), Positives = 99/190 (52%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRE 192
           +N K + E+ LF AG+EG+   ++  +  +     E +++E+I   E D  RG+ V +    Y+L TK + S  +           L+Q  +ETLAIIAY  P TR +I E+R       L  L    L++EAGR+E  G+ YLY  T +F D FGL SI +LP   L E   +E   +E   FF+  +E
  S:     4 VNWKGITESLLFAAGDEGLSLKQIAEVLEMDESQAETILQELIQSCEDDYTRGITVAQFAGTYQLVTKKENSDYLKKLVETPGTGSLSQAALETLAIIAYKQPITRVEIEEIRGVKTERPLHTLAAKALIKEAGRAEGAGRAYLYATTKEFLDYFGLKSIDELPP--LTENDEDEYAGDEADLFFEKFQE 191
>gi|116618396|ref|YP_818767.1| condensin subunit ScpB [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122271404|sp|Q03WM8|SCPB_LEUMM Segregation and condensation protein B >gi|116097243|gb|ABJ62394.1| condensin subunit ScpB [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (199 aa)
Score = 261, Expect = 2.3e-21, Identities = 57/166 (34%), Positives = 92/166 (55%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +N  S IEA LF++G+EG+    +  I+       + ++EE++ +Y+ D    L +R+  + Y+L TKP++   V   F       L+Q  +ETL I+AY  P TR +I  +R    +  L+KL    LV E GR +  G+P ++  T +F D FGL SI++LP +
  S:     1 MNNLSQIEALLFVSGDEGISVKNMSIITGFDRSAIQGLLEELVLKYDTDLSSALQIRESDDVYRLVTKPELGGTVKQYFDSPVNATLSQAQLETLVIVAYKQPITRVEIDTIRGVQSSGTLQKLALRQLVHEVGRKDEPGRPIMFGTTDEFLDYFGLKSIEELPPL 166
>gi|110004422|emb|CAK98760.1| putative chromosome segregation and condensation protein b [Spiroplasma citri] (182 aa)
Score = 260, Expect = 3.0e-21, Identities = 65/187 (34%), Positives = 107/187 (57%)
  Q:     1 MSINVK-SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFF 187
           M++N K +V+E  LFI+G+EG++  ++  I  +SV + E V+ ++  EY+    RGL +    + Y+L TK +  +        K +  L+Q  +ETLAIIAY  P ++ +I ELR  +   ++ KL    L++EAG+S+  GKP  Y +T +F  +F L S+ DLP+       I+E   E+E + F
  S:     1 MNLNEKMAVLEGLLFISGDEGINLKEIAHILEISVPECEEVLTKLKAEYQTSNNRGLTITSFADKYRLATKQEYYQFYLKLANNKIEARLSQAALETLAIIAYRGPISKPEIEELRGVNSDSVINKLRARDLIDEAGKSDLPGKPMTYHITEEFLKVFNLTSLADLPQ-------IKETVVEKEQDLF 181
>gi|56420825|ref|YP_148143.1| hypothetical protein GK2290 [Geobacillus kaustophilus HTA426] >gi|81346942|sp|Q5KXL1|SCPB_GEOKA Segregation and condensation protein B >gi|56380667|dbj|BAD76575.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (217 aa)
Score = 259, Expect = 4.2e-21, Identities = 65/193 (33%), Positives = 113/193 (58%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGD 196
           + K+++EA LF AG+EG+   ++ ++  +S  + +AV+EE+  +  ++ +RG+ + ++G  + L TK + +  +         +PL+Q  +ETLAIIAY  P TR++I E+R       L+ L+   L++E GR+E  G+P LY  TP+F D FGL ++++LP   LPE   +  +  E   FF+   E+  D
  S:    16 SAKAIVEALLFAAGDEGLSLSQIAAVLEVSELEAKAVIEELQQDCRRE-ERGIQLVELGGVFLLATKKEHAPYLKKLVEAPGASPLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTGRPILYGTTPEFLDYFGLKTLEELPP--LPEWADDGESEREADLFFEKLAENLSD 205
>gi|15614124|ref|NP_242427.1| hypothetical protein BH1561 [Bacillus halodurans C-125] >gi|41018144|sp|Q9KCL0|SCPB_BACHD Segregation and condensation protein B >gi|10174178|dbj|BAB05280.1| BH1561 [Bacillus halodurans C-125] (197 aa)
Score = 257, Expect = 7.5e-21, Identities = 67/183 (36%), Positives = 104/183 (56%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFF 187
           +++ IE  LF+ G+EGV  ++L  +  LS     A +EE+   Y  D  RGL + +V   ++L TKP+++           ++ L+Q  +ETLAIIAY  P TR ++ E+R       ++ L    L++E GR++  G+P LY  TP+F D FGL S+K+LP   LPE  I+E +  EE + F
  S:     6 LQAAIEGILFVRGDEGVTLEELCDLLELSTDVVYAALEELRLSY-TDEARGLRIEEVAHAFRLSTKPELAPYFKKLALSTLQSGLSQAALETLAIIAYRQPITRIEVDEVRGVKSEKAIQTLTSRLLIKEVGRAQGTGRPILYGTTPQFLDHFGLKSLKELPP--LPED-IDESSIGEEADLF 184
>gi|149181677|ref|ZP_01860170.1| hypothetical protein BSG1_08096 [Bacillus sp. SG-1] >gi|148850655|gb|EDL64812.1| hypothetical protein BSG1_08096 [Bacillus sp. SG-1] (197 aa)
Score = 255, Expect = 1.1e-20, Identities = 70/190 (36%), Positives = 107/190 (56%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEA--VMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRE 192
           IN K ++E+ LF AG+EG+   ++ ++  L V++ +A  ++E +  EY  D  RG+ + ++   Y+L TK    P + K+V S       N L+Q  +ETLAI+AY  P TR+ I E+R       L  L   GL++  GR+E  G+  LY  T +F D FGL  I +LP   LP+   EE   E+   FF+  +E
  S:     4 INWKGILESLLFAAGDEGLSLKQVCAV--LDVEEHQALEIIEGLFAEYHNDKSRGISLIELAGTYQLVTKKEHAPYLKKLVES----PNVNSLSQAALETLAIVAYKQPITRADIEEIRGVKTERPLSTLASKGLIKAVGRAEGTGRAILYGTTKEFLDYFGLKDISELPP--LPDNIDEEFMSEDADLFFEKFQE 191
>gi|90961916|ref|YP_535832.1| segregation and condensation protein ScpB [Lactobacillus salivarius UCC118] >gi|122448961|sp|Q1WTK3|SCPB_LACS1 Segregation and condensation protein B >gi|90821110|gb|ABD99749.1| Segregation and condensation protein ScpB [Lactobacillus salivarius UCC118] (196 aa)
Score = 254, Expect = 1.4e-20, Identities = 61/173 (35%), Positives = 99/173 (57%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           ++ IE+ LFI+GNEG+   +L  I+ +        ++++  +Y++D    L +    E YKL TKP ++++V           L    +ETLAIIAY  P TR  + E+R    + M+++L  + L++E GR +A G+P LY  T KF D FGL+S+  LPE+   +Q+ EE+
  S:     5 QAKIESLLFISGNEGITLTELSQITGILKPALHEQLDKLADKYKQDRSSSLQLIHAEERYKLVTKPALAELVKKYLNSNNITELTGAALETLAIIAYKQPITRIGVDEIRGVQSSSMIQRLQLLELIKENGRLDAPGRPILYVTTDKFLDYFGLESLDQLPELDEEKQEDEEM 177
>gi|114566941|ref|YP_754095.1| putative transcriptional regulator [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337876|gb|ABI68724.1| condensin subunit ScpB [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (171 aa)
Score = 251, Expect = 3.3e-20, Identities = 60/168 (35%), Positives = 100/168 (59%)
  Q:     1 MSINVKSVIEAALFI-AGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M   +K+ +EA LF+ AG  G+  D+L  I  + + + + +++EMI EY  + + GL + ++   Y L T+P  S I+A      QK  L+   ++TLAI+AY  P TR +I ++R      ++  L+E GL++EAG    +GKP LY  T +F  +FGL ++K+LP++
  S:     3 MRDQIKAAVEAVLFVRAGRVGM--DELVEILDIPLLELKEILQEMILEYNNNIRGGLQIVELDGGYLLCTRPAYSDILAR-MEKPQKKRLSAAALDTLAIVAYRQPITRLEIEQIRGVKSDRIVNTLLEKGLIQEAGHKAVLGKPILYATTEEFLKVFGLTNLKELPDL 168
>gi|163791508|ref|ZP_02185914.1| hypothetical protein CAT7_11575 [Carnobacterium sp. AT7] >gi|159873231|gb|EDP67329.1| hypothetical protein CAT7_11575 [Carnobacterium sp. AT7] (192 aa)
Score = 251, Expect = 3.8e-20, Identities = 63/181 (34%), Positives = 99/181 (54%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFF 187
           + IEA LF+AG+EG+  +++ ++   S Q     +  +  EYE    RGL++ +VG  Y+L TK + + ++           L+Q  +ETLAIIAY  P TR +I E+R    +  L+KL   GL+E  GR +  G+  LY  +  F D FGL  +K+LP+I     ++E    E+E + F
  S:     5 AAIEALLFVAGDEGMSLEEISTMLECSTQQAYQFLMRLQKEYEASTARGLMLLEVGNLYQLATKKEYADVIKKYAISPLTTNLSQAALETLAIIAYKQPLTRMEIDEIRGVQTSGALQKLTLRGLIEPKGRVDGPGRAILYGTSEYFMDYFGLKDLKELPKIT----ELETENNEKESDLF 181
>gi|15674517|ref|NP_268691.1| segregation and condensation protein B [Streptococcus pyogenes M1 GAS] >gi|19745525|ref|NP_606661.1| segregation and condensation protein B [Streptococcus pyogenes MGAS8232] >gi|21909804|ref|NP_664072.1| segregation and condensation protein B [Streptococcus pyogenes MGAS315] >gi|28896503|ref|NP_802853.1| segregation and condensation protein B [Streptococcus pyogenes SSI-1] >gi|50913681|ref|YP_059653.1| segregation and condensation protein B [Streptococcus pyogenes MGAS10394] >gi|56808583|ref|ZP_00366314.1| COG1386: Predicted transcriptional regulator containing the HTH domain [Streptococcus pyogenes M49 591] >gi|71902964|ref|YP_279767.1| segregation and condensation protein B [Streptococcus pyogenes MGAS6180] >gi|71910123|ref|YP_281673.1| segregation and condensation protein B [Streptococcus pyogenes MGAS5005] >gi|94989813|ref|YP_597913.1| segregation and condensation protein B [Streptococcus pyogenes MGAS10270] >gi|94993699|ref|YP_601797.1| segregation and condensation protein B [Streptococcus pyogenes MGAS10750] >gi|139474356|ref|YP_001129072.1| segregation and condensation protein B [Streptococcus pyogenes str. Manfredo] >gi|167016594|sp|A2RG91|SCPB_STRPG Segregation and condensation protein B >gi|41017859|sp|P60220|SCPB_STRP1 Segregation and condensation protein B >gi|41017860|sp|P60221|SCPB_STRP8 Segregation and condensation protein B >gi|41017861|sp|P60222|SCPB_STRP3 Segregation and condensation protein B >gi|73919293|sp|Q5XDP3|SCPB_STRP6 Segregation and condensation protein B >gi|123640452|sp|Q48V44|SCPB_STRPM Segregation and condensation protein B >gi|124053379|sp|Q1JIF4|SCPB_STRPD Segregation and condensation protein B >gi|124053380|sp|Q1J8A8|SCPB_STRPF Segregation and condensation protein B >gi|13621620|gb|AAK33412.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] >gi|19747644|gb|AAL97160.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|21903989|gb|AAM78875.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811757|dbj|BAC64686.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] >gi|50902755|gb|AAT86470.1| ScpB [Streptococcus pyogenes MGAS10394] >gi|71802059|gb|AAX71412.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS6180] >gi|71852905|gb|AAZ50928.1| hypothetical cytosolic protein [Streptococcus pyogenes MGAS5005] >gi|94543321|gb|ABF33369.1| Segregation and condensation protein ScpB [Streptococcus pyogenes MGAS10270] >gi|94547207|gb|ABF37253.1| Segregation and condensation protein ScpB [Streptococcus pyogenes MGAS10750] >gi|134272603|emb|CAM30870.1| segregation and condensation protein B [Streptococcus pyogenes str. Manfredo] (183 aa)
Score = 249, Expect = 5.7e-20, Identities = 58/172 (33%), Positives = 97/172 (56%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           S IEA LF+AG EG+    L S+  L+    +  +E++  +YEKD    L + +    Y+L TK   ++++ +      K P+NQ +    +E L+I+AY  P TR +I ++R  + +  L KL+   L+ EAG+ + VG+P+LY  T  F D  G++ + +L E+   E   EE+
  S:     5 SQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEGFAELLRA----YAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEI 176
>gi|160915008|ref|ZP_02077221.1| hypothetical protein EUBDOL_01015 [Eubacterium dolichum DSM 3991] >gi|158432807|gb|EDP11096.1| hypothetical protein EUBDOL_01015 [Eubacterium dolichum DSM 3991] (193 aa)
Score = 249, Expect = 6.4e-20, Identities = 65/181 (35%), Positives = 109/181 (60%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEE--------MIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEI 184
           ++ +++E  L+++G+EG+   +L     LS  + EAV EE        M+ EY +    G+ +   G NYK  +K  +       F   +   L+   +ETLAIIAY  P TR +I E+R      M+ KL+   L++E GRS+A G+P+LY+VT +F D F L+S+K+LP++   +++++E  ++EEI
  S:     3 SLHAILEGLLYLSGDEGLSIKQL-----LSCFETEAVNEEELLKALDAMMEEYLQ-ADHGIELVCYGGNYKFVSKEMLHPYAEKLFAATKMATLSNAALETLAIIAYKQPITRVEIEEIRGVGCDMMIRKLLARSLIKECGRSDAPGRPFLYEVTKEFMDTFQLESLKELPDLPDFKEQVDEELFDEEI 185
>gi|94987939|ref|YP_596040.1| segregation and condensation protein B [Streptococcus pyogenes MGAS9429] >gi|94991823|ref|YP_599922.1| segregation and condensation protein B [Streptococcus pyogenes MGAS2096] >gi|124053377|sp|Q1JDD0|SCPB_STRPB Segregation and condensation protein B >gi|124053378|sp|Q1JNA3|SCPB_STRPC Segregation and condensation protein B >gi|94541447|gb|ABF31496.1| segregation and condensation protein [Streptococcus pyogenes MGAS9429] >gi|94545331|gb|ABF35378.1| Segregation and condensation protein ScpB [Streptococcus pyogenes MGAS2096] (183 aa)
Score = 248, Expect = 7.2e-20, Identities = 58/172 (33%), Positives = 96/172 (55%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           S IEA LF+AG EG+    L S+  L+    +  +E++  +YEKD    L + +    Y+L TK   + ++ +      K P+NQ +    +E L+I+AY  P TR +I ++R  + +  L KL+   L+ EAG+ + VG+P+LY  T  F D  G++ + +L E+   E   EE+
  S:     5 SQIEALLFVAGEEGLSLRHLASMLSLTPTALQQQLEKLSQKYEKDQHSSLCLIETANTYRLVTKEGFAGLLRA----YAKTPMNQSLSRASLEVLSIVAYKQPITRIEIDDIRGVNSSGALSKLLAFDLIREAGKKDVVGRPHLYATTDYFLDYMGINHLDELIEVSAVEPADEEI 176
>gi|16079378|ref|NP_390202.1| hypothetical protein BSU23210 [Bacillus subtilis subsp. subtilis str. 168] >gi|466186|sp|P35155|SCPB_BACSU Segregation and condensation protein B >gi|410132|gb|AAA67488.1| ORFX8 >gi|2634756|emb|CAB14253.1| ypuH [Bacillus subtilis subsp. subtilis str. 168] (197 aa)
Score = 247, Expect = 1.1e-19, Identities = 61/186 (32%), Positives = 103/186 (55%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           +N K+++EA L+ AG+EG+ K +L ++  +   +   +M ++  EY  D  RG+ + +  + Y L TK D +  +     +  K  L+Q  +E LAI++Y  P TR++I E+R      +L  L+   L+ E GR++  G+  LY  TP F + FGL ++ +LP   LPE   E++  EE   FF+
  S:     6 VNWKAIVEALLYAAGDEGLTKKQLLTVLEIEEPELNTIMADVADEYRGD-TRGIELIEYADTYMLSTKKDFAPYLKKLIEVPSKG-LSQASLEVLAIVSYKQPITRAEIEEIRGVKSERILHSLVAKALLCEVGRADGPGRAILYGTTPTFLEQFGLKTLDELPP--LPENAEEDVLQEEADLFFE 187
>gi|28378542|ref|NP_785434.1| transcription regulator (putative) [Lactobacillus plantarum WCFS1] >gi|41018002|sp|Q88VY8|SCPB_LACPL Segregation and condensation protein B >gi|28271378|emb|CAD64283.1| transcription regulator (putative) [Lactobacillus plantarum WCFS1] (199 aa)
Score = 246, Expect = 1.3e-19, Identities = 55/162 (33%), Positives = 85/162 (52%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVL 170
           IE  LF+AG+EG+   +++  +  +      ++ ++  +Y+ DP   L++      Y+L TK  ++ ++   F       L+Q  +E LAIIAY  P TR +I E+R       ++KL+   LV E GR    G+P LY  T  F D FGL S+ DLP I L
  S:     7 IEGLLFVAGDEGITVAEIEHATGFAKPAITTMLTQLATKYQADPDSALMILSTANTYRLATKAAVAPVLKRYFEAPLTTSLSQASLEVLAIIAYRQPLTRIEIDEIRGVHSGSTIQKLVLRQLVTETGRLSEPGRPILYGTTELFLDYFGLKSLDDLPAIDL 168
>gi|154686566|ref|YP_001421727.1| ScpB [Bacillus amyloliquefaciens FZB42] >gi|167016584|sp|A7Z670|SCPB_BACA2 Segregation and condensation protein B >gi|154352417|gb|ABS74496.1| ScpB [Bacillus amyloliquefaciens FZB42] (197 aa)
Score = 245, Expect = 1.5e-19, Identities = 60/186 (32%), Positives = 106/186 (56%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           +N K+++EA L+ AG+EG+ K +L ++  +   +   +MEE+  +Y++D  RG+ + +  + Y L TK +    +     +  K  L+Q  +E LAI++Y  P TR++I ++R      +L  L+   L+ E GR++  G+  LY  TP F + FGL ++++LP   LPE   E++  EE   FF+
  S:     6 VNWKAIVEALLYAAGDEGLTKKQLVTVLEIEEAELAGIMEEVAAQYKED-DRGIELTEYADTYMLGTKKEFVPYLKKLIEVPSKG-LSQASLEVLAIVSYKQPITRAEIEDIRGVKSERILHSLVSKALLCEVGRADGPGRAILYGTTPVFLEQFGLKTLEELPP--LPENAEEDVLQEEADLFFE 187
>gi|116494857|ref|YP_806591.1| transcriptional regulator [Lactobacillus casei ATCC 334] >gi|191638364|ref|YP_001987530.1| Segregation and condensation protein B [Lactobacillus casei] >gi|116105007|gb|ABJ70149.1| condensin subunit ScpB [Lactobacillus casei ATCC 334] >gi|190712666|emb|CAQ66672.1| Segregation and condensation protein B [Lactobacillus casei BL23] (206 aa)
Score = 245, Expect = 1.6e-19, Identities = 66/193 (34%), Positives = 97/193 (50%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEK----DPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           ++  +EA L+ AG  GV   +L  I  +S    E+ M + +  Y +    D QRGL +++  + Y L TKP  +  +   F       L+Q  +E LAIIAY  P TR +I E+R    +  L  L    L++EAGR EA G+P LY  T  F D FGL+ + DLP +       +      E++ F   R D+  E
  S:     1 MEPALEAILYTAGESGVTLGELAGILEIS----ESAMRQQLDAYRQRLAADDQRGLQLQQFADRYYLLTKPAYAPAIKKYFAGPPAAGLSQAALEVLAIIAYQQPITRIEIDEIRGVQSSGALTTLAARQLIKEAGRKEAPGRPILYATTQFFLDYFGLNRLADLPPLA------DAPADTGEVDLFTAFRHDDDQE 187
>gi|52141435|ref|YP_085394.1| segregation and condensation protein B [Bacillus cereus E33L] >gi|81686388|sp|Q635M3|SCPB_BACCZ Segregation and condensation protein B >gi|51974904|gb|AAU16454.1| conserved hypothetical protein; possible transcriptional regulator [Bacillus cereus E33L] (190 aa)
Score = 245, Expect = 1.7e-19, Identities = 56/172 (32%), Positives = 96/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           KS+IE  LF++G+EG++ +++  +  +   +   ++EEM  E E    RGL + +  + Y+  TK + +        I     L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KSIIEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEMQKECE-GAHRGLQIVQYAKVYRFATKKEHASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|83590207|ref|YP_430216.1| condensin subunit ScpB [Moorella thermoacetica ATCC 39073] >gi|123524433|sp|Q2RIR6|SCPB_MOOTA Segregation and condensation protein B >gi|83573121|gb|ABC19673.1| condensin subunit ScpB [Moorella thermoacetica ATCC 39073] (195 aa)
Score = 245, Expect = 1.9e-19, Identities = 60/167 (35%), Positives = 97/167 (58%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           S N+++ +E  LF+AG   V  D L +   +   D + +  E+   Y ++ +RGL +R V   Y++ T+P+ +    +   ++ + P L++  +ETLAIIAY  P TR+++  +R      +L  LI  GLV+E GR EA G+P LY  TPKF + FGL  +K+LP +
  S:     6 SDNLRAALECLLFVAGGP-VSVDSLAACLGVKPGDVDELAAELQELYARE-ERGLQIRAVAGGYQMCTRPEFASYCEAL--LRPELPALSRAALETLAIIAYRQPVTRTEMEYIRGVKVDGVLNTLISRGLVQEVGRKEAPGRPILYGTTPKFLEFFGLKDLKELPPL 169
>gi|30022144|ref|NP_833775.1| segregation and condensation protein B [Bacillus cereus ATCC 14579] >gi|41017960|sp|Q819C8|SCPB_BACCR Segregation and condensation protein B >gi|29897701|gb|AAP10976.1| Transcriptional regulator, LuxR family [Bacillus cereus ATCC 14579] (190 aa)
Score = 245, Expect = 1.9e-19, Identities = 55/172 (31%), Positives = 96/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           KS+IE  LF++G+EG++ +++  +  + + +   ++EEM  E E    RGL + +  + Y+  TK + +              L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KSIIEGLLFVSGDEGIYPEQIAKVLEIEMNEAINILEEMQQECE-GANRGLQIVQYAKVYRFATKKEHASYYQKLIDTPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|47565939|ref|ZP_00236978.1| conserved hypothetical protein protein TIGR00281 [Bacillus cereus G9241] >gi|47557219|gb|EAL15548.1| conserved hypothetical protein protein TIGR00281 [Bacillus cereus G9241] (190 aa)
Score = 244, Expect = 2.0e-19, Identities = 56/172 (32%), Positives = 96/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           KS+IE  LF++G+EG++ +++  +  +   +   ++EEM  E E    RGL + +  + Y+  TK + +        I     L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KSIIEGLLFVSGDEGIYPEQIAKVLGIEGNEVINILEEMQKECE-GAHRGLQIVQYAKVYRFATKKEHASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|75764357|ref|ZP_00743879.1| Segregation and condensation protein ScpB [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168140032|ref|ZP_02583261.1| segregation and condensation protein B [Bacillus cereus G9842] >gi|74488158|gb|EAO51852.1| Segregation and condensation protein ScpB [Bacillus thuringiensis serovar israelensis ATCC 35646] (190 aa)
Score = 244, Expect = 2.4e-19, Identities = 55/172 (31%), Positives = 96/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           KS+IE  LF++G+EG++ +++  +  + + +   ++EEM  E E    RGL + +  + Y+  TK + +              L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KSIIEGLLFVSGDEGIYPEQIAKVLEIEMNEVMNILEEMQQECE-GANRGLQIVQYAKVYRFATKKEHASYYQKLIDTPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|49186965|ref|YP_030217.1| segregation and condensation protein B [Bacillus anthracis str. Sterne] >gi|49481618|ref|YP_038117.1| segregation and condensation protein B [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65321451|ref|ZP_00394410.1| COG1386: Predicted transcriptional regulator containing the HTH domain [Bacillus anthracis str. A2012] >gi|118479261|ref|YP_896412.1| segregation and condensation protein B [Bacillus thuringiensis str. Al Hakam] >gi|161486560|ref|NP_846510.2| segregation and condensation protein B [Bacillus anthracis str. Ames] >gi|161611195|ref|YP_022679.2| segregation and condensation protein B [Bacillus anthracis str. 'Ames Ancestor'] >gi|165871185|ref|ZP_02215835.1| segregation and condensation protein B [Bacillus anthracis str. A0488] >gi|166995627|ref|ZP_02262087.1| segregation and condensation protein B [Bacillus cereus AH820] >gi|167633654|ref|ZP_02391978.1| segregation and condensation protein B [Bacillus anthracis str. A0442] >gi|167639501|ref|ZP_02397772.1| segregation and condensation protein B [Bacillus anthracis str. A0193] >gi|170687162|ref|ZP_02878380.1| segregation and condensation protein B [Bacillus anthracis str. A0465] >gi|170705658|ref|ZP_02896121.1| segregation and condensation protein B [Bacillus anthracis str. A0389] >gi|177652633|ref|ZP_02935049.1| segregation and condensation protein B [Bacillus anthracis str. A0174] >gi|190565827|ref|ZP_03018746.1| segregation and condensation protein B [Bacillus anthracis Tsiankovskii-I] >gi|196035028|ref|ZP_03102435.1| segregation and condensation protein B [Bacillus cereus W] >gi|196045775|ref|ZP_03113004.1| segregation and condensation protein B [Bacillus cereus 03BB108] >gi|167016585|sp|A0RI62|SCPB_BACAH Segregation and condensation protein B >gi|41017966|sp|Q81MH2|SCPB_BACAN Segregation and condensation protein B >gi|56749593|sp|Q6HEA9|SCPB_BACHK Segregation and condensation protein B >gi|49180892|gb|AAT56268.1| conserved hypothetical protein TIGR00281 [Bacillus anthracis str. Sterne] >gi|49333174|gb|AAT63820.1| conserved hypothetical protein, possible transcriptional regulator [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118418486|gb|ABK86905.1| condensin subunit ScpB [Bacillus thuringiensis str. Al Hakam] >gi|164713104|gb|EDR18631.1| segregation and condensation protein B [Bacillus anthracis str. A0488] >gi|167512560|gb|EDR87935.1| segregation and condensation protein B [Bacillus anthracis str. A0193] >gi|167531060|gb|EDR93747.1| segregation and condensation protein B [Bacillus anthracis str. A0442] >gi|170129198|gb|EDS98062.1| segregation and condensation protein B [Bacillus anthracis str. A0389] >gi|170668779|gb|EDT19524.1| segregation and condensation protein B [Bacillus anthracis str. A0465] >gi|172081968|gb|EDT67036.1| segregation and condensation protein B [Bacillus anthracis str. A0174] >gi|190562746|gb|EDV16712.1| segregation and condensation protein B [Bacillus anthracis Tsiankovskii-I] >gi|195992567|gb|EDX56528.1| segregation and condensation protein B [Bacillus cereus W] >gi|196023215|gb|EDX61893.1| segregation and condensation protein B [Bacillus cereus 03BB108] (190 aa)
Score = 243, Expect = 2.9e-19, Identities = 56/172 (32%), Positives = 96/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           KS+IE  LF++G+EG++ +++  +  +   +   ++EEM  E E    RGL + +  + Y+  TK + +        I     L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KSIIEGLLFVSGDEGIYPEQIAKVLEIEGNEVIDILEEMQKECE-GAHRGLQIVQYAKVYRFATKKEHASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|166985601|ref|ZP_02256879.1| segregation and condensation protein B [Bacillus cereus AH187] >gi|168162910|ref|ZP_02598143.1| segregation and condensation protein B [Bacillus cereus H3081.97] (190 aa)
Score = 243, Expect = 3.0e-19, Identities = 56/172 (32%), Positives = 95/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           KS+IE  LF++G+EG+  +++  +  +   +   ++EEM  E E    RGL + +  + Y+  TK + +        I     L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KSIIEGLLFVSGDEGISPEQIAKVLEIEGNEVINILEEMQKECE-GAHRGLQIVQYAKVYRFATKKEHASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|69248061|ref|ZP_00604606.1| Conserved hypothetical protein 281 [Enterococcus faecium DO] >gi|68194580|gb|EAN09071.1| Conserved hypothetical protein 281 [Enterococcus faecium DO] (189 aa)
Score = 243, Expect = 3.2e-19, Identities = 58/171 (33%), Positives = 97/171 (56%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           S +EA LFI G EG+  ++L  +  LS  +  ++++E+   Y ++    L + +   +Y L TK +++ ++   +     N L+Q  +ETLAIIAY  P TR++I ++R    +  +++L    L+EE GR E  G+P LY  T  F D FGL S+++LP+    E  +EE
  S:     5 SELEALLFIVGEEGISNEELSGLLNLSEAEVTSLVKELKESYTQNSHSALHIFETESHYVLTTKKELAPLLKR-YAQGTSNTLSQAAVETLAIIAYKQPITRAEIEQIRGVQVSGAVQRLAAHKLIEEKGRVEGPGRPILYGTTGYFLDYFGLKSLEELPDTQEMEISLEE 174
>gi|167462342|ref|ZP_02327431.1| Transcriptional regulator LuxR family protein [Paenibacillus larvae subsp. larvae BRL-230010] (214 aa)
Score = 243, Expect = 3.2e-19, Identities = 62/163 (38%), Positives = 99/163 (60%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ---RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           +KSVIE  +F++G+EG+    +K ++ +  QD E+ + ++I E ++D Q   RG+ + +V   Y+  T P+ +           ++ L+Q  +ETL+IIAY  P TR +I E+R       L  L+   L+EE+GR+EA+G+P LY  + KF + FGL SI DLPE
  S:     7 MKSVIEGLIFVSGDEGI---TVKQLAEVLDQD-ESTLRDLIEELKQDLQESERGIQIVEVAGCYQCTTLPEHALYFERLAYTPSRSTLSQAALETLSIIAYKQPITRVEIEEIRGVKCDRALHTLMAKELIEESGRAEAIGRPILYGTSKKFLEYFGLGSIHDLPE 168
>gi|42783171|ref|NP_980418.1| segregation and condensation protein B [Bacillus cereus ATCC 10987] >gi|56749633|sp|Q731P1|SCPB_BACC1 Segregation and condensation protein B >gi|42739099|gb|AAS43026.1| transcriptional regulator, putative [Bacillus cereus ATCC 10987] (190 aa)
Score = 242, Expect = 3.6e-19, Identities = 56/172 (32%), Positives = 95/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           KS+IE  LF++G+EG+  +++  +  +   +   ++EEM  E E    RGL + +  + Y+  TK + +        I     L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KSIIEGLLFVSGDEGISPEQIAKVLEIEGNEVIDILEEMQKECE-GAHRGLQIVQYAKVYRFATKKEHASYYQKLIDIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|167755786|ref|ZP_02427913.1| hypothetical protein CLORAM_01301 [Clostridium ramosum DSM 1402] >gi|167704725|gb|EDS19304.1| hypothetical protein CLORAM_01301 [Clostridium ramosum DSM 1402] (204 aa)
Score = 242, Expect = 3.7e-19, Identities = 63/194 (32%), Positives = 103/194 (53%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           N   +IE  L++AG++GV   ++  +  +S ++   +M++    Y     +G+V+   G  YKL T  D   I       +    L+   +ETLAIIAYN P TR+ + ++R      M+ KL+   L++E GR +  G P LY VT +F D FGL ++++LP++      I E+  +E+I F    RED  D+
  S:     5 NYLDIIEGMLYLAGDDGVDIKQVAGVLEISKKEATLLMDQFTEIYGNKALKGIVLVNFGGRYKLATNADYF-IYYQKMVEQSSASLSNAALETLAIIAYNQPITRAGVEDIRGVGCDAMIRKLVAKALIKEVGREDTPGMPILYGVTDEFMDTFGLTTLEELPDLA----DIVEVDEQEDI-FATRYREDTSDD 192
>gi|78043897|ref|YP_360764.1| segregation and condensation protein B [Carboxydothermus hydrogenoformans Z-2901] >gi|77996012|gb|ABB14911.1| segregation and condensation protein B [Carboxydothermus hydrogenoformans Z-2901] (192 aa)
Score = 241, Expect = 4.6e-19, Identities = 61/175 (34%), Positives = 102/175 (58%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           IN++  +EA LF++  E +   K+     LSV++ + ++  +  + E+D QRG+++   GE   L T+PD S  +   F    ++ L Q  +ETLAIIAY  P T+++I  +R       +  L+E GL+EEAGR +A G+P +Y+ T KF + FGL S+ +LP + L  + + +
  S:    14 INLEGALEALLFVS-PEPLSLKKIAQTLELSVEEAKEIVLRLQEKLEQD-QRGIMLHFSGEEVWLTTRPDFSVYIERLFKPPAQH-LTQATLETLAIIAYKQPVTKTEIELIRGVKADSSIATLLEKGLIEEAGRKDAPGRPIIYRTTAKFLEFFGLKSLDELPPLNLENEAVND 185
>gi|124053376|sp|Q3AAS0|SCPB_CARHZ Segregation and condensation protein B (185 aa)
Score = 241, Expect = 4.9e-19, Identities = 61/175 (34%), Positives = 102/175 (58%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           IN++  +EA LF++  E +   K+     LSV++ + ++  +  + E+D QRG+++   GE   L T+PD S  +   F    ++ L Q  +ETLAIIAY  P T+++I  +R       +  L+E GL+EEAGR +A G+P +Y+ T KF + FGL S+ +LP + L  + + +
  S:     7 INLEGALEALLFVS-PEPLSLKKIAQTLELSVEEAKEIVLRLQEKLEQD-QRGIMLHFSGEEVWLTTRPDFSVYIERLFKPPAQH-LTQATLETLAIIAYKQPVTKTEIELIRGVKADSSIATLLEKGLIEEAGRKDAPGRPIIYRTTAKFLEFFGLKSLDELPPLNLENEAVND 178
>gi|163849456|ref|YP_001637500.1| segregation and condensation protein B [Chloroflexus aurantiacus J-10-fl] >gi|187600352|ref|ZP_02986584.1| segregation and condensation protein B [Chloroflexus sp. Y-400-fl] >gi|163670745|gb|ABY37111.1| segregation and condensation protein B [Chloroflexus aurantiacus J-10-fl] >gi|187487635|gb|EDU25604.1| segregation and condensation protein B [Chloroflexus sp. Y-400-fl] (209 aa)
Score = 241, Expect = 5.1e-19, Identities = 58/169 (34%), Positives = 92/169 (54%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           ++  +IEA LF+A  E +  D+L  I  +   +    ++E+   Y    QRG+ +++  ++    + P+ +  +    G +Q   L+   +ETLAIIAY  P TR+QI  +R  D +  L  L+   L+ EAGR E +G+P LY  TP F   FGL S+ +LP I +PE
  S:    36 SLTQLIEALLFVAA-EPMTLDQLTRILDVEAAEVVNAIDELSTIY---AQRGIRLQRHNDHVMFVSAPEAAPTIRRFLGAQQNQRLSHAALETLAIIAYRQPITRAQIDAIRGVDSSAALRALLSRDLICEAGRLEVLGRPILYATTPTFLQQFGLTSLDELPPIEIPE 200
>gi|81428636|ref|YP_395636.1| segregation and condensation protein B [Lactobacillus sakei subsp. sakei 23K] >gi|123564218|sp|Q38WV4|SCPB_LACSS Segregation and condensation protein B >gi|78610278|emb|CAI55327.1| Segregation and condensation protein B [Lactobacillus sakei subsp. sakei 23K] (207 aa)
Score = 240, Expect = 6.9e-19, Identities = 62/185 (33%), Positives = 103/185 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAV---MEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRED 193
           IE+ L++AG+EG+    L+ I+RL + D  AV   + ++   Y++D Q GL + +  + YKL TK   + ++ + F       ++Q  +E LAII Y  P TR +I E+R    +  ++ L+   L+ E GR +A G+P LY  +  F D FGL S+K+LPE       +E++T  ++    D +  D
  S:     7 IESLLYVAGDEGI---TLQHIARLIMLDEAAVRQLLTKLAKRYQEDEQSGLNLIQAADCYKLVTKKAYAGLLKAYFDGPVSTSISQAALEVLAIIVYRQPLTRIEIDEVRGVQSSGAIQTLLARQLIVEKGRKDAPGRPILYGTSDYFLDYFGLGSLKELPE-------LEQMTLTDDTAESDNDSAD 184
>gi|116513913|ref|YP_812819.1| transcriptional regulator [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093228|gb|ABJ58381.1| condensin subunit ScpB [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (200 aa)
Score = 239, Expect = 9.2e-19, Identities = 53/160 (33%), Positives = 92/160 (57%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++A L++AG+ G+ K++L+ + +L+  + E++ + +  +   DP  GL + ++ + YKL T  ++S +V + F       ++Q  +E LAI+AY  P TR +I E+R  + +  L+ L+  GLV+  G  +A G P LY  T  F   FG  S+ DLP I
  S:     8 LQALLYVAGDGGIKKEQLRDLLQLADPEIESLAKRLQEKLASDPDCGLQLLEINDEYKLTTSWEVSDLVEAYFNKDLTKNISQSALEILAIVAYRQPITRIEIDEIRGVNSSGALQTLVWRGLVKAQGVKDAPGHPKLYVTTDYFLQYFGYKSLADLPVI 167
>gi|152976467|ref|YP_001375984.1| segregation and condensation protein B [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189046142|sp|A7GS81|SCPB_BACCN Segregation and condensation protein B >gi|152025219|gb|ABS22989.1| putative transcriptional regulator [Bacillus cereus subsp. cytotoxis NVH 391-98] (190 aa)
Score = 239, Expect = 9.6e-19, Identities = 58/186 (31%), Positives = 102/186 (54%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRE 192
           ++ E  LF+AG+EG++ +++  +  +  +D   ++EEM  ++E +  RGL + +  + Y+L TK + +              L+Q  +ETLAI+AY  P TR ++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E        FFD+ +E
  S:     8 AITEGLLFVAGDEGIYPEQIAKVLEIEEEDVIKIVEEMQEKWEGE-GRGLQIVQFAKAYRLATKKEHAPYYQKLMDTPTAASLSQAALETLAIVAYRQPITRMEMEEIRGVKTERALQTLVSHLLIKEVGRAEGPGRPILYGTTKEFLDTFGLQTLDDLPALSEENEQMNEADL-----FFDSLQE 187
>gi|55820358|ref|YP_138800.1| segregation and condensation protein B [Streptococcus thermophilus LMG 18311] >gi|81561026|sp|Q5M621|SCPB_STRT2 Segregation and condensation protein B >gi|55736343|gb|AAV59985.1| conserved hypothetical protein [Streptococcus thermophilus LMG 18311] (193 aa)
Score = 237, Expect = 1.3e-18, Identities = 58/185 (31%), Positives = 103/185 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRED 193
           +EA LF+AG +G+    +  +  + V      +E++  +YE D    L + +    YK+ TKPD + ++        K P+NQ +    +E L+I+AY  P TR+++ ++R  + +  + KL   GL+ EAG+ +AVG+P LY  T  F D  G++S+ +L  + + + ++E    E+E + F   RED
  S:     8 LEALLFVAGEDGLSLRTMAQLLEIPVTGLTQSLEKLQAKYEADEDTALCLLESSNTYKIVTKPDFACLLRD----YSKTPINQSLSRASLEVLSIVAYKQPITRAEVDDIRGVNSSGAIAKLQAFGLIREAGKKDAVGRPNLYATTDYFLDYIGINSLDEL--VAIDQLELE----EQETSLF---RED 183
>gi|18310786|ref|NP_562720.1| segregation and condensation protein B [Clostridium perfringens str. 13] >gi|110798854|ref|YP_696488.1| segregation and condensation protein B [Clostridium perfringens ATCC 13124] >gi|168210832|ref|ZP_02636457.1| segregation and condensation protein B [Clostridium perfringens B str. ATCC 3626] >gi|168214379|ref|ZP_02640004.1| segregation and condensation protein B [Clostridium perfringens CPE str. F4969] >gi|168215433|ref|ZP_02641058.1| segregation and condensation protein B [Clostridium perfringens NCTC 8239] >gi|169343512|ref|ZP_02864511.1| segregation and condensation protein B [Clostridium perfringens C str. JGS1495] >gi|182625678|ref|ZP_02953447.1| segregation and condensation protein B [Clostridium perfringens D str. JGS1721] >gi|41017903|sp|Q46206|SCPB_CLOPE Segregation and condensation protein B >gi|123049725|sp|Q0TPF2|SCPB_CLOP1 Segregation and condensation protein B >gi|18145467|dbj|BAB81510.1| conserved hypothetical protein [Clostridium perfringens str. 13] >gi|110673501|gb|ABG82488.1| segregation and condensation protein B [Clostridium perfringens ATCC 13124] >gi|169298072|gb|EDS80162.1| segregation and condensation protein B [Clostridium perfringens C str. JGS1495] >gi|170711127|gb|EDT23309.1| segregation and condensation protein B [Clostridium perfringens B str. ATCC 3626] >gi|170714160|gb|EDT26342.1| segregation and condensation protein B [Clostridium perfringens CPE str. F4969] >gi|177909080|gb|EDT71555.1| segregation and condensation protein B [Clostridium perfringens D str. JGS1721] >gi|182382126|gb|EDT79605.1| segregation and condensation protein B [Clostridium perfringens NCTC 8239] (195 aa)
Score = 237, Expect = 1.3e-18, Identities = 66/179 (36%), Positives = 96/179 (53%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDF---EAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           +KS+IE+ LF++G        LK I R+  +DF   E +M E++  Y  D  RG+ +  +   Y+L TK   S+ V        +  L+Q  +E+LAII Y  P TR +I E+R       +++L+E  LVEE GR E  G+P LY  T +F   F L+ + DLP I L E+  E     EE
  S:    18 LKSIIESLLFVSGEPLA----LKDICRIVEEDFKYVEDLMRELMNIYNGDSSRGIKIISLNGTYQLVTKTKNSEYVQKLLKKNVRQSLSQASLESLAIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPGRPILYGTTDEFLRHFALNDLGDLPSIELFEENDEVSDMVEE 195
>gi|125718578|ref|YP_001035711.1| segregation and condensation protein B [Streptococcus sanguinis SK36] >gi|167016595|sp|A3CPQ6|SCPB_STRSV Segregation and condensation protein B >gi|125498495|gb|ABN45161.1| Segregation and condensation protein B, putative [Streptococcus sanguinis SK36] (189 aa)
Score = 237, Expect = 1.5e-18, Identities = 57/169 (33%), Positives = 92/169 (54%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           IEA LF+AG +G+   +L  I  L        +E++  +YE +P   L + +  + YKL TKP+ ++I+ +         L++  +ETL+IIAY  P TR +I ++R  + +  L KL+   LV E G+ E +G+P LY  T  F D  G++ + +LP +   E   EE
  S:     7 IEALLFVAGEDGLKVHQLAEILSLPPTGVIQSLEKLAEQYEVNPDSSLTLLETSKTYKLVTKPEFAEILRAYSRAPINQSLSRAALETLSIIAYKQPITRVEIDDIRGVNSSGALAKLLAFELVREDGKKEVIGRPNLYVTTDYFLDYMGINHLDELPIVEETELVAEE 175
>gi|118727479|ref|ZP_01576078.1| putative transcriptional regulator [Clostridium cellulolyticum H10] >gi|118663122|gb|EAV69784.1| putative transcriptional regulator [Clostridium cellulolyticum H10] (190 aa)
Score = 237, Expect = 1.5e-18, Identities = 60/184 (32%), Positives = 106/184 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ VIE+ +F  G+  +  DK+  I  L  +   ++++ M+  Y  +  RG+++R++ E Y++ +KP+    V+  + I+QK  L+Q   E LAIIAYN P TR++I ++R  +    + +L E  L++EAG+ +  G+P LY+ T +F   FG  SI+D    +L    + EL  +E +  FD
  S:     6 IECVIESLIFSYGDP-LPLDKICEILELDKKTARSILKNMMDSY-NNSNRGIIIREINEKYQMCSKPEYFDYVSKLYQIRQKQALSQAAYEVLAIIAYNQPITRAKIEQIRGVNSDSAVTRLTERNLIKEAGKLDVPGRPRLYETTDEFLRCFGFKSIRD--LPLLDIDDLNELNLQELVEEFD 185
>gi|194333284|ref|YP_002015144.1| segregation and condensation protein B [Prosthecochloris aestuarii DSM 271] >gi|194311102|gb|ACF45497.1| segregation and condensation protein B [Prosthecochloris aestuarii DSM 271] (206 aa)
Score = 237, Expect = 1.5e-18, Identities = 50/144 (34%), Positives = 82/144 (56%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           R   +  + E Y+  T P ++ ++      K +  L+Q ++E LA+IAY  P +RS I  +R   P   + KL+E GL++  GR+ +VGKP LY  T +F D F L S+KDLP++    ++I EL  +++I  F  +  DN ++
  S:    57 RAFRIESIAEGYRFMTIPALAPLLRKMLAPKIRRKLSQSVLEVLAVIAYQQPVSRSDIQHIRGVSPDYAVNKLLERGLIDVRGRAASVGKPLLYGTTKEFLDFFHLSSLKDLPKL----REIRELARDKDIENFLMSSGDNNEQ 196
>gi|24380086|ref|NP_722041.1| segregation and condensation protein B [Streptococcus mutans UA159] >gi|41017951|sp|Q7ZAK9|SCPB_STRMU Segregation and condensation protein B >gi|24378081|gb|AAN59347.1|AE015000_5 conserved hypothetical protein [Streptococcus mutans UA159] (198 aa)
Score = 237, Expect = 1.6e-18, Identities = 63/188 (33%), Positives = 105/188 (55%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTY----EEEINFFDTNREDN 194
           S IEA LF+AG +G+   +L ++  + V      +E+M  +YE+D    L + +  + YKL TK D + ++        K P+NQ +    +E L+IIAY  P TR ++  +R  + +  + KL    L++EAG+ E +G+P LY  +  F D  G++S+++LP+    E K EE T     E E    +  +E+N
  S:     5 SKIEALLFVAGEDGLSLRQLATLLDIPVTALLQQLEKMAQKYERDDNSALSLLESSKTYKLVTKKDYADLLRQ----YSKTPINQSLSRASLEVLSIIAYKQPITRIEVDNIRGVNSSSAISKLQAFDLIQEAGKKEVLGRPNLYVTSDYFLDYMGINSLEELPDASSIELKDEEFTLFDNKENEEQISENVKEEN 196
>gi|110802399|ref|YP_699088.1| segregation and condensation protein B [Clostridium perfringens SM101] >gi|123047291|sp|Q0SS19|SCPB_CLOPS Segregation and condensation protein B >gi|110682900|gb|ABG86270.1| segregation and condensation protein B [Clostridium perfringens SM101] (195 aa)
Score = 236, Expect = 1.7e-18, Identities = 65/179 (36%), Positives = 96/179 (53%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDF---EAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           +KS+IE+ LF++G        LK I R+  +DF   E +M E++  Y  D  RG+ +  +   Y+L TK   S+ +        +  L+Q  +E+LAII Y  P TR +I E+R       +++L+E  LVEE GR E  G+P LY  T +F   F L+ + DLP I L E+  E     EE
  S:    18 LKSIIESLLFVSGEPLA----LKDICRIVEEDFKYVEDLMRELMNIYNGDSSRGIKIISLNGTYQLVTKTKNSEYIQKLLKKNVRQSLSQASLESLAIICYKQPITRVEIDEIRGVKSESAIQRLVEKNLVEETGRLEVPGRPILYGTTDEFLRHFALNDLGDLPSIELFEENNEVSDMVEE 195
>gi|150390295|ref|YP_001320344.1| putative transcriptional regulator [Alkaliphilus metalliredigens QYMF] >gi|167016582|sp|A6TR67|SCPB_ALKMQ Segregation and condensation protein B >gi|149950157|gb|ABR48685.1| putative transcriptional regulator [Alkaliphilus metalliredigens QYMF] (190 aa)
Score = 236, Expect = 1.7e-18, Identities = 60/173 (34%), Positives = 100/173 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           +K+ IEA LF A ++ +   +L +I  + V + + +M+EMI E+    +RG+ + ++ ++Y++ T+ +  +I+   F  KQ   L Q  +ETLAIIAY  P T+++I  +R       +  L E  L+E+ GR E  G+P L+  T  F   FGL S++DLP+I   +Q  EE
  S:     6 IKAAIEAILF-AWSDPISSSELSNILDIKVTETKEIMKEMIDEFNFH-KRGIQIIQMNDHYQMSTRAEYHEILQKLFEPKQNKGLTQASLETLAIIAYRQPITKTEIESVRGVKCDKAISTLFEKNLIEDRGRLEKTGRPILFGTTLHFLKNFGLKSLEDLPKITEIDQANEE 176
>gi|116492847|ref|YP_804582.1| condensin subunit ScpB [Pediococcus pentosaceus ATCC 25745] >gi|122265689|sp|Q03F82|SCPB_PEDPA Segregation and condensation protein B >gi|116102997|gb|ABJ68140.1| condensin subunit ScpB [Pediococcus pentosaceus ATCC 25745] (196 aa)
Score = 236, Expect = 1.9e-18, Identities = 54/166 (32%), Positives = 93/166 (56%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +N +  +EA LF+AG EG+  ++L + +  +      +++ +   YE + +  L + + G  YKL TKP+++ I+   F    ++ L+   +E L+I+AY  P TR +I ++R       L+ L+   LV+  GR E  G+P  Y  T +F D FGL+ IKDLP++
  S:     1 MNNEQKVEALLFVAGAEGISVEELSNFTGYAKPAILTMLDNLEKNYEVNSKTALKLIQTGGTYKLVTKPELASILEKYFDRNSRSGLSPAALEILSIVAYRQPITRIEIDQIRGVQSGTTLQNLVLRNLVKVVGRLEEPGRPKTYGTTDEFLDYFGLEDIKDLPKL 166
>gi|55822248|ref|YP_140689.1| segregation and condensation protein B [Streptococcus thermophilus CNRZ1066] >gi|116627194|ref|YP_819813.1| segregation and condensation protein B [Streptococcus thermophilus LMD-9] >gi|81559850|sp|Q5M1H9|SCPB_STRT1 Segregation and condensation protein B >gi|55738233|gb|AAV61874.1| conserved hypothetical protein [Streptococcus thermophilus CNRZ1066] >gi|116100471|gb|ABJ65617.1| condensin subunit ScpB [Streptococcus thermophilus LMD-9] (193 aa)
Score = 234, Expect = 3.4e-18, Identities = 57/185 (30%), Positives = 103/185 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRED 193
           +EA LF+AG +G+    +  +  + V      +E++  +Y+ D    L + +    YK+ TKPD + ++        K P+NQ +    +E L+I+AY  P TR+++ ++R  + +  + KL   GL+ EAG+ +AVG+P LY  T  F D  G++S+ +L  + + + ++E    E+E + F   RED
  S:     8 LEALLFVAGEDGLSLRTMAQLLEIPVTGLTQSLEKLQAKYKADEDTALCLLESSNTYKIVTKPDFACLLRD----YSKTPINQSLSRASLEVLSIVAYKQPITRAEVDDIRGVNSSGAIAKLQAFGLIREAGKKDAVGRPNLYATTDYFLDYIGINSLDEL--VAIDQLELE----EQETSLF---RED 183
>gi|138895859|ref|YP_001126312.1| LuxR family transcriptional regulator [Geobacillus thermodenitrificans NG80-2] >gi|196248751|ref|ZP_03147451.1| segregation and condensation protein B [Geobacillus sp. G11MC16] >gi|167016591|sp|A4IQG3|SCPB_GEOTN Segregation and condensation protein B >gi|134267372|gb|ABO67567.1| Transcriptional regulator LuxR family [Geobacillus thermodenitrificans NG80-2] >gi|196211627|gb|EDY06386.1| segregation and condensation protein B [Geobacillus sp. G11MC16] (209 aa)
Score = 234, Expect = 3.4e-18, Identities = 61/192 (31%), Positives = 107/192 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           K+++EA LF AG+EG+   ++ ++  +   + +AV+  +  +Y ++ +RG+ + ++   + L TK + +  +         + L+Q  +ETLAIIAY  P TR++I E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++++LP   LPE   +     E   FF+   E+  DE
  S:    19 KAIVEALLFAAGDEGLSLAQIAAVLDVDESEAKAVIAALQEDYSRE-ERGIQLMELAGVFLLATKKEHASYLKKLVEAPGASSLSQAALETLAIIAYRQPITRAEIEEIRGVKSDKPLQTLMARALIKEVGRAEGTGRPILYGTTAEFLDYFGLKTLEELPP--LPEWADDGELEREADLFFEKLAENLSDE 207
>gi|163941798|ref|YP_001646682.1| segregation and condensation protein B [Bacillus weihenstephanensis KBAB4] >gi|163863995|gb|ABY45054.1| segregation and condensation protein B [Bacillus weihenstephanensis KBAB4] (190 aa)
Score = 234, Expect = 3.6e-18, Identities = 56/172 (32%), Positives = 96/172 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           K++IE  LF+AG+EG++ +++  +  + V++    +EEM  E E    RGL + +  + Y+  TK + +              L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     7 KAIIEGLLFVAGDEGIYPEQIAKVLEVEVEEVLNSIEEMQKECEGS-NRGLQIVQYAKVYRFATKKEHASYYQKLIDTPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKETGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 177
>gi|119356330|ref|YP_910974.1| condensin subunit ScpB [Chlorobium phaeobacteroides DSM 266] >gi|119353679|gb|ABL64550.1| condensin subunit ScpB [Chlorobium phaeobacteroides DSM 266] (202 aa)
Score = 233, Expect = 4.2e-18, Identities = 53/166 (31%), Positives = 95/166 (57%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           I +K  +EA +F A  E V    ++ I    L +   +A++E++  EY     R   +RK+   Y+ F++ +   ++      K +  ++Q M+E LA+IAY  P T+++I ++R   P   L++L+E G +E  GR+++ GKP  Y  T +F D+F L S++DLP++
  S:     7 IVLKQQVEALVF-ASEEAVTLSTIRHIIGCSLGLAGLDAIVEQLNSEYASS-GRSFRIRKIAGGYRFFSESEFDALLKKLMAPKIRKRVSQSMLEVLAVIAYQQPVTKAEILQVRGVSPDYSLDRLLERGFIEVRGRADSPGKPLQYGTTKEFLDLFSLFSLRDLPKL 172
>gi|158320618|ref|YP_001513125.1| segregation and condensation protein B [Alkaliphilus oremlandii OhILAs] >gi|167016583|sp|A8MFG6|SCPB_ALKOO Segregation and condensation protein B >gi|158140817|gb|ABW19129.1| segregation and condensation protein B [Alkaliphilus oremlandii OhILAs] (185 aa)
Score = 233, Expect = 4.4e-18, Identities = 57/164 (34%), Positives = 91/164 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +KS IEA LF   +    KD L  +  +  ++ E V+ EMI E+    +RG+ + K+ + Y+L T+P+  + +   F  KQ   + Q  +ETLAIIAY  P T+++I E+R       +  L+E  L+EE GR E  G+P +Y  T  F  +F + S+ +LP +
  S:     6 IKSAIEAILFAWSDPLSIKD-LSEVLDIGTKEIEGVLAEMINEFNYS-KRGIQIIKMNDYYQLSTRPEHYEYLQKLFAPKQNRGITQAALETLAIIAYKQPITKTEIEEIRGVKCDKAISTLLEKELIEEQGRLEKTGRPIIYGTTINFLKVFSISSLDNLPNV 167
>gi|167404850|ref|ZP_02309624.1| hypothetical protein LmonocytFSL_16191 [Listeria monocytogenes FSL J2-003] (225 aa)
Score = 232, Expect = 5.1e-18, Identities = 51/164 (31%), Positives = 91/164 (55%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLP 171
           V+E+ LF AG+ G+  ++L  +  ++  +   ++E +   Y +   RGL++ ++   ++L TK   ++ +     +     L+Q  +ETLAIIAY  P TR ++ E+R       +  L+  GLV + GR +  G+  LY  T +F D FGL+S++DLP++  P
  S:     9 VLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNESADRGLILLELAGTFQLATKKAHAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAGRAKLYVTTSEFLDAFGLNSLEDLPKLADP 172
>gi|116333417|ref|YP_794944.1| transcriptional regulator [Lactobacillus brevis ATCC 367] >gi|116098764|gb|ABJ63913.1| condensin subunit ScpB [Lactobacillus brevis ATCC 367] (200 aa)
Score = 232, Expect = 5.4e-18, Identities = 63/189 (33%), Positives = 95/189 (50%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE----ELTYEEEINFFDTNREDNGDE 197
           IE+ LF++G+EG+    L + + L      A +E +  +Y  D    L +      Y+L TK   S +V   F       L+   +E LAIIAY  P TR +I E+R       ++KL+   LVE+AGR +  G+P LYQ +  F D FGL+ + +LP +    Q  E    E T +  +  F+     +GDE
  S:     7 IESLLFVSGDEGISVADLSAATGLMRPAVLATLERLAQKYAADEASALELMVNDTTYRLVTKEAASDLVKRYFENPLSTSLSPASLEVLAIIAYRQPITRIEIDEIRGVQSASTVQKLVLRRLVEDAGRLDEPGRPKLYQTSDYFLDYFGLEQLAELPPLPAAAQPSETTADEATGDLFLQAFNQQLNQSGDE 199
>gi|148377982|ref|YP_001256858.1| segregation and condensation protein B [Mycoplasma agalactiae PG2] >gi|148292028|emb|CAL59420.1| Segregation and condensation protein B [Mycoplasma agalactiae PG2] (192 aa)
Score = 232, Expect = 6.2e-18, Identities = 67/186 (36%), Positives = 98/186 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRL-SVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEE--EINFFDTNRED 193
           ++EA L++ G+EG+  +++K I  L ++ +   VM + +  Y  D  R L V    E +KL T+    + +     + +K+ L+   IE   I+AY  P TRSQI+ LR      +L  L+  G+VEE G S   G P LY VT KFYD F L S  +LP+  L E    + T  E  + N FD  R D
  S:     5 ILEALLYVQGDEGLTLEQVKDIFGLNTISEARKVMNDFVRAY-NDEDRALKVVNFNEVFKLATREAYKEYITKMVQVVKKHRLSNAAIEVAGIVAYKQPVTRSQINNLRGVASEQVLNTLLTKGVVEEVGISPTPGNPILYGVTNKFYDYFKLKSTYELPK--LTEFNYSDGTENEAKDFNLFDGIRVD 190
>gi|146295973|ref|YP_001179744.1| putative transcriptional regulator [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145409549|gb|ABP66553.1| condensin subunit ScpB [Caldicellulosiruptor saccharolyticus DSM 8903] (177 aa)
Score = 231, Expect = 6.9e-18, Identities = 62/169 (36%), Positives = 103/169 (60%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQK-NPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQ 173
           VKSV+E+ LF++  E +   K+  I  +S ++ E  +EE+  EY K+ +RG +V K  + Y L T P+ SK +   F  +QK + L+Q   E L+IIA N P TR +I  +R      +++ L+E GL++EAG+ + +GKP LY+VT  FY   G+ ++++L E ++  +
  S:     6 VKSVLESILFLSA-EPIEIAKIAKILDISEREVEDCIEELKEEY-KNQKRGFIVIKEEKGYTLVTNPENSKYIKEYFEFEQKQSSLSQAAYEVLSIIALNGPITRQEIERIRGVSSDNVIKSLLEKGLIKEAGKLDTIGKPTLYEVTELFYYSLGIQNLEELKEKIMQRE 173
>gi|11967880|emb|CAC19450.1| hypothetical protein [Streptococcus pneumoniae] (187 aa)
Score = 230, Expect = 8.4e-18, Identities = 56/160 (35%), Positives = 90/160 (56%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           IEA LF+AG +G+   +L  +  L     +  + ++  +YEKDP   L + +    Y+L TKP  ++I+        K P+NQ +    +ETL+IIAY  P TR +I  +R  + +  L KL    L++E G+ E +G+P LY  T  F D  G++ +++LP I
  S:     7 IEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQFAEILKE----YSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVI 166
>gi|15901703|ref|NP_346307.1| segregation and condensation protein B [Streptococcus pneumoniae TIGR4] >gi|15903732|ref|NP_359282.1| segregation and condensation protein B [Streptococcus pneumoniae R6] >gi|111657283|ref|ZP_01408048.1| hypothetical protein SpneT_02001500 [Streptococcus pneumoniae TIGR4] >gi|116516630|ref|YP_817105.1| segregation and condensation protein B [Streptococcus pneumoniae D39] >gi|148984327|ref|ZP_01817622.1| segregation and condensation protein B [Streptococcus pneumoniae SP3-BS71] >gi|148989668|ref|ZP_01821000.1| segregation and condensation protein B [Streptococcus pneumoniae SP6-BS73] >gi|148993333|ref|ZP_01822873.1| segregation and condensation protein B [Streptococcus pneumoniae SP9-BS68] >gi|148998739|ref|ZP_01826177.1| segregation and condensation protein B [Streptococcus pneumoniae SP11-BS70] >gi|149003916|ref|ZP_01828730.1| segregation and condensation protein B [Streptococcus pneumoniae SP14-BS69] >gi|149006470|ref|ZP_01830169.1| segregation and condensation protein B [Streptococcus pneumoniae SP18-BS74] >gi|149011260|ref|ZP_01832507.1| segregation and condensation protein B [Streptococcus pneumoniae SP19-BS75] >gi|149024999|ref|ZP_01836379.1| segregation and condensation protein B [Streptococcus pneumoniae SP23-BS72] >gi|168483407|ref|ZP_02708359.1| segregation and condensation protein B [Streptococcus pneumoniae CDC1873-00] >gi|168487317|ref|ZP_02711825.1| segregation and condensation protein B [Streptococcus pneumoniae CDC1087-00] >gi|168489847|ref|ZP_02714046.1| segregation and condensation protein B [Streptococcus pneumoniae SP195] >gi|168491810|ref|ZP_02715953.1| segregation and condensation protein B [Streptococcus pneumoniae CDC0288-04] >gi|168494209|ref|ZP_02718352.1| segregation and condensation protein B [Streptococcus pneumoniae CDC3059-06] >gi|168574936|ref|ZP_02720899.1| segregation and condensation protein B [Streptococcus pneumoniae MLV-016] >gi|169833931|ref|YP_001695241.1| segregation and condensation protein B [Streptococcus pneumoniae Hungary19A-6] >gi|182684818|ref|YP_001836565.1| segregation and condensation protein B [Streptococcus pneumoniae CGSP14] >gi|194398542|ref|YP_002038464.1| segregation and condensation protein B [Streptococcus pneumoniae G54] >gi|122278049|sp|Q04IT3|SCPB_STRP2 Segregation and condensation protein B >gi|41018030|sp|Q8DNI9|SCPB_STRR6 Segregation and condensation protein B >gi|41018116|sp|Q97NX6|SCPB_STRPN Segregation and condensation protein B >gi|14973378|gb|AAK75947.1| segregation and condensation protein B [Streptococcus pneumoniae TIGR4] >gi|15459365|gb|AAL00493.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] >gi|116077206|gb|ABJ54926.1| segregation and condensation protein B [Streptococcus pneumoniae D39] >gi|147755433|gb|EDK62482.1| segregation and condensation protein B [Streptococcus pneumoniae SP11-BS70] >gi|147758056|gb|EDK65061.1| segregation and condensation protein B [Streptococcus pneumoniae SP14-BS69] >gi|147761768|gb|EDK68731.1| segregation and condensation protein B [Streptococcus pneumoniae SP18-BS74] >gi|147764250|gb|EDK71181.1| segregation and condensation protein B [Streptococcus pneumoniae SP19-BS75] >gi|147923616|gb|EDK74729.1| segregation and condensation protein B [Streptococcus pneumoniae SP3-BS71] >gi|147924985|gb|EDK76067.1| segregation and condensation protein B [Streptococcus pneumoniae SP6-BS73] >gi|147928100|gb|EDK79119.1| segregation and condensation protein B [Streptococcus pneumoniae SP9-BS68] >gi|147929492|gb|EDK80487.1| segregation and condensation protein B [Streptococcus pneumoniae SP23-BS72] >gi|168996433|gb|ACA37045.1| segregation and condensation protein B [Streptococcus pneumoniae Hungary19A-6] >gi|172043273|gb|EDT51319.1| segregation and condensation protein B [Streptococcus pneumoniae CDC1873-00] >gi|182630152|gb|ACB91100.1| segregation and condensation protein B [Streptococcus pneumoniae CGSP14] >gi|183569807|gb|EDT90335.1| segregation and condensation protein B [Streptococcus pneumoniae CDC1087-00] >gi|183571711|gb|EDT92239.1| segregation and condensation protein B [Streptococcus pneumoniae SP195] >gi|183573871|gb|EDT94399.1| segregation and condensation protein B [Streptococcus pneumoniae CDC0288-04] >gi|183575783|gb|EDT96311.1| segregation and condensation protein B [Streptococcus pneumoniae CDC3059-06] >gi|183578964|gb|EDT99492.1| segregation and condensation protein B [Streptococcus pneumoniae MLV-016] >gi|194358209|gb|ACF56657.1| segregation and condensation protein B [Streptococcus pneumoniae G54] (189 aa)
Score = 230, Expect = 9.9e-18, Identities = 56/160 (35%), Positives = 90/160 (56%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           IEA LF+AG +G+   +L  +  L     +  + ++  +YEKDP   L + +    Y+L TKP  ++I+        K P+NQ +    +ETL+IIAY  P TR +I  +R  + +  L KL    L++E G+ E +G+P LY  T  F D  G++ +++LP I
  S:     7 IEALLFVAGEDGIRVRQLAELLSLPPTGIQQSLGKLAQKYEKDPDSSLALIETSGAYRLVTKPQFAEILKE----YSKAPINQSLSRAALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIKEDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVI 166
>gi|104773905|ref|YP_618885.1| putative segregation and condensation protein B [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|122397240|sp|Q1GAK5|SCPB_LACDA Segregation and condensation protein B >gi|103422986|emb|CAI97668.1| Putative segregation and condensation protein B [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (200 aa)
Score = 230, Expect = 1.0e-17, Identities = 52/160 (32%), Positives = 91/160 (56%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++A L++AG+ G+ K++L+ + +L+  + E++ + +  +   D   GL + ++ + YKL T  ++S +V + F       ++Q  +E LAI+AY  P TR +I E+R  + +  L+ L+  GLV+  G  +A G P LY  T  F   FG  S+ DLP I
  S:     8 LQALLYVAGDGGIKKEQLRDLLQLADPEIESLAKRLQEKLASDLDCGLQLLEINDEYKLTTSGEVSDLVEAYFNKDLTKNISQSALEILAIVAYRQPITRIEIDEIRGVNSSGALQTLVWRGLVKAQGVKDAPGHPKLYVTTDYFLQYFGYKSLADLPVI 167
>gi|160945261|ref|ZP_02092487.1| hypothetical protein FAEPRAM212_02780 [Faecalibacterium prausnitzii M21/2] >gi|158442992|gb|EDP19997.1| hypothetical protein FAEPRAM212_02780 [Faecalibacterium prausnitzii M21/2] (181 aa)
Score = 229, Expect = 1.4e-17, Identities = 52/164 (31%), Positives = 88/164 (53%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           + + +EA LF  G+  +  DKL    +L     +A +E +   Y+++   GL +  +   ++L TK   +  V      ++  PL    +ETL +IAYN P +R+ I ++R  D +  +  L+E GL+EEAGR +  G+P  ++ T  F  +FGL S+ DLP +
  S:     6 ILAAVEAMLFACGDP-IGADKLAQAVQLPQSSVDAALETLHTRYQRE-DSGLCLLHLNTRWQLATKTQWADCVRRVLDSRRAVPLGPAAMETLTVIAYNQPVSRAFIEQVRGVDSSSSVSGLLEKGLIEEAGRLDLPGRPVSFRTTDTFLRVFGLSSLADLPPV 167
>gi|16801130|ref|NP_471398.1| hypothetical protein lin2064 [Listeria innocua Clip11262] >gi|41018103|sp|Q92A58|SCPB_LISIN Segregation and condensation protein B >gi|16414565|emb|CAC97294.1| lin2064 [Listeria innocua] (198 aa)
Score = 228, Expect = 1.4e-17, Identities = 57/181 (31%), Positives = 97/181 (53%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           V+E+ LF AG+ G+  ++L  +  ++  +   ++E +   Y  +  RGL++ ++   ++L TK   ++ +     +     L+Q  +ETLAIIAY  P TR ++ E+R       +  L+  GLV + GR +  G+  LY  T +F D FGL+S+ DLP++  PE   E+    E   FFD
  S:     9 VLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNGNEDRGLILLELAGTFQLATKKAHAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAGRAKLYVTTSEFLDAFGLNSLDDLPKLADPEA--EDPDQSEMDLFFD 187
>gi|163763817|ref|ZP_02170877.1| putative transcriptional regulator [Bacillus selenitireducens MLS10] >gi|160355642|gb|EDP82295.1| putative transcriptional regulator [Bacillus selenitireducens MLS10] (197 aa)
Score = 228, Expect = 1.5e-17, Identities = 61/194 (31%), Positives = 98/194 (50%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNG 195
           S  VK+VIE  LF++G EG+ + ++  +  +  +  +  + EM  E      RGL + + G  Y+L TK + +              L+Q  +E LAIIAY  P +R +I ++R       +  L+   L+ EAGR E  G+  L+  T KF + FGL S+ +LPE+    + I+E   + E++ F   RED  
  S:     3 SQEVKAVIEGLLFVSGEEGIDEKQMMDVLSIDRKSLKFYLNEM-RELFASSGRGLQIVESGGVYQLTTKEEHAPFFKKLVQSPASTTLSQAALECLAIIAYRQPISRIEIEDIRGVKSERPIRTLVSKELIREAGRVEGTGRAILFGTTRKFLEQFGLTSLDELPEL---SEHIDEQDVQNELDLFHHMREDQA 192
>gi|51892940|ref|YP_075631.1| hypothetical protein STH1802 [Symbiobacterium thermophilum IAM 14863] >gi|81388762|sp|Q67NF6|SCPB_SYMTH Segregation and condensation protein B >gi|51856629|dbj|BAD40787.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM 14863] (219 aa)
Score = 228, Expect = 1.5e-17, Identities = 58/168 (34%), Positives = 91/168 (54%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M  N   +I  AL +A  E +   ++  +  L  +D   +M ++  +YE  P RGL +R++   Y L T+P+ ++ V      K +  L+   +ETLAIIAY  P T+++I  +R       LE L+E GL+E+ GR EA G+P LY  T +F   FGL  + +LP +
  S:     1 MIWNHGKMILEALLLASPEPLTIKRIAEVIGLDERDAALLMADLQKDYEA-PHRGLAIREMAGGYVLTTRPEAAEYVERLLQPKSRG-LSHAALETLAIIAYRQPITKAEIENVRGVKVDRALETLLERGLIEDKGRKEAPGRPILYGTTAEFLRYFGLRELSELPPV 166
>gi|77408476|ref|ZP_00785214.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae COH1] >gi|77172918|gb|EAO76049.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae COH1] (217 aa)
Score = 228, Expect = 1.6e-17, Identities = 58/188 (30%), Positives = 101/188 (53%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGD 196
           IEA LF+AG +G+   ++  +  L+       +E++   YE+D    L++ +  + YKL TK     ++        K P+NQ +    +E L+IIAY  P TR +I ++R  + +  + +LI  GL++EAG+ E +G+P LY+ T  F D  G++ + DL    +    IE +  +EE++ F  +     D
  S:     7 IEALLFVAGEDGLSLRQMAELLSLTPSALIQQLEKLAKRYEEDDDSSLLLLETAQTYKLVTKDSYMTLLRD----YAKAPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLGRPNLYETTNYFLDYMGINQLDDL----IDASSIELV--DEEVSLFSMDSXXTED 188
>gi|157692822|ref|YP_001487284.1| segregation and condensation protein B [Bacillus pumilus SAFR-032] >gi|167016586|sp|A8FEQ7|SCPB_BACP2 Segregation and condensation protein B >gi|157681580|gb|ABV62724.1| segregation and condensation protein B [Bacillus pumilus SAFR-032] (197 aa)
Score = 227, Expect = 1.9e-17, Identities = 63/188 (33%), Positives = 103/188 (54%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTN 190
           +N K++IEA L+ AG+EG+ K +L S+  +       +M  +  EY+K  +RG+ + +  ++Y L TK + S  +        K  L+Q  +E LAI++Y  P TRS++ E+R      +L  L+   L+ E GR++  G+  LY  TP F + FGL ++ +LP   LPE  +E    +EE + F  N
  S:     6 VNWKAIIEALLYAAGDEGLTKKQLMSVLEVEEVALLDMMSAVKEEYQKQ-ERGIELIEYADSYMLLTKKEYSIYLKKLVETPSKG-LSQAALEVLAIVSYKQPITRSEVEEIRGVKSERVLHSLVAKALLCEVGRADGPGRAILYGTTPTFLEQFGLKALDELPP--LPEN-VEADGVQEEADLFFEN 188
>gi|29376103|ref|NP_815257.1| hypothetical protein EF1539 [Enterococcus faecalis V583] >gi|41017980|sp|Q834U3|SCPB_ENTFA Segregation and condensation protein B >gi|29343565|gb|AAO81327.1| conserved hypothetical protein TIGR00281 [Enterococcus faecalis V583] (201 aa)
Score = 227, Expect = 2.0e-17, Identities = 63/188 (33%), Positives = 100/188 (53%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEIN-FFDTNREDN 194
           S IEA LF+ G EG+  ++L  +   S       + ++   Y  D +  L + +VG ++ L TK   + ++         N L+Q  +ETL+IIAY  P +R +I E+R    +  ++KL+   L+EE GR +  G+  LY  T  F D FGL S+ +LP+I   +Q  +EL  E  ++ FFD  +E N
  S:     5 SQIEAILFVVGEEGIGLEELAYLLEKSTAKTYEELTKLKEHYASDNKSALNILEVGNHFVLTTKKKYASLLKKYAQSPMSNALSQAALETLSIIAYKQPISRIEIDEIRGVQTSGSIQKLVARQLIEEKGRVDGPGRAILYGTTKYFMDYFGLKSLDELPDI---QQMEDELEEELPMDLFFDRYQETN 190
>gi|157151269|ref|YP_001450947.1| segregation and condensation protein B [Streptococcus gordonii str. Challis substr. CH1] >gi|189046146|sp|A8AYT7|SCPB_STRGC Segregation and condensation protein B >gi|157076063|gb|ABV10746.1| segregation and condensation protein B [Streptococcus gordonii str. Challis substr. CH1] (188 aa)
Score = 227, Expect = 2.0e-17, Identities = 57/171 (33%), Positives = 94/171 (54%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           S IEA LF+AG +G+   ++  I  +        +E++  +YE D    L + +    YKL TK   ++++ +      K+P+NQ +    +ETL+IIAY  P TR +I ++R  + +  L KL+   LV E G+ E +G+P LY  T  F D  G++ +++LP +   E   EE
  S:     5 SEIEALLFVAGEDGLKVRQIAEILSIPPTGVSQSLEKLTAKYEADADCSLALLETSNTYKLVTKQAFAELLRA----YSKSPINQSLSRAALETLSIIAYKQPITRVEIDDIRGVNSSGALAKLLAFELVREDGKKEVLGRPNLYVTTEYFLDYMGINHLEELPVVTDTELVAEE 175
>gi|116873392|ref|YP_850173.1| hypothetical protein lwe1976 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123461279|sp|A0AK62|SCPB_LISW6 Segregation and condensation protein B >gi|116742270|emb|CAK21394.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (198 aa)
Score = 227, Expect = 2.0e-17, Identities = 51/165 (30%), Positives = 92/165 (55%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           ++E+ LF AG+ G+  ++L  +  ++  +   ++E +   Y  +  RGL++ ++   ++L TK   ++ +     +     L+Q  +ETLAIIAY  P TR ++ E+R       +  L+  GLV + GR +  G+  LY  T +F D FGL+S++DLP++  PE
  S:     9 ILESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNGNADRGLILLELAGTFQLATKKAHAEYLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAGRAKLYVTTSEFLDAFGLNSLEDLPKLADPE 173
>gi|116512119|ref|YP_809335.1| segregation and condensation protein B [Lactococcus lactis subsp. cremoris SK11] >gi|125624023|ref|YP_001032506.1| segregation and condensation protein B [Lactococcus lactis subsp. cremoris MG1363] >gi|123320364|sp|Q02YQ9|SCPB_LACLS Segregation and condensation protein B >gi|167016592|sp|A2RKH6|SCPB_LACLM Segregation and condensation protein B >gi|116107773|gb|ABJ72913.1| condensin subunit ScpB [Lactococcus lactis subsp. cremoris SK11] >gi|124492831|emb|CAL97786.1| segregation and condensation protein B [Lactococcus lactis subsp. cremoris MG1363] (188 aa)
Score = 227, Expect = 2.3e-17, Identities = 56/166 (33%), Positives = 95/166 (57%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +N  +  E  LF++G  G+   +L S++ +S Q  +  ++ +  +Y  D +  L + +    Y++ TK D S+I+ +      K PLNQ +    +E L+IIAY  P TR +I +LR  + + +L  L    LVE+ G+ EA G+P LY  T  F D  G++++++LPEI
  S:     1 MNKTATCELLLFVSGEAGLTLTELSSLTEMSKQACQQQIDYLKEKYHSDRESALTIIETAGKYRMATKEDFSEILKN----YAKTPLNQSLSKSALEVLSIIAYKQPLTRIEIDQLRGVNSSGVLSTLRAFDLVEKVGQVEAPGRPSLYATTEFFLDYIGINNLEELPEI 166
>gi|153202943|ref|ZP_01944381.1| segregation and condensation protein B [Listeria monocytogenes HPB2262] >gi|133735013|gb|EBA36711.1| segregation and condensation protein B [Listeria monocytogenes HPB2262] (198 aa)
Score = 226, Expect = 2.4e-17, Identities = 56/181 (30%), Positives = 96/181 (53%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           V+E+ LF AG+ G+  ++L  +  ++  +   ++E +   Y     RGL++ ++   ++L TK   ++ +     +     L+Q  +ETLAIIAY  P TR ++ E+R       +  L+  GLV + GR +  G+  LY  T +F D FGL+S++DLP++  P    +E    E   FFD
  S:     9 VLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSDRYNGSADRGLILLELAGTFQLATKKAHAEFLRKLVDVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAGRAKLYVTTSEFLDAFGLNSLEDLPKLADP--ATDEPDQNEMDLFFD 187
>gi|118586874|ref|ZP_01544308.1| transcriptional regulator [Oenococcus oeni ATCC BAA-1163] >gi|118432706|gb|EAV39438.1| transcriptional regulator [Oenococcus oeni ATCC BAA-1163] (196 aa)
Score = 226, Expect = 2.7e-17, Identities = 55/162 (33%), Positives = 94/162 (58%)
  Q:    11 AALFIAGNEGVHKDKLKSISRLSVQDFEAV---MEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           A +F++G++G+    L+SIS+++  D  AV   +E +    E+D Q  + + +  + Y+L TK   + ++   +     N L++  +ETL IIAY  P TR ++ ++R  + +  + +L+   L++E+GR   VG+P LY  T  F D FGL  I DLPE+  PE
  S:    12 ALVFVSGDDGI---DLQSISKITGFDRSAVQSDLESLSNRLEEDQQNPIKLVENDQVYRLVTKSKFAPLLKKYYQTPVANSLSKASLETLTIIAYKQPVTRIEVDKIRGVNSSGAISRLVSRELIQESGRKAEVGRPLLYTTTNFFLDYFGLKKIDDLPELPDPE 173
>gi|89895033|ref|YP_518520.1| hypothetical protein DSY2287 [Desulfitobacterium hafniense Y51] >gi|89334481|dbj|BAE84076.1| hypothetical protein [Desulfitobacterium hafniense Y51] (196 aa)
Score = 226, Expect = 2.9e-17, Identities = 59/176 (33%), Positives = 100/176 (56%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEI 184
           +EA LF+A ++ + K++L  I +LS +D   ++ ++   Y   P  G+ + +V E YKL TKP++S  + + +  +    L+   +E LAIIAY  P TR ++  +R       L  L+E GLV++ GR E  G+P LY  T +F   FGL S+++LP++    + ++E    EE+
  S:    11 VEALLFVA-DKPLTKERLAEILQLSSEDIAEILYDLKQRYAA-PASGVTLIEVNEGYKLGTKPEMSAYIETLYH-QPSQGLSGAALEVLAIIAYKQPVTRGEVDFIRGVQSDRSLGTLVEKGLVKDVGRKEGPGRPILYGTTEQFLIHFGLKSLEELPDLNF--ESMQEAALAEEL 181
>gi|16803989|ref|NP_465474.1| hypothetical protein lmo1950 [Listeria monocytogenes EGD-e] >gi|47097093|ref|ZP_00234663.1| segregation and condensation protein B [Listeria monocytogenes str. 1/2a F6854] >gi|153175177|ref|ZP_01930572.1| segregation and condensation protein B [Listeria monocytogenes FSL N3-165] >gi|153179999|ref|ZP_01933138.1| segregation and condensation protein B [Listeria monocytogenes F6900] >gi|153183435|ref|ZP_01934295.1| segregation and condensation protein B [Listeria monocytogenes J0161] >gi|153191446|ref|ZP_01938666.1| segregation and condensation protein B [Listeria monocytogenes J2818] >gi|153196457|ref|ZP_01940827.1| segregation and condensation protein B [Listeria monocytogenes 10403S] >gi|167212661|ref|ZP_02282968.1| hypothetical protein LmonL_17550 [Listeria monocytogenes LO28] >gi|41018095|sp|Q8Y5V5|SCPB_LISMO Segregation and condensation protein B >gi|16411403|emb|CAD00028.1| lmo1950 [Listeria monocytogenes] >gi|47014538|gb|EAL05501.1| segregation and condensation protein B [Listeria monocytogenes str. 1/2a F6854] >gi|126943726|gb|EBA21443.1| segregation and condensation protein B [Listeria monocytogenes J0161] >gi|127633918|gb|EBA23310.1| segregation and condensation protein B [Listeria monocytogenes 10403S] >gi|127765225|gb|EBA25575.1| segregation and condensation protein B [Listeria monocytogenes J2818] >gi|133729630|gb|EBA31328.1| segregation and condensation protein B [Listeria monocytogenes FSL N3-165] >gi|133732174|gb|EBA33872.1| segregation and condensation protein B [Listeria monocytogenes F6900] (198 aa)
Score = 225, Expect = 3.2e-17, Identities = 56/181 (30%), Positives = 97/181 (53%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           V+E+ LF AG+ G+  ++L  +  ++  +   ++E +   Y +   RGL++ ++   ++L TK   ++ +     +     L+Q  +ETLAIIAY  P TR ++ E+R       +  L+  GLV + GR +  G+  LY  T +F D FGL+S++DLP++  P    +E    E   FFD
  S:     9 VLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSERYNESADRGLILLELAGTFQLATKKAHAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAGRAKLYVTTSEFLDAFGLNSLEDLPKLADP--ATDEPDQNEMDLFFD 187
>gi|78188519|ref|YP_378857.1| putative transcriptional regulator [Chlorobium chlorochromatii CaD3] >gi|78170718|gb|ABB27814.1| condensin subunit ScpB [Chlorobium chlorochromatii CaD3] (224 aa)
Score = 225, Expect = 3.4e-17, Identities = 53/164 (32%), Positives = 93/164 (56%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQ--DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           V+  IEA +F A NE V    ++ ++ L ++  + + ++E +  EYE    R   +  +   Y++ T P+ S ++      K +   ++ ++E LA+IAYN P TR+ I ++R   P   +E+L+  GL+E  GR++A G+P  Y  T  F D+F L S+ DLP++
  S:    27 VQQQIEAIVF-AANEVVTIATIRQVTGLLLRPAEIKNMVERLNEEYEAT-GRTFRIHAIAGGYRMLTCPEFSDLLRPLNAPKTRRAFSRSLLEVLAVIAYNQPVTRADIQQVRGVSPDYAVERLLHHGLIEVRGRADAPGRPLQYGTTAAFLDMFHLSSLTDLPKL 190
>gi|46908184|ref|YP_014573.1| hypothetical protein LMOf2365_1980 [Listeria monocytogenes str. 4b F2365] >gi|47093379|ref|ZP_00231146.1| segregation and condensation protein B [Listeria monocytogenes str. 4b H7858] >gi|153167805|ref|ZP_01927890.1| segregation and condensation protein B [Listeria monocytogenes FSL N1-017] >gi|167015105|ref|ZP_02277638.1| hypothetical protein LmonFS_12039 [Listeria monocytogenes FSL J1-194] >gi|167214775|ref|ZP_02285082.1| hypothetical protein LmonoFSL_15932 [Listeria monocytogenes FSL R2-503] >gi|167217920|ref|ZP_02287556.1| hypothetical protein LmonocFSL_16056 [Listeria monocytogenes FSL J1-175] >gi|56749621|sp|Q71Y64|SCPB_LISMF Segregation and condensation protein B >gi|46881454|gb|AAT04750.1| segregation and condensation protein B [Listeria monocytogenes str. 4b F2365] >gi|47018250|gb|EAL09016.1| segregation and condensation protein B [Listeria monocytogenes str. 4b H7858] >gi|133726676|gb|EBA28374.1| segregation and condensation protein B [Listeria monocytogenes FSL N1-017] (198 aa)
Score = 225, Expect = 3.4e-17, Identities = 56/181 (30%), Positives = 96/181 (53%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           V+E+ LF AG+ G+  ++L  +  ++  +   ++E +   Y     RGL++ ++   ++L TK   ++ +     +     L+Q  +ETLAIIAY  P TR ++ E+R       +  L+  GLV + GR +  G+  LY  T +F D FGL+S++DLP++  P    +E    E   FFD
  S:     9 VLESLLFAAGDAGLSTEQLTEVMEITHIEALNLLELLSDRYNGSADRGLILLELAGTFQLATKKAHAEFLRKLVEVPSNTVLSQASLETLAIIAYRQPVTRMEVDEVRGVQTDGPIRTLVAKGLVTDKGRVDGAGRAKLYVTTSEFLDAFGLNSLEDLPKLADP--ATDEPDQNEMDLFFD 187
>gi|109645368|ref|ZP_01369288.1| putative transcriptional regulator [Desulfitobacterium hafniense DCB-2] >gi|109643317|gb|EAT52870.1| putative transcriptional regulator [Desulfitobacterium hafniense DCB-2] (196 aa)
Score = 225, Expect = 3.5e-17, Identities = 62/185 (33%), Positives = 105/185 (56%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINF----FDTNRED 193
           +EA LF+A ++ + K++L  I +LS +D   ++ ++   Y   P  G+ + +V E YKL TKP++S  + + +  +    L+   +E LAIIAY  P TR ++  +R       L  L+E GLV++ GR E  G+P LY  T +F   FGL S+++LP++    + ++E    EE++     F  + ED
  S:    11 VEALLFVA-DKPLTKERLAEILQLSSEDIAEILYDLKQRYAA-PASGVTLIEVNEGYKLGTKPEMSAYIETLYH-QPAQGLSGAALEVLAIIAYKQPVTRGEVDFIRGVQSDRSLGTLVEKGLVKDVGRKEGPGRPILYGTTEQFLIHFGLKSLEELPDLNF--ESMQEAALAEELSMGAGEFGQDNED 194
>gi|153953881|ref|YP_001394646.1| segregation and condensation protein B [Clostridium kluyveri DSM 555] >gi|146346762|gb|EDK33298.1| ScpB [Clostridium kluyveri DSM 555] (192 aa)
Score = 225, Expect = 3.6e-17, Identities = 61/165 (36%), Positives = 90/165 (54%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           N  S+IE+ LF++G E +   ++ +I   +++    ++ EM FEYE +  RG+ +    + Y L TK + S  V        +  L++  +ETLAIIAY  P TR  I E+R       L  L+E  L+EE GR    G+P LY  T +F   FGLDSIK++P I
  S:    14 NYFSIIESLLFVSG-EPLTLKQIAAIIGCNLEYTRDLINEMAFEYE-NCSRGIKILNSNDKYSLVTKSENSGYVEKLLKNNLRQSLSRAALETLAIIAYMQPVTRIDIDEIRGVKSDRALMTLMEKKLIEENGRLSVPGRPILYVTTEEFLKYFGLDSIKEIPGI 176
>gi|22537734|ref|NP_688585.1| segregation and condensation protein B [Streptococcus agalactiae 2603V/R] >gi|25011683|ref|NP_736078.1| segregation and condensation protein B [Streptococcus agalactiae NEM316] >gi|76787148|ref|YP_330212.1| segregation and condensation protein B [Streptococcus agalactiae A909] >gi|77406896|ref|ZP_00783921.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae H36B] >gi|77412366|ref|ZP_00788677.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae CJB111] >gi|77414378|ref|ZP_00790533.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae 515] >gi|41017953|sp|Q7ZAL2|SCPB_STRA5 Segregation and condensation protein B >gi|41017955|sp|Q7ZAL6|SCPB_STRA3 Segregation and condensation protein B >gi|123601423|sp|Q3JZU1|SCPB_STRA1 Segregation and condensation protein B >gi|22534624|gb|AAN00458.1|AE014264_13 conserved hypothetical protein TIGR00281 [Streptococcus agalactiae 2603V/R] >gi|24413223|emb|CAD47302.1| unknown [Streptococcus agalactiae NEM316] >gi|76562205|gb|ABA44789.1| segregation and condensation protein B [Streptococcus agalactiae A909] >gi|77159568|gb|EAO70724.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae 515] >gi|77161586|gb|EAO72586.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae CJB111] >gi|77174505|gb|EAO77349.1| conserved hypothetical protein TIGR00281 [Streptococcus agalactiae H36B] (194 aa)
Score = 224, Expect = 4.1e-17, Identities = 57/186 (30%), Positives = 101/186 (54%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDN 194
           IEA LF+AG +G+   ++  +  L+       +E++   YE+D    L++ +  + YKL TK     ++        K P+NQ +    +E L+IIAY  P TR +I ++R  + +  + +LI  GL++EAG+ E +G+P LY+ T  F D  G++ + DL +    E   EE++     +    ++E+N
  S:     7 IEALLFVAGEDGLSLRQMAELLSLTPSALIQQLEKLAKRYEEDDDSSLLLLETAQTYKLVTKDSYMTLLRD----YAKAPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLGRPNLYETTNYFLDYMGINQLDDLIDASSIELVDEEVSLFSMDSINTEDKENN 192
>gi|56963581|ref|YP_175312.1| transcriptional regulator [Bacillus clausii KSM-K16] >gi|81366278|sp|Q5WH04|SCPB_BACSK Segregation and condensation protein B >gi|56909824|dbj|BAD64351.1| transcriptional regulator [Bacillus clausii KSM-K16] (193 aa)
Score = 224, Expect = 4.3e-17, Identities = 60/185 (32%), Positives = 98/185 (52%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLS----VQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRED 193
           IE  LF+ G++G+   ++  +  +S    +Q  E + E+M  E     +RG+ + ++   Y+L TK + + +            L++  +ETLAI+AY  P TR++I E+R       L+ L+   L+EE GR+   G+  LY  TP F D FGL+S+ DLP+  L E  + E   +E   FF+    D
  S:    11 IEGLLFVTGDDGISPTEMAELVEISEDEVIQLLEVLSEQMAKE-----ERGIRLARLANRYRLTTKVEHADMYKKLASSPIHGGLSRAALETLAIVAYKQPITRAEIDEVRGVKSEKALQSLVSKLLIEECGRASGTGRAILYGTTPYFLDHFGLESLADLPD--LKELDLNEEEQDETDLFFEKLNAD 192
>gi|160947163|ref|ZP_02094330.1| hypothetical protein PEPMIC_01095 [Peptostreptococcus micros ATCC 33270] >gi|158446297|gb|EDP23292.1| hypothetical protein PEPMIC_01095 [Peptostreptococcus micros ATCC 33270] (194 aa)
Score = 224, Expect = 4.6e-17, Identities = 56/163 (34%), Positives = 93/163 (57%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           K VIE  LF+ G+  +  D +  +  + +++     +E++ E+E   +RGLV++K+  +Y++ T+ +   I++  F       L    +ETLAIIAY  P TR +I E+R       +E L+    +EEAGR + +GKP +Y+ T  F + F L S+KDLP+I
  S:     7 KQVIEQLLFVYGDP-LKIDDIAKVLDIPIKEATVYADELVEEFEFQ-KRGLVIQKISNHYQIKTRKEYHDIISKLFEKVTMKHLTNSTLETLAIIAYKQPITRQEIEEIRGVKCNSSIETLMSKDFIEEAGRLDRIGKPIIYKTTLNFLNQFNLKSLKDLPDI 167
>gi|167772313|ref|ZP_02444366.1| hypothetical protein ANACOL_03690 [Anaerotruncus colihominis DSM 17241] >gi|167665416|gb|EDS09546.1| hypothetical protein ANACOL_03690 [Anaerotruncus colihominis DSM 17241] (194 aa)
Score = 224, Expect = 4.6e-17, Identities = 46/119 (38%), Positives = 74/119 (62%)
  Q:    58 VRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP------EIVLPEQKIE 176
           V ++G+  +L T  D + ++ +   +++  PL+Q  +E LA+IAYN P TR+ I ++R  D + ++  LIE  L+EEAGR +  G+P  Y+ TP F   FGL+S+  LP      E  LP+  +E
  S:    56 VLRLGDRLQLCTSSDYAAVIRAALELRRSAPLSQAALEVLAVIAYNQPVTRAFIEQVRGVDSSGVVNSLIEKSLIEEAGRLDLPGRPIAYRTTPDFLRCFGLESLDKLPALPSTDEDALPDDVLE 180
>gi|116491035|ref|YP_810579.1| condensin subunit ScpB [Oenococcus oeni PSU-1] >gi|116091760|gb|ABJ56914.1| condensin subunit ScpB [Oenococcus oeni PSU-1] (196 aa)
Score = 223, Expect = 5.8e-17, Identities = 54/160 (33%), Positives = 93/160 (58%)
  Q:    13 LFIAGNEGVHKDKLKSISRLSVQDFEAV---MEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           +F++G++G+    L+SIS+++  D  AV   +E +    E+D Q  + + +  + Y+L TK   + ++   +     N L++  +ETL IIAY  P TR ++ ++R  + +  + +L+   L++E+GR   VG+P LY  T  F D FGL  I DLPE+  PE
  S:    14 VFVSGDDGI---DLQSISKITGFDRSAVQIDLESLSNRLEEDQQNPIKLVENDQVYRLVTKSKFAPLLKKYYQTPVANSLSKASLETLTIIAYKQPVTRIEVDKIRGVNSSGAISRLVSRELIQESGRKAEVGRPLLYTTTNFFLDYFGLKKIDDLPELPDPE 173
>gi|110597202|ref|ZP_01385491.1| Prokaryotic chromosome segregation and condensation protein ScpB [Chlorobium ferrooxidans DSM 13031] >gi|110341393|gb|EAT59858.1| Prokaryotic chromosome segregation and condensation protein ScpB [Chlorobium ferrooxidans DSM 13031] (199 aa)
Score = 222, Expect = 8.4e-17, Identities = 54/175 (30%), Positives = 95/175 (54%)
  Q:     9 IEAALFIAGNEGVHKDKLKSIS--RLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           IEA +F A  E V    ++ ++         +AV++++  EYE    R   + ++   Y+  + P+ +  +      K +  L++ ++E LA+IAYN P TR++I ++R   P   +++L+  G +E  GR+E  GKP  Y  T  F D+F L S+KDLP++    ++I E+  E E
  S:    12 IEAVIF-ASEEAVTIQTIRQVTGREFDSAGLQAVIDQLNSEYEFT-GRTFRIHRIAGGYRFLSTPEFADTIKKLLAPKIQRRLSRSILEVLAVIAYNQPVTRAEIQQIRGVSPEYAIDRLLHRGFIEVRGRAETPGKPLQYGTTRDFLDLFHLSSLKDLPKL----REIREILQENE 182
>gi|52080835|ref|YP_079626.1| SMC interacting protein [Bacillus licheniformis ATCC 14580] >gi|52786206|ref|YP_092035.1| YpuH [Bacillus licheniformis ATCC 14580] >gi|81385179|sp|Q65HX2|SCPB_BACLD Segregation and condensation protein B >gi|52004046|gb|AAU23988.1| SMC interacting protein [Bacillus licheniformis ATCC 14580] >gi|52348708|gb|AAU41342.1| YpuH [Bacillus licheniformis DSM 13] (197 aa)
Score = 220, Expect = 1.3e-16, Identities = 60/188 (31%), Positives = 105/188 (55%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTN 190
           +N K+++EA L+ AG+EG+ K +L S+  +   +   +M ++   YEK+  RG+ + +  + Y L TK + +  +        K  L+Q  +E LAI++Y  P TR+++ E+R      +L+ L+   L+ E GR++  G+  LY  T  F + FGL ++++LP   LPE  +EE   +EE + F  N
  S:     6 VNWKAIVEALLYAAGDEGLTKKQLLSVLEVDEAELLDIMLDVKETYEKE-DRGIELVEYADTYMLSTKKEFAVYLKKLIEAPSKG-LSQAALEVLAIVSYKQPITRAEVEEIRGVKSERILQSLVAKALLCEVGRADGPGRAILYGTTETFLEQFGLKTLEELPP--LPEN-VEEDGVQEEADLFFEN 188
>gi|154248329|ref|YP_001419287.1| putative transcriptional regulator [Xanthobacter autotrophicus Py2] >gi|154162414|gb|ABS69630.1| putative transcriptional regulator [Xanthobacter autotrophicus Py2] (242 aa)
Score = 218, Expect = 2.1e-16, Identities = 60/159 (37%), Positives = 90/159 (56%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQ-DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           VIEA LF +    V    LK    LS + D  A+ME +  +Y +   RG+ + K    + L T PD++++VA    + +   L++  IE LAI+AY+ P TR++I E+R    +   L+ L+E G V   GR +A G+P  Y  TP F   FGLD+++DLP
  S:    29 VIEALLFTSSGP-VDARALKP--HLSNEADLAALMEALTADYAR---RGVNIMKAAGGWMLRTAPDLARVVAGP--VPEARKLSRAAIEVLAIVAYHQPVTRAEIEEIRGVSTSKGTLDVLLETGWVRLRGRRKAPGRPVTYGTTPAFLVQFGLDAVQDLP 181
>gi|126650122|ref|ZP_01722355.1| hypothetical protein BB14905_02590 [Bacillus sp. B14905] >gi|126593294|gb|EAZ87256.1| hypothetical protein BB14905_02590 [Bacillus sp. B14905] (192 aa)
Score = 218, Expect = 2.1e-16, Identities = 53/158 (33%), Positives = 90/158 (56%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIF---EYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSI 162
           ++S IEA LF+ G++G+    +K +S+L  +  E +++ M      Y++D  RG+ V+++   ++L TK D++  +           L+Q  +E LAI+AY  P TR  I +LR       ++ L+  GL++E GRSE  G+  LY  T +F   FGL+S+
  S:     2 LQSKIEALLFVVGDDGL---TIKQLSQLLGEQDEIIIQAMDALRKVYDEDLARGITVKEMAGVFQLITKSDLADTIQRLVENPTAQSLSQASLEVLAIVAYKQPITRVAIEDLRGVKCERPIQTLVSRGLIKEVGRSEGTGRAILYGTTKEFLHYFGLNSV 159
>gi|146319354|ref|YP_001199066.1| segregation and condensation protein B [Streptococcus suis 05ZYH33] >gi|146321559|ref|YP_001201270.1| segregation and condensation protein B [Streptococcus suis 98HAH33] >gi|145690160|gb|ABP90666.1| Predicted transcriptional regulator containing the HTH domain [Streptococcus suis 05ZYH33] >gi|145692365|gb|ABP92870.1| Predicted transcriptional regulator containing the HTH domain [Streptococcus suis 98HAH33] (191 aa)
Score = 218, Expect = 2.4e-16, Identities = 59/194 (30%), Positives = 104/194 (53%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDN 194
           M +N  + IE  LF+AG +G+    L  +  +        +E++  +Y  D   GL + +    YKL TK + + ++     I  K P+NQ M    +ETL+I+AY  P TR ++ ++R  + +  + KL    L+ E G+ E +G+P LY  T  F D  G++S+++LP++     +I+ +  E E+ F + N  +N
  S:     1 MKMNRLAEIEVLLFVAGEDGLTLRNLAEMLEMQPTAVSQQLEKLSEKYMADKASGLAILESSNRYKLVTKKEYANLLR----IYAKTPINQTMSRALLETLSIVAYKQPITRIEVDDIRGVNSSGAISKLQAFDLIRENGKKEVLGRPNLYVTTDYFLDYMGINSLEELPDV----SEIDLIQEETEL-FVERNELEN 189
>gi|83816819|ref|YP_445617.1| segregation and condensation protein B [Salinibacter ruber DSM 13855] >gi|83758213|gb|ABC46326.1| segregation and condensation protein B [Salinibacter ruber DSM 13855] (248 aa)
Score = 217, Expect = 3.3e-16, Identities = 55/180 (30%), Positives = 102/180 (56%)
  Q:     4 NVKSVIEAA--LFIAGNEGVHKDKLKSI-------SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           N  +++EAA  +  A +E V   ++ +I       S  S  D  A ++ +   YE+   R   V+     Y++ T+  +S    + +  +Q+  L++ ++ETLA+IAY  P TR ++  +R  +    + KL+E+ L    GR+E+VG+P LY  T +F + FGLD++ DLP +   E  +++  +++E
  S:    24 NDHTLVEAAEAILFAADEPVSASRIATIVGDVTGRSEPSEDDVAAALDRLNTTYEEH-DRAFEVKSWAGGYRMVTRAPLSPYAKTFYVEEQETTLSRSLMETLAVIAYRQPVTRPEVDFVRGVNSDYAIRKLLEMDLASVEGRAESVGRPLLYGTTDRFLEQFGLDALDDLPTLREVEDLLDDPAFDDE 211
>gi|41018135|sp|Q9EUR1|SCPB_STRMT Segregation and condensation protein B >gi|11967874|emb|CAC19445.1| hypothetical protein [Streptococcus mitis] (189 aa)
Score = 217, Expect = 3.3e-16, Identities = 56/160 (35%), Positives = 88/160 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           IEA LF+ G + +   +L  +  L     +  +E++  +YEKD    L + + G  Y+L TKP  S+I+        K P+NQ +    +ETL+IIAY  P TR +I  +R  + +  L KL    L+ E G+ E +G+P LY  T  F D  G++ +++LP I
  S:     7 IEALLFVRGEDWIRVRQLAELLSLPPTGIQQSLEKLSQKYEKDLDSSLDLIETGGAYRLVTKPQFSEILKE----YSKAPINQSLSRPALETLSIIAYKQPITRIEIDAIRGVNSSGALAKLQAFDLIREDGKKEVLGRPNLYVTTDYFLDYMGINHLEELPVI 166
>gi|167037543|ref|YP_001665121.1| chromosome segregation and condensation protein, ScpB [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040205|ref|YP_001663190.1| putative transcriptional regulator [Thermoanaerobacter sp. X514] >gi|166854445|gb|ABY92854.1| putative transcriptional regulator [Thermoanaerobacter sp. X514] >gi|166856377|gb|ABY94785.1| chromosome segregation and condensation protein, ScpB [Thermoanaerobacter pseudethanolicus ATCC 33223] (168 aa)
Score = 216, Expect = 3.7e-16, Identities = 55/160 (34%), Positives = 89/160 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           IEA LF AG   V    L  +  LS ++   V+ ++   Y+++  RGL +    +  ++ T  +  +IV    G++ K  L+Q  +E LAIIAYN P TR++I  +R       +  L+E  L++E+GR+ + G+P LY  T  F   FG+ S+K+LP+I
  S:     7 IEAILFAAGGP-VKLRTLCEVVGLSQEEIVDVVNKLKEYYDRE-NRGLDIIFFEDKVQMCTNDNYGEIVRQALGLEIKQGLSQAALEVLAIIAYNQPITRAEIERIRGVKSDKAINTLLEYNLIKESGRALSAGRPILYTTTEDFLKYFGIKSLKELPQI 164
>gi|161507453|ref|YP_001577407.1| hypothetical protein lhv_1055 [Lactobacillus helveticus DPC 4571] >gi|160348442|gb|ABX27116.1| hypothetical protein lhv_1055 [Lactobacillus helveticus DPC 4571] (197 aa)
Score = 216, Expect = 4.2e-16, Identities = 50/160 (31%), Positives = 82/160 (51%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +EA L+ AG+ G+ +  L  +  +  +  + V + +  +  +D   GL +  +   YKL T P  +KI+   F       L+Q  +E LAI+AY  P TR +I ++R  + +  L+ L+  GL++  G+ +A G P LY  T  F   F   S+ DLP I
  S:     8 LEALLYAAGDNGLEEQNLTEMLEIDGESLDKVAQNLQQKLTQDADSGLQLIHIAHTYKLTTSPQTAKIIEKYFQKDLTKNLSQSALEILAIVAYRQPITRVEIDDIRGVNSSGALQTLVWRGLIKADGKKDAPGHPKLYVTTDYFLQYFNYHSLADLPLI 167
>gi|58337260|ref|YP_193845.1| hypothetical protein LBA0962 [Lactobacillus acidophilus NCFM] >gi|58254577|gb|AAV42814.1| hypothetical protein LBA0962 [Lactobacillus acidophilus NCFM] (197 aa)
Score = 216, Expect = 4.4e-16, Identities = 53/181 (29%), Positives = 92/181 (50%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDT 189
           +EA L+ AG+ G+ +  L  +  ++ ++   + +E+  +   D   G+ +  +   YKL T P  +K++   F       L+Q  +E LAIIAY  P TR +I ++R  + +  L+ LI  GL+E  G  +A G P LY  +  F   F   S+ DLP I    ++  +   + E++ FD+
  S:     8 LEALLYAAGDNGIEETHLIDLLEVNKEELSEIADELEKKLSTDTNSGIQIIHIAHTYKLTTSPQTAKVIEKYFQKDLTKNLSQSALEILAIIAYRQPITRVEIDDIRGVNSSGALQTLIWRGLIETNGTKDAPGHPKLYVTSDYFLQYFNYQSLADLPLI----EEFADNENDMEMDLFDS 184
>gi|167629956|ref|YP_001680455.1| segregation and condensation protein b [Heliobacterium modesticaldum Ice1] >gi|167592696|gb|ABZ84444.1| segregation and condensation protein b [Heliobacterium modesticaldum Ice1] (191 aa)
Score = 214, Expect = 6.1e-16, Identities = 59/181 (32%), Positives = 100/181 (55%)
  Q:     4 NVKS-VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEI 184
           N KS VIEA LF++ ++ +  + +   +  + ++   ++  +  EY+ D +RG  + +V   ++L T+ + +  +       Q   L+   +ETLAIIAY+ P TR++I ++R       L  L+  GL++E GR EA+G+P LY  T  F   FGL S+ DLP       K+EE+  +EE+
  S:     7 NSKSRVIEALLFVS-SDPLSVETIAEATGFAAEEVRELLAGLKAEYD-DQERGWQLEEVAGGFRLSTRAEFAPYIERLLRTPQPG-LSNAALETLAIIAYHQPVTRAEIEQIRGVKADRSLATLLGKGLIQEVGRKEALGRPILYGTTDSFLRHFGLRSLADLP-------KLEEVFLQEEL 178
>gi|187251627|ref|YP_001876109.1| segregation and condensation protein B [Elusimicrobium minutum Pei191] >gi|186971787|gb|ACC98772.1| segregation and condensation protein B [Elusimicrobium minutum Pei191] (282 aa)
Score = 214, Expect = 6.4e-16, Identities = 56/185 (30%), Positives = 97/185 (52%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINF 186
           S + K +IE  LFI       K   + +  ++  D   ++  +  EY  +  R + +  +   +++ TKP+  + V   +  K    L+   +ETLAIIAY  P TR+++  +R  D    LEKL+E GLV+  G+ + +GKP +Y  T +F  +FGL+ + DLP++ +   K   +T E ++ F
  S:    23 SEDAKKIIENLLFITDRPLTVKRITEVVEGVNAADVMEIITGLQKEYS-ETGRAIQILDIAGGFQMSTKPEYGRWVRKLYNEKMTAKLSNAALETLAIIAYKQPVTRAEVEAIRGVDIAGPLEKLLERGLVKILGKRDTIGKPMVYGTTDEFLRLFGLNKVSDLPDMDIFAAKTAPVTEEADLPF 206
>gi|81177091|ref|ZP_00875985.1| Conserved hypothetical protein 281 [Streptococcus suis 89/1591] >gi|80976222|gb|EAP39855.1| Conserved hypothetical protein 281 [Streptococcus suis 89/1591] (189 aa)
Score = 213, Expect = 9.1e-16, Identities = 58/192 (30%), Positives = 103/192 (53%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDN 194
           +N  + IE  LF+AG +G+    L  +  +        +E++  +Y  D   GL + +    YKL TK + + ++     I  K P+NQ M    +ETL+I+AY  P TR ++ ++R  + +  + KL    L+ E G+ E +G+P LY  T  F D  G++S+++LP++     +I+ +  E E+ F + N  +N
  S:     1 MNRLAEIEVLLFVAGEDGLTLRNLAEMLEMQPTAVSQQLEKLSEKYMADKASGLAILESSNRYKLVTKKEYANLLR----IYAKTPINQTMSRALLETLSIVAYKQPITRIEVDDIRGVNSSGAISKLQAFDLIRENGKKEVLGRPNLYVTTDYFLDYMGINSLEELPDV----SEIDLIQEETEL-FVERNELEN 187
>gi|189499451|ref|YP_001958921.1| segregation and condensation protein B [Chlorobium phaeobacteroides BS1] >gi|189494892|gb|ACE03440.1| segregation and condensation protein B [Chlorobium phaeobacteroides BS1] (201 aa)
Score = 212, Expect = 1.1e-15, Identities = 60/184 (32%), Positives = 102/184 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFT----KPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRE 192
           IEA +F A +E V    +  +    LS +D +A +E +   Y     R   + ++   ++  T    +P + K++A     K +  L+Q ++E LA+IAY  P TR +I ++R   P   + KL+E GL++  GR+E  GKP +Y  T +F D F + S+KDLP++    ++I EL  ++EI  +  + E
  S:    12 IEAVIF-ASDEAVSAQIILQVLAEELSAEDIDAGVESLNASY-ASTGRSFRIARIAGGFRFLTLGMLEPTLKKMLAP----KIQRKLSQSVLEVLAVIAYQQPATRGEIQQVRGVSPDYAINKLLERGLIDVRGRAEKPGKPLIYGTTKEFLDFFNITSLKDLPKL----REIRELVQDKEIQEYLASSE 191
>gi|160880715|ref|YP_001559683.1| segregation and condensation protein B [Clostridium phytofermentans ISDg] >gi|189046143|sp|A9KMT3|SCPB_CLOPH Segregation and condensation protein B >gi|160429381|gb|ABX42944.1| segregation and condensation protein B [Clostridium phytofermentans ISDg] (189 aa)
Score = 212, Expect = 1.2e-15, Identities = 57/182 (31%), Positives = 102/182 (56%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINF 186
           ++++IEA LF  G E V  +++ S     V     ++  M+  YE D +RG+ + ++  ++++ TK  + + +     + +K+ L   ++E+L+IIAY  P T+ QI  +R       + KL+E  LV E GR +A G+P L+  T  F   FG+ S++DLP +V PE+  + ++  EEE+  
  S:     6 LEAMIEAILFTMG-EAVEVERIASALDHDVDTIRKIIHNMMDRYEGD-ERGIKIIELDNSFQMCTKAQMYEAIVKIAHVPKKHILTDVLLESLSIIAYKQPITKQQIESIRGVKSDHAVNKLVEYNLVCEVGRMDAPGRPILFGTTEDFLRNFGIASLEDLP-VVAPEKVADFKMEAEEEVQL 185
>gi|40062485|gb|AAR37437.1| conserved hypothetical protein TIGR00281 [uncultured marine bacterium 105] (225 aa)
Score = 212, Expect = 1.2e-15, Identities = 53/168 (31%), Positives = 89/168 (52%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           MS  +K +IEA +F +      K   K +     +D EA +  +  +Y  D   GL + KV   +++ T+P++ + V   F  +    L    +ETLA++AY  P T  ++ E+R  + + +L  LIE  L++  GR + +G+P+LY  T +F   FGL  +KDLP +
  S:     1 MSDQLKPIIEALVFASPEPLTIKTLFKLLEDEPQEDVEAALAAVQADY--DRPGGLQLVKVAGGFQIVTRPELHEWVRRLFHERSTQKLTVQSLETLAVVAYRQPVTAPEVSEIRGVNTSGVLSTLIERRLIKVVGRKKVIGRPFLYATTQEFLIRFGLSDLKDLPNV 166
>gi|161611236|ref|YP_278227.2| segregation and condensation protein B [Mycoplasma synoviae 53] >gi|144574960|gb|AAZ43516.2| conserved hypothetical protein [Mycoplasma synoviae 53] (189 aa)
Score = 211, Expect = 1.5e-15, Identities = 59/185 (31%), Positives = 98/185 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLS-VQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTY------EEEINFFDTNRE 192
           +IEA L+I G+EG++ +++K +  L+   + + +M++   ++  +  RGL V    E +KL T+  +   V+       K  L    IE   IIAY  P TR QI ++R      ++  L++ G++ E G S   G P LY+V+ +FYD F + S +DLP       K+ +  Y      E E + F + RE
  S:     5 IIEALLYIQGDEGLNLEQVKEVFNLNNTHEAKKIMQDFQKDF-NNLDRGLKVVVFDEIFKLATRESVRAYVSKLVTTTGKQRLTSAAIEVAGIIAYKGPITRGQISKIRGAVSDHIVNNLLKKGIIHEVGVSHTQGNPVLYEVSSQFYDHFKISSKQDLP-------KMRDFDYSDGFEDESEFDIFQSQRE 188
>gi|15895330|ref|NP_348679.1| segregation and condensation protein B [Clostridium acetobutylicum ATCC 824] >gi|41018112|sp|Q97HF1|SCPB_CLOAB Segregation and condensation protein B >gi|15025047|gb|AAK80019.1|AE007709_3 Predicted transciptinal regulator (HTH-type), YPUH B.subtilis ortholog [Clostridium acetobutylicum ATCC 824] (202 aa)
Score = 211, Expect = 1.5e-15, Identities = 55/179 (30%), Positives = 98/179 (54%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEI 184
           +S+IE+ LF++G E +   ++ +I   + +  + V+  M+ +Y  D  RG+ +  + ++Y+L TK + S  V        +  L+Q  +ETLAIIAY  P TR  + E+R       +  L E  L++E GR +  G+P LY+ T +F   F L +I +LP +     +++E+  +EE+
  S:    21 ESIIESLLFVSG-EPLKLKQISAILECTTKRAQEVLNNMMLKY-NDNCRGVKLININDSYQLVTKNENSDYVRKLLKTNTRQALSQAALETLAIIAYKQPITRIDVDEIRGVKSDRAILTLQEKKLIQECGRLDVPGRPILYETTDEFLKNFNLGNIDELPPMEQIASELDEVAVDEEV 197
>gi|47459311|ref|YP_016173.1| segregation and condensation protein B [Mycoplasma mobile 163K] >gi|56749596|sp|Q6KHG8|SCPB_MYCMO Segregation and condensation protein B >gi|47458641|gb|AAT27962.1| predicted transcriptional regulator [Mycoplasma mobile 163K] (192 aa)
Score = 211, Expect = 1.5e-15, Identities = 56/189 (29%), Positives = 99/189 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE--EEINFFDTNREDNGD 196
           +IEA ++I G EG+  ++L+ + +         + ++  E   + Q G+ V +  + YK  T  D+   V+    I +K  L+   IE   I+AY  P ++SQI+++R      ++  L+  G++EE G ++  G P LY VT KFYD F + S+ +LP +   +   E   YE  E+ + + + RED  +
  S:     5 IIEALIYIQGEEGLSSEQLQKVLKSESISSARALLKVFKEKWNNEQHGIKVEEFNDVYKFATIKDVKDYVSELVTIIKKQRLSNAAIEVAGIVAYKQPISKSQINKIRGVASEIVVNTLLIKGIIEEVGIAQTPGNPILYGVTAKFYDYFKIKSLHELPNLKEFDDTGE---YESIEDFDLYSSQREDQDE 192
>gi|150016749|ref|YP_001309003.1| segregation and condensation protein B [Clostridium beijerinckii NCIMB 8052] >gi|149903214|gb|ABR34047.1| putative transcriptional regulator [Clostridium beijerinckii NCIMB 8052] (197 aa)
Score = 211, Expect = 1.6e-15, Identities = 59/171 (34%), Positives = 94/171 (54%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQK 174
           ++KS IE+ LF +G     +D +  +   + +  E ++ EM+ EYE D  RG+ +  +  +Y+L TK + S  +       ++  L+Q  IE+LAIIAY  P TR  I E+R       L++L+E  L++E GR E  G+P LY  T +F   F L  +K+LP + L  Q+
  S:    20 SLKSAIESLLFASGEPLSLQDLVNHLEEKN-KLIEIIIHEMMEEYEND-DRGIKIICIKGSYQLVTKAENSDYIQKLLKKNKRQSLSQASIESLAIIAYKQPITRIDIDEIRGVKSESALQRLLEKDLIKEVGRLEVPGRPILYGTTDEFLRQFELKDLKELPSLDLFGQE 188
>gi|30024034|ref|NP_267432.2| segregation and condensation protein B [Lactococcus lactis subsp. lactis Il1403] >gi|41018129|sp|Q9CG34|SCPB_LACLA Segregation and condensation protein B (188 aa)
Score = 211, Expect = 1.6e-15, Identities = 53/166 (31%), Positives = 92/166 (55%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +N  +  E  LF++G  G+   +L +++ +S Q  +  ++ +  +Y  D +  L + +    Y++ TK + ++I+ +      K PLNQ +    +E L+IIAY  P TR +I  LR  + + +L  L    LVE+ G+ EA G+P LY  T  F D  G++ + +LPEI
  S:     1 MNKTASCELLLFVSGEAGLTLAELSALTEMSKQACQQQIDYLKEKYHSDEESALTIIETAGKYRMATKEEFAEILKN----YAKTPLNQSLSKSALEVLSIIAYKQPLTRLEIDHLRGVNSSGVLSTLRAFDLVEKVGQVEAPGRPSLYATTDFFLDYIGINHLDELPEI 166
>gi|163813992|ref|ZP_02205385.1| hypothetical protein COPEUT_00144 [Coprococcus eutactus ATCC 27759] >gi|158450686|gb|EDP27681.1| hypothetical protein COPEUT_00144 [Coprococcus eutactus ATCC 27759] (260 aa)
Score = 211, Expect = 1.7e-15, Identities = 64/189 (33%), Positives = 100/189 (52%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE--EEINF---FDTNRED 193
           + S +EA LF  G E V  D+L +   +  +     +E ++F Y  +  RG+ +  +  + +L T+ +   ++A      +K  L   ++ETL+IIAY  P TR +I  +R       + KLIE  LV+E GR +A G+P ++  T +F   FG+ S  DLP  V+   KIE+   E  EE +F    DT  ED
  S:    71 LTSALEAILFSLG-ESVSVDRLAAALEMEKKKLVKQLETVVFNYNNN-DRGIKIIDLDGSLQLCTRNEYYGVLAKIVNTPKKLSLTDVVLETLSIIAYKQPITRPEIEAIRGVSCVHAINKLIEYNLVQEVGRLDAPGRPIMFGTTEEFLRCFGVSSTSDLP--VISPDKIEDFKKEALEEADFTLSVDTTSED 260
>gi|144227735|gb|AAZ44717.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] >gi|144575565|gb|AAZ53995.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (195 aa)
Score = 210, Expect = 1.8e-15, Identities = 56/186 (30%), Positives = 105/186 (56%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLS-VQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE------INFFDTNRED 193
           +IEA L++ G +GV   +L++  +L+ + +   ++++   E+ +  +RG++V +  + +K  T  D+   +      ++K  L+   IE  AIIAY  P TRS I ++R   +   ++  L+  G++EE G +   G P LY VT +F+D F L S KDLP+     Q+ +  ++E++       + F + RE+
  S:     5 IIEAILYLQGEKGVSSLQLQNCLKLAKISEARKLLKDFAIEFNRQ-KRGILVVEFDDIFKFVTAKDLKPFIIDFVSNERKYRLSNSSIEVAAIIAYKQPVTRSTIAQIRGGINSDYIVGSLLAKGIIEELGTASTPGNPTLYGVTSRFFDYFKLRSAKDLPKF----QEFDLFSHEDQNSQVDNFDLFSSQREN 193
>gi|167745572|ref|ZP_02417699.1| hypothetical protein ANACAC_00263 [Anaerostipes caccae DSM 14662] >gi|167654884|gb|EDR99013.1| hypothetical protein ANACAC_00263 [Anaerostipes caccae DSM 14662] (191 aa)
Score = 210, Expect = 2.0e-15, Identities = 63/189 (33%), Positives = 105/189 (55%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE--EEINFFDTNREDN 194
           ++VIEA LF  G E V K +L +   +    F  +++++  +Y +    G+ + ++  +Y+L T+P+    +       +K  L   M+ETL+IIAY  P T+ +I  +R       + KL+E  L+ EAGR +AVG+P L++ T +F   FG+ SIK+LPEI   + K+E+   E  EE+ +     E N
  S:     5 QAVIEAILFSMG-ESVSKKQLMAALDIPEDLFFYLIDQLKRKYNRK-DSGIRLLELDGSYQLCTRPEYYDQLIKIVNQPKKPKLTDVMMETLSIIAYKQPVTKQEIEAIRGVKCDHPVNKLLEYNLIREAGRLDAVGRPILFRTTEEFLRCFGVGSIKELPEI--EQDKVEDFKQEAQEEVKYALEELEQN 191
>gi|54020286|ref|YP_116162.1| segregation and condensation protein B [Mycoplasma hyopneumoniae 232] >gi|53987459|gb|AAV27660.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (195 aa)
Score = 210, Expect = 2.2e-15, Identities = 56/186 (30%), Positives = 104/186 (55%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLS-VQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE------INFFDTNRED 193
           +IEA L++ G +GV   +L++  +L+ +     ++++   E+ +  +RG++V +  + +K  T  D+   +      ++K  L+   IE  AIIAY  P TRS I ++R   +   ++  L+  G++EE G +   G P LY VT +F+D F L S KDLP+     Q+ +  ++E++       + F + RE+
  S:     5 IIEAILYLQGEKGVSSLQLQNCLKLAKISQARKLLKDFAIEFNRQ-KRGILVVEFDDIFKFVTAKDLKPFIIDFVSNERKYRLSNSSIEVAAIIAYKQPVTRSTIAQIRGGINSDYIVGSLLAKGIIEELGTASTPGNPTLYGVTSRFFDYFKLRSAKDLPKF----QEFDLFSHEDQNSQVDNFDLFSSQREN 193
>gi|158423358|ref|YP_001524650.1| chromosome segregation and condensation protein [Azorhizobium caulinodans ORS 571] >gi|158330247|dbj|BAF87732.1| prokaryotic chromosome segregation and condensation protein [Azorhizobium caulinodans ORS 571] (265 aa)
Score = 209, Expect = 2.4e-15, Identities = 57/159 (35%), Positives = 90/159 (56%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQ-DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +IEA LF A       D     +RL  + D  A+M+ +  +Y +   RG+ + +V   + L T PD++ +V+ G    +K  L++  +E LAIIAY+ P TR++I ++R    +   L+ L+E G V   GR +A G+P  Y  TP F   FGLD+++DLP
  S:    53 IIEALLFTAA---APIDSAAIAARLPEKTDIRALMDILAADYAR---RGVNLVRVAGGWMLRTAPDLAAVVSQGAVETRK--LSRAAVEVLAIIAYHQPVTRAEIEDIRGVSTSKGTLDVLLESGWVRLRGRRKAPGRPVTYGTTPAFLVHFGLDALQDLP 205
>gi|28211198|ref|NP_782142.1| segregation and condensation protein B [Clostridium tetani E88] >gi|41018007|sp|Q894L3|SCPB_CLOTE Segregation and condensation protein B >gi|28203638|gb|AAO36079.1| conserved protein [Clostridium tetani E88] (189 aa)
Score = 209, Expect = 2.7e-15, Identities = 54/157 (34%), Positives = 89/157 (56%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIK 163
           S+IE+ LF +G     KD +  I  L+  D + ++++MI EYE + +RG+ + ++ + Y+L TK + S  +           L+Q  +ETL+I+AY  P TR  + E+R       L+ L++  L++E GR +  G+P LY  T +F   FGL+SIK
  S:    18 SIIESLLFASGEPLGLKD-ISEIIELNTLDTKEILQKMIREYEIE-KRGIKLIEIEKKYQLVTKEENSCFIEQLLKTNSSQSLSQAALETLSIVAYKQPVTRVDVDEIRGVKSDRALQTLLQKSLIKETGRLDVPGRPILYSTTEEFLKHFGLESIK 172
>gi|71893982|ref|YP_279428.1| segregation and condensation protein B [Mycoplasma hyopneumoniae J] >gi|72080960|ref|YP_288018.1| segregation and condensation protein B [Mycoplasma hyopneumoniae 7448] (191 aa)
Score = 209, Expect = 2.8e-15, Identities = 56/186 (30%), Positives = 105/186 (56%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLS-VQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE------INFFDTNRED 193
           +IEA L++ G +GV   +L++  +L+ + +   ++++   E+ +  +RG++V +  + +K  T  D+   +      ++K  L+   IE  AIIAY  P TRS I ++R   +   ++  L+  G++EE G +   G P LY VT +F+D F L S KDLP+     Q+ +  ++E++       + F + RE+
  S:     1 MIEAILYLQGEKGVSSLQLQNCLKLAKISEARKLLKDFAIEFNRQ-KRGILVVEFDDIFKFVTAKDLKPFIIDFVSNERKYRLSNSSIEVAAIIAYKQPVTRSTIAQIRGGINSDYIVGSLLAKGIIEELGTASTPGNPTLYGVTSRFFDYFKLRSAKDLPKF----QEFDLFSHEDQNSQVDNFDLFSSQREN 189
>gi|154497953|ref|ZP_02036331.1| hypothetical protein BACCAP_01933 [Bacteroides capillosus ATCC 29799] >gi|150272943|gb|EDN00100.1| hypothetical protein BACCAP_01933 [Bacteroides capillosus ATCC 29799] (211 aa)
Score = 208, Expect = 3.6e-15, Identities = 55/182 (30%), Positives = 96/182 (52%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINF 186
           ++S IE  LF AG+  V  ++L     L     + V + +  +Y    +RG+ + ++  +Y+L + P+ +  +   F  ++   L+Q  +E LAIIAY  P TR+ + ++R  D    +  L+E  L+EE GR    G+P LY+ T  F   FGL S+++LPE+     +  ++T E + N 
  S:     6 IESAIEGILFAAGDP-VGVERLCMALDLDRATVDNVCQRLA-DYYSYERRGVRLLRLENSYQLCSAPEHADCIRRAFESRRPARLSQPALEVLAIIAYYQPTTRAYVDQIRGVDSAYTVGLLLERDLIEECGRLAVPGRPILYRTTQTFLRSFGLSSLEELPELPSASPEDGQITMEMQANL 185
>gi|189347480|ref|YP_001944009.1| segregation and condensation protein B [Chlorobium limicola DSM 245] >gi|189341627|gb|ACD91030.1| segregation and condensation protein B [Chlorobium limicola DSM 245] (221 aa)
Score = 206, Expect = 5.0e-15, Identities = 54/186 (29%), Positives = 99/186 (53%)
  Q:     9 IEAALFIAGNEGVHKDKLKSIS--RLSVQDFEAVMEEMIFEYEKDPQRGLVVR--KVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDN 194
           IEA +F A  E V    ++ I+   +S+   + ++  +   Y      GL  R  ++   Y+  T+P   +++      K +  L+  ++E L++IAY  P T+ +I +LR T P   +++L+E G +   GR+++ G+P  Y  T  F D+FGL S++DLP++    ++I E+  E E   +   + DN
  S:    30 IEAVIF-ASEEAVTLSSIRQITGAEISLSQLDLLISALNDGYAAS---GLTFRIHRIAGGYRFLTEPRFCELLKRIQAPKVRRKLSNSILEVLSVIAYKQPVTKGEIQQLRGTAPDYAVDRLLERGFITVYGRADSPGRPLQYGTTDDFLDLFGLHSLRDLPKL----REIREILQEHEEQEYLAGKADN 211
>gi|164688530|ref|ZP_02212558.1| hypothetical protein CLOBAR_02175 [Clostridium bartlettii DSM 16795] >gi|164602943|gb|EDQ96408.1| hypothetical protein CLOBAR_02175 [Clostridium bartlettii DSM 16795] (190 aa)
Score = 206, Expect = 5.2e-15, Identities = 55/172 (31%), Positives = 97/172 (56%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISR-LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE 176
           +KS+IE+ +F  G     K+   +I+  LS ++ E ++  +  EYE+   RG+ + K+ + Y++ T  D +  +      K+K  L+Q  +ETL IIAY  P T+ +I  +R      +L+ L+E  L+ EAGR   +GKP +Y+ T +F  +  ++ ++DLP I   E+ I+
  S:    19 IKSIIESIMFAYGEPISVKELNYAINEELSPKEIEYMLNLLKDEYEEQ-NRGIQIIKLEDRYQMCTNKDYTPYIKKVLEPKRKKTLSQATLETLTIIAYKQPITKVEIENIRGVKCDKVLQTLLENSLIREAGRLNKIGKPIIYKTTDEFLKLLNIEKLEDLPPIEEFEENID 190
>gi|84496362|ref|ZP_00995216.1| hypothetical protein JNB_02545 [Janibacter sp. HTCC2649] >gi|84383130|gb|EAP99011.1| hypothetical protein JNB_02545 [Janibacter sp. HTCC2649] (234 aa)
Score = 206, Expect = 6.2e-15, Identities = 54/168 (32%), Positives = 91/168 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPE 172
           +KS IEA L +  +E V +  + S   + V D E+ + E+  EY     RG  +R+VG  ++++++ D + +V+      Q+  L Q  +ETLA+IAY  P +RS++  +R  +   ++  L+  GL+EE G  E     + Y  T  F +  GL ++ DLP +   LPE
  S:    55 LKSAIEAVLMVV-DEPVTELDIASALEIPVPDVESALTELEAEYAAQ-LRGFTLRQVGGGWRIYSRSDYAAVVSKFILAGQQARLTQASLETLAVIAYRQPVSRSRVSAVRGVNVDGVIRTLLTRGLIEEVGTDEESTATF-YGTTSYFLERLGLQTLDDLPALAPYLPE 221
>gi|42519011|ref|NP_964941.1| hypothetical protein LJ1085 [Lactobacillus johnsonii NCC 533] >gi|56749640|sp|Q74JM2|SCPB_LACJO Segregation and condensation protein B >gi|41583298|gb|AAS08907.1| hypothetical protein LJ_1085 [Lactobacillus johnsonii NCC 533] (196 aa)
Score = 206, Expect = 6.2e-15, Identities = 58/189 (30%), Positives = 93/189 (49%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE-INFFDT----NREDNGDE 197
           +EA L+ AG++G+  + L  +  +S      +   +    + D   GL +  + + YKL T P    I++  F       L+Q  +E L+IIAY  P TR +I +LR  +    L+ L+  GL++  G+ +  G P LY  T  F   F  +S+ DLP        IEE   ++  +N F+     N+E N DE
  S:     8 LEALLYAAGDDGLETENLLQLLEISPAALRELANHLKDRLKNDENSGLQLICINQTYKLTTSPKCGDIISKFFQKDLSKNLSQSALEILSIIAYRQPITRVEIDDLRGVNSAGALQTLVWRGLIKVDGKKDVPGHPNLYVTTDYFLQYFNYESLADLP-------VIEEFEADDNPVNLFNQDDSRNKEINFDE 194
>gi|134298998|ref|YP_001112494.1| putative transcriptional regulator [Desulfotomaculum reducens MI-1] >gi|172044271|sp|A4J3L6|SCPB_DESRM Segregation and condensation protein B >gi|134051698|gb|ABO49669.1| condensin subunit ScpB [Desulfotomaculum reducens MI-1] (181 aa)
Score = 206, Expect = 6.3e-15, Identities = 56/163 (34%), Positives = 89/163 (54%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           KS +EA LF+A +E +    L  I  + V D   ++ E+  EY+  P  GL + +V + +++ T+P+ +  +   +  K    L++  IETLAIIAY  P TRS++  +R       +  L+E  L+EE GR E  G+P LY  T +F   FGL  + +LP +
  S:    10 KSALEALLFVA-SEPLTVQALARIVEIDVADALELLLELAKEYQDRPG-GLKIVQVSDTWQICTRPECAPYIERLYR-KSGTGLSKAAIETLAIIAYRQPITRSEVEMIRGVKVDSPINTLLERNLIEEKGRREGPGRPVLYGTTLEFLKHFGLKDVSELPPL 169
>gi|94970888|ref|YP_592936.1| condensin subunit ScpB [Acidobacteria bacterium Ellin345] >gi|94552938|gb|ABF42862.1| condensin subunit ScpB [Acidobacteria bacterium Ellin345] (353 aa)
Score = 205, Expect = 7.0e-15, Identities = 51/159 (32%), Positives = 88/159 (55%)
  Q:    10 EAALFIAGNEGVHKDKLKSISRLSV--QDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM--IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +AA  ++  E   K K      L+        V+ E++ +Y+ D  RGL +R++   Y++ TKP+   +V  GF    K P+   +  +ETLA++AY  P T  ++ E+R  D + ++  L++  LV  AGR + +G+P LY+ T +F   FGL  + +LP +
  S:    89 DAATEVSAPETTSKKKAPKDPELTAVKAKLRTVLAELVADYQSDA-RGLEIRQIAGGYRMATKPEHHDVVV-GFAKSLKPPIRLSLQALETLAVVAYKQPVTAPEVSEIRGVDSSGVIATLLDRKLVTTAGRKQVIGRPILYKTTKEFLLRFGLKDVNELPSM 249
>gi|121535746|ref|ZP_01667548.1| putative transcriptional regulator [Thermosinus carboxydivorans Nor1] >gi|121305645|gb|EAX46585.1| putative transcriptional regulator [Thermosinus carboxydivorans Nor1] (166 aa)
Score = 205, Expect = 7.7e-15, Identities = 55/154 (35%), Positives = 85/154 (55%)
  Q:    24 DKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPEQKIEE 177
           DKL  I  +  +    ++EE+  +     +RGL + +V   Y+L TKP+++  V S     Q+  L+   +ETLAIIA+  P T+ +I  +R      +L  L+E  LV E GR E +G+P LY  T +F   FGL SI++L  +   LPE  +E+
  S:    11 DKLAQILEIPEEHVALLLEELAQDM-ASAERGLTLVQVAGGYQLCTKPEMADFV-SRLAQVQEGRLSMAAMETLAIIAFKQPITKQEIEAIRGVKIDKVLNNLVERRLVREIGRKETIGRPILYGTTDEFLKCFGLKSIEELLALAANLPEPALEK 164
>gi|116629542|ref|YP_814714.1| transcriptional regulator [Lactobacillus gasseri ATCC 33323] >gi|122273520|sp|Q043U6|SCPB_LACGA Segregation and condensation protein B >gi|116095124|gb|ABJ60276.1| condensin subunit ScpB [Lactobacillus gasseri ATCC 33323] (199 aa)
Score = 205, Expect = 8.3e-15, Identities = 53/186 (28%), Positives = 91/186 (48%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE-INFFDTNREDN 194
           +EA L+ AG++G+  D L  +  +S      +   +    + D   GL +  +   YKL T  +   +++  F       L+Q  +E L+IIAY  P TR +I +LR  + +  L+ L+  GL++  G+ +  G P LY  T  F   F  +S+ DLP        IEE   ++  +N FD + +++
  S:    11 LEALLYAAGDDGLETDNLLQLLEISPSALRELANHLKDRLKNDENSGLQLICINHTYKLTTSAECGDVISKFFQKDLSKNLSQSALEILSIIAYRQPITRVEIDDLRGVNSSGALQTLVWRGLIKVNGKKDVPGHPNLYVTTDYFLQYFNYESLADLP-------VIEEFEADDNPVNLFDQDEQNS 190
>gi|159900304|ref|YP_001546551.1| segregation and condensation protein B [Herpetosiphon aurantiacus ATCC 23779] >gi|159893343|gb|ABX06423.1| segregation and condensation protein B [Herpetosiphon aurantiacus ATCC 23779] (274 aa)
Score = 204, Expect = 1.0e-14, Identities = 49/164 (29%), Positives = 84/164 (51%)
  Q:    10 EAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQ 173
           EA LF+AG+  V    L +   L  QD   ++ ++    ++   RG+ ++      +L + P+ +  +    G+ Q   L+   +E LAIIAY  P TR+ +  +R  D + ++  L+   L+ E GR+E +G+P LY  T +F  IFG+ S+ +LP      Q
  S:   102 EAVLFVAGDP-VEYATLANALELREQDIPLLIADL---RQRFAGRGIRLQDQAGTLQLVSAPEATSALERFLGVSQPQKLSPAALEVLAIIAYRQPVTRAGLEAIRGVDSSGVVRSLLARELIYEVGRAETIGRPVLYGTTSQFLHIFGITSLAELPAFNFERQ 261
>gi|172057048|ref|YP_001813508.1| segregation and condensation protein B [Exiguobacterium sibiricum 255-15] >gi|171989569|gb|ACB60491.1| segregation and condensation protein B [Exiguobacterium sibiricum 255-15] (190 aa)
Score = 203, Expect = 1.1e-14, Identities = 49/155 (31%), Positives = 86/155 (55%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSI 162
           +IE+ LF+ G++G+    L  +  +S       +  +   +E + +R L + + G  +K+ T+ ++S  V +  G   ++ L++  +ETL IIAY  P TR+ I  +R      ++  L   GL++EAGR++ VG+  LY+ T  F D FGL+SI
  S:     6 IIESLLFVVGDDGIDPRGLSQVLEISEAAAREQLHALQTTFEAE-ERVLQIVESGGVFKMVTRKEMSPYVQAYAGSLAEDSLSRAAMETLVIIAYKQPVTRADIEVIRGVKTERVIHTLSAKGLIDEAGRAKGVGRAKLYKTTDHFLDHFGLNSI 159
>gi|42526386|ref|NP_971484.1| transcriptional regulator, putative [Treponema denticola ATCC 35405] >gi|41816498|gb|AAS11365.1| transcriptional regulator, putative [Treponema denticola ATCC 35405] (171 aa)
Score = 203, Expect = 1.2e-14, Identities = 54/171 (31%), Positives = 96/171 (56%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           ++EA L++ G+  +  + L  IS LS +     ++ +   Y   PQ G+ + K+   + +  K D+ + +   +G K +  L++  +ETL+IIAY+ P TR++I  +R      M+  LIE  L++E G+ +  GKP ++  T +F  IF L+SI DLP++   E++  EL
  S:     1 MVEAILYLEGDP-LTDEALCKISGLSPEIVSDAIKALQESY-ASPQSGIELAKMMGGWVIMPKKDLWEHLKDRYGKKNEGRLSRAAMETLSIIAYSQPVTRAEIEAIRGVSADNMIRLLIEKDLIKEVGKKDVPGKPAMFGTTKEFLKIFRLNSIADLPKLDETERERFEL 169
>gi|160931613|ref|ZP_02079008.1| hypothetical protein CLOLEP_00445 [Clostridium leptum DSM 753] >gi|156869484|gb|EDO62856.1| hypothetical protein CLOLEP_00445 [Clostridium leptum DSM 753] (188 aa)
Score = 201, Expect = 1.9e-14, Identities = 54/169 (31%), Positives = 92/169 (54%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQK 174
           ++VIEA LF +G E V  D+L  I  L       + + +    E+    G+ + ++   +++ +KP+   I+     +++  PL+   +E L+I+AYN P T++ I ++R  D + +L+ L    LVEE GR E  G+P LY  T  F   F L S+++LP   LPE++
  S:     7 QAVIEAVLFASG-EPVSVDRLAEILELDKPTVLKLAQSLQERLEQK-DSGVCLLRIDNQFQMASKPEYGDIIRKVMDMRRNVPLSPAAMEVLSIVAYNQPVTKAFIEQIRGVDCSGVLQSLTVKELVEEKGRLELPGRPLLYGTTDNFLRCFQLSSLEELPP--LPEKE 171
>gi|148379816|ref|YP_001254357.1| segregation and condensation protein B [Clostridium botulinum A str. ATCC 3502] >gi|153932861|ref|YP_001384114.1| segregation and condensation protein B [Clostridium botulinum A str. ATCC 19397] >gi|153935812|ref|YP_001387654.1| segregation and condensation protein B [Clostridium botulinum A str. Hall] >gi|153938954|ref|YP_001391116.1| segregation and condensation protein B [Clostridium botulinum F str. Langeland] >gi|170754815|ref|YP_001781404.1| segregation and condensation protein B [Clostridium botulinum B1 str. Okra] >gi|170758596|ref|YP_001787182.1| segregation and condensation protein B [Clostridium botulinum A3 str. Loch Maree] >gi|167016587|sp|A7FUR1|SCPB_CLOB1 Segregation and condensation protein B >gi|167016588|sp|A5I2X9|SCPB_CLOBH Segregation and condensation protein B >gi|167016589|sp|A7GEA6|SCPB_CLOBL Segregation and condensation protein B >gi|148289300|emb|CAL83396.1| segregation and condensation protein B [Clostridium botulinum A str. ATCC 3502] >gi|152928905|gb|ABS34405.1| segregation and condensation protein B [Clostridium botulinum A str. ATCC 19397] >gi|152931726|gb|ABS37225.1| segregation and condensation protein B [Clostridium botulinum A str. Hall] >gi|152934850|gb|ABS40348.1| segregation and condensation protein B [Clostridium botulinum F str. Langeland] >gi|169120027|gb|ACA43863.1| segregation and condensation protein B [Clostridium botulinum B1 str. Okra] >gi|169405585|gb|ACA53996.1| segregation and condensation protein B [Clostridium botulinum A3 str. Loch Maree] (193 aa)
Score = 201, Expect = 2.3e-14, Identities = 59/177 (33%), Positives = 91/177 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEE 182
           KS+IE+ LF++G E ++   L +I         +++ EM   Y     RG+ +       +L TKP+ S  V        +  L+Q  +ETL+IIAY  P TR  I E+R       +  L+E  +++E GR +  GKP LY  T +F   FGLDSI+ +P +   E  ++E + EE
  S:    21 KSIIESLLFMSG-EPINIKDLATILNCKQDKVSSLLNEMNNSY-VGKDRGIKILIHNRAVQLVTKPENSIYVEKLLKTNVRQSLSQAALETLSIIAYKQPITRVAIDEIRGVKSDRAIYTLLEKNIIKECGRLDVPGKPILYGTTEEFLKFFGLDSIEAIPNL---EDLLKEFSKEE 192
>gi|149176946|ref|ZP_01855555.1| hypothetical protein PM8797T_06992 [Planctomyces maris DSM 8797] >gi|148844201|gb|EDL58555.1| hypothetical protein PM8797T_06992 [Planctomyces maris DSM 8797] (277 aa)
Score = 201, Expect = 2.4e-14, Identities = 45/158 (28%), Positives = 84/158 (53%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +EA LF+A +  +   K+  ++ L+       + + +    +       +++V   Y++ T+P  S  +      +    L+   +ETLAI+ Y  P TR+ I  +R      ML++L++ GLV   G+ +++G+P+LY+ T KF +IFGL ++ DLP
  S:    69 VEAVLFVA-DSALSTRKIAQLATLANASEARELIDQLNAALEATHSAFHIKRVATGYQMMTQPQFSFWLNKLHQRQAALKLSSPAMETLAIVVYRQPITRADIESIRGVQSAEMLKQLMDRGLVRIGGKDDSLGRPFLYESTRKFLEIFGLKNLDDLP 225
>gi|21673313|ref|NP_661378.1| hypothetical protein CT0478 [Chlorobium tepidum TLS] >gi|21646405|gb|AAM71720.1| segregation and condensation protein B [Chlorobium tepidum TLS] (209 aa)
Score = 201, Expect = 2.4e-14, Identities = 48/172 (27%), Positives = 95/172 (55%)
  Q:    12 ALFIAGNEGVHKDKLKSIS--RLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           AL  +  E V+   L  I+  + +  + +  ++E+  +YE    R   +  +   Y+  T+P+ + +V        +  L++ M+E LA++A++ P T+ +I ++R   P   +++L+  GL+E  GR+++ G+P  Y  T  F D+F L S+KDLP++    ++I+E+  E E
  S:    14 ALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEAT-GRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHLPSLKDLPKL----REIKEILQEHE 182
>gi|62424883|ref|ZP_00380023.1| COG1386: Predicted transcriptional regulator containing the HTH domain [Brevibacterium linens BL2] (210 aa)
Score = 200, Expect = 2.6e-14, Identities = 58/164 (35%), Positives = 86/164 (52%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEY---EKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPE 172
           IEA L I+ +  V   +L +   L        + E+  +Y   E   QRG  +R V   +++F++ D  +IV       Q   L+Q  +ETLA+IAY  P +R +I  +R      ++  L+  GL+ EAG+ EA     LY  T +F D  G++SI DLPEI   LPE
  S:    10 IEAVLMIS-DSAVSVTELATALGLDEDTVTDAIAELKADYDGGEDRRQRGFEIRLVAGGFRIFSRGDYHEIVKDFLTSGQSAKLSQAALETLAVIAYRQPISRPRIAAIRGVSVDGVIRTLLLRGLIVEAGK-EATTSALLYTTTHQFLDALGMNSIDDLPEIAPYLPE 176
>gi|160892714|ref|ZP_02073504.1| hypothetical protein CLOL250_00244 [Clostridium sp. L2-50] >gi|156865755|gb|EDO59186.1| hypothetical protein CLOL250_00244 [Clostridium sp. L2-50] (262 aa)
Score = 200, Expect = 3.2e-14, Identities = 56/177 (31%), Positives = 94/177 (53%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           S +EA LF  G E V  D+L     + ++     MEE++  Y +   RG+ + ++   Y+L T+ +   ++       +K  L   ++ETL+I+AY  P TR +I  +R       + KL+E GLV+E GR +A G+P L+  T +F   FG+ S ++LP  ++   KIE+   E +
  S:    76 SAVEAILFSIG-ESVSVDRLAKALEMEIKKLSKQMEEVLAIYNQS-DRGIKMVELENAYQLCTRNEYYDVLTKVVCTPKKPNLTDVLLETLSIVAYKQPITRPEIEAIRGVSCAHAINKLMEYGLVDEVGRLDAPGRPILFGTTEEFLRSFGVASTEELP--MISPDKIEDFKKEAQ 248
>gi|24213955|ref|NP_711436.1| hypothetical protein LA1255 [Leptospira interrogans serovar Lai str. 56601] >gi|45658295|ref|YP_002381.1| hypothetical protein LIC12452 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|24194814|gb|AAN48454.1|AE011307_7 conserved hypothetical protein [Leptospira interrogans serovar Lai str. 56601] >gi|45601537|gb|AAS71018.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (187 aa)
Score = 199, Expect = 3.2e-14, Identities = 56/177 (31%), Positives = 101/177 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLS-VQDFEA--VMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE 181
           +K +IEA LF++G       KL SI++ + ++  EA  +++E+I +Y  +   G +++++   Y+  T    ++++ + F  K++  L++  ++TLAIIAY  P T  +I E+R      M+  LI   L++  G  E  G+P LY  T +F   FGL+ + DLP  V    +++EL +E
  S:     8 IKGLIEALLFVSG----EPLKLASIAKSAEIEKTEAREILDELILDYS-EKNGGFLLKEIAGAYQFVTNEGFAELLGNIFKEKRREQLSKSSLDTLAIIAYKQPITLPEIDEIRGVSSRAMVTSLISKKLIKPVGNKEVPGRPALYGTTKEFLIHFGLNKLSDLPAPV----EVKELKFE 178
>gi|110636568|ref|YP_676775.1| condensin subunit ScpB [Cytophaga hutchinsonii ATCC 33406] >gi|110279249|gb|ABG57435.1| condensin subunit ScpB [Cytophaga hutchinsonii ATCC 33406] (237 aa)
Score = 199, Expect = 3.4e-14, Identities = 45/137 (32%), Positives = 79/137 (57%)
  Q:    30 SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           + + + D    +++++ +YE D      + ++G  Y+  TKP     +      K K  L+   +ET+AI+AY  P T++QI ++R  +    ++KL+E  LVE  G+S+ VG+P LY  + KF + FG+++IKDLP
  S:    34 AEIPLDDILNAVDDLLSKYE-DETFPFQILQIGGGYQFMTKPAYQSSLGIFLKQKSKKRLSTSALETMAIVAYKQPITKAQIEQIRGVNCDYAMQKLLEKELVEIQGKSDGVGRPILYGTSQKFLEYFGINNIKDLP 169
>gi|116328728|ref|YP_798448.1| transcriptional regulator [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116121472|gb|ABJ79515.1| Transcriptional regulator [Leptospira borgpetersenii serovar Hardjo-bovis L550] (177 aa)
Score = 199, Expect = 3.8e-14, Identities = 54/174 (31%), Positives = 96/174 (55%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISR---LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE 181
           +IEA LF++G       KL SI++   +   D   +++E++ +Y  +   G +++++   Y+  T    +K++ + F  K++  L++  ++TLAIIAY  P T  +I E+R      M+  LI   L++  G  E  G+P LY  T +F   FGL+ + DLP  V    +++EL +E
  S:     1 MIEALLFVSG----EPLKLASIAKSAGIEKIDAREILDELVLDYS-EKNGGFLLKEIAGAYQFVTNESFAKLLGNVFREKRREQLSKSSLDTLAIIAYKQPITLPEIDEIRGVSSRAMVTSLISKKLIKPIGNKEVPGRPALYGTTKEFLIHFGLNKLSDLPAPV----EVKELKFE 168
>gi|124004167|ref|ZP_01689013.1| segregation and condensation protein B [Microscilla marina ATCC 23134] >gi|123990237|gb|EAY29736.1| segregation and condensation protein B [Microscilla marina ATCC 23134] (193 aa)
Score = 199, Expect = 3.9e-14, Identities = 55/158 (34%), Positives = 92/158 (58%)
  Q:     9 IEAALFIAGNEGVHKDKLKS-ISRL--SVQDFEAVME--EMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +EA +F A +E +  D+L+S +S L  +V   E V++  E++ E  +D      + ++ E Y+  TKP+    +A       K  L++  +ETLAIIAY  P T+ Q+ ++R       ++KL+E  LV   G++E  G+P LY  + KF + FG++S+ DLP
  S:     8 VEALIFCA-SEPISIDELQSCLSELFDTVIPEEEVLQTIEVLTEKYEDGNFAFQICQMSEGYQFLTKPEFQPSIAVLLKQNSKKRLSKAALETLAIIAYKQPITKGQLEQIRGVSCDYTIQKLLEKELVAIKGKAETAGRPILYGTSKKFMEYFGINSLSDLP 169
>gi|145619861|ref|ZP_01775905.1| putative transcriptional regulator [Geobacter bemidjiensis Bem] >gi|144943866|gb|EDJ78947.1| putative transcriptional regulator [Geobacter bemidjiensis Bem] >gi|197088037|gb|ACH39308.1| segregation and condensation protein B [Geobacter bemidjiensis Bem] (192 aa)
Score = 198, Expect = 4.4e-14, Identities = 54/174 (31%), Positives = 100/174 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI-SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKP---DISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           +KS++E+ LF+  ++ +  D+L  I       D  A ++E++ EY    +RG+V+  VG  Y+L ++P   D  + +    G+K     +Q  +ETL+I+AY  P TR+++  LR  D   +++ L+E  L+   G+ +  GKP +Y  + +F ++FGL  +  LP +    ++I+EL
  S:     6 LKSIVESLLFVY-DQPLSLDRLALILEEFERSDLRAALDELMEEY-AGAERGIVLSYVGGGYQLRSRPEHADYIRRLTKSKGVK----FSQSALETLSIVAYRQPITRAEVEYLRGVDSGGVMKSLLEKKLLRILGKKDVPGKPLIYGTSREFLELFGLKDLNALPTL----KEIQEL 173
>gi|95931321|ref|ZP_01314036.1| putative transcriptional regulator [Desulfuromonas acetoxidans DSM 684] >gi|95132622|gb|EAT14306.1| putative transcriptional regulator [Desulfuromonas acetoxidans DSM 684] (191 aa)
Score = 198, Expect = 4.6e-14, Identities = 47/164 (28%), Positives = 92/164 (56%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K+ +EA LF + +E +  D+L+++  +        ++E++ EY +D  RG+V+++V   +++ T+ + +  +       +   L++   E+LAIIAY  P TR++I  LR  D   ++  L+E  LV+  G+ +  G+P LY  +  F + FGL  + +LP +
  S:     8 LKARLEAVLF-SSDEPLRFDRLQALFEVETTVLRQALQELMVEYAQD-NRGVVLQEVAGGFQIRTRAEYAAWILK-LNKSRVTRLSKAATESLAIIAYRQPVTRAEIEYLRGVDSGGVVRMLMEKQLVKIVGKKDVPGRPLLYGTSRHFLEFFGLKDLSELPNL 168
>gi|139439676|ref|ZP_01773089.1| Hypothetical protein COLAER_02117 [Collinsella aerofaciens ATCC 25986] >gi|133775017|gb|EBA38837.1| Hypothetical protein COLAER_02117 [Collinsella aerofaciens ATCC 25986] (242 aa)
Score = 198, Expect = 4.7e-14, Identities = 50/165 (30%), Positives = 88/165 (53%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++K  +EA L ++ ++ V    L     ++  +  +++ E+  EYE +  RG  +R+V   ++LFT P    +V +         L+Q  +ETLA+IAY+ P TR  +  +R  +   ++  L++ GLV E GR    G+  +Y  T  F + FGL S +DLP++
  S:    11 SLKGALEALLLVS-SDPVSAPALAGALDIAPGECASLLAELKVEYE-EANRGFQLREVAGGWRLFTHPAYHDVVEAYVLSWDTQKLSQAALETLAVIAYHQPVTREVVKGIRGVNSDGVIASLVDKGLVRELGRDPQRGQAIIYGTTNAFLEKFGLRSTRDLPDL 173
>gi|84702718|ref|ZP_01017293.1| hypothetical protein PB2503_07132 [Parvularcula bermudensis HTCC2503] >gi|84691964|gb|EAQ17804.1| hypothetical protein PB2503_07132 [Parvularcula bermudensis HTCC2503] (276 aa)
Score = 197, Expect = 5.7e-14, Identities = 44/114 (38%), Positives = 73/114 (64%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSE-AVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           QRG+ +RK+GE ++  + PD+S ++       Q   L++  +ETLAIIAY+ PC+R+ I ++R        L++L+E+G ++  GR + A G+P LY  T  F + FGL+++ DLP
  S:   110 QRGVNLRKIGEGWQFVSAPDLSGVLVEHR--VQVRKLSRAALETLAIIAYHQPCSRADIEDVRGVSVAKGSLDQLLELGWIKLRGRRQTAPGRPVLYGTTLSFLEHFGLEALTDLP 223
>gi|118443352|ref|YP_878106.1| segregation and condensation protein B [Clostridium novyi NT] >gi|118133808|gb|ABK60852.1| segregation and condensation protein B [Clostridium novyi NT] (190 aa)
Score = 197, Expect = 6.0e-14, Identities = 54/171 (31%), Positives = 92/171 (53%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           S+IE+ LF +GN  ++  ++  I     +   +++EEM   Y ++  RGL++  + E Y L TKP+ S  +        +  L++  +E LAII Y  P TR +I E+R       ++ L+E  +++EAGR +  G+P +Y  T +F   FGL+ +  +P +    QK EE
  S:    22 SIIESVLFASGNP-LNIKEIAHIIECGEEYTYSLLEEMKKTYNEN-SRGLLLINMKEEYTLVTKPENSVFLQKLLKTNNRQSLSRASLEALAIIVYKQPITRIEIDEIRGVKSDKAIQTLLEKDIIKEAGRKKVPGRPIMYVTTGEFLKYFGLEDLNQMPILDEFIQKEEE 190
>gi|162450300|ref|YP_001612667.1| hypothetical protein sce2028 [Sorangium cellulosum 'So ce 56'] >gi|161160882|emb|CAN92187.1| hypothetical protein [Sorangium cellulosum 'So ce 56'] (579 aa)
Score = 196, Expect = 7.9e-14, Identities = 54/178 (30%), Positives = 93/178 (52%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE 181
           ++K V+EA +F+A      +D  +S +    +    ++ E++ EY+    RG  + +V   Y   T P  +  V     + ++ P  +++   ETLAI+AY  P TR +I E+R  D    L+ L+E  LV   G+ +  G+P LY  T +F + FGL ++ +LP +    ++  ELT E
  S:   230 HLKGVLEALIFVAERPVPARDLARS-ANAEHRVVRELLAELVAEYDG---RGFRLDEVAGGYVFRTSPAFAPFVRE---VTEQKPVKMSRAQTETLAIVAYRQPITRPEIDEIRGVDSGAALKSLLERDLVRILGKKDEPGRPMLYGTTAQFLEFFGLKALGELPTL----REFTELTEE 398
>gi|167459568|ref|ZP_02325749.1| segregation and condensation protein B [Anaeromyxobacter dehalogenans 2CP-1] >gi|167414133|gb|EDR80892.1| segregation and condensation protein B [Anaeromyxobacter dehalogenans 2CP-1] (387 aa)
Score = 196, Expect = 8.0e-14, Identities = 51/164 (31%), Positives = 91/164 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           V++V+E  LF+A    +  +++++ S + V+  E  ++++   Y + P  G+V+ +V   ++L T PD S        +K +  L +  +ETLAIIAY  P TR +I ++R  D   +++ L+E  LV+  G+ E  G+P LY  T +F + F L  +  LP +
  S:   122 VRTVVETLLFLA-ERPLSVEEMRAASGVEVERLEKALDKLSGHYREGPC-GIVLHEVAGGWQLRTSPDNSDFARRFLKVKPQR-LTRAALETLAIIAYRQPVTRPEIEDIRGVDCGAVVKALLERKLVKILGKKEEPGRPILYGTTREFLEFFALKDLASLPTL 282
>gi|78187543|ref|YP_375586.1| putative transcriptional regulator [Pelodictyon luteolum DSM 273] >gi|78167445|gb|ABB24543.1| condensin subunit ScpB [Pelodictyon luteolum DSM 273] (213 aa)
Score = 196, Expect = 8.3e-14, Identities = 53/188 (28%), Positives = 105/188 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQ--DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGD 196
           IEA +F A  E V    ++ ++  S+   + + ++E +  EY  +  R   + ++   Y+  ++ + ++++      K +  L++ ++E L++IAY+ P T+S I E+R   P   +++L+E  L+E  GR+++ GKP  Y  T +F D+F L S KDLP++    ++I+E+  E E   + T  +  G+
  S:    10 IEAVIF-ASEEAVTLQTIRQVTGTSLDSGELQEIIERLNAEY-LETGRTFHIHRLAGGYRFLSREEYAELLRKLESPKIRRRLSRSILEVLSVIAYHQPVTKSSIQEIRGVSPDYAIDRLLERELIEVRGRADSPGKPLQYGTTKEFLDLFHLSSAKDLPKL----REIKEILREHEEQEYLTQPDSGGE 193
>gi|163769146|ref|ZP_02176109.1| segregation and condensation protein B [Anaeromyxobacter sp. K] >gi|196172427|gb|ACG73400.1| segregation and condensation protein B [Anaeromyxobacter sp. K] (372 aa)
Score = 196, Expect = 8.8e-14, Identities = 51/164 (31%), Positives = 91/164 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           V++V+E  LF+A    +  +++++ S + V+  E  ++++   Y + P  G+V+ +V   ++L T PD S        +K +  L +  +ETLAIIAY  P TR +I ++R  D   +++ L+E  LV+  G+ E  G+P LY  T +F + F L  +  LP +
  S:   107 VRTVVETLLFLA-ERPLSVEEMRAASGVEVERLEKALDKLSGHYREGPC-GIVLHEVAGGWQLRTSPDNSDFARRFLKVKPQR-LTRAALETLAIIAYRQPVTRPEIEDIRGVDCGAVVKALLERKLVKILGKKEEPGRPILYGTTREFLEFFALKDLASLPTL 267
>gi|145220278|ref|YP_001130987.1| condensin subunit ScpB [Prosthecochloris vibrioformis DSM 265] >gi|145206442|gb|ABP37485.1| condensin subunit ScpB [Prosthecochloris vibrioformis DSM 265] (208 aa)
Score = 196, Expect = 8.8e-14, Identities = 46/175 (26%), Positives = 99/175 (56%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQD--FEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           IE+ +F A  E +    ++ ++ + +     + V+E +  EY  +  R   + ++   Y++ ++ + + ++      K +  L++ ++E L+++AY+ P TR +I ++R   P   +++L+E G +E  GR++  G+P  Y  T +F D+F L S+KDLP++    ++I+E+  E E
  S:     5 IESVIF-ASEEAITLQVIRQVTGVEMDSAALQEVVEAINREY-LESGRPFSIHRIAGGYRMLSREEFAPLLRKLLAPKIRRRLSRSILEVLSVVAYHQPVTRGEIQQIRGVSPDYAIDRLMERGFIEVQGRADTPGRPLQYGTTKEFLDLFHLSSLKDLPKL----REIKEILREHE 175
>gi|20807774|ref|NP_622945.1| transcription regulator [Thermoanaerobacter tengcongensis MB4] >gi|41018081|sp|Q8RAA0|SCPB_THETN Segregation and condensation protein B >gi|20516330|gb|AAM24549.1| predicted transcriptional regulator containing the HTH domain [Thermoanaerobacter tengcongensis MB4] (168 aa)
Score = 195, Expect = 9.7e-14, Identities = 51/160 (31%), Positives = 85/160 (53%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           IEA LF AG + V    L     ++ ++   +++ +  EY K+  RG+ +    +  ++ T      IV     ++    L+Q  +E LAIIAYN P T+++I  +R       +  L+E  L++E+GR+ + G+P LY  T  F   FG+ S+K+LPEI
  S:     7 IEAILFAAG-QAVKIRTLAEALEVTEEEVRELLKRLKEEYVKN-HRGIDIVIFEDKVEMCTNDSYGDIVRKALKMEITQGLSQAALEVLAIIAYNQPITKAEIERIRGVRSDKPINTLLEYNLIKESGRASSPGRPILYSTTEDFLKYFGISSLKELPEI 164
>gi|86158108|ref|YP_464893.1| condensin subunit ScpB [Anaeromyxobacter dehalogenans 2CP-C] >gi|85774619|gb|ABC81456.1| condensin subunit ScpB [Anaeromyxobacter dehalogenans 2CP-C] (387 aa)
Score = 195, Expect = 1.1e-13, Identities = 51/164 (31%), Positives = 91/164 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           V++V+E  LF+A    +  +++++ S + V+  E  ++++   Y + P  G+V+ +V   ++L T PD S        +K +  L +  +ETLAIIAY  P TR +I ++R  D   +++ L+E  LV+  G+ E  G+P LY  T +F + F L  +  LP +
  S:   122 VRTVVETLLFLA-ERPLTVEEMRAASGVDVERLEKALDKLSGHYREGPC-GIVLHEVAGGWQLRTSPDNSDFARRFLKVKPQR-LTRAALETLAIIAYRQPVTRPEIEDIRGVDCGAVVKALLERKLVKILGKKEEPGRPILYGTTREFLEFFALKDLASLPTL 282
>gi|116330615|ref|YP_800333.1| transcriptional regulator [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116124304|gb|ABJ75575.1| Transcriptional regulator [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (177 aa)
Score = 195, Expect = 1.2e-13, Identities = 53/174 (30%), Positives = 96/174 (55%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISR---LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE 181
           +IEA LF++G       KL SI++   +   D   +++E++ +Y  +   G +++++   Y+  T    ++++ + F  K++  L++  ++TLAIIAY  P T  +I E+R      M+  LI   L++  G  E  G+P LY  T +F   FGL+ + DLP  V    +++EL +E
  S:     1 MIEALLFVSG----EPLKLASIAKSAGIEKIDAREILDELVLDYS-EKNGGFLLKEIAGAYQFVTNESFAELLGNVFREKRREQLSKSSLDTLAIIAYKQPITLPEIDEIRGVSSRAMVTSLISKKLIKPIGNKEVPGRPALYGTTKEFLIHFGLNKLSDLPAPV----EVKELKFE 168
>gi|154483608|ref|ZP_02026056.1| hypothetical protein EUBVEN_01312 [Eubacterium ventriosum ATCC 27560] >gi|149735518|gb|EDM51404.1| hypothetical protein EUBVEN_01312 [Eubacterium ventriosum ATCC 27560] (188 aa)
Score = 194, Expect = 1.6e-13, Identities = 54/168 (32%), Positives = 89/168 (52%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M IN ++ IEA LF  G E V   K+     L   + + +++ M  E   D  RG+ + ++   Y++ TKP++ + +       +K  L   ++ETL+IIAY  P T+S+I  +R       + KL+E  LV+E GR +  G+P L+  T +F   FG++S   LP +
  S:     1 MEINYEAQIEAILFTMG-ESVEITKIAKALELKPGEVKKIVKSMQ-EKMNDSSRGIKIIELDGAYQMCTKPEMYEALIRVAKQPRKQVLTDVLMETLSIIAYKQPITKSEIERIRGVKSDFAVNKLVEYELVQEVGRMDTPGRPLLFGTTEEFLRRFGVESADSLPMV 166
>gi|149186240|ref|ZP_01864554.1| hypothetical protein ED21_30924 [Erythrobacter sp. SD-21] >gi|148830271|gb|EDL48708.1| hypothetical protein ED21_30924 [Erythrobacter sp. SD-21] (205 aa)
Score = 193, Expect = 1.6e-13, Identities = 56/160 (35%), Positives = 88/160 (55%)
  Q:     9 IEAALFIAGNEGVHKDKLKS-ISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +EAALF A  E +  D L   +      +  A ++ +   YEK   RG+ + + G+ +   T PD++ ++      +Q   L++   E LAIIAY+ P +R++I  +R    +   L+ L+E G V+ AGR E  G+P +Y  TP+F D FGL S +DLP I
  S:     8 VEAALF-AAEEPMSVDALAGFLGDADKSEVRAALKALAETYEK---RGIHLVERGKRWHFETAPDLAHLLRKER--EQVRRLSRAATEVLAIIAYHEPVSRAEIESIRGVQTSGGTLDVLMEAGWVKIAGRREVPGRPTIYATTPEFLDHFGLSSRRDLPGI 163
>gi|148658705|ref|YP_001278910.1| putative transcriptional regulator [Roseiflexus sp. RS-1] >gi|148570815|gb|ABQ92960.1| condensin subunit ScpB [Roseiflexus sp. RS-1] (184 aa)
Score = 193, Expect = 2.1e-13, Identities = 50/155 (32%), Positives = 78/155 (50%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSI 162
           +IEA LF+AG E V   +L     L     E  ++E+        +RG+ +++  +  +L + P+ + ++    G      L+   +E L IIAY  P TR+QI  +R  D + +L  L+   L+ E GR E VG+P LY  T  F   FGL S+
  S:    20 LIEAILFVAG-EPVTITELARTLDLPPDAVEQALDELA---AACIERGIRLQRDADRVQLVSAPEAAAVIERFLGAPPATRLSNAALEVLTIIAYRQPVTRAQIEAIRGVDSSGVLRALLARDLIAEGGRLETVGRPILYVTTAGFLRQFGLSSL 170
>gi|15828587|ref|NP_325947.1| segregation and condensation protein B [Mycoplasma pulmonis UAB CTIP] >gi|41018120|sp|Q98R94|SCPB_MYCPU Segregation and condensation protein B >gi|14089529|emb|CAC13289.1| conserved hypothetical protein [Mycoplasma pulmonis] (207 aa)
Score = 193, Expect = 2.1e-13, Identities = 49/161 (30%), Positives = 82/161 (50%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +IEA ++  G++G+  +++K +  L        +     E+    + G  V   GE YK+ T   +   V+    I +   L++  IE   I+AY  P T+S I+E+R      ++  L+   L+EE G S   GKP LY +T KFYD F + S+++LP +
  S:    16 IIEALMYFQGDQGLSPEQVKEVFDLEKDQEGKKLLNDFMEFYNAREGGTKVFVFGEIYKIATIEPLKDYVSKLVSIVRYQKLSKAAIEVAGIVAYKQPITKSMINEIRGVASDQVVNTLLVKNLIEEVGISPTPGKPVLYGITNKFYDYFKIKSLQELPNL 176
>gi|30258778|gb|AAP27996.1| conserved hypothetical protein TIGR00281 [Bacillus anthracis str. Ames] >gi|47551971|gb|AAT35413.1| conserved hypothetical protein TIGR00281 [Bacillus anthracis str. 'Ames Ancestor'] (146 aa)
Score = 192, Expect = 2.7e-13, Identities = 42/125 (33%), Positives = 68/125 (54%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
            RGL + +  + Y+  TK + +        I     L+Q  +ETLAI+AY  P TR+++ E+R       L+ L+   L++E GR+E  G+P LY  T +F D FGL ++ DLP +    +++ E
  S:     9 HRGLQIVQYAKVYRFATKKEHASYYQKLIEIPTAASLSQAALETLAIVAYRQPITRTEMEEIRGVKTDKALQTLVSHLLIKEMGRAEGPGRPILYGTTKEFLDTFGLKTLDDLPPLSEENEQMNE 133
>gi|73662567|ref|YP_301348.1| putative transcriptional regulator [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581642|sp|Q49XU2|SCPB_STAS1 Segregation and condensation protein B >gi|72495082|dbj|BAE18403.1| putative transcriptional regulator [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (182 aa)
Score = 191, Expect = 2.7e-13, Identities = 53/166 (31%), Positives = 87/166 (52%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           M++  K ++EA L+ AG+EG+ + +L  I  +        + E+I  Y+     GL ++  G  Y L TK + S  +      K K  L+Q  +E+L+IIAYN P +RS I  +R  +    ++ LI  GLVE   + EA  + +    T  F ++FG++ + DLP
  S:     1 MALQDKGILEALLYTAGDEGLDQQQLLEILEIE----PTTLTELIEAYDSP---GLTIQHYGNTYVLTTKKEASDYIEQLIEQKSKMKLSQAAMESLSIIAYNQPLSRSDIELIRGINSDGAVKTLIARGLVE--AKEEADSRSHQLYTTELFLNVFGIEHLDDLP 157
>gi|70726423|ref|YP_253337.1| hypothetical protein SH1422 [Staphylococcus haemolyticus JCSC1435] >gi|82581641|sp|Q4L6J4|SCPB_STAHJ Segregation and condensation protein B >gi|68447147|dbj|BAE04731.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (179 aa)
Score = 191, Expect = 3.1e-13, Identities = 55/159 (34%), Positives = 87/159 (54%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVE----EAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +IE+ L+ AG+EG+ + +L  I  ++    +A + E+I  Y      GL+++K G  Y L +K + S  +      K    L+Q  +ETL+IIAYN P +RS I  +R  +    +  LI  GL+E    E  RS A+      Q T  F ++FG++ I+DLP
  S:     6 IIESLLYTAGDEGLDEKQLLEILEIN----QAKLSELISSYTSS---GLIIQKFGSTYILTSKKEASPYIEQLIEQKSNMKLSQAAMETLSIIAYNQPLSRSDIELIRGINSDGAVRTLIARGLIEAKDVENSRSHAL------QTTDLFLNVFGIEKIEDLP 155
>gi|88810634|ref|ZP_01125891.1| chromosome segregation and condensation protein ScpB [Nitrococcus mobilis Nb-231] >gi|88792264|gb|EAR23374.1| chromosome segregation and condensation protein ScpB [Nitrococcus mobilis Nb-231] (198 aa)
Score = 190, Expect = 3.8e-13, Identities = 53/168 (31%), Positives = 90/168 (53%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M   +K +IEAAL  AG E +  ++L+ +     Q   AV+   +    +D Q RG+ +++V   Y++  + +++  VA  +  +     ++ ++ETLAIIAY  P TR +I E+R     T ++  L E G +  AG     G+P L+  T  F D F L S+++LP +
  S:     1 MESELKYIIEAALLAAG-EPLSVERLQRLFPQDRQPGTAVVRGALVALAEDYQHRGIELKEVASGYRIQVRAELAPWVAQLWAARPGR-YSRALLETLAIIAYRQPITRGEIEEIRGVALSTSIMRTLQERGWIHVAGHRPLPGRPALFGTTRAFLDYFNLKSLEELPAL 168
>gi|152967065|ref|YP_001362849.1| putative transcriptional regulator [Kineococcus radiotolerans SRS30216] >gi|151361582|gb|ABS04585.1| putative transcriptional regulator [Kineococcus radiotolerans SRS30216] (251 aa)
Score = 190, Expect = 4.1e-13, Identities = 55/178 (30%), Positives = 97/178 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPEQKIEELTYEE 182
           V++ +EA L +A +E V    L   +  +  + + ++ E+  EY +   RG  +R+VG  ++++++ + + +V +     Q   L Q  +ETLAI+AY  P +R+++  +R      ++  L+  GLV EAG  EA     LY+ T +F    GLD ++DLP +   LP    +ELT E+
  S:    28 VRAALEAVLMVA-DEPVRVQALARATGEAPDEVDLLLRELAGEYAEQ-GRGFELREVGGGWRVYSRAEHADVVEAFLLDGQTAKLTQAALETLAIVAYRQPVSRARVSAVRGVSVDGVMRTLLTRGLVCEAG-VEATSGATLYRTTEEFLQRMGLDGLEDLPPLAPFLP----DELTVED 200
>gi|87308263|ref|ZP_01090404.1| hypothetical protein DSM3645_11871 [Blastopirellula marina DSM 3645] >gi|87288820|gb|EAQ80713.1| hypothetical protein DSM3645_11871 [Blastopirellula marina DSM 3645] (191 aa)
Score = 189, Expect = 5.8e-13, Identities = 46/158 (29%), Positives = 79/158 (50%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +EA LF+A  E +   KL  ++ L+       +   +        R   V +    ++L T+P  +  +         + L+   +ETLA++AY  P  R+ +  +R  +   ML +L++  LV+ +GRSE +G+PYLY  T  F  +FGL ++ DLP
  S:     4 LEAILFLA-REPLSSRKLAQLANLADGTEARTLIRFLNRLYDAAHRAFRVEQSAGGFQLMTRPKFADWIRRLGNQPVASGLSSPAMETLAVVAYRQPVLRADVEAIRGVNCGEMLRQLMDRDLVKISGRSEELGRPYLYSTTRSFLRMFGLRNLDDLP 160
>gi|117928444|ref|YP_872995.1| condensin subunit ScpB [Acidothermus cellulolyticus 11B] >gi|117648907|gb|ABK53009.1| condensin subunit ScpB [Acidothermus cellulolyticus 11B] (205 aa)
Score = 188, Expect = 6.4e-13, Identities = 58/181 (32%), Positives = 99/181 (54%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRL-SVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPE-QKIEELTYEEEI 184
           +V   +EA LF+A +E V    + ++  +   Q  EAV    +     D  RG+ +R+V   ++L+T+P  +++V       Q+  L Q  +ETLA+IAY  P +RS++  +R  +   ++  L+  GL+EEAG  +  G   LY+ T  F +  G++ + +LP +   LPE   IE L  EE++
  S:    23 DVMGAVEAMLFVA-DEPVTVTAMAAVLGVPEPQVAEAVAR--LAASLADAGRGIELRQVAGGWRLYTRPAYAEVVQRFLREGQQARLTQAALETLAVIAYRQPISRSRVSAVRGVNVDGVIRTLLSRGLIEEAGTEDGTGAT-LYRTTRYFLEKLGINDLSELPPLADHLPEGTSIEAL--EEQL 201
>gi|153814791|ref|ZP_01967459.1| hypothetical protein RUMTOR_01006 [Ruminococcus torques ATCC 27756] >gi|145847822|gb|EDK24740.1| hypothetical protein RUMTOR_01006 [Ruminococcus torques ATCC 27756] (189 aa)
Score = 188, Expect = 6.7e-13, Identities = 57/179 (31%), Positives = 99/179 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           ++S IEA LF  G + V   KL        +  + ++  M+  YEK+  RG+ + ++ ++++L TK ++ + +       ++  L   ++ETL+I+AY  P T+ +I ++R       + KL+E GL+EE GR +A G+P L+  T +F   F + S+ DLP ++ PEQ IE    E E
  S:     6 LQSAIEAILFTMG-DSVEISKLAFAIGHDEETTKKLVRNMMERYEKE-DRGIRIIELEDSFQLCTKKEMYEYLIRVAKQPKRYALTDVLLETLSIVAYKQPVTKLEIEKIRGVKSDHAVNKLVEYGLIEETGRLDAPGRPLLFGTTEEFLRRFSVQSLDDLP-MLNPEQ-IEHFKEEAE 180
>gi|29833053|ref|NP_827687.1| transcriptional regulator [Streptomyces avermitilis MA-4680] >gi|29610174|dbj|BAC74222.1| putative chromosome segregation and condensation protein B [Streptomyces avermitilis MA-4680] (216 aa)
Score = 188, Expect = 7.2e-13, Identities = 56/194 (28%), Positives = 95/194 (48%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPEQKIEELTYEEEINFFDTNREDNGD 196
           +++K  +EA L +       +   K + R   Q  +A + E+  EY     RG  +R +   ++ +T+P  +  V       Q+  L Q  +ETLA++AY  P +RS++  +R  +   ++  L++ GLVEEAG     G   LY+ T  F +  GL  + +LPE+   LPE    E   +E +  FD +  +  D
  S:    18 LDLKPALEAVLMVVDEPATVEHLAKILERPKRQIADA-LRELADEYTGQ-GRGFELRLIAGGWRFYTRPKYATAVERFVLDGQQARLTQAALETLAVVAYRQPVSRSRVSAVRGVNCDGVMRTLLQRGLVEEAGAEPETGA-ILYRTTNYFLERMGLRGLDELPELAPFLPEADAIEAETQEGVPSFDPDAPETDD 210
>gi|149920283|ref|ZP_01908754.1| putative transcriptional regulator [Plesiocystis pacifica SIR-1] >gi|149818870|gb|EDM78310.1| putative transcriptional regulator [Plesiocystis pacifica SIR-1] (517 aa)
Score = 187, Expect = 8.1e-13, Identities = 52/167 (31%), Positives = 93/167 (55%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           S+ + S++E+ LF +      K   K ++  +V   +  ++ ++   + + +RG+VV +V   + L T+P  +  V     + Q  P  L++  +ETL++IAY  P TR +I  +R  D   +L+ L+E  LV+  G+ E VG+P LY  T  F + F L S++DLP++
  S:   118 SLRLVSIVESLLFASPKPMRVKQLRKLLAEPTVHQIQLALKHLM---DHNHERGIVVAQVAGGFVLQTQPQNAHWVQK---LLQAKPVRLSRPQLETLSVIAYRQPVTRPEIDHIRGVDSGAVLKILLERELVQIVGKKEEVGRPMLYGTTVYFLEFFNLMSLRDLPDL 280
>gi|126698893|ref|YP_001087790.1| segregation and condensation protein B [Clostridium difficile 630] >gi|145955025|ref|ZP_01804029.1| hypothetical protein CdifQ_04001433 [Clostridium difficile QCD-32g58] >gi|168696375|ref|ZP_02728652.1| segregation and condensation protein B [Clostridium difficile QCD-37x79] >gi|168723260|ref|ZP_02755537.1| segregation and condensation protein B [Clostridium difficile QCD-76w55] >gi|168730893|ref|ZP_02763170.1| segregation and condensation protein B [Clostridium difficile QCD-97b34] >gi|196159964|ref|ZP_03120525.1| segregation and condensation protein B [Clostridium difficile CIP 107932] >gi|123067078|sp|Q18BG3|SCPB_CLOD6 Segregation and condensation protein B >gi|115250330|emb|CAJ68152.1| segregation and condensation protein B [Clostridium difficile 630] (179 aa)
Score = 187, Expect = 8.8e-13, Identities = 53/165 (32%), Positives = 95/165 (57%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++K +IE+ +F  G E +   +L  I    LS ++ E ++  +I EY ++  RG+ + K+   Y++ T  D ++ +      K+K  L+Q  +ETL IIAY  P T+ +I ++R      +L+ L E  L+ EAGR   +GKP +Y+ T +F  +  ++S+++LP I
  S:     5 DIKYIIESVMFAYG-EPISIKELNYIINKELSSKEIEIMLNLLIEEY-REQNRGIQIIKLENKYQMCTNKDYAEYIKKIIEPKKKKSLSQATLETLTIIAYKQPITKVEIEDIRGVKCDKVLQTLFENELIREAGRLNKIGKPIIYKTTDEFLKLLNIESLEELPPI 169
>gi|148269566|ref|YP_001244026.1| putative transcriptional regulator [Thermotoga petrophila RKU-1] >gi|170288242|ref|YP_001738480.1| segregation and condensation protein B [Thermotoga sp. RQ2] >gi|147735110|gb|ABQ46450.1| condensin subunit ScpB [Thermotoga petrophila RKU-1] >gi|170175745|gb|ACB08797.1| segregation and condensation protein B [Thermotoga sp. RQ2] (167 aa)
Score = 186, Expect = 1.1e-12, Identities = 53/160 (33%), Positives = 88/160 (55%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSI 162
           + +K+ IEA +F   + G+  ++L  I     ++ + V+EE+  EYE D   G+V+R+V   Y+ FTKP+ +  V+   G K KN L    +E +A++  + P  +S+I   R  D + +L  L  +G+V    R +  GK YLYQ++P F +   LD I
  S:     1 MQLKAAIEALIF--ASNGITLERLIKILEKDPEEIKRVLEELKKEYE-DEAHGVVLREVNGRYRFFTKPEYADFVSKLSGRKYKN-LTDAQMEVVALLLLSGPIPKSEIDAFRGKDSSAVLSSLQRMGIV----RKKRKGKSYLYQLSPSFVESTMLDEI 152
>gi|119716722|ref|YP_923687.1| condensin subunit ScpB [Nocardioides sp. JS614] >gi|119537383|gb|ABL82000.1| condensin subunit ScpB [Nocardioides sp. JS614] (241 aa)
Score = 186, Expect = 1.2e-12, Identities = 50/173 (28%), Positives = 89/173 (51%)
  Q:    12 ALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEI 184
           AL I  ++ +    L + +   V +    +E +  EY +   RG  +R VG  ++ +T+ + + +V       Q+  L Q  +ETLA++AY  P +R+++  +R  +   ++  L+  GLVEEAG     G   LY+ T  F +  G+ S+ DLPE+      +++L  EEE+
  S:    29 ALLIIADQPMDTMTLATAAGYPVAEVSTALEGLAVEYTEQ-GRGFELRHVGGGWRYYTRDEYAAVVEGFVLDGQQARLTQAALETLAVVAYKQPVSRARVSAIRGVNVDGVMRTLLTRGLVEEAGHDHETGAN-LYRTTTYFLERIGVTSLDDLPELAPYLPDMDDL--EEEL 197
>gi|126646431|ref|ZP_01718948.1| segregation and condensation protein B [Algoriphagus sp. PR1] >gi|126578063|gb|EAZ82283.1| segregation and condensation protein B [Algoriphagus sp. PR1] (156 aa)
Score = 184, Expect = 1.8e-12, Identities = 40/127 (31%), Positives = 73/127 (57%)
  Q:    41 MEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           +E++  +Y+ D      +  +G  Y+  TKP     ++     + +  L+   +ETL+IIAY  P T+  I ++R  +    ++KL++  LVE  G+SE +G+P L+  + KF + FG++SI+DLP+
  S:    15 LEDIKVKYDSD-DFSFTLENLGGGYQFLTKPAYQTSISILLKQQSQKRLSTAQMETLSIIAYKQPVTKGDIEQIRGVNSDYSVQKLLDKELVEVKGKSEGIGRPLLFGTSEKFMEYFGINSIRDLPQ 140
>gi|116625543|ref|YP_827699.1| condensin subunit ScpB [Solibacter usitatus Ellin6076] >gi|116228705|gb|ABJ87414.1| condensin subunit ScpB [Solibacter usitatus Ellin6076] (308 aa)
Score = 184, Expect = 2.1e-12, Identities = 52/164 (31%), Positives = 96/164 (58%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM--IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           VK+V+EA +++A +E +   ++ +  +   +  + +++++I E+++ P  G+ +R+V   YK+ TKP+  + V + F    K PL   +  +ETLA+IAY  P T  +I E+R      + + L++  L+  AGR   +GKP LY+ T +F   FGL  + +LP +
  S:    73 VKAVLEAIVYVA-DEPLTLAQIAASLQQPPERIKELLDQLIAEFDQ-PGHGVAIREVAGGYKMATKPEHHEAVRN-FVKSLKPPLKLSLPALETLAVIAYKQPATGPEIMEIRGVQGGGVFKTLLDRKLIAVAGRKNVIGKPILYKTTKEFLIQFGLKDLSELPSL 235
>gi|167759041|ref|ZP_02431168.1| hypothetical protein CLOSCI_01388 [Clostridium scindens ATCC 35704] >gi|167663448|gb|EDS07578.1| hypothetical protein CLOSCI_01388 [Clostridium scindens ATCC 35704] (201 aa)
Score = 184, Expect = 2.2e-12, Identities = 54/169 (31%), Positives = 92/169 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQ 173
           ++ VIEA LF  G E V  +K+ +      +    ++  M+ +YE +  RG+ + ++ + +++ TK  + + +       +K  L   ++ETL+IIAY  P T+ +I ++R       + KL+E  LV E GR EA GKP L+  T +F   F + S++DLP +  PEQ
  S:    18 LEGVIEAILFTMG-ESVELNKIAAAIEHDEETTRKIIHRMMDKYEAE-DRGVRIIELEDAFQMCTKTQMYEYLIRVAKQPKKYVLTDVLLETLSIIAYKQPVTKLEIEKIRGVKSDHAVNKLVEYNLVCEKGRMEAPGKPILFGTTEEFLRRFSIQSVEDLPSLN-PEQ 183
>gi|114327919|ref|YP_745076.1| segregation and condensation protein ScpB [Granulibacter bethesdensis CGDNIH1] >gi|114316093|gb|ABI62153.1| segregation and condensation protein ScpB [Granulibacter bethesdensis CGDNIH1] (217 aa)
Score = 183, Expect = 2.4e-12, Identities = 40/114 (35%), Positives = 67/114 (58%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELR-KTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           RG+ +  +   ++  T PD++  +     + ++ P  +  +ETLA+IAY+ P TR ++ E+R  T     L+ L+E GL+   GR E  G+P L+  TP+F + FGL S+ DLP+
  S:    52 RGIELHDIAGGWQFRTAPDLANALRRVVEVPRRLP--RVAMETLAVIAYHQPVTRGEVEEIRGATLSQSTLDTLLEAGLITPRGRKEVPGRPSLWGTTPRFLEQFGLASLTDLPK 164
>gi|145594470|ref|YP_001158767.1| segregation and condensation protein B [Salinispora tropica CNB-440] >gi|145303807|gb|ABP54389.1| condensin subunit ScpB [Salinispora tropica CNB-440] (282 aa)
Score = 183, Expect = 2.8e-12, Identities = 52/174 (29%), Positives = 90/174 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPEQKIEEL 178
           +++ +EA L +  +E V +  L  +    +   +A++  +   Y      G  +R+    ++L+T+P+ +  V       Q   L Q  +ETLA+++Y  P TRS+I  +R  +   ++  L+  GLVEE G     G  +LY+ T  F +  GLDSI DLP +   LP+  +E+L
  S:   106 LRAALEAILLVV-DEPVAETTLADVLEQPLDRVQAMLHAISTGYTTRGH-GFELRRAAGGWRLYTRPEYAGYVERFVLDGQTVRLTQAALETLAVVSYKQPVTRSRISAIRGVNCDGVVRTLVSRGLVEECGTEPETGA-HLYRTTTLFLEKLGLDSITDLPPLAPFLPDD-VEDL 277
>gi|12724252|gb|AAK05374.1|AE006360_3 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] (165 aa)
Score = 183, Expect = 2.9e-12, Identities = 46/143 (32%), Positives = 80/143 (55%)
  Q:    26 LKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           + +++ +S Q  +  ++ +  +Y  D +  L + +    Y++ TK + ++I+ +      K PLNQ +    +E L+IIAY  P TR +I  LR  + + +L  L    LVE+ G+ EA G+P LY  T  F D  G++ + +LPEI
  S:     1 MSALTEMSKQACQQQIDYLKEKYHSDEESALTIIETAGKYRMATKEEFAEILKN----YAKTPLNQSLSKSALEVLSIIAYKQPLTRLEIDHLRGVNSSGVLSTLRAFDLVEKVGQVEAPGRPSLYATTDFFLDYIGINHLDELPEI 143
>gi|89211797|ref|ZP_01190137.1| Prokaryotic chromosome segregation and condensation protein ScpB [Halothermothrix orenii H 168] >gi|89158596|gb|EAR78304.1| Prokaryotic chromosome segregation and condensation protein ScpB [Halothermothrix orenii H 168] (179 aa)
Score = 182, Expect = 3.0e-12, Identities = 54/178 (30%), Positives = 87/178 (48%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           M +   + +EA LF +  E V   ++   + +S  +    ++ +  E++K    G+ V++  + Y   TKP+ S  + S         L+Q  +ETLAIIAY  P TR++I E+R       L  L + GL+ E GR E  G P +Y  T KF     +  +  LP++   EQ  EE+
  S:     1 MDVGNLAKLEALLFTS-PEPVSPGEIARAADMSESEVRKYLKILTREFDKK-SHGIQVKEYNDRYFFVTKPEFSSYIKSLHNKPGSIRLSQAALETLAIIAYKQPITRAEIEEIRGVKAEKTLLTLGKYGLIRELGRKETTGNPIVYGTTEKFLQYLDIKDLSQLPDL---EQFYEEI 173
>gi|91202362|emb|CAJ75422.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] (175 aa)
Score = 182, Expect = 3.6e-12, Identities = 51/163 (31%), Positives = 89/163 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEE---MIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           +K ++EA LF A  E +   K+ +I    + D +A + +    + + E + Q R   + ++   ++L+T P+  + ++       +  L+   +ETLAIIAY  P  R+ +  +R      ++  L+E  LV+  GR E++G P LY  T KF + FGL +IKDLP+
  S:     7 IKPIVEALLFSA-EEPLSSKKICNI----IDDVDAALIKEAITLLQQEYNQQGRAFQIEEIAGGFQLYTLPEYHEWISKLRKKSAETKLSSASLETLAIIAYKQPVLRADVESIRGVQSGQIIRLLMEKDLVKVVGRDESLGHPLLYGTTKKFLEHFGLKNIKDLPK 168
>gi|167751644|ref|ZP_02423771.1| hypothetical protein EUBSIR_02649 [Eubacterium siraeum DSM 15702] >gi|167655452|gb|EDR99581.1| hypothetical protein EUBSIR_02649 [Eubacterium siraeum DSM 15702] (196 aa)
Score = 181, Expect = 4.3e-12, Identities = 48/166 (28%), Positives = 90/166 (54%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQ 173
           +IEA LF +G E +  D+L   S +  +    +++ +  +Y       + V ++  +Y+L T+ + +  +      K++  L+   +E LA++AYN P T++ + ++R TD + ++  L+E  L+ EAGR E  G+P  Y+ T  F   F L+S+  LP   LP++
  S:     9 IIEALLFASG-EPISLDRLSEASGIEPETVVKLIDRLERKYNVS-DSAIRVLRLENSYQLSTREEYAPYIKRAMENKRQARLSPAALEVLAVVAYNQPVTKAFVEQVRGTDSSGVINTLVERELLYEAGRLELPGRPITYKTTDNFLRCFKLESLAQLPS--LPDE 170
>gi|158522769|ref|YP_001530639.1| segregation and condensation protein B [Desulfococcus oleovorans Hxd3] >gi|158511595|gb|ABW68562.1| segregation and condensation protein B [Desulfococcus oleovorans Hxd3] (299 aa)
Score = 181, Expect = 4.6e-12, Identities = 46/164 (28%), Positives = 84/164 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K++IE+ LF+           K ++   + +    + E+  EYE   Q G V+ +V + Y+  T+    + +   F       L +  +ETLAIIAY+ P  R+ + ++R  D   +L  L+E  L+   G+ E  G+P +Y  T +F ++F L S++D+P +
  S:     6 LKNIIESLLFVTDTPLSPSAVKKVVTDSDIGEIRQALAELKAEYEAR-QGGFVLSEVADGYQFRTRSAYKEWIKRMFK-PPPTRLGKAALETLAIIAYHQPVIRADVEKIRGVDSGAILRTLLERKLIRILGKKEIPGRPLIYATTQRFLEVFNLRSLRDMPTL 167
>gi|148259964|ref|YP_001234091.1| putative transcriptional regulator [Acidiphilium cryptum JF-5] >gi|146401645|gb|ABQ30172.1| condensin subunit ScpB [Acidiphilium cryptum JF-5] (185 aa)
Score = 181, Expect = 4.6e-12, Identities = 45/133 (33%), Positives = 75/133 (56%)
  Q:    35 QDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPT-PMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           +D +A++  +   +E     G+ + + G+     T PD++  +     I ++ P  +  +ETLA+IAY+ P TR++I E+R    +   L+ L+E  LV  AG  EA G+P L+  TP F   FGL S++DLP+
  S:    41 EDLDALLASLRARHEGG---GIELVEAGQGMMFRTAPDLAPALRRVVEIPRRLP--RAAMETLAVIAYHQPVTRAEIEEIRGVSLSQSALDALLEADLVTPAGHREAPGRPALWATTPHFLVQFGLKSLRDLPK 169
>gi|148556832|ref|YP_001264414.1| condensin subunit ScpB [Sphingomonas wittichii RW1] >gi|148502022|gb|ABQ70276.1| condensin subunit ScpB [Sphingomonas wittichii RW1] (195 aa)
Score = 181, Expect = 4.9e-12, Identities = 45/115 (39%), Positives = 66/115 (57%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + + G  +   T  D++ I+      ++   L++  IETLAIIAY+ P +R++I  +R    +   L+ L+E G +  AGR EA G+P LY  TP F   FGL S KDLP I
  S:    51 RGIELVERGGRWHFQTAADMAHILRRTR--EEPRKLSRAGIETLAIIAYHEPVSRAEIEAIRGVQISKGTLDVLLEAGWIRPAGRREAPGRPLLYATTPSFLTHFGLSSRKDLPGI 164
>gi|71066125|ref|YP_264852.1| condensin subunit ScpB [Psychrobacter arcticus 273-4] >gi|71039110|gb|AAZ19418.1| condensin subunit ScpB [Psychrobacter arcticus 273-4] (183 aa)
Score = 180, Expect = 5.3e-12, Identities = 41/111 (36%), Positives = 63/111 (56%)
  Q:    56 LVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           L +      Y+L      S ++ S F  +Q+  L+Q ++ETL++IAY  P TRS I  +R  T  + +L +L + G +EE G  + +G+P L   TPKF D FGL  + +LP
  S:    64 LNLHHTASGYRLQIADSHSALIQSVFPQRQER-LSQALLETLSVIAYKQPVTRSDIEHVRGVTLSSTILRQLFDKGWIEENGHKDTLGRPALLHTTPKFLDAFGLSHLDELP 174
>gi|42560926|ref|NP_975377.1| hypothetical protein MSC_0386 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492423|emb|CAE77019.1| Conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (209 aa)
Score = 180, Expect = 5.3e-12, Identities = 50/168 (29%), Positives = 89/168 (52%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSI-SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGEN-YKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLD-SIKDLPEI 168
           M+    ++IE  LFI G++G+    ++++   L   + + ++ ++  +Y  DP     ++   +N Y+L TKP++ +  A      +   L+   IE L+IIAY  P T+ QI E+R  D T  L KL E  L++  G+     +  LY +T  F+ +F +   I++LP I
  S:     1 MNQQYSAIIEGLLFIYGDDGISLLDIQTVLDNLKPTEIKEIIIQLNKKYLSDPSTAFCIQTYKKNNYRLQTKPELHEYFAKLEQYNENKKLSHSTIEVLSIIAYKQPITKQQIDEIRNVDSTYQLYKLREKKLIKVVGKDLENNRSNLYGITDNFFKVFNIKGGIEELPTI 171
>gi|46198746|ref|YP_004413.1| putative cytoplasmic protein [Thermus thermophilus HB27] >gi|55980761|ref|YP_144058.1| hypothetical protein TTHA0792 [Thermus thermophilus HB8] >gi|46196369|gb|AAS80786.1| hypothetical cytosolic protein [Thermus thermophilus HB27] >gi|55772174|dbj|BAD70615.1| conserved hypothetical protein [Thermus thermophilus HB8] (177 aa)
Score = 180, Expect = 5.5e-12, Identities = 53/165 (32%), Positives = 93/165 (56%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRG---LVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++K+++ A LF AG     K+ L+++        EAV+  +    E+D + G   + + +V   ++L   P   + V     +K   P L++  +E LA++AY+ P TR+++  +R      +LE L+E GLV   G  EA G+P LY  T +F ++FGL+S++DLP +
  S:     6 SLKTLLLAVLFAAGRPVALKE-LRALGHPE----EAVLRALK-ALERDLEAGHLGVALERVAGGWRLVVHPKALEAVERV--LKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGVLESLLERGLVRVVGEKEAPGRPKLYGTTERFLEVFGLESLEDLPPL 166
>gi|15643260|ref|NP_228304.1| hypothetical protein TM0494 [Thermotoga maritima MSB8] >gi|4981005|gb|AAD35579.1|AE001726_13 conserved hypothetical protein [Thermotoga maritima MSB8] (167 aa)
Score = 180, Expect = 6.2e-12, Identities = 52/160 (32%), Positives = 87/160 (54%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSI 162
           + +K+ IEA +F   + G+  ++L  I     ++ +  +EE+  EYE D   G+V+R+V   Y+ FTKP+ +  V+   G K KN L    +E +A++  + P  +S+I   R  D + +L  L  +G+V    R +  GK YLYQ++P F +   LD I
  S:     1 MQLKAAIEALIF--ASNGITLERLIKILEKDPEEIKRALEELKKEYE-DEAHGVVLREVNGRYRFFTKPEYAGFVSKLSGRKYKN-LTDTQMEVVALLLISGPIPKSEIDAFRGKDSSAVLSSLQRMGIV----RKKRKGKSYLYQLSPSFVESTMLDEI 152
>gi|86138653|ref|ZP_01057226.1| segregation and condensation protein B [Roseobacter sp. MED193] >gi|85824713|gb|EAQ44915.1| segregation and condensation protein B [Roseobacter sp. MED193] (219 aa)
Score = 180, Expect = 6.6e-12, Identities = 47/128 (36%), Positives = 74/128 (57%)
  Q:    39 AVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           A +E +   YE    RG+ V +VGE + + T PD+  ++     I +   L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VTP F D FGL+S +DLP
  S:    55 AALEHLRKRYEG---RGVRVVQVGEAWAIRTAPDLGFLMQKE--IVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTVDQLLEMEWIRIGRRRMTPGRPVTFVVTPVFLDHFGLESARDLP 178
>gi|153810799|ref|ZP_01963467.1| hypothetical protein RUMOBE_01183 [Ruminococcus obeum ATCC 29174] >gi|149833195|gb|EDM88277.1| hypothetical protein RUMOBE_01183 [Ruminococcus obeum ATCC 29174] (189 aa)
Score = 180, Expect = 6.7e-12, Identities = 48/164 (29%), Positives = 91/164 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +++ IEA LF  G E V   ++    +   +    +++ M+ +Y+K   RG+ + ++ ++Y+L +K +  + +       +K  L   M+ETL+IIAY  P T+++I ++R       + KL+E  LV E GR +A G+P L+  T +F   FG+  +++LP +
  S:     6 LEAAIEAILFTMG-ESVELSQIADAIQQDKETTRKIIQNMMDKYQKK-DRGIQIIELEQSYQLCSKKEYYECLIRLAMHPKKPALTDVMLETLSIIAYKQPVTKAEIEKIRGVKCDHAINKLVEYELVRELGRLDAPGRPILFGTTEEFLRCFGVQGLEELPSV 167
>gi|89054002|ref|YP_509453.1| condensin subunit ScpB [Jannaschia sp. CCS1] >gi|88863551|gb|ABD54428.1| condensin subunit ScpB [Jannaschia sp. CCS1] (228 aa)
Score = 179, Expect = 7.0e-12, Identities = 45/113 (39%), Positives = 70/113 (61%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ V KVG+N+   T  D+  ++A    ++Q+  L++  IETLAIIAY+ P TR++I E+R    +   +++LIE+  ++   R    G+P  Y VT  F D FGL+S +DLP
  S:    65 RGVQVAKVGDNWAFRTAADLGFLMARD-QVEQRK-LSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTIDQLIELDWIKFGRRRMTPGRPVTYVVTQLFLDHFGLESARDLP 176
>gi|156744358|ref|YP_001434487.1| segregation and condensation protein B [Roseiflexus castenholzii DSM 13941] >gi|156235686|gb|ABU60469.1| segregation and condensation protein B [Roseiflexus castenholzii DSM 13941] (187 aa)
Score = 179, Expect = 7.7e-12, Identities = 47/151 (31%), Positives = 78/151 (51%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFG 158
           +IEA LF+AG E V   +L  +  LS    +A+ + +         RG+ +++  +  ++ + P+ + +V    G    + L+   +E L IIAY  P TR+QI  +R  D + +L  L+   L+ E GR E +G+P LY  T +F   FG
  S:    23 LIEALLFVAG-EPVTVTELARVLDLSP---DAIEQALDDLAAACAGRGVRLQRDADRIQMVSAPEAAAVVERFLGTPPSSRLSAAALEVLTIIAYRQPITRAQIEAIRGVDSSGVLRALLSRDLIAEGGRLETLGRPILYVTTVEFLRQFG 169
>gi|159037541|ref|YP_001536794.1| segregation and condensation protein B [Salinispora arenicola CNS-205] >gi|157916376|gb|ABV97803.1| segregation and condensation protein B [Salinispora arenicola CNS-205] (191 aa)
Score = 179, Expect = 8.6e-12, Identities = 44/124 (35%), Positives = 70/124 (56%)
  Q:    55 GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPEQKIEEL 178
           G  +R+    ++L+T+P+ +  V       Q   L Q  +ETLA+++Y  P TRS+I  +R  +   ++  LI  GL+EE G +E     +LY+ T  F +  GLDSI DLP +   LP+  +E+L
  S:    63 GFELRRAAGGWRLYTRPEYAGYVERFVLDGQTVRLTQAALETLAVVSYKQPVTRSRISAIRGVNCDGVIRTLISRGLIEECG-AEPDSGAHLYRTTTLFLEKLGLDSITDLPPLAPFLPDD-VEDL 186
>gi|83593109|ref|YP_426861.1| condensin subunit ScpB [Rhodospirillum rubrum ATCC 11170] >gi|83576023|gb|ABC22574.1| condensin subunit ScpB [Rhodospirillum rubrum ATCC 11170] (239 aa)
Score = 178, Expect = 1.1e-11, Identities = 56/161 (34%), Positives = 81/161 (50%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSV-QDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +IEA LF A       D     SRL    D  A++  +   Y    QRG+V+ + G  +   T  D+    A    ++   P  L++  IETLAIIAY+ P TR+ I E+R    +   L+ L+E G +   GR +  G+P  +  T  F D FGL S+ DLP +
  S:    23 LIEALLFAAPTPLSVADL---ASRLPAGADVAALLGALADHYR---QRGVVLVESGGRWAFRTAADL----AGQLRLETTEPRRLSRAAIETLAIIAYHQPVTRADIEEIRGVALSKGTLDLLLEAGWIHPCGRRQTAGRPLTWGTTEGFLDHFGLGSVDDLPGV 177
>gi|114319883|ref|YP_741566.1| condensin subunit ScpB [Alkalilimnicola ehrlichei MLHE-1] >gi|114226277|gb|ABI56076.1| condensin subunit ScpB [Alkalilimnicola ehrlichei MLHE-1] (194 aa)
Score = 177, Expect = 1.4e-11, Identities = 49/164 (29%), Positives = 89/164 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           VK V+EAAL +A    +  D+++ +   ++      + + + E  +D + RGL V++V   +++  +   +  V S    ++    ++ ++ETLAIIAY  P TR +I ++R  T  + ++  L + G V   G  +  G+P LY  TP F D F L S+ +LP++
  S:     7 VKYVLEAAL-MAAEGTLDLDQMQGLFDPALAPDRQTLRQALAELRQDYEGRGLEVKQVASGWRIQVREAYAPWV-SRLWEEKPGRYSRALLETLAIIAYRQPVTRGEIEDIRGVTVSSSIMRTLTDRGWVRIVGHKDVPGRPGLYATTPAFLDYFNLSSLSELPDL 170
>gi|72161609|ref|YP_289266.1| condensin subunit ScpB [Thermobifida fusca YX] >gi|71915341|gb|AAZ55243.1| condensin subunit ScpB [Thermobifida fusca YX] (193 aa)
Score = 176, Expect = 1.5e-11, Identities = 48/164 (29%), Positives = 86/164 (52%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPE 172
           +EA L +  ++ V   +L       V+    V+ E   EY +   RG  +R+V E ++ +T+P+ ++ V        +  L Q  +ETLA++AY  P +R ++  +R  +   ++  L+  GL+EEAG+    G   LY+ T  F +  GL S+ +LP++   LP+
  S:    17 LEAVLMVV-DQPVSAYELARAFGTDVETVTRVLRETAREYTEQ-GRGFDLREVAEGWRFYTRPECAEAVEHFLRDGHEVRLTQAALETLAVVAYRQPVSRGKVSAIRGVNCDGVMRTLVLRGLIEEAGQDPESGA-ILYRTTSYFLERLGLRSLDELPDLAPFLPD 179
>gi|54294519|ref|YP_126934.1| hypothetical protein lpl1595 [Legionella pneumophila str. Lens] >gi|53754351|emb|CAH15835.1| hypothetical protein [Legionella pneumophila str. Lens] (193 aa)
Score = 176, Expect = 1.5e-11, Identities = 58/179 (32%), Positives = 103/179 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE-----------QKIEELTYEEE 183
           +K+++EA L ++ NE V  +K++       R +++D +A++E +  +Y     R   + +V   +K+ TK   +  VA    I++    ++ ++ETLAIIAY  P TR+ I ++R     + +++ L+E   +  AG  + VGKP +Y  T +F + F L+ + +LP   LPE           Q IEE T  E+
  S:     6 LKNIVEA-LVLSSNEPVTLEKIQETFDEWQRPTLEDLQAIIESLKVDYS---SRAFELIQVAGGFKVQTKSKYATWVAR-LQIEKPAKYSRALLETLAIIAYKQPVTRADIEDIRGVAVNSQIMKTLMEREWIRIAGYKDVVGKPAVYTTTKEFLNYFNLNYLSELPP--LPEIMDTLTLHEATQSIEECTQNEQ 193
>gi|153004983|ref|YP_001379308.1| putative transcriptional regulator [Anaeromyxobacter sp. Fw109-5] >gi|152028556|gb|ABS26324.1| putative transcriptional regulator [Anaeromyxobacter sp. Fw109-5] (352 aa)
Score = 176, Expect = 1.6e-11, Identities = 46/164 (28%), Positives = 90/164 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           V++++E  LF+A    +  ++L+  + + ++  E  ++++   Y ++   G+V+ +V   ++L + PD +        +K +  L +  +ETLAIIAY  P TR +I E+R  D   +++ L+E  L++  G+ E  G+P LY  T +F + F L  +  LP +
  S:   102 VRTIMETLLFLA-ERPLTSEELRQATGVDLERIEKALDKLSGHY-REGVCGIVLHEVAGGWQLRSSPDNAAFSRRWLKVKPQR-LTRAALETLAIIAYRQPVTRPEIEEIRGVDCGAVVKALLERKLIKILGKKEEPGRPMLYGTTREFLEFFALKDLASLPTL 262
>gi|99080748|ref|YP_612902.1| condensin subunit ScpB [Silicibacter sp. TM1040] >gi|99037028|gb|ABF63640.1| condensin subunit ScpB [Silicibacter sp. TM1040] (226 aa)
Score = 176, Expect = 1.8e-11, Identities = 42/113 (37%), Positives = 67/113 (59%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ V +VGE + + T PD+  ++       +   L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VTP F D FGL+S +DLP
  S:    73 RGVRVVQVGEAWAMRTAPDLGYLMQKE--TVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTIDQLLEMEWIRLGRRKMTPGRPVTFVVTPVFLDHFGLESARDLP 184
>gi|56697347|ref|YP_167715.1| segregation and condensation protein B [Silicibacter pomeroyi DSS-3] >gi|56679084|gb|AAV95750.1| segregation and condensation protein B [Silicibacter pomeroyi DSS-3] (218 aa)
Score = 176, Expect = 1.9e-11, Identities = 44/113 (38%), Positives = 70/113 (61%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ V +VGE + + T PD+      GF ++++      L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VTP F D FGL+S +DLP
  S:    65 RGVRVVQVGEGWAIRTAPDL------GFLMQKETVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTIDQLLEMEWIRLGRRRMTPGRPVTFVVTPHFLDHFGLESARDLP 176
>gi|84500947|ref|ZP_00999182.1| segregation and condensation protein B [Oceanicola batsensis HTCC2597] >gi|84391014|gb|EAQ03432.1| segregation and condensation protein B [Oceanicola batsensis HTCC2597] (223 aa)
Score = 175, Expect = 2.0e-11, Identities = 41/113 (36%), Positives = 66/113 (58%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ V +VG+ + + T PD+  ++       +   L++  IETLAIIAY+ P TR++I E+R    +   ++ LIE+G +    R    G+P  + VT  F D FGL++ +DLP
  S:    69 RGIRVVQVGDQWAIRTAPDLGHLMQKE--TVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTIDLLIEMGWIRFGRRRMTPGRPVTFVVTATFLDHFGLETARDLP 180
>gi|154502525|ref|ZP_02039585.1| hypothetical protein RUMGNA_00338 [Ruminococcus gnavus ATCC 29149] >gi|153796921|gb|EDN79341.1| hypothetical protein RUMGNA_00338 [Ruminococcus gnavus ATCC 29149] (189 aa)
Score = 175, Expect = 2.0e-11, Identities = 50/162 (30%), Positives = 88/162 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +++ IEA LF  G   V   KL        +  + ++ +M+  YEK+  RG+ + ++  ++++ TK ++ + +       +K  L   ++ETL+IIAY  P T+ +I ++R       + KL+E  LVEE GR +A GKP L+  T +F   F + S+ +LP
  S:     6 LQAAIEAILFAMGGS-VELKKLAQAIGHDEETTKKIIRQMMDRYEKE-DRGIRIIELEASFQMCTKKEMYEYLIRVAKQPKKQVLTDVLLETLSIIAYKQPVTKLEIEKIRGVKSDHAVSKLVEYDLVEEVGRMDAPGKPLLFGTTEEFLRRFSVHSLDELP 165
>gi|153855280|ref|ZP_01996446.1| hypothetical protein DORLON_02460 [Dorea longicatena DSM 13814] >gi|149752279|gb|EDM62210.1| hypothetical protein DORLON_02460 [Dorea longicatena DSM 13814] (192 aa)
Score = 175, Expect = 2.0e-11, Identities = 52/162 (32%), Positives = 90/162 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEA---VMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++ +IEA LF  G+      ++  I+R   QD E    V+ +M+ +Y  +  RG+ + ++   Y++ TK ++ + +       +K+ L   ++ETL+IIAY  P T+ +I ++R       + KL+E  LV E GR +A GKP L+  T +F   F + S+ DLP
  S:     9 MEGIIEAILFTMGDSV----EIGKIARALEQDEETTRKVIHKMMDKYVAE-DRGVRIIELDGAYQMCTKTEMYEYLIRVASQPKKHVLTDVLLETLSIIAYKQPVTKLEIEKIRGVKSDHAVNKLVEYNLVSERGRMDAPGKPILFGTTEEFLRRFSIHSLDDLP 168
>gi|53803499|ref|YP_114626.1| segregation and condensation protein B [Methylococcus capsulatus str. Bath] >gi|53757260|gb|AAU91551.1| segregation and condensation protein B [Methylococcus capsulatus str. Bath] (201 aa)
Score = 175, Expect = 2.0e-11, Identities = 53/170 (31%), Positives = 91/170 (53%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           +++K+++EAALF A    +   +L+++     R + ++    +  +  EY   P   L +RKV   Y+   +   +  ++  F  ++    ++ ++ETLAIIAY  P TR QI E+R     + ++  L E   V   G  +  G+P L+  TP+F D F L+S+ DLP   LPE
  S:     1 MDLKAILEAALF-AAQRPLSLAELEALFGEDERPATEEIRLALATLADEYAARP---LELRKVASGYRFQVRAAYAPWISRLFE-ERPGRYSRALLETLAIIAYRQPVTRGQIEEIRGVAVSSGIIRTLTEREWVTVVGHRDVPGRPALFATTPQFLDHFNLESLADLP--ALPE 168
>gi|21220261|ref|NP_626040.1| hypothetical protein SCO1769 [Streptomyces coelicolor A3(2)] >gi|5738485|emb|CAB52833.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)] (223 aa)
Score = 175, Expect = 2.0e-11, Identities = 52/180 (28%), Positives = 92/180 (51%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPE-QKIEELTYE 181
           ++++K  +EA L +  +E   +++L  I +   +     + E+  EY     RG  +R +   ++ +++P+ +  V       Q   L Q  +ETLA++AY  P +R ++  +R  +   ++  L++ GLVEEAG     G   LY  T  F +  GL  + +LPE+   LPE + IE  T E
  S:    23 ALDLKPALEAVLMVV-DEPATEERLAKILQRPRRRIADALRELADEYAVQ-GRGFELRLIAGGWRFYSRPEYAAAVEGFVLDGQHARLTQAALETLAVVAYRQPVSRGRVSAVRGVNCDGVMRTLLQRGLVEEAGTEPETGA-ILYVTTNYFLERMGLRGLDELPELAPFLPEAEAIEADTLE 202
>gi|34763150|ref|ZP_00144118.1| Hypothetical Cytosolic Protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887179|gb|EAA24282.1| Hypothetical Cytosolic Protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (181 aa)
Score = 175, Expect = 2.1e-11, Identities = 55/176 (31%), Positives = 95/176 (53%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQR--GLVVRKVGENYKLFTKPDISKIVASGFGIKQK-NPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           +++KS +EA +F+ G+E   KD L    ++S++D   ++ E+     KD ++  G+ +    E   L T P   +++ + F  + K   L+   IETL+IIAY  P T+S+I  +R      ++  L E   V   GR E   +  LY+VT KF    G+ +I +LP+  L ++KI+ +
  S:     1 MSIKSQVEAIIFLGGDENKIKD-LAKFFKISIEDMLKILLEL-----KDDRKDTGINIEIDSEIVYLSTNPLYGEVINNYFEQETKPKKLSSASIETLSIIAYKQPVTKSEIESIRGVSVDRIISNLEERKFVRNCGRQETGRRANLYEVTDKFLSYLGIKNITELPDYDLLKEKIKSM 173
>gi|25028114|ref|NP_738168.1| hypothetical protein CE1558 [Corynebacterium efficiens YS-314] >gi|23493398|dbj|BAC18368.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] (187 aa)
Score = 175, Expect = 2.3e-11, Identities = 48/167 (28%), Positives = 88/167 (52%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +S IE+ L +  +  V    L +   +     EA++ E+  E+ +    G  +R+    ++L+T+PD + +V +      ++ L++  +ETLA++AY  P TRSQI  +R  +   ++  L   GLV E     A G  + Y  T  F ++ G+DS+  LP++  +LP+
  S:    14 RSRIESILLVV-DTPVPASTLAAAVGMDTAGVEAILTEIAGEFTRRGS-GFDLREADGGWRLYTRPDNAAVVEALLLDGAQSRLSRAALETLAVVAYRQPVTRSQISAVRGVNVDGVMRTLQMRGLVAEVDVEPATGA-HRYATTALFLELLGIDSLDRLPDLAPLLPD 179
>gi|58176740|pdb|1T6S|A Chain A, Crystal Structure Of A Conserved Hypothetical Protein From Chlorobium Tepidum >gi|58176741|pdb|1T6S|B Chain B, Crystal Structure Of A Conserved Hypothetical Protein From Chlorobium Tepidum (162 aa)
Score = 175, Expect = 2.3e-11, Identities = 39/148 (26%), Positives = 79/148 (53%)
  Q:    12 ALFIAGNEGVHKDKLKSIS--RLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           AL  +  E V+   L  I+  + +  + +  ++E+  +YE    R   +  +   Y+  T+P+ + +V        +  L++ M+E LA++A++ P T+ +I ++R   P   +++L+  GL+E  GR+++ G+P  Y  T  F D+F L
  S:    14 ALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEAT-GRTFRIHAIAGGYRFLTEPEFADLVRQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLFHL 162
>gi|24374539|ref|NP_718582.1| hypothetical protein SO_3014 [Shewanella oneidensis MR-1] >gi|24349131|gb|AAN56026.1|AE015738_1 conserved hypothetical protein [Shewanella oneidensis MR-1] (198 aa)
Score = 174, Expect = 2.8e-11, Identities = 59/180 (32%), Positives = 101/180 (56%)
  Q:     2 SINVKSVIEAALFIAGNE---GVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--------------VLPEQKIEELTYE 181
           SI +K +IEA+LF+ G      + K+ + +   +S    +A +EE+  +Y+   +RG+ + KV   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD++ DLP +              V PEQ  E+ T E
  S:     5 SIQLKQLIEASLFVLGKPLSVKMLKETVLADFSVSRDKIKAALEELQQDYQ---ERGVQLVKVAGGYRFQTLEVLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVAISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPALTDTESLQAVFSGLKVTPEQSEEQDTNE 198
>gi|115379479|ref|ZP_01466575.1| segregation and condensation protein B, putative [Stigmatella aurantiaca DW4/3-1] >gi|115363514|gb|EAU62653.1| segregation and condensation protein B, putative [Stigmatella aurantiaca DW4/3-1] (239 aa)
Score = 174, Expect = 2.8e-11, Identities = 44/162 (27%), Positives = 88/162 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +++V+++ LF+A ++ +  D+L   + +  +     + + I    +D   G+V+ +V + ++  T P  ++ V     +K +  L +  +ETLAIIAY  P TR ++ ++R  D   +++ L++  LV+  G+ E VG+P LY  T +F + F L  +   P
  S:    74 IRTVLQSVLFVA-DKPLTVDQLYESTGIDRELIAKALNQ-ISGLHRDGVNGIVLHEVADGWQFRTDPHSAEYVRRYLRVKPQR-LTRAAVETLAIIAYRQPVTRPEVEDIRGVDCGAVIKALMDRKLVKILGKKEEVGRPILYGTTREFLEFFALKDLASCP 232
>gi|32477053|ref|NP_870047.1| putative transcriptional regulator [Rhodopirellula baltica SH 1] >gi|32447601|emb|CAD79200.1| conserved hypothetical protein-putative transcriptional regulator [Rhodopirellula baltica SH 1] (540 aa)
Score = 174, Expect = 2.8e-11, Identities = 39/115 (33%), Positives = 65/115 (56%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + +V    ++ T+  ++  +     +     L+  M+ETLA++AY    TR+ +  +R      +L +L+++ LV  +GRSE +G+PYLY  T +F  I GL SIK LP I
  S:   211 RGIRIEQVAGGQRMMTRSVVAPWLRRLGFLAPAIRLSWPMMETLAVVAYRQDVTRADVEAVRGVACGEILRQLMQLDLVRISGRSEELGRPYLYGTTKRFLKICGLASIKSLPPI 325
>gi|158316820|ref|YP_001509328.1| segregation and condensation protein B [Frankia sp. EAN1pec] >gi|158112225|gb|ABW14422.1| segregation and condensation protein B [Frankia sp. EAN1pec] (238 aa)
Score = 174, Expect = 3.1e-11, Identities = 52/161 (32%), Positives = 83/161 (51%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           +++EA L +A N  V   +  +   +  +  EA++ E+  +YE+D  RG  +R VG  ++L+T     P + + V +G    Q   L+Q  +ETLAI+AY  P +R +I  +R      ++  L    LVEE G     G   LY+ T  F +  GL   +DL E
  S:    64 ALVEAVLTVAENP-VGVAEFATALDIPARRVEALLAELAAQYERD-GRGFRLRHVGRGWRLYTADECAPWVERFVLAG----QSARLSQAALETLAIVAYQQPVSRGRISAVRGVSADGVIRTLTARNLVEECGHDHESGA-ILYRTTDYFLERMGL---RDLDE 218
>gi|163746491|ref|ZP_02153849.1| putative transcriptional regulator [Oceanibulbus indolifex HEL-45] >gi|161380376|gb|EDQ04787.1| putative transcriptional regulator [Oceanibulbus indolifex HEL-45] (218 aa)
Score = 174, Expect = 3.2e-11, Identities = 53/159 (33%), Positives = 83/159 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +IEA LF +      ++    + R S      V E M F   +   RG+ V KVG+ Y   T PD+  ++       +   L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT +F D FGL+S +DLP
  S:    24 MIEAVLFASSEPITLRELEDRLPRGS-----DVGEAMAFLRHRYQGRGVQVMKVGDAYAFRTAPDLGFLMHRE--TVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVAVSRGTVDQLLEMEWIRFGRRKMTPGRPVTFVVTQEFLDHFGLESARDLP 176
>gi|166031715|ref|ZP_02234544.1| hypothetical protein DORFOR_01415 [Dorea formicigenerans ATCC 27755] >gi|166028168|gb|EDR46925.1| hypothetical protein DORFOR_01415 [Dorea formicigenerans ATCC 27755] (193 aa)
Score = 174, Expect = 3.3e-11, Identities = 53/169 (31%), Positives = 90/169 (53%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQ 173
           +++VIEA LF  G E V   K+ +           ++  +  +YE +  RGL + ++ ++++L TK ++   +       +K  L   ++ETL+IIAY  P T+ +I ++R       + KL+E  L  E GR +A G+P L+  T +F   F + SI+DLP +  PEQ
  S:    10 MEAVIEAILFTMG-ESVELKKIAAAIEHDEATTRKIIHRLQDKYEAE-DRGLRIIELEDSFQLCTKREMYDYLIRIAKQPKKCVLTDVLLETLSIIAYRQPVTKLEIEKIRGVKSDHAVNKLVEYNLACEVGRLDAPGRPILFGTTEEFLRRFSIQSIEDLPSM-QPEQ 175
>gi|126726957|ref|ZP_01742796.1| Predicted transcriptional regulator containing the HTH domain [Rhodobacterales bacterium HTCC2150] >gi|126703915|gb|EBA03009.1| Predicted transcriptional regulator containing the HTH domain [Rhodobacterales bacterium HTCC2150] (216 aa)
Score = 173, Expect = 3.4e-11, Identities = 41/113 (36%), Positives = 66/113 (58%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ + KVG+ Y L T PD+  ++       +   L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  ++   R    G+P  + VT  F D FGL+  +DLP
  S:    63 RGVNLVKVGDAYALRTAPDLGYLMQKE--TVETRKLSRAAIETLAIIAYHQPATRAEIEEIRGVSVSRGTIDQLLELEWIKFGRRRMTPGRPVTFMVTQDFLDHFGLEGTRDLP 174
>gi|85373145|ref|YP_457207.1| hypothetical protein ELI_01590 [Erythrobacter litoralis HTCC2594] >gi|84786228|gb|ABC62410.1| hypothetical protein ELI_01590 [Erythrobacter litoralis HTCC2594] (230 aa)
Score = 173, Expect = 3.8e-11, Identities = 48/163 (29%), Positives = 82/163 (50%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +++  IEA LF + +    +     +   +  D    ++ +   YE   +RG+ + +    +   T PD++ ++      +Q   L++   E LAI+AY+ P +R++I  +R        L+ L+E G V  AGR E  G+P +Y  TP+F   FGL S KDLP
  S:     7 DLERAIEATLFASEDPMGVESLATHLGDAAASDVRDALKNLAKHYE---ERGVHLVERSRRWHFQTAPDLAHLLRRE--KEQVRRLSRAATEVLAIVAYHEPVSRAEIEAIRGVQTAKGTLDVLMEAGWVRAAGRREVPGRPVIYATTPEFLQHFGLASRKDLP 165
>gi|148358977|ref|YP_001250184.1| hypothetical protein LPC_0862 [Legionella pneumophila str. Corby] >gi|148280750|gb|ABQ54838.1| Segregation and condensation protein B [Legionella pneumophila str. Corby] (193 aa)
Score = 173, Expect = 3.8e-11, Identities = 57/179 (31%), Positives = 103/179 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE-----------QKIEELTYEEE 183
           +K+++EA L ++ NE V  +K++       R +++D +A++E +  +Y     R   + +V   +K+ TK   +  VA    I++    ++ ++ETLAIIAY  P TR+ I ++R     + +++ L+E   +  AG  + VGKP +Y  T +F + F L+ + +LP   LPE           Q I+E T  E+
  S:     6 LKNIVEA-LILSSNEPVTLEKIQETFDEWQRPTLEDLQAIIESLKVDYS---SRAFELIQVASGFKVQTKSKYATWVAR-LQIEKPAKYSRALLETLAIIAYKQPVTRADIEDIRGVAVNSQIIKTLMEREWIRIAGYKDVVGKPAVYTTTKEFLNYFNLNYLSELPP--LPEIMDTLTLHEATQPIKECTQNEQ 193
>gi|83320037|ref|YP_424569.1| chromosomal segregation and condensation protein B [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283923|gb|ABC01855.1| chromosomal segregation and condensation protein B [Mycoplasma capricolum subsp. capricolum ATCC 27343] (209 aa)
Score = 173, Expect = 4.1e-11, Identities = 51/177 (28%), Positives = 92/177 (51%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSI-SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGEN-YKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLD-SIKDLPEIVLPEQKIEE 177
           M +   ++IE  LFI G++GV    ++++   L   + + ++ E+  +Y  D      ++   +N Y+L TKP++    A      +   L+   IE L+IIAY  P T+  I E+R  D +  L KL E  L++  G+     +  LY +T  F+ +F +   I++LP  V+ +Q I++
  S:     1 MKLQYSAIIEGLLFIYGDDGVSLLDIQTVLEDLKPTEIKEIIIELNKKYLADQSTAFCIQTYKKNNYRLQTKPELHPYFAKLEQYNENKKLSHSTIEVLSIIAYKQPITKQSIEEIRNVDCSYQLHKLREKRLIKVVGKDLENNRSNLYAITDNFFKVFNIKGGIEELP--VISDQDIKQ 178
>gi|27468096|ref|NP_764733.1| hypothetical protein SE1178 [Staphylococcus epidermidis ATCC 12228] >gi|57866961|ref|YP_188634.1| segregation and condensation protein B [Staphylococcus epidermidis RP62A] >gi|41017949|sp|Q7ZAJ3|SCPB_STAES Segregation and condensation protein B >gi|81674522|sp|Q5HP56|SCPB_STAEQ Segregation and condensation protein B >gi|27315642|gb|AAO04777.1|AE016748_11 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] >gi|57637619|gb|AAW54407.1| segregation and condensation protein B [Staphylococcus epidermidis RP62A] (180 aa)
Score = 173, Expect = 4.1e-11, Identities = 48/172 (27%), Positives = 90/172 (52%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           +++EA L+ +G+EG+ + ++  I  +++      +E+++ +Y      GL +++ G  Y L TK + S  +      K K  L+Q  +ETL+IIAYN P TR  I  +R  +    ++ LI  GLVE      +  + +    T  F ++FG++++  LP     E +++E 
  S:     5 AILEALLYTSGDEGLEQKQIIDILDINLNQ----LEDLVSKYH---SHGLTIQRYGSTYVLTTKKETSTYIEQLVKEKSKMKLSQAAMETLSIIAYNQPLTRGDIEMIRGINSDGAVKTLIARGLVEAKDVDHS--RSHHLITTDLFLNVFGIENLDALPTTEEDEAEMDEF 167
>gi|159044273|ref|YP_001533067.1| segregation and condensation protein B [Dinoroseobacter shibae DFL 12] >gi|157912033|gb|ABV93466.1| segregation and condensation protein B [Dinoroseobacter shibae DFL 12] (229 aa)
Score = 172, Expect = 4.7e-11, Identities = 42/113 (37%), Positives = 67/113 (59%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ V +VG+ + + T PD+  ++ +   + +   L++  IETLAIIAY+ P TR++I E+R    +   L++LIE+  V    R    G+P  +  T  F D FGL+S +DLP
  S:    81 RGVHVVRVGDAWAMRTAPDLGFLMQNE--VTETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTLDQLIELEWVRFGRRRMTPGRPTTFVATQTFLDQFGLESARDLP 192
>gi|85712443|ref|ZP_01043492.1| Predicted transcriptional regulator containing the HTH domain [Idiomarina baltica OS145] >gi|85693721|gb|EAQ31670.1| Predicted transcriptional regulator containing the HTH domain [Idiomarina baltica OS145] (188 aa)
Score = 172, Expect = 4.7e-11, Identities = 55/184 (29%), Positives = 96/184 (52%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRL---------SVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           +K +IEAALF       H   L S+ RL         S+   +  ++ +  +Y     RG+ +  V   ++  T+P+  +++A   G+ Q+ P   +Q ++ETLA+IAY  P TR +I ++R     + +++ L E   +   G+ E  G+P LY  T +F D F L ++ +LP I   ++   E    E  +  D
  S:     6 LKQLIEAALF------AHPQPL-SVQRLYELFEAQGVSLNGVKGAIKSLQDDYH---DRGIELVNVASGFRFQTRPEFGELLA---GLWQERPTRYSQALLETLALIAYRQPITRGEIEQVRGVSVSSNIIKTLQERQWIAVVGQKEVPGRPQLYGTTAQFLDDFNLTNLSELPSIDFSDETTAETAITERDDLHD 188
>gi|49483744|ref|YP_040968.1| hypothetical protein SAR1570 [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749563|sp|Q6GGK4|SCPB_STAAR Segregation and condensation protein B >gi|49241873|emb|CAG40566.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] (180 aa)
Score = 172, Expect = 4.7e-11, Identities = 49/159 (30%), Positives = 84/159 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++E+ LF AG+EG+ + +L  I  +S        ++++   E     GL++++ G  Y L TK + S  +      K +  L+Q  +E L+IIAYN P +RS I  +R  +    ++ LI  GLVE    +E   +  +   T  F ++FG+ +I+DLP
  S:     6 ILESLLFTAGDEGLDEKQLLEILDIS-------KDQLVELIENYSSHGLIIQRFGTTYVLTTKKEASMYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNEQRSQQLI--TTDLFLNVFGISNIEDLP 155
>gi|114562610|ref|YP_750123.1| putative transcriptional regulator [Shewanella frigidimarina NCIMB 400] >gi|114333903|gb|ABI71285.1| putative transcriptional regulator [Shewanella frigidimarina NCIMB 400] (245 aa)
Score = 172, Expect = 5.3e-11, Identities = 52/166 (31%), Positives = 89/166 (53%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAV---MEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           I +K +IEA+LF+          +K+I    + DF      ++E + E ++D Q RG+ + K+   Y+  T+  +S  +   +  ++K+P  ++  +ETLA+IAY  P TR  I  +R     + +++ L +   ++  G  E  GKP LY  TP F D F L  + DLP +
  S:     7 IQLKQLIEASLFVLAK----PLSVKAIKETVLADFSVSRTRIQETLDELQQDYQERGVQLVKIASGYRFQTQEILSPYLQPLW--QEKSPKYSRATLETLAVIAYRQPVTRGDIEYIRGVAISSHIIKSLADRQWIKVVGHKEVPGKPALYATTPAFLDYFNLTKLADLPAL 172
>gi|108804280|ref|YP_644217.1| putative transcriptional regulator [Rubrobacter xylanophilus DSM 9941] >gi|108765523|gb|ABG04405.1| putative transcriptional regulator [Rubrobacter xylanophilus DSM 9941] (185 aa)
Score = 172, Expect = 5.5e-11, Identities = 57/177 (32%), Positives = 84/177 (47%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQR-GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEI 184
           ++EA LF +    V +  L S + LS  + E  + E+   Y   P+R G+V+R+V   ++L T P  S  V    G  +  PL+    E LA + Y  P TR  I  +R  +   ++  LIE GL+ E G SE  G+  L  VT  F    G  S +D P        +E L  +EE+
  S:     6 LVEAVLFSSARP-VSRGALASCTGLSAGEVERALAELAGRYS--PERSGVVLREVAGGFQLATNPACSAAVERFRGEARPAPLSAAAHEVLACVLYLGPLTRGAISRVRGVNSDAVVRTLIERGLLAEKGSSEE-GQAALLDVTEDFLVAAGASSREDFP-------PLESLVRKEEL 172
>gi|56460845|ref|YP_156126.1| transcription regulator [Idiomarina loihiensis L2TR] >gi|56179855|gb|AAV82577.1| Predicted transcriptional regulator containing the HTH domain [Idiomarina loihiensis L2TR] (190 aa)
Score = 171, Expect = 5.7e-11, Identities = 52/166 (31%), Positives = 91/166 (54%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           + +K +IEAALF A  + +  ++L  +     +   A + + + E + D Q RG+ + KV   Y+  T+ ++ + +A   G+ Q+ P   +  ++ETLA+I Y  P TR +I ++R     + +++ L E G V+  G  E  G+P LY  T  F D F L  + +LP+I
  S:     4 LQLKQLIEAALF-AHPQPLSAEQLYQLLLNEGEASLAAIRQQLKELQSDYQERGIELVKVASGYRFQTRAELGQRLA---GLWQEKPPRYSNALLETLALIVYRQPITRGEIEQIRGVSVSSQIMKTLQERGWVKVVGHKEVPGRPQLYASTNDFLDDFNLSDLSELPDI 169
>gi|39996930|ref|NP_952881.1| hypothetical protein GSU1831 [Geobacter sulfurreducens PCA] >gi|39983818|gb|AAR35208.1| conserved hypothetical protein TIGR00281 [Geobacter sulfurreducens PCA] (195 aa)
Score = 171, Expect = 5.9e-11, Identities = 53/179 (29%), Positives = 95/179 (53%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEM--IFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           ++S++E+ LF++    +  D+L S+  L   D  A+ E +  + E      RG+++ +VG  ++ F  P  +  V       +    +Q  +ETLAIIAY  P TR++I  LR  D   +L+ L+E  L++  G+ +  GKP +Y  T +F ++F L  +K LP +    +  E   +E++
  S:     4 LESLVESLLFVSETP-LSLDRLCSL--LEEFDRAAIREALDRLLERYGGEGRGIILAEVGGGFQ-FRTPAGNGDVIRRLTKARPARFSQSALETLAIIAYRQPVTRAEIEYLRGVDSGGVLKTLLEKKLIKILGKRDIPGKPLIYGTTREFLELFALKDLKSLPSLREIRELSETAVFEQQ 180
>gi|54297356|ref|YP_123725.1| hypothetical protein lpp1401 [Legionella pneumophila str. Paris] >gi|53751141|emb|CAH12552.1| hypothetical protein [Legionella pneumophila str. Paris] (193 aa)
Score = 171, Expect = 6.7e-11, Identities = 57/179 (31%), Positives = 103/179 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE-----------QKIEELTYEEE 183
           +K+++EA L ++ NE V  +K++       R +++D +A++E +  +Y     R   + +V   +K+ TK   +  VA    I++    ++ ++ETLAIIAY  P TR+ I ++R     + +++ L+E   +  AG  + VGKP +Y  T +F + F L+ + +LP   LPE           Q I+E T  E+
  S:     6 LKNIVEA-LVLSNNEPVTLEKIQETFDEWQRPTLEDLQAIIESLKVDYS---SRAFELIQVAGGFKVQTKSKYATWVAR-LQIEKPAKYSRALLETLAIIAYKQPVTRADIEDIRGVAVNSQIIKTLMEREWIRIAGYKDVVGKPAVYTTTKEFLNYFNLNYLSELPP--LPEIMDTLTLHEATQPIKECTQNEQ 193
>gi|148653752|ref|YP_001280845.1| putative transcriptional regulator [Psychrobacter sp. PRwf-1] >gi|148572836|gb|ABQ94895.1| condensin subunit ScpB [Psychrobacter sp. PRwf-1] (219 aa)
Score = 171, Expect = 7.0e-11, Identities = 38/113 (33%), Positives = 66/113 (58%)
  Q:    56 LVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           L + +    Y+L  + + S ++   F  ++   L+Q ++ETL++IAY  P TR  I ++R  T  + +L +L + G + E G  E +G+P L   TP+F D FGL+S++ LP +
  S:    99 LSLSESASGYRLQIRSEYSALIQHVFP-QRLESLSQALLETLSVIAYKQPVTRGDIEQVRGVTVSSNILRQLFDKGWIIEKGYRETLGRPALLHTTPQFLDAFGLESLEQLPPL 211
>gi|77918904|ref|YP_356719.1| hypothetical protein Pcar_1300 [Pelobacter carbinolicus DSM 2380] >gi|123574371|sp|Q3A508|SCPB_PELCD Segregation and condensation protein B >gi|77544987|gb|ABA88549.1| condensin subunit ScpB [Pelobacter carbinolicus DSM 2380] (200 aa)
Score = 171, Expect = 7.0e-11, Identities = 59/187 (31%), Positives = 99/187 (52%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ +K++IEA LF A    V  ++L   +         ++ E+  EY +   RG V+ ++ E Y+L T+P+ ++ V       +   L++  +E LAIIAY  P TR+ I  LR  D   +++ L++  LV   G+ +  G+P LY  + +F + FGL S+ DLP +    ++  ELT E E   FD
  S:     6 TVELKAIIEALLFAAPGP-VRLEQLALAADADPARVAPLLAELETEYLR-AGRGFVLVELAEGYQLRTRPEHAEWVRR-LHSSRPTRLSRAALEALAIIAYQQPVTRADIDYLRGVDSGGVVKSLLDKRLVRIVGKKDVPGRPLLYGTSREFLEFFGLRSLSDLPTL----KEFTELTKESESLLFD 185
>gi|84516343|ref|ZP_01003703.1| segregation and condensation protein B [Loktanella vestfoldensis SKA53] >gi|84510039|gb|EAQ06496.1| segregation and condensation protein B [Loktanella vestfoldensis SKA53] (213 aa)
Score = 170, Expect = 7.9e-11, Identities = 40/115 (34%), Positives = 68/115 (59%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ V ++G+ + + T PD+  ++     I +   L++  IETLAI+AY+ P TR++I E+R    +   +++LIE+  +    R    G+P  + VT  F D FGL++ +DLP I
  S:    62 RGVNVVRIGDAWAIRTAPDLGFLMQKE--IVETRKLSRAAIETLAIVAYHQPVTRAEIEEIRGVSVSRGTIDQLIEMEWIRLGRRKMTPGRPVTFVVTQAFLDHFGLENARDLPGI 175
>gi|149914956|ref|ZP_01903485.1| putative transcriptional regulator [Roseobacter sp. AzwK-3b] >gi|149811144|gb|EDM70981.1| putative transcriptional regulator [Roseobacter sp. AzwK-3b] (220 aa)
Score = 170, Expect = 8.1e-11, Identities = 46/135 (34%), Positives = 83/135 (61%)
  Q:    32 LSVQDFEAVM-------EEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           L++++ EA M       E +++  ++   RG+ + KVG+ + + T PD+      GF ++++      L++  +ETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT  F D FGL+S +DLP
  S:    36 LTIKEMEARMPHGCDAAEALVYVRKRYEGRGVNLVKVGDAWAMRTAPDL------GFLMQKETVETRKLSRAAVETLAIIAYHQPVTRAEIEEIRGVSVSRGTVDQLLEMEWIRFGRRKMTPGRPVTFVVTQSFLDHFGLESARDLP 176
>gi|163727095|ref|ZP_02134594.1| putative transcriptional regulator [Desulfatibacillum alkenivorans AK-01] >gi|161399642|gb|EDQ23911.1| putative transcriptional regulator [Desulfatibacillum alkenivorans AK-01] (344 aa)
Score = 170, Expect = 8.3e-11, Identities = 55/175 (31%), Positives = 92/175 (52%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGR-SEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           N+K +IE+ LFI+      +   +SI     +     +E +  EYE     G  +  V   Y+L T+P+ ++ +     + Q  P  L++  +ETLAIIAY  P  RS I  +R  D   +L+ L+E  L+   GR ++  G+P +Y  T KF ++F L  + +LP +    +++EEL
  S:     3 NLKYIIESLLFISSTPLSMERLRQSIPEADSKMIRTALETLGREYELRGG-GFALHHVAGGYQLRTRPEYAQWIKR---LHQSQPVRLSKPALETLAIIAYRQPVLRSDIEYIRGVDSGGVLKMLMEKQLIRVLGRDTDKPGRPMIYSTTKKFLEVFDLKDLTELPTL----KELEEL 172
>gi|163739607|ref|ZP_02147016.1| putative transcriptional regulator [Phaeobacter gallaeciensis BS107] >gi|161387066|gb|EDQ11426.1| putative transcriptional regulator [Phaeobacter gallaeciensis BS107] (220 aa)
Score = 170, Expect = 9.0e-11, Identities = 51/139 (36%), Positives = 82/139 (58%)
  Q:    28 SISRLSVQDFEA----------VMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           S   ++V+D EA           ME +   YE    RG+ + +VG+ + L T  D+      GF ++++      L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VTP F D FGL+S +DLP
  S:    36 SAEPVTVRDLEARMPHGCEPGTAMEHLRKRYEG---RGVNIVRVGDAWALRTASDL------GFLMQKETVETRKLSRAAIETLAIIAYHQPVTRAEIEEVRGVSVSRGTIDQLLEMDWIRLGRRKMTPGRPVTFVVTPVFLDHFGLESARDLP 180
>gi|113969808|ref|YP_733601.1| condensin subunit ScpB [Shewanella sp. MR-4] >gi|114047037|ref|YP_737587.1| condensin subunit ScpB [Shewanella sp. MR-7] >gi|117919972|ref|YP_869164.1| condensin subunit ScpB [Shewanella sp. ANA-3] >gi|113884492|gb|ABI38544.1| putative transcriptional regulator [Shewanella sp. MR-4] >gi|113888479|gb|ABI42530.1| putative transcriptional regulator [Shewanella sp. MR-7] >gi|117612304|gb|ABK47758.1| putative transcriptional regulator [Shewanella sp. ANA-3] (198 aa)
Score = 170, Expect = 9.0e-11, Identities = 58/179 (32%), Positives = 100/179 (55%)
  Q:     3 INVKSVIEAALFIAGNE---GVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--------------VLPEQKIEELTYE 181
           I +K +IEA+LF+ G      + K+ + +   +S    +A +EE+  +Y+   +RG+ + KV   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD++ DLP +              V PEQ  E+ T E
  S:     6 IQLKQLIEASLFVLGKPLSVKMLKETVLADFSVSRDKIKAALEELQQDYQ---ERGVQLVKVAGGYRFQTLEVLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVAISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPALTDTESLQAVFSGLKVTPEQSEEQDTNE 198
>gi|163741407|ref|ZP_02148798.1| segregation and condensation protein B [Phaeobacter gallaeciensis 2.10] >gi|161385141|gb|EDQ09519.1| segregation and condensation protein B [Phaeobacter gallaeciensis 2.10] (220 aa)
Score = 170, Expect = 9.2e-11, Identities = 51/139 (36%), Positives = 82/139 (58%)
  Q:    28 SISRLSVQDFEA----------VMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           S   ++V+D EA           ME +   YE    RG+ + +VG+ + L T  D+      GF ++++      L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VTP F D FGL+S +DLP
  S:    36 SAEPVTVRDLEARMPHGCEPGTAMEHLRKRYEG---RGVNIVRVGDAWALRTASDL------GFLMQKETVETRKLSRAAIETLAIIAYHQPVTRAEIEEVRGVSVSRGTIDQLLEMDWIRLGRRKMTPGRPVTFVVTPVFLDHFGLESARDLP 180
>gi|15924484|ref|NP_372018.1| hypothetical protein SAV1494 [Staphylococcus aureus subsp. aureus Mu50] >gi|15927075|ref|NP_374608.1| hypothetical protein SA1325 [Staphylococcus aureus subsp. aureus N315] >gi|148267978|ref|YP_001246921.1| putative transcriptional regulator [Staphylococcus aureus subsp. aureus JH9] >gi|150394043|ref|YP_001316718.1| segregation and condensation protein B [Staphylococcus aureus subsp. aureus JH1] >gi|156979813|ref|YP_001442072.1| hypothetical protein SAHV_1482 [Staphylococcus aureus subsp. aureus Mu3] >gi|167016593|sp|A7X2K7|SCPB_STAA1 Segregation and condensation protein B >gi|189046144|sp|A6U1W3|SCPB_STAA2 Segregation and condensation protein B >gi|189046145|sp|A5IT22|SCPB_STAA9 Segregation and condensation protein B >gi|41017857|sp|P60218|SCPB_STAAM Segregation and condensation protein B >gi|41017858|sp|P60219|SCPB_STAAN Segregation and condensation protein B >gi|13701293|dbj|BAB42587.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247265|dbj|BAB57656.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|147741047|gb|ABQ49345.1| condensin subunit ScpB [Staphylococcus aureus subsp. aureus JH9] >gi|149946495|gb|ABR52431.1| segregation and condensation protein B [Staphylococcus aureus subsp. aureus JH1] >gi|156721948|dbj|BAF78365.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (180 aa)
Score = 170, Expect = 9.2e-11, Identities = 48/159 (30%), Positives = 84/159 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++E+ LF AG+EG+ + +L  I  +S        ++++   E     GL++++ G  Y L TK + +  +      K +  L+Q  +E L+IIAYN P +RS I  +R  +    ++ LI  GLVE    +E   +  +   T  F ++FG+ +I+DLP
  S:     6 ILESLLFTAGDEGLDEKQLLEILDMS-------KDQLVELIENYSSHGLMIQRFGTTYVLTTKKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNEQRSQQLI--TTDLFLNVFGISNIEDLP 155
>gi|157961473|ref|YP_001501507.1| segregation and condensation protein B [Shewanella pealeana ATCC 700345] >gi|157846473|gb|ABV86972.1| segregation and condensation protein B [Shewanella pealeana ATCC 700345] (198 aa)
Score = 170, Expect = 9.3e-11, Identities = 52/164 (31%), Positives = 88/164 (53%)
  Q:     5 VKSVIEAALFIAGNE---GVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K +IEA+LF+          K+ + S   +S    +A +EE+  +YE    RG+ + KV   Y+  T  ++S  +   +  ++K P  ++  +ETLA+IAY  P TR  I  +R     + +++ L +   ++  G  E  G+P LY  T +F   FG+DSI DLP +
  S:     9 LKQLIEASLFVLAKPMTIKALKETVLSSFNVSRAKIKACIEELQLDYE---NRGVQLVKVAGGYRFQTLAELSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEFVRGVAISSHIIKSLNDRNWIKVVGHKEVPGRPALYATTTEFLAYFGIDSIADLPPL 172
>gi|52841676|ref|YP_095475.1| hypothetical protein lpg1446 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52628787|gb|AAU27528.1| hypothetical protein lpg1446 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (196 aa)
Score = 169, Expect = 9.7e-11, Identities = 57/179 (31%), Positives = 103/179 (57%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE-----------QKIEELTYEEE 183
           +K+++EA L ++ NE V  +K++       R +++D +A++E +  +Y     R   + +V   +K+ TK   +  VA    I++    ++ ++ETLAIIAY  P TR+ I ++R     + +++ L+E   +  AG  + VGKP +Y  T +F + F L+ + +LP   LPE           Q I+E T  E+
  S:     9 LKNIVEA-LVLSSNEPVTLEKIQETFDEWQRPTLEDLQAIIESLKVDYS---YRAFELIQVAGGFKVQTKSKYATWVAR-LQIEKPAKYSRALLETLAIIAYKQPVTRADIEDIRGVAVNSQIIKTLMEREWIRIAGYKDVVGKPAVYTTTKEFLNYFNLNYLSELPP--LPEIMDTLTLHEATQPIKECTQNEQ 196
>gi|167570134|ref|ZP_02363008.1| hypothetical protein BoklC_09836 [Burkholderia oklahomensis C6786] (437 aa)
Score = 169, Expect = 9.9e-11, Identities = 41/106 (38%), Positives = 62/106 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNREDNG 195
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D G
  S:    75 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGDGG 182
>gi|21283177|ref|NP_646265.1| hypothetical protein MW1448 [Staphylococcus aureus subsp. aureus MW2] >gi|49486332|ref|YP_043553.1| hypothetical protein SAS1434 [Staphylococcus aureus subsp. aureus MSSA476] >gi|41018070|sp|Q8NWF2|SCPB_STAAW Segregation and condensation protein B >gi|56749516|sp|Q6G970|SCPB_STAAS Segregation and condensation protein B >gi|21204617|dbj|BAB95313.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49244775|emb|CAG43211.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] (180 aa)
Score = 169, Expect = 1.0e-10, Identities = 50/159 (31%), Positives = 84/159 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++E+ LF AG+EG+ + +L  I  +S       + E+I  Y      GL++++ G  Y L TK + +  +      K +  L+Q  +E L+IIAYN P +RS I  +R  +    ++ LI  GLVE    +E   +  +   T  F ++FG+ +I+DLP
  S:     6 ILESLLFTAGDEGLDEKQLLEILDMSKNQ----LVELIENYS---SHGLMIQRFGTTYVLTTKKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNEQRSQQLI--TTDLFLNVFGISNIEDLP 155
>gi|89901091|ref|YP_523562.1| putative transcriptional regulator [Rhodoferax ferrireducens T118] >gi|89345828|gb|ABD70031.1| condensin subunit ScpB [Rhodoferax ferrireducens T118] (230 aa)
Score = 169, Expect = 1.2e-10, Identities = 50/175 (28%), Positives = 88/175 (50%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKD-KLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE 176
           ++  K ++E AL         +D ++    RL +   + ++ E+  ++    QRG+ +  V   ++  ++P++ + +       +K P   +  +ETLAIIAY  P TR  I ++R      +L K +E  G +E  G  E VG+P L+  T  F D  GL+S+  LP    PEQ+ +
  S:     3 TVAAKRILETALICTSQPLPLRDMRVLFDDRLGLDTLKVLLRELQQDW---AQRGVELVNVASGWRFQSRPEMREFLDRLH--PEKPPRYTRATLETLAIIAYRQPVTRGDIEDVRGVTVNSLLIKQLEDRGWIEVIGHRETVGRPALFATTKHFLDDLGLESLDQLPLFDTPEQRTD 175
>gi|167562945|ref|ZP_02355861.1| hypothetical protein BoklE_10320 [Burkholderia oklahomensis EO147] (435 aa)
Score = 169, Expect = 1.2e-10, Identities = 41/106 (38%), Positives = 62/106 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNREDNG 195
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D G
  S:    75 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGDGG 182
>gi|19704092|ref|NP_603654.1| putative cytoplasmic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714294|gb|AAL94953.1| Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (181 aa)
Score = 169, Expect = 1.2e-10, Identities = 54/176 (30%), Positives = 96/176 (54%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQR--GLVVRKVGENYKLFTKPDISKIVASGFGIKQK-NPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           +++K+ +E+ +F+ G+E   KD L    ++S++D   ++ E+     KD ++  G+ +    E   L T P   +++ + F  + K   L+   IETL+IIAY  P T+S+I  +R      ++  L E   V   G+ E+  K  LY+VT KF    G+ SI +LP+  L ++KI+ +
  S:     1 MSIKNQVESIIFLGGDENKIKD-LAKFFKISIEDMLKILLEL-----KDDRKDTGINLEVDSEIVYLSTNPLYGEVINNYFEQETKPKKLSSASIETLSIIAYKQPITKSEIESIRGVSVDRIVSNLEERKFVRNCGKQESGRKANLYEVTDKFLSYLGIKSITELPDYDLLKEKIKNM 173
>gi|148323973|gb|EDK89223.1| possible transcriptional regulator [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (181 aa)
Score = 168, Expect = 1.3e-10, Identities = 53/176 (30%), Positives = 96/176 (54%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQR--GLVVRKVGENYKLFTKPDISKIVASGFGIKQK-NPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           +++K+ +EA +F+ G+E   KD L    ++S++D   ++ E+     KD ++  G+ +    E   L T P   +++ + F  + K   L+   IETL+IIAY  P T+S+I  +R      ++  L E   V   G+ E+  K  LY+VT +F    G+ +I +LP+  L ++KI+ +
  S:     1 MSIKNQVEAIIFLGGDENKIKD-LAKFFKISIEDMLKILLEL-----KDDRKDTGINLEVDSEIVYLSTNPLYGEVINNYFEQETKPKKLSSASIETLSIIAYKQPVTKSEIESIRGVSVDRIISNLEERKFVRNCGKQESGRKANLYEVTDRFLSYLGIKNITELPDYDLLKEKIKSM 173
>gi|57650450|ref|YP_186379.1| segregation and condensation protein B [Staphylococcus aureus subsp. aureus COL] >gi|87160083|ref|YP_494140.1| segregation and condensation protein B [Staphylococcus aureus subsp. aureus USA300] >gi|88195299|ref|YP_500103.1| hypothetical protein SAOUHSC_01588 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221614|ref|YP_001332436.1| hypothetical protein NWMN_1402 [Staphylococcus aureus subsp. aureus str. Newman] >gi|168726917|ref|ZP_02759194.1| hypothetical protein Sauraur_00669 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|172048895|sp|A6QH42|SCPB_STAAE Segregation and condensation protein B >gi|81694452|sp|Q5HFS8|SCPB_STAAC Segregation and condensation protein B >gi|122539459|sp|Q2FY77|SCPB_STAA8 Segregation and condensation protein B >gi|123485741|sp|Q2FGN8|SCPB_STAA3 Segregation and condensation protein B >gi|57284636|gb|AAW36730.1| segregation and condensation protein B [Staphylococcus aureus subsp. aureus COL] >gi|87126057|gb|ABD20571.1| segregation and condensation protein B [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202857|gb|ABD30667.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374414|dbj|BAF67674.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] (180 aa)
Score = 168, Expect = 1.3e-10, Identities = 48/159 (30%), Positives = 84/159 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++E+ LF AG+EG+ + +L  I  +S        ++++   E     GL++++ G  Y L TK + +  +      K +  L+Q  +E L+IIAYN P +RS I  +R  +    ++ LI  GLVE    +E   +  +   T  F ++FG+ +I+DLP
  S:     6 ILESLLFTAGDEGLDEKQLLEILDMS-------KDQLVELIENYSSHGLMIQRFGMTYVLTTKKEAATYIEQLIEQKSQMKLSQAAMEVLSIIAYNQPLSRSDIELIRSINSDGAVKTLIAKGLVEAKVVNEQRSQQLI--TTDLFLNVFGISNIEDLP 155
>gi|89068220|ref|ZP_01155630.1| Predicted transcriptional regulator containing the HTH domain [Oceanicola granulosus HTCC2516] >gi|89046137|gb|EAR52195.1| Predicted transcriptional regulator containing the HTH domain [Oceanicola granulosus HTCC2516] (221 aa)
Score = 168, Expect = 1.4e-10, Identities = 38/113 (33%), Positives = 69/113 (61%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPT-PMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ V ++GE++ + T PD+  ++     + +   L++  IETLAI+AY+ P TR++I E+R    +   +++L+E+  +    R  + G+P  + VT  F D FGL++ +DLP
  S:    74 RGVNVVRIGESWAIRTAPDLGFLMRHE--VVETRKLSRAAIETLAIVAYHQPVTRAEIEEIRGVGVSRGTIDQLLELDWIRFGRRRMSPGRPVTFVVTEAFLDHFGLENPRDLP 185
>gi|114771800|ref|ZP_01449193.1| segregation and condensation protein B [alpha proteobacterium HTCC2255] >gi|114547616|gb|EAU50507.1| segregation and condensation protein B [alpha proteobacterium HTCC2255] (214 aa)
Score = 168, Expect = 1.4e-10, Identities = 55/163 (33%), Positives = 95/163 (58%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           + ++EA LF + +E + K +L+   R+ +     V E ++    +   RG+ + +VGE Y L T P +      GF +++++     L++  IETLAIIAY+ P TRS+I E+R     +  ++ L+E+  ++   R ++ G+P  + VT  F D FG++S KDLP I
  S:    21 ERMLEAILF-SVSEPISKQQLEK--RMPIG--SDVSEALVAMKNRYSTRGVNLVRVGEGYALRTAPGL------GFLMQKESVETRKLSRAAIETLAIIAYHQPVTRSEIEEIRGVSVSSGTIDILLELEWIKLGRRRQSPGRPVTFIVTQVFLDHFGMESSKDLPGI 177
>gi|149374979|ref|ZP_01892752.1| Predicted transcriptional regulator [Marinobacter algicola DG893] >gi|149360868|gb|EDM49319.1| Predicted transcriptional regulator [Marinobacter algicola DG893] (220 aa)
Score = 168, Expect = 1.4e-10, Identities = 51/181 (28%), Positives = 95/181 (52%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEIN 185
           ++++ EAAL  AG   +  D+L+ +     +    VME ++   E+  Q RG  ++K+   Y+L  + + +  V   F  K +   ++ ++ETLA++AY  P TR +I ++R  T  + ++  L+E   V   G  +  G+P +Y  T +F D F L+ +  +P +    + +EE+  E E N
  S:     9 IQAITEAALLAAGKP-LSVDQLRDLFEEGERPARQVMEHVLVLLEQSCQGRGFELKKIASGYRLQVREEFAPWVGRLFEEKPQR-YSRALLETLALVAYRQPITRGEIEDIRGVTVSSNIVRTLLEREWVRVVGHRDVPGRPAMYATTRQFLDYFNLEGLDQMPPLS-DIRDLEEIGREIEKN 188
>gi|15639449|ref|NP_218899.1| hypothetical protein TP0458 [Treponema pallidum subsp. pallidum str. Nichols] >gi|189025690|ref|YP_001933462.1| hypothetical protein TPASS_0458 [Treponema pallidum subsp. pallidum SS14] >gi|3322746|gb|AAC65446.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum str. Nichols] >gi|189018265|gb|ACD70883.1| hypothetical protein TPASS_0458 [Treponema pallidum subsp. pallidum SS14] (192 aa)
Score = 168, Expect = 1.4e-10, Identities = 39/113 (34%), Positives = 62/113 (54%)
  Q:    67 LFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELT 179
           L     + + +A+ +G + +  L++  +ETL+I+AY  P TR++I  +R      M+  L E  L+ E G+ +  GKP  Y  T +F   F L SI DLP++   EQ+  ELT
  S:    79 LLPAATVRERLATLYGKRSEGRLSRAAMETLSIVAYAQPVTRAEIEAIRGVGADTMIRLLSERRLICEVGKKDIPGKPAQYGTTEEFLTAFRLRSIADLPKLDEEEQRRFELT 191
>gi|110601892|ref|ZP_01390055.1| Prokaryotic chromosome segregation and condensation protein ScpB [Geobacter sp. FRC-32] >gi|110547399|gb|EAT60662.1| Prokaryotic chromosome segregation and condensation protein ScpB [Geobacter sp. FRC-32] (194 aa)
Score = 168, Expect = 1.5e-10, Identities = 56/178 (31%), Positives = 100/178 (56%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVME--EMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           MS N+KSVIE+ +F++  + V  D+L  +  L   +   + E  E++ E  +D  RG+V+ +V   Y+  ++P+ +  +       +    +Q  +ETLAIIAY  P TR++I  LR  D   +++ L+E  L++  G+ E  GKP +Y  + +F ++F L  +  LP +    ++I+EL
  S:     1 MSANLKSVIESLIFVS-EQPVSLDRLCGV--LEEHERPEIREALELLVEEYRDSARGIVLAEVAGGYQFRSRPENADYLRR-LTRSKTTKFSQSALETLAIIAYRQPITRAEIEYLRGVDSGGVVKSLLEKKLLKILGKKEIPGKPLIYGTSREFLELFNLKDLSSLPSL----KEIQEL 172
>gi|154508820|ref|ZP_02044462.1| hypothetical protein ACTODO_01330 [Actinomyces odontolyticus ATCC 17982] >gi|153798454|gb|EDN80874.1| hypothetical protein ACTODO_01330 [Actinomyces odontolyticus ATCC 17982] (188 aa)
Score = 168, Expect = 1.5e-10, Identities = 50/165 (30%), Positives = 86/165 (52%)
  Q:     1 MSIN-VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEY---EKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDL 165
           MS N ++  IEA L +A +E V    L  +  +S  D E  M  +  EY    ++  RG  +R+V   +++++    + +V           L+Q  +ETLA+IAY  P +R++I  +R  +   ++  L+  GLVEE G + +  +  LY  T +F +  GL S+ +L
  S:     3 MSENTLRGAIEAILMVA-SEPVAASDLAEVLGVSTADIEQHMRALAAEYLGEGRERPRGFELREVAGGWRIYSARAYADVVGRFVVGSSHARLSQAALETLAVIAYRQPISRARICRIRGVNVDGVVRTLLARGLVEETGLTPSGAR--LYGTTGEFLEKMGLTSLSEL 168
>gi|85703266|ref|ZP_01034370.1| segregation and condensation protein B [Roseovarius sp. 217] >gi|85672194|gb|EAQ27051.1| segregation and condensation protein B [Roseovarius sp. 217] (219 aa)
Score = 168, Expect = 1.6e-10, Identities = 50/159 (31%), Positives = 85/159 (53%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +IEA LF +      +D  + +   S        E ++   ++   RG+ V KVG+ + + T PD+  +++      +   L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  V    R    G+P  + VT +F D FGL+S +DLP
  S:    24 MIEAMLFASAEPLTTRDMAERMPHGS-----DPAEALVHLRKRYEGRGVRVVKVGDAWAIRTAPDLGYLMSRE--TIETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVAVSRGTVDQLLEMEWVRFGRRKMTPGRPVTFVVTQEFLDHFGLESARDLP 176
>gi|118466801|ref|YP_882250.1| segregation and condensation protein B [Mycobacterium avium 104] >gi|118168088|gb|ABK68985.1| segregation and condensation protein B [Mycobacterium avium 104] (235 aa)
Score = 167, Expect = 1.7e-10, Identities = 52/173 (30%), Positives = 94/173 (54%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE-QKIEELT 179
           SV+EA L +  +  V  + L + ++  V      ++EM  E       G+ +RK  E ++++T+    P + K++  G     ++ L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ EAG  E  G    +  T  F +  GL S+ DLP+I  +LP+   IE+L+
  S:    34 SVLEALLLVV-DTPVTAEALAAATQQPVYRIATKLQEMADELTAR-DSGIDLRKTSEGWRMYTRARFAPYVEKLLLDG----ARSKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEAGVDEDTGAT-TFATTDLFLERLGLTSLADLPDIAPLLPDVDTIEDLS 206
>gi|163793129|ref|ZP_02187105.1| Predicted transcriptional regulator containing the HTH domain [alpha proteobacterium BAL199] >gi|159181775|gb|EDP66287.1| Predicted transcriptional regulator containing the HTH domain [alpha proteobacterium BAL199] (225 aa)
Score = 167, Expect = 2.1e-10, Identities = 50/158 (31%), Positives = 86/158 (54%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +EA LF A  E V +  L+     +V D   ++ E+   Y    +RG+ + + G  +   T PD+  ++ S   +++K  L++  +ETL+IIAY+ P TR+++ E+R    +   L+ L+E   ++  GR +  G+P  +  T  F D FGL  IK+LP
  S:    24 VEAVLF-ASAEPVDEALLRQRVPETV-DLTKLLVELSEAY---AERGVNLVRHGTRWSFRTAPDLGAMLRSDKPVQRK--LSRAAVETLSIIAYHQPVTRAEVEEIRGVALSRGTLDTLLEASWIKPRGRRDTPGRPLQWGTTEAFLDHFGLADIKELP 175
>gi|108760008|ref|YP_632022.1| segregation and condensation protein B [Myxococcus xanthus DK 1622] >gi|108463888|gb|ABF89073.1| segregation and condensation protein B [Myxococcus xanthus DK 1622] (329 aa)
Score = 166, Expect = 2.4e-10, Identities = 50/177 (28%), Positives = 92/177 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE 181
           +++VIE+ LF+A    +  D+L   + +  +     + ++     +D   G+V+ +V   ++  T P   + V     +K +  L +  +ETLAIIAY  P TR +I ++R  D   +++ L++  LV+  G+ E VG+P LY  + +F + F L  +  LP +    ++  ELT E
  S:    79 IRTVIESVLFVA-ERPLSVDELYMATGIERELIAEALNQLS-GIHRDGISGIVLYEVAGGWQFRTDPHSGEYVRRYLRVKPQR-LTRAAVETLAIIAYRQPVTRPEIEDIRGVDCGAVIKALMDRKLVKILGKREEVGRPILYGTSREFLEFFALKDLSALPTL----REFHELTQE 248
>gi|69934528|ref|ZP_00629606.1| Conserved hypothetical protein 281 [Paracoccus denitrificans PD1222] >gi|119384603|ref|YP_915659.1| putative transcriptional regulator [Paracoccus denitrificans PD1222] >gi|119374370|gb|ABL69963.1| condensin subunit ScpB [Paracoccus denitrificans PD1222] (221 aa)
Score = 166, Expect = 2.4e-10, Identities = 40/113 (35%), Positives = 65/113 (57%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ + +VG+ +   T  D+  ++     + +   L++   ETLAIIAY+ P TR++I E+R    +   L++LIE+  V    R +  G+P  + VT  F D FGL+S +DLP
  S:    66 RGVQLARVGDAWAFRTAADLGFLMQES--VVESRRLSRAATETLAIIAYHQPVTRAEIEEIRGVAVSRGTLDQLIELDWVRIGRRRQTPGRPVTFVVTEAFLDHFGLESARDLP 177
>gi|87199115|ref|YP_496372.1| condensin subunit ScpB [Novosphingobium aromaticivorans DSM 12444] >gi|87134796|gb|ABD25538.1| condensin subunit ScpB [Novosphingobium aromaticivorans DSM 12444] (215 aa)
Score = 166, Expect = 2.5e-10, Identities = 41/115 (35%), Positives = 66/115 (57%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + + G  +   T PD++ ++      +++ P  L++   E LAIIAY+ P +R++I  +R        L+ L+E G +  AGR E  G+P +Y  TP F   FGL+S +DLP I
  S:    50 RGVHLVERGGRWHFQTAPDLAHLLRR----EKEEPRRLSRAATEALAIIAYHEPVSRAEIEAIRGVQTAKGTLDVLLEAGWIRIAGRREVPGRPTIYATTPDFLSHFGLESRRDLPGI 163
>gi|196157085|ref|YP_002126574.1| hypothetical protein MADE_02284 [Alteromonas macleodii 'Deep ecotype'] >gi|88773984|gb|EAR05243.1| hypothetical protein MADE_17707 [Alteromonas macleodii 'Deep ecotype'] >gi|196112864|gb|ACG66580.1| hypothetical protein MADE_02284 [Alteromonas macleodii 'Deep ecotype'] (197 aa)
Score = 166, Expect = 2.7e-10, Identities = 49/165 (29%), Positives = 88/165 (53%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKS--ISRLSVQD--FEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +  +K ++EAA+F+A ++ + + +LK   ++  SV D     V+ E+  +Y+    RG+ + +V   ++ F   D      S    +     ++ M+ETLA+IAY  P TR +I ++R     + +++ L E   ++  G  E  G+P LY  T  F D F + S+ DLP
  S:     6 TAQLKQLVEAAIFVA-DKPISRQQLKETVLNEFSVADRTLSKVLNELKLDYQP---RGIQLVEVASGFR-FQSLDALSPWLSKLWQENAPKYSRAMLETLALIAYRQPITRGEIEQVRGVAVSSNIIKTLTERDWIKVVGHKEVPGRPALYATTKGFLDYFSMSSLSDLP 170
>gi|167624537|ref|YP_001674831.1| segregation and condensation protein B [Shewanella halifaxensis HAW-EB4] >gi|167354559|gb|ABZ77172.1| segregation and condensation protein B [Shewanella halifaxensis HAW-EB4] (198 aa)
Score = 165, Expect = 2.8e-10, Identities = 52/164 (31%), Positives = 88/164 (53%)
  Q:     5 VKSVIEAALFIAGNE---GVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K +IEA+LF+          K+ + S   +S    +A ++E+  +YE    RG+ + KV   Y+  T  ++S  +   +  ++K P  ++  +ETLA+IAY  P TR  I  +R     + +++ L +   ++  G  E  G+P LY  T +F   FGLDSI DLP +
  S:     9 LKQLIEASLFVLAKPMTIKALKETVLSNFNVSRVKIKACIDELQLDYE---DRGVQLVKVAGGYRFQTLAELSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEFVRGVAVSSHIIKSLNDRNWIKVVGHKEVPGRPALYATTTEFLAYFGLDSIVDLPHL 172
>gi|167003060|ref|ZP_02268850.1| segregation and condensation protein B [Burkholderia mallei PRL-20] (281 aa)
Score = 165, Expect = 2.9e-10, Identities = 55/188 (29%), Positives = 97/188 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           K V+E AL I   E +    L+ +    +S      ++E++  E+     RG+ +  +   ++  +KP + +        ++    ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G+ +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:     7 KIVLETAL-ICAQEPLKLGDLRKLFADGVSADTVRTLLEDLKQEWTG---RGVELVALASGWRFQSKPAM-RTYLDRLHPEKPPKYSRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGQRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|85707717|ref|ZP_01038783.1| hypothetical protein NAP1_00740 [Erythrobacter sp. NAP1] >gi|85689251|gb|EAQ29254.1| hypothetical protein NAP1_00740 [Erythrobacter sp. NAP1] (225 aa)
Score = 165, Expect = 2.9e-10, Identities = 41/115 (35%), Positives = 67/115 (58%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + + G+ +   T  D++ ++      +Q   L++   E LAIIAY+ P +R++I  +R    +   L+ L+E G ++ AGR E  G+P +Y  TP+F D FGL S +DLP I
  S:    58 RGVRLVERGKRWHFETAADMAHLLRRE--KEQVRRLSRAATEVLAIIAYHEPVSRAEIESIRGVQTSGGTLDVLMEAGWIKLAGRREVPGRPVIYATTPEFLDHFGLASRRDLPGI 171
>gi|149202731|ref|ZP_01879703.1| segregation and condensation protein B [Roseovarius sp. TM1035] >gi|149144013|gb|EDM32047.1| segregation and condensation protein B [Roseovarius sp. TM1035] (218 aa)
Score = 165, Expect = 3.0e-10, Identities = 49/159 (30%), Positives = 86/159 (54%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +IEA LF +      +D ++ +   S        E ++   ++   RG+ V KVG+ + + T PD+  +++      +   L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT +F D FGL+S +DLP
  S:    24 MIEAMLFASTEPLTTRDMVERMPHGS-----DPAEALVHLRKRYEGRGVRVVKVGDAWAIRTAPDLGYLMSRE--TVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVAVSRGTVDQLLEMEWIRFGRRKMTPGRPVTFVVTQEFLDHFGLESARDLP 176
>gi|134101742|ref|YP_001107403.1| putative segregation and condensation protein B [Saccharopolyspora erythraea NRRL 2338] >gi|133914365|emb|CAM04478.1| putative segregation and condensation protein B [Saccharopolyspora erythraea NRRL 2338] (242 aa)
Score = 165, Expect = 3.2e-10, Identities = 38/114 (33%), Positives = 63/114 (55%)
  Q:    51 DPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKD 164
           + +RG+ +R+VG+ ++ +T+   +  V       Q+  L +  +ETLA+IAY  P TRS++  +R  +   ++  L+  GL+EEAG     G   LY  T  F +  GL S+KD
  S:   113 EARRGIDLRRVGDGWRFYTRETYAPYVERYLLDGQRAKLTRAALETLAVIAYRQPVTRSRVAAVRGVNVDGVIRTLVGRGLIEEAGTDPETGG-ILYCTTELFLERLGLSSLKD 225
>gi|91793798|ref|YP_563449.1| chromosome segregation and condensation protein ScpB [Shewanella denitrificans OS217] >gi|91715800|gb|ABE55726.1| chromosome segregation and condensation protein ScpB [Shewanella denitrificans OS217] (206 aa)
Score = 165, Expect = 3.5e-10, Identities = 52/168 (30%), Positives = 93/168 (55%)
  Q:     1 MSIN---VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAV---MEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M IN   +K +IEA+LF+          +K++    + DF+     ++E+I E ++D Q RG+ + KV   Y+  T+  +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  +  G+P LY  T  F   FGL  + DLP++
  S:     5 MQINTTQLKQLIEASLFVLAKPMT----IKALKETVLADFDVSRKRIQEVIDELQQDYQERGVQLVKVASGYRFQTQELLSPYLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQIRGVAVSSHIIKNLADRHWIKSVGHKDVPGRPALYATTNDFLAYFGLTKLADLPQL 175
>gi|29654368|ref|NP_820060.1| segregation and condensation protein B [Coxiella burnetii RSA 493] >gi|154706487|ref|YP_001424363.1| segregation and condensation protein B [Coxiella burnetii Dugway 5J108-111] >gi|81629002|sp|Q83CP9|SCPBL_COXBU Segregation and condensation protein B homolog >gi|29541635|gb|AAO90574.1| segregation and condensation protein B [Coxiella burnetii RSA 493] >gi|154355773|gb|ABS77235.1| segregation and condensation protein B [Coxiella burnetii Dugway 5J108-111] (209 aa)
Score = 164, Expect = 3.9e-10, Identities = 54/174 (31%), Positives = 101/174 (58%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP--EIVLPEQKIE 176
           +N K VIEAALF A  E +  ++L+ +    + +S+ + + ++ E+  +Y    +RG+ +++V   Y+   +PD S  +     + +K P   ++ ++ETLA+I Y  P +R +I E+R     + +++KL++   +      +  GKP L+  T  F D F L S+++LP  E V+  +KIE
  S:     4 VNPKIVIEAALF-ASAEPLTPERLQQLFDEQNPISLSEIKNLLSELKEDYR---ERGVDLQEVASGYRFQARPDFSPWLQR---LWEKKPARYSRALLETLALIVYRQPISRGEIEEVRGVAVSSDIIKKLLDREWISVVAHRDVPGKPALFGTTKTFLDYFNLKSLEELPPLEDVVDLEKIE 179
>gi|83718805|ref|YP_443085.1| segregation and condensation protein B [Burkholderia thailandensis E264] >gi|167620252|ref|ZP_02388883.1| segregation and condensation protein B [Burkholderia thailandensis Bt4] >gi|83652630|gb|ABC36693.1| segregation and condensation protein B [Burkholderia thailandensis E264] (458 aa)
Score = 164, Expect = 3.9e-10, Identities = 40/104 (38%), Positives = 62/104 (59%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R+D
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARDD 193
>gi|77409456|ref|ZP_00786149.1| Putative transcriptional regulators (Ypuh-like) superfamily [Streptococcus agalactiae COH1] >gi|77171923|gb|EAO75099.1| Putative transcriptional regulators (Ypuh-like) superfamily [Streptococcus agalactiae COH1] (123 aa)
Score = 164, Expect = 3.9e-10, Identities = 38/109 (34%), Positives = 65/109 (59%)
  Q:    86 KNPLNQGM----IETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDN 194
           K P+NQ +    +E L+IIAY  P TR +I ++R  + +  + +LI  GL++EAG+ E +G+P LY+ T  F D  G++ + DL +    E   EE++     +    ++E+N
  S:     9 KAPINQSLSRASLEVLSIIAYKQPITRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLGRPNLYETTNYFLDYMGINQLDDLIDASSIELVDEEVSLFSMDSINTEDKENN 121
>gi|91776225|ref|YP_545981.1| condensin subunit ScpB [Methylobacillus flagellatus KT] >gi|91710212|gb|ABE50140.1| condensin subunit ScpB [Methylobacillus flagellatus KT] (184 aa)
Score = 164, Expect = 4.0e-10, Identities = 47/164 (28%), Positives = 84/164 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSIS-RLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPL--NQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           VK V+EA L  AG     +  L+    R+       +++E+  E++    R + + +V   ++   + D++  +A    +  + P+  ++  +ETLAIIAY  P TR  I E+R     P ++ + +E   ++  G+ +  G+P LY  T  F D  GL S+ +LP I
  S:    10 VKQVLEAVLLTAGEPLSLEMLLRPFEGRMERATLRMLLDELRQEWQG---RSMELVQVASGWRFQARADLAPFIAR---LNPERPMRYSRAALETLAIIAYRQPVTRGDIEEIRGVAVNPNIMRQFLERNWIDIVGQRDVPGRPSLYATTKTFLDDLGLRSLSELPPI 171
>gi|116670094|ref|YP_831027.1| putative transcriptional regulator [Arthrobacter sp. FB24] >gi|116610203|gb|ABK02927.1| putative transcriptional regulator [Arthrobacter sp. FB24] (229 aa)
Score = 164, Expect = 4.1e-10, Identities = 42/138 (30%), Positives = 78/138 (56%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIK-QKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--LPE-QKIEELTYEEEINFFDTNR 191
           RG  +R +   ++++++ D + +V  GF ++ Q   L Q  +ETLA+IAY  P +R+++  +R  +   ++  L++ GL+E++G     G   LY+ T  F +  G+ S+ +LP++   LP  + IEE        F+D  R
  S:    97 RGFELRNIAGGWRIYSRTDFADVVG-GFVLEGQTARLTQAALETLAVIAYRQPVSRARVSAIRGVNVDSVVRTLMQRGLIEDSGTDPESGA-ILYRTTSYFLERMGIGSVAELPQLSPHLPGLEGIEE--------FYDAGR 228
>gi|161356430|ref|ZP_02102308.1| segregation and condensation protein B [Burkholderia pseudomallei 1106b] (443 aa)
Score = 164, Expect = 4.2e-10, Identities = 40/104 (38%), Positives = 61/104 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:    75 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 180
>gi|194571335|ref|YP_002106335.1| segregation and condensation protein B [Burkholderia pseudomallei 406e] >gi|157807393|gb|EDO84563.1| segregation and condensation protein B [Burkholderia pseudomallei 406e] (430 aa)
Score = 164, Expect = 4.2e-10, Identities = 40/104 (38%), Positives = 61/104 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:    75 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 180
>gi|53724822|ref|YP_102764.1| segregation and condensation protein B [Burkholderia mallei ATCC 23344] >gi|67641345|ref|ZP_00440125.1| COG1386: Predicted transcriptional regulator containing the HTH domain [Burkholderia mallei GB8 horse 4] >gi|121599493|ref|YP_992841.1| segregation and condensation protein B [Burkholderia mallei SAVP1] >gi|124385017|ref|YP_001026184.1| segregation and condensation protein B [Burkholderia mallei NCTC 10229] >gi|126448580|ref|YP_001080546.1| segregation and condensation protein B [Burkholderia mallei NCTC 10247] >gi|194313801|ref|YP_002009895.1| segregation and condensation protein B [Burkholderia mallei ATCC 10399] >gi|194525298|ref|YP_002060828.1| segregation and condensation protein B [Burkholderia mallei FMH] >gi|194529466|ref|YP_002064987.1| segregation and condensation protein B [Burkholderia mallei JHU] >gi|194575283|ref|YP_002110167.1| segregation and condensation protein B [Burkholderia mallei 2002721280] >gi|52428245|gb|AAU48838.1| segregation and condensation protein B [Burkholderia mallei ATCC 23344] >gi|121228303|gb|ABM50821.1| segregation and condensation protein B [Burkholderia mallei SAVP1] >gi|124293037|gb|ABN02306.1| segregation and condensation protein B [Burkholderia mallei NCTC 10229] >gi|126241450|gb|ABO04543.1| segregation and condensation protein B [Burkholderia mallei NCTC 10247] >gi|147749308|gb|EDK56382.1| segregation and condensation protein B [Burkholderia mallei FMH] >gi|147753476|gb|EDK60541.1| segregation and condensation protein B [Burkholderia mallei JHU] >gi|148027535|gb|EDK85556.1| segregation and condensation protein B [Burkholderia mallei 2002721280] >gi|160699177|gb|EDP89147.1| segregation and condensation protein B [Burkholderia mallei ATCC 10399] (442 aa)
Score = 164, Expect = 4.3e-10, Identities = 40/104 (38%), Positives = 62/104 (59%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G+ +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGQRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|58040187|ref|YP_192151.1| hypothetical protein GOX1756 [Gluconobacter oxydans 621H] >gi|58002601|gb|AAW61495.1| Hypothetical protein GOX1756 [Gluconobacter oxydans 621H] (129 aa)
Score = 164, Expect = 4.4e-10, Identities = 33/84 (39%), Positives = 52/84 (61%)
  Q:    83 IKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +++   L++G +ETLAIIAY+ PCTR++I  +R       +L+ L+E  L+   GR E  G+P L+  T  F + FGL  ++ LP
  S:    17 VEKPRRLSRGAMETLAIIAYHQPCTRAEIEAIRGVSLGQAVLDALLEDSLIAPKGRKEVPGRPVLWGTTASFLESFGLPDLRGLP 101
>gi|109899134|ref|YP_662389.1| putative transcriptional regulator [Pseudoalteromonas atlantica T6c] >gi|109701415|gb|ABG41335.1| condensin subunit ScpB [Pseudoalteromonas atlantica T6c] (250 aa)
Score = 164, Expect = 4.5e-10, Identities = 49/165 (29%), Positives = 90/165 (54%)
  Q:     2 SINVKSVIEAALFIAG---NEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           S+ +K +IEAA+F++    ++   +D + S  +++ +  +  +EE+  EY+    RG+ + +V   Y+ F   D      S    +Q    ++ ++ETL+++AY  P TR +I ++R     + +++ LIE   V+  G  E  G+P LY  T  F + F L  +KDLP
  S:     6 SVQLKQLIEAAVFVSDAPVSQEHLQDTVLSGLKVTKKALKEAIEELQVEYQ---SRGVQLVEVASGYR-FQSMDSLGPWLSKLWQEQAPRYSRALLETLSMVAYRQPITRGEIEDVRGVAVSSHIMKTLIERDWVKVVGHKEVPGRPALYATTKGFLNYFSLKRLKDLP 170
>gi|93006576|ref|YP_581013.1| putative transcriptional regulator [Psychrobacter cryohalolentis K5] >gi|92394254|gb|ABE75529.1| condensin subunit ScpB [Psychrobacter cryohalolentis K5] (186 aa)
Score = 164, Expect = 4.6e-10, Identities = 40/117 (34%), Positives = 65/117 (55%)
  Q:    56 LVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           L +      Y+L      S ++ + F  +Q+  L+Q ++ETL++IAY  P TRS I  +R  T  + +L +L + G +EE G  + +G+P L   T +F D FGL  + +LP   +PE
  S:    64 LSLHHTASGYRLQIADSHSALIQNVFPQRQER-LSQALLETLSVIAYKQPVTRSDIEHVRGVTLSSNILRQLFDKGWIEENGYKDTLGRPALLHTTSQFLDAFGLSHLDELPP--MPE 178
>gi|117620457|ref|YP_857422.1| segregation and condensation protein B [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117561864|gb|ABK38812.1| segregation and condensation protein B [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (198 aa)
Score = 164, Expect = 4.7e-10, Identities = 48/164 (29%), Positives = 92/164 (56%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K++IEAALF+AG   ++  +LKS            ++ ++ E  +D  +RG+ +++V   ++   + + ++ ++  +   ++ P  ++ ++ETL +IAY  P TR++I  +R     + ++  L E G V   G  E VG+P L   T +F D F L S++ LPE+
  S:     8 LKTLIEAALFVAGRP-LNVSELKSSVLADYPVTSRYVQLLLAELRQDYSERGVELKEVASGWRFQARQEYAEELSRLW--SERAPRYSRAVMETLTLIAYRQPITRAEIEAIRGVAVSSQIVNTLKERGWVRSIGHKEVVGRPELLATTREFLDYFNLQSLEQLPEL 171
>gi|126668318|ref|ZP_01739277.1| hypothetical protein MELB17_11525 [Marinobacter sp. ELB17] >gi|126627235|gb|EAZ97873.1| hypothetical protein MELB17_11525 [Marinobacter sp. ELB17] (195 aa)
Score = 163, Expect = 4.9e-10, Identities = 53/179 (29%), Positives = 95/179 (53%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEK-DPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLP----------EQKIEELTY 180
           ++ +  +IEA L  AG   +   +L+ +   + +     +E+ + E E+    RG+ ++KV   Y+L  +   +  VA  F  ++K P  ++ ++ETLA+I Y  P TR +I ++R     + ++  L+E   V   G  E  G+P +Y  T +F D F L S+  LP + +           EQKIE+  +
  S:     6 ALPITGIIEAVLLTAGKP-LTVQQLREVFDETERPTHKAVEQALVELEQLCSGRGIELKKVASGYRLQVRESFAPWVARLF--EEKPPRYSRALLETLALIGYRQPITRGEIEDIRGVAVSSNIIRTLVEREWVRIVGHREVPGRPAMYATTRQFLDYFNLISLDQLPPLSVSRDLDAIGREIEQKIEQTPF 194
>gi|124548931|ref|ZP_01707399.1| putative transcriptional regulator [Shewanella putrefaciens 200] >gi|124508195|gb|EAY52297.1| putative transcriptional regulator [Shewanella putrefaciens 200] (197 aa)
Score = 163, Expect = 5.0e-10, Identities = 53/168 (31%), Positives = 93/168 (55%)
  Q:     1 MSIN---VKSVIEAALFIAG---NEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M IN   +K +IEA+LF+ G   +  + KD +     +S    +A ++E+  +Y+    RG+ + KV   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD++ DLP +
  S:     1 MQINPTQLKQLIEASLFVLGKPLSAKMLKDTVLVDFTVSRDKIKAALDELQQDYQ---DRGVQLVKVAGGYRFQTLEVLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVAISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPPL 171
>gi|126452356|ref|YP_001066027.1| segregation and condensation protein B [Burkholderia pseudomallei 1106a] >gi|194514318|ref|YP_002050280.1| segregation and condensation protein B [Burkholderia pseudomallei S13] >gi|126225998|gb|ABN89538.1| segregation and condensation protein B [Burkholderia pseudomallei 1106a] >gi|169653926|gb|EDS86619.1| segregation and condensation protein B [Burkholderia pseudomallei S13] (456 aa)
Score = 163, Expect = 5.0e-10, Identities = 55/188 (29%), Positives = 96/188 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           K V+E AL I   E +    L+ +    +S      ++E++  E+     RG+ +  +   ++  +KP + +        ++    ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:     7 KIVLETAL-ICAQEPLKLGDLRKLFADGVSADTVRTLLEDLKQEWTG---RGVELVALASGWRFQSKPAM-RTYLDRLHPEKPPKYSRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|148273159|ref|YP_001222720.1| putative transcriptional regulator [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147831089|emb|CAN02034.1| conserved hypothetical protein, putative transcriptional regulator [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (203 aa)
Score = 163, Expect = 5.1e-10, Identities = 43/170 (25%), Positives = 89/170 (52%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDP---QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +++   +EA L +A +E      L + +   V++    ++ ++ +++      +RG  +R+VG  ++++ +P+   ++      +    L+Q  +ETLA+IAY  P +RSQ+  +R  +   ++  L+  GLV EA      G  + Y  T       G++S+ +LP I  +LP+
  S:    21 LDLDRALEALLMVA-DEPQSVTTLATATSTPVKEVRRAIQRLVDDFDGTTGGVRRGFELREVGGGWRVYVRPEYDTVIRDHVLTQNPTRLSQAALETLAVIAYKQPISRSQVAAIRAVNVDSVVRTLLARGLVTEAFTDGETGAIH-YGTTDHLLTQLGINSLDELPPISPLLPD 193
>gi|53719536|ref|YP_108522.1| hypothetical protein BPSL1922 [Burkholderia pseudomallei K96243] >gi|167816046|ref|ZP_02447726.1| hypothetical protein Bpse9_12952 [Burkholderia pseudomallei 91] >gi|52209950|emb|CAH35922.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] (455 aa)
Score = 163, Expect = 5.1e-10, Identities = 55/188 (29%), Positives = 96/188 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           K V+E AL I   E +    L+ +    +S      ++E++  E+     RG+ +  +   ++  +KP + +        ++    ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:     7 KIVLETAL-ICAQEPLKLGDLRKLFADGVSADTVRTLLEDLKQEWTG---RGVELVALASGWRFQSKPAM-RTYLDRLHPEKPPKYSRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|161369490|ref|ZP_02109059.1| segregation and condensation protein B [Burkholderia pseudomallei 1710a] >gi|167911171|ref|ZP_02498262.1| segregation and condensation protein B [Burkholderia pseudomallei 112] (443 aa)
Score = 163, Expect = 5.1e-10, Identities = 40/104 (38%), Positives = 61/104 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:    75 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 180
>gi|76810112|ref|YP_333310.1| segregation and condensation protein B [Burkholderia pseudomallei 1710b] >gi|167824422|ref|ZP_02455893.1| segregation and condensation protein B [Burkholderia pseudomallei 9] >gi|194510131|ref|YP_002022661.1| segregation and condensation protein B [Burkholderia pseudomallei Pasteur 52237] >gi|76579565|gb|ABA49040.1| segregation and condensation protein B [Burkholderia pseudomallei 1710b] >gi|157936284|gb|EDO91954.1| segregation and condensation protein B [Burkholderia pseudomallei Pasteur 52237] (456 aa)
Score = 163, Expect = 5.1e-10, Identities = 55/188 (29%), Positives = 96/188 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           K V+E AL I   E +    L+ +    +S      ++E++  E+     RG+ +  +   ++  +KP + +        ++    ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:     7 KIVLETAL-ICAQEPLKLGDLRKLFADGVSADTVRTLLEDLKQEWTG---RGVELVALASGWRFQSKPAM-RTYLDRLHPEKPPKYSRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|194506503|ref|YP_002036073.1| segregation and condensation protein B [Burkholderia pseudomallei 1655] >gi|184210524|gb|EDU07567.1| segregation and condensation protein B [Burkholderia pseudomallei 1655] (455 aa)
Score = 163, Expect = 5.1e-10, Identities = 55/188 (29%), Positives = 96/188 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           K V+E AL I   E +    L+ +    +S      ++E++  E+     RG+ +  +   ++  +KP + +        ++    ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:     7 KIVLETAL-ICAQEPLKLGDLRKLFADGVSADTVRTLLEDLKQEWTG---RGVELVALASGWRFQSKPAM-RTYLDRLHPEKPPKYSRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|119962118|ref|YP_947434.1| putative segregation and condensation protein B [Arthrobacter aurescens TC1] >gi|119948977|gb|ABM07888.1| putative segregation and condensation protein B [Arthrobacter aurescens TC1] (218 aa)
Score = 163, Expect = 5.2e-10, Identities = 45/163 (27%), Positives = 89/163 (54%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYE----KDPQ-------------RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++ +EA L +  +E    ++L +   ++V   E +++++  EY     K P              RG  +R V   ++++++ D + IV       Q   L Q  +ETLA+IAY  P +R+++  +R  +   ++  L + GL+E++G     G   LY+ T  F +  G+ S+ +LP++
  S:    22 RAALEAVLMVI-DEPATSEELAAGLNVTVAVVEDLLQDLQREYSGYTVKAPDVDAVGFAVASTAPRGFELRNVAGGWRIYSRSDFADIVGRFVLEGQTTRLTQAALETLAVIAYRQPVSRARVSAIRGVNVDSVVRTLTQRGLIEDSGNDPESGA-VLYRTTSYFLERMGIGSVAELPQL 199
>gi|126441833|ref|YP_001058775.1| segregation and condensation protein B [Burkholderia pseudomallei 668] >gi|126221326|gb|ABN84832.1| segregation and condensation protein B [Burkholderia pseudomallei 668] (455 aa)
Score = 163, Expect = 5.5e-10, Identities = 40/104 (38%), Positives = 61/104 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|146329487|ref|YP_001209390.1| hypothetical protein DNO_0478 [Dichelobacter nodosus VCS1703A] >gi|146232957|gb|ABQ13935.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A] (180 aa)
Score = 163, Expect = 5.5e-10, Identities = 51/167 (30%), Positives = 84/167 (50%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPD-ISKIVASGFGIKQKNPL--NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKI 175
           IEA LF   N G+  + +            A + E++  YE      + V ++   ++L  +PD  S I A    +    P+  ++   ETLA I Y+ P TR++I  +R  T  T + ++L ++G +  AG+ E VG+P L   T  F D FG+ ++ +LP +   EQ I
  S:     8 IEALLFTR-NSGLSVNDIAQALNADKTAVVAALNELMKRYESS---AISVVEIASGWRLQVRPDYFSDICA----LNHMQPVTYSRAFWETLAYIVYHQPVTRAEIDRVRGVTTNTRIYQQLFDLGWIVVAGQKEVVGRPDLLATTRAFLDDFGVQTLAELPPLSAIEQFI 170
>gi|77360284|ref|YP_339859.1| hypothetical protein PSHAa1341 [Pseudoalteromonas haloplanktis TAC125] >gi|76875195|emb|CAI86416.1| conserved protein of unknown function [Pseudoalteromonas haloplanktis TAC125] (196 aa)
Score = 163, Expect = 6.0e-10, Identities = 49/167 (29%), Positives = 94/167 (56%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQK 174
           +IEAA+F+A ++ + K  LK +    +      + + I   +   Q RG+ + +VG  Y+      +S  +++ +  +++ P  ++ ++ETL++IAY  P TR++I ++R  T  + +++ L+E   ++  G  E  GKP LY  T +F D F +  + +LP   LPEQ+
  S:    14 IIEAAIFVA-DKPLSKRHLKDVVLADLAISMVRINDAITAIQTHFQTRGIRLVEVGSGYRFQACSSLSPWLSNLW--QERAPKYSRALLETLSLIAYRQPITRAEIEQVRGVTTGSNIIKTLLEREWIKVVGHKEVPGKPALYATTKQFLDYFSITGLDNLP--ALPEQQ 178
>gi|41407510|ref|NP_960346.1| hypothetical protein MAP1412 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41395863|gb|AAS03729.1| hypothetical protein MAP_1412 [Mycobacterium avium subsp. paratuberculosis K-10] (235 aa)
Score = 163, Expect = 6.1e-10, Identities = 51/173 (29%), Positives = 93/173 (53%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE-QKIEELT 179
           SV+EA L +  +  V  + L + ++  V      ++EM  E       G+ +RK  E ++++T+    P + K++  G     ++ L +  +ETLA++AY  P  R+++  +R  +   ++  L+  GL+ EAG  E  G    +  T  F +  GL S+ DLP+I  +LP+   IE+L+
  S:    34 SVLEALLLVV-DTPVTAEALAAATQQPVYRIATKLQEMADELTAR-DSGIDLRKTSEGWRMYTRARFAPYVEKLLLDG----ARSKLTRAALETLAVVAYRQPVARARVSAVRGVNVDAVMRTLLARGLITEAGVDEDTGAT-TFATTDLFLERLGLTSLADLPDIAPLLPDVDTIEDLS 206
>gi|120610105|ref|YP_969783.1| condensin subunit ScpB [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120588569|gb|ABM32009.1| condensin subunit ScpB [Acidovorax avenae subsp. citrulli AAC00-1] (274 aa)
Score = 163, Expect = 6.2e-10, Identities = 52/170 (30%), Positives = 94/170 (55%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISR--LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLP 171
           +++ K V+E AL  A    + ++ L+++ +  L     + ++ E+  E+    QRG+ + +V   ++  ++P++ + +       +K P   +  +ETLAIIAY  P TR  I E+R  T  + +L++L + G VE  G  E VG+P L+  T +F D  GL S+ +LP +  P
  S:     3 TVDAKRVLETALICAPQPAMLRE-LRTLFQDALGADTIKRLLVELQQEWS---QRGVELVQVASGWRFQSRPEMREYLDRLH--PEKPPRYTRAALETLAIIAYRQPVTRGDIEEIRGVTVNSLILKQLEDRGWVEVIGHRETVGRPALFATTRQFLDDLGLKSLDELPMLENP 170
>gi|161830861|ref|YP_001596670.1| segregation and condensation protein B [Coxiella burnetii RSA 331] >gi|161762728|gb|ABX78370.1| segregation and condensation protein B [Coxiella burnetii RSA 331] (209 aa)
Score = 162, Expect = 6.4e-10, Identities = 54/174 (31%), Positives = 100/174 (57%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP--EIVLPEQKIE 176
           +N K VIEAALF A  E +  ++L+ +    + +S+ + + ++ E+  +Y    +RG+ +++V   Y+   +PD S  +     + +K P   ++ ++ETLA+I Y  P +R +I E+R     + +++KL+    +      +  GKP L+  T  F D F L S+++LP  E V+  +KIE
  S:     4 VNPKIVIEAALF-ASAEPLTPERLQQLFDEQNPISLSEIKNLLSELKEDYR---ERGVDLQEVASGYRFQARPDFSPWLQR---LWEKKPARYSRALLETLALIVYRQPISRGEIEEVRGVAVSSDIIKKLLAREWISVVAHRDVPGKPALFGTTKTFLDYFNLKSLEELPPLEDVVDLEKIE 179
>gi|134282392|ref|ZP_01769097.1| segregation and condensation protein B [Burkholderia pseudomallei 305] >gi|134246430|gb|EBA46519.1| segregation and condensation protein B [Burkholderia pseudomallei 305] (455 aa)
Score = 162, Expect = 6.4e-10, Identities = 40/104 (38%), Positives = 61/104 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|153206705|ref|ZP_01945546.1| segregation and condensation protein B [Coxiella burnetii 'MSU Goat Q177'] >gi|165918523|ref|ZP_02218609.1| segregation and condensation protein B [Coxiella burnetii RSA 334] >gi|120577068|gb|EAX33692.1| segregation and condensation protein B [Coxiella burnetii 'MSU Goat Q177'] >gi|165917769|gb|EDR36373.1| segregation and condensation protein B [Coxiella burnetii RSA 334] (209 aa)
Score = 162, Expect = 6.6e-10, Identities = 54/174 (31%), Positives = 100/174 (57%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP--EIVLPEQKIE 176
           +N K VIEAALF A  E +  ++L+ +    + +S+ + + ++ E+  +Y    +RG+ +++V   Y+   +PD S  +     + +K P   ++  +ETLA+I Y  P +R +I E+R     + +++KL++   +      +  GKP L+  T  F D F L S+++LP  E V+  +KIE
  S:     4 VNPKIVIEAALF-ASAEPLTPERLQQLFDEQNPISLSEIKNLLSELKEDYR---ERGVDLQEVASGYRFQARPDFSPWLQR---LWEKKPARYSRAFLETLALIVYRQPISRGEIEEVRGVAVSSDIIKKLLDREWISVVAHRDVPGKPALFGTTKTFLDYFNLKSLEELPPLEDVVDLEKIE 179
>gi|126174905|ref|YP_001051054.1| putative transcriptional regulator [Shewanella baltica OS155] >gi|125998110|gb|ABN62185.1| putative transcriptional regulator [Shewanella baltica OS155] (198 aa)
Score = 162, Expect = 6.7e-10, Identities = 59/181 (32%), Positives = 101/181 (55%)
  Q:     1 MSIN---VKSVIEAALFIAG---NEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--------------VLPEQKIEELTYE 181
           M IN   +K +IEA+LF+ G   +  + KD +     +S    +A ++E+  +Y+    RG+ + KV   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD++ DLP +              + PEQ  E+ T E
  S:     1 MQINPTQLKQLIEASLFVLGKPLSAKMLKDTVLVDFTVSRDKIKAALDELQQDYQ---DRGVQLVKVAGGYRFQTLDVLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVAISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPPLSDTESLQAVFSSVKLTPEQSEEQNTNE 198
>gi|160875908|ref|YP_001555224.1| putative transcriptional regulator [Shewanella baltica OS195] >gi|160861430|gb|ABX49964.1| segregation and condensation protein B [Shewanella baltica OS195] (198 aa)
Score = 162, Expect = 6.7e-10, Identities = 59/181 (32%), Positives = 101/181 (55%)
  Q:     1 MSIN---VKSVIEAALFIAG---NEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--------------VLPEQKIEELTYE 181
           M IN   +K +IEA+LF+ G   +  + KD +     +S    +A ++E+  +Y+    RG+ + KV   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD++ DLP +              + PEQ  E+ T E
  S:     1 MQINPTQLKQLIEASLFVLGKPLSAKMLKDTVLVDFTVSRDKIKAALDELQQDYQ---DRGVQLVKVAGGYRFQTLEVLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVAISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPPLSDTESLQAVFSSVRLTPEQSEEQNTNE 198
>gi|153001234|ref|YP_001366915.1| putative transcriptional regulator [Shewanella baltica OS185] >gi|151365852|gb|ABS08852.1| putative transcriptional regulator [Shewanella baltica OS185] (198 aa)
Score = 162, Expect = 7.1e-10, Identities = 59/181 (32%), Positives = 101/181 (55%)
  Q:     1 MSIN---VKSVIEAALFIAG---NEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--------------VLPEQKIEELTYE 181
           M IN   +K +IEA+LF+ G   +  + KD +     +S    +A ++E+  +Y+    RG+ + KV   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD++ DLP +              + PEQ  E+ T E
  S:     1 MQINPTQLKQLIEASLFVLGKPLSAKMLKDTVLVDFTVSRDKIKAALDELQQDYQ---DRGVQLVKVAGGYRFQTLEVLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVAISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPPLSDTESLQAVFSSVKLTPEQSEEQNTNE 198
>gi|118595132|ref|ZP_01552479.1| segregation and condensation protein B [Methylophilales bacterium HTCC2181] >gi|118440910|gb|EAV47537.1| segregation and condensation protein B [Methylophilales bacterium HTCC2181] (190 aa)
Score = 162, Expect = 7.1e-10, Identities = 52/174 (29%), Positives = 90/174 (51%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKI 175
           S+ +K+ IE AL  +G   ++ D+L+ +   R+       +++E+  E+    ++ + +  V   Y+   KP  S  +      ++    ++ ++E LAIIAY  P TR  I ++R     P  L +L+E   VE  G+ +  G+P LY  T  F D FGL ++ DLP+I   E+ I
  S:     4 SLKLKNTIEVALLTSGRP-LNIDELQKLFEERIERSTIRMLLDEIKSEWS---EKTMELVLVANGYRFEAKPIFSNSLMR-LSPERVIKYSRAVMEVLAIIAYRQPVTRGDIEKIRGVSLNPNALRQLVEREWVEIIGQKDVPGRPSLYATTKYFLDDFGLKALGDLPDIKTSEEDI 175
>gi|120598426|ref|YP_963000.1| putative transcriptional regulator [Shewanella sp. W3-18-1] >gi|146293495|ref|YP_001183919.1| putative transcriptional regulator [Shewanella putrefaciens CN-32] >gi|120558519|gb|ABM24446.1| putative transcriptional regulator [Shewanella sp. W3-18-1] >gi|145565185|gb|ABP76120.1| putative transcriptional regulator [Shewanella putrefaciens CN-32] (198 aa)
Score = 162, Expect = 7.2e-10, Identities = 53/168 (31%), Positives = 93/168 (55%)
  Q:     1 MSIN---VKSVIEAALFIAG---NEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M IN   +K +IEA+LF+ G   +  + KD +     +S    +A ++E+  +Y+    RG+ + KV   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD++ DLP +
  S:     1 MQINPTQLKQLIEASLFVLGKPLSAKMLKDTVLVDFTVSRDKIKAALDELQQDYQ---DRGVQLVKVAGGYRFQTLEVLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVAISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPPL 171
>gi|167582092|ref|ZP_02374966.1| segregation and condensation protein B [Burkholderia thailandensis TXDOH] (458 aa)
Score = 162, Expect = 7.7e-10, Identities = 40/104 (38%), Positives = 61/104 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   +E  L  ++ I+F D  R D
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAAHLEASLLAQQAIDFPDDARGD 193
>gi|114762848|ref|ZP_01442280.1| segregation and condensation protein B [Roseovarius sp. HTCC2601] >gi|114544458|gb|EAU47465.1| segregation and condensation protein B [Roseovarius sp. HTCC2601] (256 aa)
Score = 162, Expect = 7.8e-10, Identities = 42/113 (37%), Positives = 69/113 (61%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPT-PMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ V +VG+ + + T PD+      GF ++++      L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT  F D FGL+S +DLP
  S:   101 RGVRVVRVGDAWAIRTAPDL------GFLMQKETVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTVDQLLEMEWIRFGRRKMTPGRPVTFVVTQDFLDEFGLESARDLP 212
>gi|160871935|ref|ZP_02062067.1| segregation and condensation protein B [Rickettsiella grylli] >gi|159120734|gb|EDP46072.1| segregation and condensation protein B [Rickettsiella grylli] (188 aa)
Score = 161, Expect = 8.3e-10, Identities = 53/185 (28%), Positives = 91/185 (49%)
  Q:     5 VKSVIEAALFIAGNEGVHK---DKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEK-LIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDT 189
           +K V EAALF AG     K   D      R +  + + ++ ++  +Y     RG+ ++++   Y   T   +   V   +   +K P  ++  +ETL+IIAY  P TR  I  +R    +P + K L+E   ++  G+ E  G+P LY  +  F D FGL ++ +LP       K  E+T    +++ +T
  S:     6 LKFVCEAALFAAGEPVSLKRLLDLFTDEERPTASEMKKILADLTHDYR---DRGIHLKQLASGYCFQTDSLLHDWVKRLW--PEKPPRYSRAFLETLSIIAYKQPVTRGDIEAIRGVAVSPQIIKVLLEHAWIQVVGQREVPGRPNLYATSTLFLDHFGLKTVSELPPF---PSKTNEVTPCPRVDYHNT 187
>gi|163703056|ref|ZP_02121891.1| prokaryotic chromosome segregation and condensation protein [Methylobacterium nodulans ORS 2060] >gi|162430741|gb|EDQ41350.1| prokaryotic chromosome segregation and condensation protein [Methylobacterium nodulans ORS 2060] (220 aa)
Score = 161, Expect = 8.3e-10, Identities = 48/131 (36%), Positives = 71/131 (54%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D EAV+ E+   Y     RG+ + +V   Y   T PD++  +       +   L++  IETLAI+AY+ P TR++I E+R    +   L+ L+E G V   GR    G+P  Y  TP F + FGLD++ DLP
  S:    50 DVEAVLAELRRIYLP---RGINLVRVAGGYVFRTAPDLAAALRGD--APEPRKLSRAAIETLAIVAYHQPVTRAEIEEIRGVSTSKGSLDLLLETGWVRLRGRRRTPGRPVTYGTTPAFLEHFGLDAVSDLP 176
>gi|88798248|ref|ZP_01113834.1| hypothetical protein MED297_13357 [Reinekea sp. MED297] >gi|88779024|gb|EAR10213.1| hypothetical protein MED297_13357 [Reinekea sp. MED297] (448 aa)
Score = 161, Expect = 8.5e-10, Identities = 49/164 (29%), Positives = 89/164 (54%)
  Q:     5 VKSVIEAALFIAGNE---GVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K ++EAALF +G+       +D  +   R  V+    +M E+I  YE    RGL + +V   Y+  T+ + ++ ++  +  K +   ++ ++ET+A+IAY  P TR +I ++R     + ++  L+E   V   G  +  G+P +Y  T +F D FGL S+  LP +
  S:   114 LKRILEAALFASGSTLSVNHLRDMFEPHERPKVKIVRQIMTELIALYEG---RGLELVEVASGYRFQTEAETARWISRLWDEKPQR-YSRALMETIALIAYRQPITRGEIEDVRGVAVSSNIIRTLLEREWVRVVGHRDVPGRPAMYATTRQFLDYFGLKSLDQLPSL 277
>gi|110834249|ref|YP_693108.1| putative transcriptional regulator [Alcanivorax borkumensis SK2] >gi|110647360|emb|CAL16836.1| putative transcriptional regulator [Alcanivorax borkumensis SK2] (319 aa)
Score = 161, Expect = 8.6e-10, Identities = 48/164 (29%), Positives = 95/164 (57%)
  Q:     5 VKSVIEAALFIAGNEG-VHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K ++EAA+ +A  EG + +D + ++     R S  +    +E++  EYE    RG+ +++V   ++   + ++   V+  +  ++K P  ++ ++ETLA+IAY  P TR +I E+R     + +++ L+E   V   G  +  G+P ++  T +F D F L S++DLP +
  S:     6 IKRIVEAAILVA--EGPLDRDGMLALFDEDDRPSKAELSKYLEQLGEEYEG---RGIFLKEVASGFRFQARSELGSWVSRLW--QEKPPRYSRAILETLALIAYRQPITRGEIEEIRGVSVSSHIVKSLLERNWVRVVGHRDVPGRPAMFATTKQFLDYFDLKSLEDLPSL 169
>gi|94495583|ref|ZP_01302163.1| putative transcriptional regulator [Sphingomonas sp. SKA58] >gi|94424971|gb|EAT09992.1| putative transcriptional regulator [Sphingomonas sp. SKA58] (196 aa)
Score = 161, Expect = 9.3e-10, Identities = 41/113 (36%), Positives = 63/113 (55%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ + + G  +   T PD++ I+       +K  L++  +ETLAIIAY+ P +R++I  +R        L+ L+E G V  AGR E  G+P +Y  +  F   FGL S +DLP
  S:    51 RGVNLVERGGRWHFQTAPDLAHILRREKDEPRK--LSRAAMETLAIIAYHEPVSRAEIEAIRGVQVAKGTLDVLMEAGWVRPAGRREVPGRPLIYATSVDFLSHFGLSSRRDLP 162
>gi|149926276|ref|ZP_01914538.1| putative transcriptional regulator (Ypuh-like) protein [Limnobacter sp. MED105] >gi|149825094|gb|EDM84306.1| putative transcriptional regulator (Ypuh-like) protein [Limnobacter sp. MED105] (204 aa)
Score = 161, Expect = 9.6e-10, Identities = 55/176 (31%), Positives = 96/176 (54%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEA-VMEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-----LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYE 181
           K+++EAAL  +    V    +K + RL    F+A V+  ++ +  +D   +GL + +V   ++  T+ D+ +       ++Q NP      ++  +ETLAIIAY  P TR  I  +R  T  T +++ L + G +E  G  +A G+P L+  TP+F     L S+ +LP   L ++K ++L  E
  S:     7 KNILEAALLCS----VEPIAVKELMRLFDDAFDASVVTTLLEDLRRDWTHKGLELVQVKTGWRFQTREDVKRY------LEQMNPEKPPKYSRATMETLAIIAYKQPVTRGDIESIRGVTVSTQVIKALEDRGWIESIGHRDAPGRPALWATTPQFLADLNLASLSELP--ALDDEKDQQLADE 178
>gi|119775260|ref|YP_928000.1| putative transcriptional regulator [Shewanella amazonensis SB2B] >gi|119767760|gb|ABM00331.1| putative transcriptional regulator [Shewanella amazonensis SB2B] (198 aa)
Score = 160, Expect = 1.1e-09, Identities = 59/179 (32%), Positives = 99/179 (55%)
  Q:     3 INVKSVIEAALFI--------AGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV--------------LPEQKIEELTYE 181
           + +K +IEA LF+        A  EGV      S  R+S      V+ E++ +Y+   +RG+ + KV   Y+  T+  ++  + + +  ++K P  ++  +ETLA+IAY  P TR  I ++R     + +L+ L +   +   G  E  G+P LY  T +F   FGLD++  LP +               LP  + EELT+E
  S:     7 LQLKQLIEACLFVQQKPMTIKALREGVLAPFAVSRERIST-----VVAELMVDYQ---ERGVNLVKVAGGYRFQTQETLNPYLQTLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVALGSHILKTLSDRRWIRVVGHKEVPGRPALYATTSEFLAYFGLDNLASLPALADLESLDALFGKQTELPNAQ-EELTHE 198
>gi|83952163|ref|ZP_00960895.1| segregation and condensation protein B [Roseovarius nubinhibens ISM] >gi|83837169|gb|EAP76466.1| segregation and condensation protein B [Roseovarius nubinhibens ISM] (242 aa)
Score = 160, Expect = 1.1e-09, Identities = 42/125 (33%), Positives = 73/125 (58%)
  Q:    42 EEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           E +++  ++   RG+ + KVG+ +   T PD+      GF ++++      L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT  F   FGL+S +DLP
  S:    72 EALVYLKKRYEGRGVALAKVGDAWVFRTAPDL------GFLMQRETVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTIDQLLEMEWIRFGRRKMTPGRPITFVVTQDFLAHFGLESARDLP 195
>gi|162148006|ref|YP_001602467.1| putative segregation and condensation protein B [Gluconacetobacter diazotrophicus PAl 5] >gi|187597937|ref|ZP_02984193.1| segregation and condensation protein B [Gluconacetobacter diazotrophicus PAl 5] >gi|161786583|emb|CAP56165.1| putative segregation and condensation protein B [Gluconacetobacter diazotrophicus PAl 5] >gi|187490039|gb|EDU27984.1| segregation and condensation protein B [Gluconacetobacter diazotrophicus PAl 5] (231 aa)
Score = 160, Expect = 1.1e-09, Identities = 33/78 (42%), Positives = 49/78 (62%)
  Q:    89 LNQGMIETLAIIAYNHPCTRSQIHELRKTDPT-PMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           L +  +ETLAIIAY+ PCTR++I E+R    +  +L+ L+E  L+   GR E  G+P L+  +  F   FGL  ++DLP
  S:   105 LARATLETLAIIAYHQPCTRAEIEEIRGVSLSQQVLDTLLEASLIVPRGRKEVPGRPILWGTSADFLRHFGLRDLRDLP 183
>gi|15806861|ref|NP_295584.1| hypothetical protein DR_1861 [Deinococcus radiodurans R1] >gi|6459641|gb|AAF11414.1|AE002026_2 conserved hypothetical protein [Deinococcus radiodurans R1] (182 aa)
Score = 160, Expect = 1.3e-09, Identities = 42/113 (37%), Positives = 60/113 (53%)
  Q:    56 LVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           + +  V   Y+L   P ++  +A          L+   +E LAIIAY  P TR++I  +R      +L  L E  LV+  GRS+AVG+P LY  T KF   FGL S++DLP +
  S:    60 ITLEAVAGGYRLIVPPGLAGHLAPLLAPAPLPSLSNAALEVLAIIAYRQPVTRAEIEAMRGASAGTVL-TLQERELVKVVGRSDAVGQPLLYGTTEKFLLEFGLGSLQDLPPL 171
>gi|119469278|ref|ZP_01612217.1| hypothetical protein ATW7_07494 [Alteromonadales bacterium TW-7] >gi|119447142|gb|EAW28411.1| hypothetical protein ATW7_07494 [Alteromonadales bacterium TW-7] (196 aa)
Score = 159, Expect = 1.4e-09, Identities = 50/171 (29%), Positives = 96/171 (56%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI-VLPEQKIEEL 178
           +IEAA+F+A ++ + K  +K    + +    + + + I   +   Q RG+ + +VG  Y+      +S  +++ +  +++ P  ++ ++ETL++IAY  P TR +I ++R  T  + +++ L+E   V+  G  E  GKP LY  T +F D F L  +++LP +    E KI +L
  S:    14 IIEAAIFVA-DKPISKRHIKDTVLVDIAISMSRINDAIETIQTHFQTRGIRLVEVGSGYRFQACSSLSPWLSNLW--QERAPKYSRALLETLSLIAYRQPITRGEIEQVRGVTTGSNIIKTLLEREWVKVVGHKEVPGKPALYATTKQFLDYFSLTGLENLPALPAQQESKINQL 185
>gi|13471184|ref|NP_102753.1| hypothetical protein mll1087 [Mesorhizobium loti MAFF303099] >gi|14021928|dbj|BAB48539.1| mll1087 [Mesorhizobium loti MAFF303099] (254 aa)
Score = 159, Expect = 1.5e-09, Identities = 38/114 (33%), Positives = 66/114 (57%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +RG+ + +VG+ +   T  D++ +++      Q+  L++  +E LAIIAY+ P TR++I ++R  + +   L+ L+E   V   GR +  G+P  Y  T  F D F L+ I+DLP
  S:    86 RRGVNLVRVGDAWAFRTAGDLAFLMSRD--TVQQRKLSRAALEVLAIIAYHQPVTRAEIEDIRGVETSKGTLDTLLETEWVRMRGRRKTPGRPVTYGTTETFLDHFALEEIRDLP 198
>gi|46445844|ref|YP_007209.1| hypothetical protein pc0210 [Candidatus Protochlamydia amoebophila UWE25] >gi|46399485|emb|CAF22934.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] (234 aa)
Score = 159, Expect = 1.5e-09, Identities = 49/164 (29%), Positives = 86/164 (52%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISR----LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K VIEA LF + ++ +   K++ I+     L  +    +++ +  E+    QR   + ++ + Y L T  + +  +      K+   ++    E LAI+AY  P TR QI  +R  D + +L +LIE  L+E  G+ EA G+P LY  T +F   +GL  + +L +I
  S:    67 IKKVIEALLFTS-SDPLPLSKIREITDTLYPLRPKQLRQIIDSLRQEFIAH-QRAFKLEEISQGYVLRTHEEYAPYLDILHRQKRTEKISCAATEVLAIVAYRQPITRPQIDAIRGVDSSGILSQLIERQLIEMVGKLEAPGRPSLYGTTKEFLKHYGLKDLSELEKI 232
>gi|50365366|ref|YP_053791.1| chromosomal segregation/condensation protein [Mesoplasma florum L1] >gi|50363922|gb|AAT75907.1| chromosomal segregation/condensation protein [Mesoplasma florum L1] (209 aa)
Score = 159, Expect = 1.7e-09, Identities = 53/184 (28%), Positives = 103/184 (55%)
  Q:     1 MSINVKSVIEAALFIAGNEGVH----KDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGEN-YKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLD-SIKDLPEIVLPEQK--IEELTYEEEI 184
           M+ N+K+++E  LF+ G++G+     ++ L+ +  +++Q  EA++ E+  +Y  DP     ++K G+N Y+L TKP++ +  A        + L+   IE L+II Y  P ++  I  +R+ + +  + +L +  L++  G++       LY +T  F+ +F +    + LP+I     K   EE  +EEEI
  S:     1 MNSNIKAIVEGLLFVYGDDGISLLDLQNVLEDVRPVTIQ--EAIL-ELEKKYSSDPDCAFSIQKFGKNKYRLQTKPELHEYFAKLELEVNNSRLSNSSIEVLSIIVYKGPISKHDIELIRQAECSYQIYRLRQKKLIKAVGKTSTGAN--LYTITDNFFKLFNITGGFEALPQIDFASYKNQDEENNFEEEI 187
>gi|42523454|ref|NP_968834.1| hypothetical protein Bd1977 [Bdellovibrio bacteriovorus HD100] >gi|39575660|emb|CAE79827.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100] (488 aa)
Score = 159, Expect = 1.8e-09, Identities = 50/162 (30%), Positives = 87/162 (53%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSI---SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           S++E+ LF A +  V    LK +   + +        ++++  EY    +RG+ + +V   Y+L TK D  + +      +Q   L+   +E L+I+AY  P  ++++ E+R  +   +L  L+E  LV   G+SE  G+P  Y  T KF +IFGL S+K+LP +
  S:   104 SIVESVLF-ASDRPVSLASLKLLFKGTNIRGDKIRRALDQLAVEYAGG-RRGVTLEEVPGGYQLRTKIDNMEFLKRTLKARQFK-LSGPALEVLSIVAYKQPTVKAEVDEIRGVESGHLLRALMEKNLVCFEGKSELPGRPMQYGTTRKFLEIFGLRSLKELPTL 265
>gi|78223165|ref|YP_384912.1| condensin subunit ScpB [Geobacter metallireducens GS-15] >gi|78194420|gb|ABB32187.1| condensin subunit ScpB [Geobacter metallireducens GS-15] (195 aa)
Score = 158, Expect = 2.1e-09, Identities = 50/180 (27%), Positives = 92/180 (51%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPL--NQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE 183
           N+KS++E+ LF+A            +      D    +  +  EY ++  RG+V+ +V   Y+  T  + +  +     + +  P+  +Q  +ETLAIIAY  P TR++I  LR  D   +L+ ++E  L++  G+ +  GKP +Y  T +F ++F L  ++ LP +       E  +YE++
  S:     3 NLKSIVESLLFVADAPMTFDRLCSFLDEFDRGDIREALGALQEEYGQE-GRGVVLVEVASGYQFRTPVENADYLRR---LTKTRPVKFSQSALETLAIIAYRQPVTRAEIEYLRGVDCGGVLKTILEKKLIKILGKKDIPGKPLIYGTTREFLELFSLKDLRSLPTLKEIRDLSETASYEQQ 180
>gi|27804826|gb|AAO22869.1| hypothetical protein [Myxococcus xanthus] (237 aa)
Score = 158, Expect = 2.3e-09, Identities = 45/162 (27%), Positives = 84/162 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +++VIE+ LF+A    +  D+L   + +  +     + ++     +D   G+V+ +V   ++  T P   + V     +K +  L +  +ETLAIIAY  P TR +I ++   D   +++ L++  LV+  G+ E VG+P LY  + +F + F L  +  LP
  S:    79 IRTVIESVLFVA-ERPLSVDELYMATGIERELIAEALNQLS-GIHRDGISGIVLYEVAGGWQFRTDPHSGEYVRRYLRVKPQR-LTRAAVETLAIIAYRQPVTRPEIEDIPGVDCGAVIKALMDRKLVKILGKREEVGRPILYGTSREFLEFFALKDLSALP 237
>gi|110680347|ref|YP_683354.1| hypothetical protein RD1_3161 [Roseobacter denitrificans OCh 114] >gi|109456463|gb|ABG32668.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] (201 aa)
Score = 157, Expect = 2.6e-09, Identities = 44/139 (31%), Positives = 83/139 (59%)
  Q:    28 SISRLSVQDFEAVM-------EEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           S   +SV++  A M       E ++   ++   RG+ + ++G+ + + T PD+      GF ++++      L++  +ETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT +F D FGL++ +DLP
  S:    15 SAEPVSVKELSARMPHGSDPSEALVHLRKRYEGRGVRLCRIGDAWAMRTAPDL------GFLMQRETIETRKLSRAAVETLAIIAYHQPVTRAEIEEIRGVSVSRGTVDQLLEMEWIRFGRRKMTPGRPVTFVVTAEFLDHFGLENARDLP 159
>gi|163735837|ref|ZP_02143266.1| hypothetical protein RLO149_00780 [Roseobacter litoralis Och 149] >gi|161390923|gb|EDQ15263.1| hypothetical protein RLO149_00780 [Roseobacter litoralis Och 149] (223 aa)
Score = 157, Expect = 2.7e-09, Identities = 49/163 (30%), Positives = 90/163 (55%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVM-------EEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           N +S+ EA         V      S   +SV++  A M       E +++  ++   RG+ +  +G+ + + T PD+      GF ++++      L++  +ETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT +F D FGL++ +DLP
  S:    13 NEQSLFEAPPMGEQERMVEAILFASAEPVSVKELAARMPHGSDPAEALVYLRKRYEGRGVRLCHIGDAWAMRTAPDL------GFLMQRETIETRKLSRAAVETLAIIAYHQPVTRAEIEEIRGVSVSRGTVDQLLEMEWIRFGRRKMTPGRPVTFVVTAEFLDHFGLENARDLP 181
>gi|78066107|ref|YP_368876.1| condensin subunit ScpB [Burkholderia sp. 383] >gi|77966852|gb|ABB08232.1| condensin subunit ScpB [Burkholderia sp. 383] (343 aa)
Score = 157, Expect = 2.8e-09, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE     ++   FD
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIEAALLAQQAMDFD 187
>gi|118580111|ref|YP_901361.1| putative transcriptional regulator [Pelobacter propionicus DSM 2379] >gi|118502821|gb|ABK99303.1| condensin subunit ScpB [Pelobacter propionicus DSM 2379] (206 aa)
Score = 157, Expect = 2.8e-09, Identities = 46/166 (27%), Positives = 87/166 (52%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +N+ +V+E+ +F A +  +  DKL  +     R +++D   V+ +++  +E     G  +  +   ++  T   + + V      K     +Q  +ETLAI+AY  P TR++I  LR  D   +L  L+E  L+   G+ +  G+P +Y  + +F ++FGL  +K LP +
  S:     1 MNLSAVVESVIFSA-DTPLSLDKLCELLPEYERGAIRD---VLRDLVSLHEVR-NGGFQLVNIAGGWQFRTPSSLQQYVVRNVKAKSAK-FSQSSLETLAIVAYRQPVTRAEIEYLRGVDCGGVLRTLLERKLIRILGKKDIPGRPLIYGTSREFLEVFGLKDLKSLPTL 164
>gi|126462352|ref|YP_001043466.1| putative transcriptional regulator [Rhodobacter sphaeroides ATCC 17029] >gi|126104016|gb|ABN76694.1| condensin subunit ScpB [Rhodobacter sphaeroides ATCC 17029] (211 aa)
Score = 157, Expect = 2.8e-09, Identities = 40/115 (34%), Positives = 68/115 (59%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + +VG+ +   T  D+  ++     ++QK  L++  IETLAI+AY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT  F D FGL+S +DLP I
  S:    62 RGVQLTRVGDAWAFRTAADLGFLMRKE-TVEQKK-LSRAAIETLAIVAYHQPVTRAEIEEIRGVAVSRGTIDQLLELEWIRFGRRRMTPGRPVTFVVTESFLDHFGLESARDLPGI 175
>gi|189424943|ref|YP_001952120.1| segregation and condensation protein B [Geobacter lovleyi SZ] >gi|189421202|gb|ACD95600.1| segregation and condensation protein B [Geobacter lovleyi SZ] (195 aa)
Score = 157, Expect = 2.9e-09, Identities = 53/189 (28%), Positives = 96/189 (50%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLS--VQDFEAVMEEMIFEYEKD--PQRGLVVR--KVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNRE 192
           ++ ++IE  LF++       D   ++ RL+  + D+E     +  +  +D   QRG  V   +V   ++L T P++   ++     +     +Q  +ETLAI+AY  P TR +I  LR  D   +L+ L+E  LV+  G+ +  G+P +Y  T +F ++F L  +K LP        + E+   +E+  F+   E
  S:     5 SLNAIIEGLLFVS-------DGPMTLDRLTELLPDYERASVRLAVQELRDDYEQRGSGVHLVEVAGGWQLRTVPELMPYLSRMVKGRPAR-FSQSALETLAIVAYRQPITRQEIEYLRGVDTGAVLKTLLEKRLVKILGKKDIPGRPIIYGTTREFLEVFNLKDLKGLP-------TLREIQSLDEVPIFEVQEE 184
>gi|146276955|ref|YP_001167114.1| putative transcriptional regulator [Rhodobacter sphaeroides ATCC 17025] >gi|145555196|gb|ABP69809.1| condensin subunit ScpB [Rhodobacter sphaeroides ATCC 17025] (211 aa)
Score = 157, Expect = 3.0e-09, Identities = 41/115 (35%), Positives = 68/115 (59%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + +VG+ +   T  D+  ++     ++QK  L++  IETLAI+AY+ P TR++I E+R    +   +++LIE+  +    R    G+P  + VT  F D FGL+S +DLP I
  S:    62 RGVHLVRVGDAWAFRTAADLGFLMRKE-TVEQKK-LSRAAIETLAIVAYHQPVTRAEIEEIRGVAVSRGTIDQLIELEWIRFGRRRMTPGRPVTFVVTETFLDHFGLESARDLPGI 175
>gi|77463496|ref|YP_353000.1| condensin subunit ScpB [Rhodobacter sphaeroides 2.4.1] >gi|77387914|gb|ABA79099.1| condensin subunit ScpB [Rhodobacter sphaeroides 2.4.1] (211 aa)
Score = 157, Expect = 3.0e-09, Identities = 40/115 (34%), Positives = 68/115 (59%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + +VG+ +   T  D+  ++     ++QK  L++  IETLAI+AY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VT  F D FGL+S +DLP I
  S:    62 RGVQLARVGDAWAFRTAADLGFLMRKE-TVEQKK-LSRAAIETLAIVAYHQPVTRAEIEEIRGVAVSRGTIDQLLELEWIRFGRRRMTPGRPVTFVVTESFLDHFGLESARDLPGI 175
>gi|153892288|ref|ZP_02013216.1| putative transcriptional regulator [Opitutaceae bacterium TAV2] >gi|151581647|gb|EDN45272.1| putative transcriptional regulator [Opitutaceae bacterium TAV2] (292 aa)
Score = 156, Expect = 3.2e-09, Identities = 41/116 (35%), Positives = 66/116 (56%)
  Q:    62 GENYKLFTKPDISKIVASGFGIKQKNP---LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI-VLPEQKIEE 177
            + Y+L T P  ++ +     ++ + P   L+Q  +ETLA++AY  P TRS+I  +R       L KL+E  LV   GR++  G+P  Y  T KF +  G+ S+ +LP   VL  ++I+E
  S:    88 AQGYRLVTHPRFARWIRI---LRDEPPPVKLSQSALETLAVVAYRQPVTRSEIESIRGVSADAGLNKLLERELVYIVGRADLPGRPLQYGTTDKFLEFVGVKSLVELPASDVLSPRQIDE 204
>gi|19552641|ref|NP_600643.1| hypothetical protein NCgl1370 [Corynebacterium glutamicum ATCC 13032] (192 aa)
Score = 156, Expect = 3.4e-09, Identities = 49/167 (29%), Positives = 90/167 (53%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +S +E+ L +  +  V    L  +  + V   EA+++EM FE  +    G+ +R+  E ++ +T+P+ + IV        +  L++  +ETLA++AY  P TRSQI  +R  +   ++  L   GLV+E    E+ G  + Y  T    ++ G+DS+  LP++  +LP+
  S:    19 RSRMESILLVV-DTPVSARTLAGVLGIDVPATEAILKEMAFELSERGS-GIDLRETAEGWRYYTRPENADIVEQFLLDGNQTRLSRAALETLAVVAYRQPVTRSQISAVRGVNVDGVMRTLQLRGLVKEVDVDESTGA-HRYGTTELLLELLGIDSLDKLPDLAPLLPD 184
>gi|194563524|ref|YP_002098547.1| hypothetical protein BDAG_01773 [Burkholderia dolosa AUO158] >gi|124895148|gb|EAY69028.1| hypothetical protein BDAG_01773 [Burkholderia dolosa AUO158] (297 aa)
Score = 156, Expect = 3.4e-09, Identities = 35/87 (40%), Positives = 52/87 (59%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE 176
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE
  S:    17 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIE 104
>gi|170727250|ref|YP_001761276.1| segregation and condensation protein B [Shewanella woodyi ATCC 51908] >gi|169812597|gb|ACA87181.1| segregation and condensation protein B [Shewanella woodyi ATCC 51908] (226 aa)
Score = 156, Expect = 3.4e-09, Identities = 53/168 (31%), Positives = 87/168 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           +K +IEAALF+ G + V    L+    ++     A ++  I E ++D Q RG+ +  V   Y+  T   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I  +R     +  ++ L +   +   G  E  G+P LY  T +F   FGLD++ DLP +  PE
  S:    14 LKQLIEAALFVMG-KTVTIKGLRETVLVNFNVSRAKVKLAIEELQEDYQGRGVELVAVAGGYRFQTVEALSPYLQCMW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEFVRGVAVSSHTIKTLSDRHWIRAVGHKEVPGRPALYGTTAEFLAYFGLDTLADLPPLSDPE 181
>gi|21324193|dbj|BAB98818.1| Predicted transcriptional regulator containing the HTH domain [Corynebacterium glutamicum ATCC 13032] (181 aa)
Score = 156, Expect = 3.6e-09, Identities = 49/167 (29%), Positives = 90/167 (53%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +S +E+ L +  +  V    L  +  + V   EA+++EM FE  +    G+ +R+  E ++ +T+P+ + IV        +  L++  +ETLA++AY  P TRSQI  +R  +   ++  L   GLV+E    E+ G  + Y  T    ++ G+DS+  LP++  +LP+
  S:     8 RSRMESILLVV-DTPVSARTLAGVLGIDVPATEAILKEMAFELSERGS-GIDLRETAEGWRYYTRPENADIVEQFLLDGNQTRLSRAALETLAVVAYRQPVTRSQISAVRGVNVDGVMRTLQLRGLVKEVDVDESTGA-HRYGTTELLLELLGIDSLDKLPDLAPLLPD 173
>gi|145295559|ref|YP_001138380.1| hypothetical protein cgR_1486 [Corynebacterium glutamicum R] >gi|140845479|dbj|BAF54478.1| hypothetical protein [Corynebacterium glutamicum R] (192 aa)
Score = 156, Expect = 3.6e-09, Identities = 49/167 (29%), Positives = 90/167 (53%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +S +E+ L +  +  V    L  +  + V   EA+++EM FE  +    G+ +R+  E ++ +T+P+ + IV        +  L++  +ETLA++AY  P TRSQI  +R  +   ++  L   GLV+E    E+ G  + Y  T    ++ G+DS+  LP++  +LP+
  S:    19 RSRMESILLVV-DTPVSARTLAGVLGIDVPATEAILKEMAFELSERGS-GIELRETAEGWRYYTRPENADIVEQFLLDGNQTRLSRAALETLAVVAYRQPVTRSQISAVRGVNVDGVMRTLQLRGLVKEVDVDESTGA-HRYGTTELLLELLGIDSLDKLPDLAPLLPD 184
>gi|134295570|ref|YP_001119305.1| condensin subunit ScpB [Burkholderia vietnamiensis G4] >gi|134138727|gb|ABO54470.1| condensin subunit ScpB [Burkholderia vietnamiensis G4] (340 aa)
Score = 156, Expect = 3.6e-09, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE     ++   FD
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIEAALLAQQAMDFD 187
>gi|115351431|ref|YP_773270.1| putative transcriptional regulator [Burkholderia ambifaria AMMD] >gi|115281419|gb|ABI86936.1| condensin subunit ScpB [Burkholderia ambifaria AMMD] (340 aa)
Score = 156, Expect = 3.9e-09, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE     ++   FD
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIEAALLAQQAMDFD 187
>gi|83311624|ref|YP_421888.1| transcription regulator [Magnetospirillum magneticum AMB-1] >gi|82946465|dbj|BAE51329.1| Predicted transcriptional regulator containing the HTH domain [Magnetospirillum magneticum AMB-1] (216 aa)
Score = 156, Expect = 4.0e-09, Identities = 38/115 (33%), Positives = 62/115 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG  + + G+ +   T  D+++  A      Q+  L++  +ETLAIIAY+ P TR++I E+R    +   ++ L   G +   GR    G+P  +  T  F D FGL+S+ DLP +
  S:    51 RGFNLVRRGDGWAFRTAVDLAE--ALKVERSQERKLSRAAVETLAIIAYHQPVTRAEIEEIRGVALSKGTMDILFSAGWIRPKGRRRTPGRPLTWATTDGFLDHFGLESLADLPGV 164
>gi|170732822|ref|YP_001764769.1| segregation and condensation protein B [Burkholderia cenocepacia MC0-3] >gi|169816064|gb|ACA90647.1| segregation and condensation protein B [Burkholderia cenocepacia MC0-3] (345 aa)
Score = 155, Expect = 4.2e-09, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE     ++   FD
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIEAALLAQQAMDFD 187
>gi|110634159|ref|YP_674367.1| condensin subunit ScpB [Mesorhizobium sp. BNC1] >gi|110285143|gb|ABG63202.1| condensin subunit ScpB [Mesorhizobium sp. BNC1] (244 aa)
Score = 155, Expect = 4.2e-09, Identities = 47/133 (35%), Positives = 82/133 (61%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           D  A+MEE+  +YE+   RG+ + +V +++   T  D++ +++    ++QK  L++  +E L++IAY+ P TR++I E+R  + +   L+ L+E G V   GR  A G+P  Y  T +F D FGL+ ++DLP I
  S:    62 DIRAIMEELKGDYER---RGVNLVRVEDSWAFRTAGDLAFLMSRD-AVQQKK-LSRAALEMLSVIAYHQPVTRAEIEEIRGVETSKGTLDLLLETGWVRMRGRRRAPGRPVTYGTTLEFLDHFGLEELRDLPGI 190
>gi|172060470|ref|YP_001808122.1| segregation and condensation protein B [Burkholderia ambifaria MC40-6] >gi|171992987|gb|ACB63906.1| segregation and condensation protein B [Burkholderia ambifaria MC40-6] (340 aa)
Score = 155, Expect = 4.4e-09, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE     ++   FD
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIEAALLAQQAMDFD 187
>gi|194556573|ref|YP_002091599.1| hypothetical protein BCPG_00298 [Burkholderia cenocepacia PC184] >gi|124870364|gb|EAY62080.1| hypothetical protein BCPG_00298 [Burkholderia cenocepacia PC184] (345 aa)
Score = 155, Expect = 4.4e-09, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE     ++   FD
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIEAALLAQQAMDFD 187
>gi|107022569|ref|YP_620896.1| putative transcriptional regulator [Burkholderia cenocepacia AU 1054] >gi|116689518|ref|YP_835141.1| putative transcriptional regulator [Burkholderia cenocepacia HI2424] >gi|105892758|gb|ABF75923.1| condensin subunit ScpB [Burkholderia cenocepacia AU 1054] >gi|116647607|gb|ABK08248.1| condensin subunit ScpB [Burkholderia cenocepacia HI2424] (345 aa)
Score = 155, Expect = 4.5e-09, Identities = 37/99 (37%), Positives = 56/99 (56%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE     ++   FD
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIEAALLAQQAMDFD 187
>gi|157374829|ref|YP_001473429.1| putative transcriptional regulator [Shewanella sediminis HAW-EB3] >gi|157317203|gb|ABV36301.1| putative transcriptional regulator [Shewanella sediminis HAW-EB3] (214 aa)
Score = 155, Expect = 5.0e-09, Identities = 56/193 (29%), Positives = 96/193 (49%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           +K +IEA+LF+ G + V    LK    ++     A ++  I E ++D Q RG+ +  V   Y+  +   +S  +   +  ++K P  ++  +ETLA+IAY  P TR  I  +R     +  ++ L +   +   G  E  G+P LY  T +F   FGLD+I DLP +   E      +   ++N  +  +E+ G E
  S:    14 LKQLIEASLFVMG-KSVSIKSLKETVLVNFNVSRAKIKLAIEELQQDYQGRGIELMSVAGGYRFQSIESLSPFLQPLW--QEKAPKYSRATLETLAVIAYRQPVTRGDIEFVRGVAVSSHTIKSLADRQWIRMVGHKEVPGRPALYATTTEFLAYFGLDTIADLPPLTDTESLAALFS---DVNSLEKPQEEIGPE 203
>gi|83953778|ref|ZP_00962499.1| Predicted transcriptional regulator containing the HTH domain [Sulfitobacter sp. NAS-14.1] >gi|83841723|gb|EAP80892.1| Predicted transcriptional regulator containing the HTH domain [Sulfitobacter sp. NAS-14.1] (217 aa)
Score = 155, Expect = 5.1e-09, Identities = 40/125 (32%), Positives = 70/125 (56%)
  Q:    42 EEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           E M+   ++   RG+ + ++G+ Y + T  D+  ++       +   L++  IETLAIIAY+ P TR++I E+R    +   L++L+E+  +    R    G+P  + VT +F   FGL+S +DLP
  S:    53 EAMVHLRKRYTGRGVELCRIGDAYAMRTAADLGYLMQHE--TVETRKLSRAAIETLAIIAYHQPATRAEIEEIRGVSVSRGTLDQLLELDWIRFGRRKMTPGRPVTFVVTQEFLAHFGLESPRDLP 176
>gi|114332010|ref|YP_748232.1| putative transcriptional regulator [Nitrosomonas eutropha C91] >gi|114309024|gb|ABI60267.1| condensin subunit ScpB [Nitrosomonas eutropha C91] (216 aa)
Score = 154, Expect = 5.5e-09, Identities = 53/168 (31%), Positives = 89/168 (52%)
  Q:     1 MSIN--VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEI-GLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +S+N  V  V+EAAL +  +E +  + LK +   ++ D + + E +    EK    G+ +  V   ++  +KP++ +I       ++    ++ ++ETLAIIAY  P TR  I E+R    +  + K +E  G +E  G+ E  GKPYLY  T  F D   L S++ LP +
  S:    17 LSLNDQVVRVVEAAL-LTTSEPLTINDLKKLFEGNI-DKKMLHESLTILDEKWCNSGIELVLVAGGWRFQSKPEM-QIFLDRLNPQRPPRYSRAVMETLAIIAYRQPVTRGDIEEIRGVAVSTQVIKTLESRGWIETIGQREIPGKPYLYATTRHFLDDLNLQSLEQLPSL 184
>gi|31789455|gb|AAP58569.1| conserved hypothetical protein [uncultured Acidobacteria bacterium] (226 aa)
Score = 154, Expect = 5.9e-09, Identities = 45/162 (27%), Positives = 85/162 (52%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKD---PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +VIEA +F++          K+I+ +  +D   V+++ + E E +      GL +R+V   ++  T+P+  + V +    +    L+   +ETLA+IAY  P T  +I E+R       ++ L++  L+   GR + VG+P +Y  + +F   FGL  + +LP +
  S:    57 AVIEALIFVSE----EPLSAKTIAEVLKED-RPVIDQALAELEGEFNGRNAGLQLREVAGGWQFATRPEYHEHVRAFLKSRPSAKLSIASLETLAVIAYKQPVTVPEILEIRGVQSPSSIKTLLDKKLIVAKGRKDTVGRPMMYGTSKEFLMQFGLKDLGELPSV 216
>gi|83942557|ref|ZP_00955018.1| transcriptional regulator [Sulfitobacter sp. EE-36] >gi|83846650|gb|EAP84526.1| transcriptional regulator [Sulfitobacter sp. EE-36] (217 aa)
Score = 154, Expect = 6.1e-09, Identities = 40/125 (32%), Positives = 70/125 (56%)
  Q:    42 EEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPT-PMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           E M+   ++   RG+ + ++G+ Y + T  D+  ++       +   L++  IETLAIIAY+ P TR++I E+R    +   L++L+E+  +    R    G+P  + VT +F   FGL+S +DLP
  S:    53 EAMVHLRKRYTGRGVELCRIGDAYAMRTAADLGYLMQHE--TVETRKLSRAAIETLAIIAYHQPATRAEIEEIRGVSVSRGTLDQLLELDWIRFGRRKMTPGRPVTFVVTQEFLAHFGLESPRDLP 176
>gi|126739451|ref|ZP_01755144.1| segregation and condensation protein B [Roseobacter sp. SK209-2-6] >gi|126719551|gb|EBA16260.1| segregation and condensation protein B [Roseobacter sp. SK209-2-6] (228 aa)
Score = 154, Expect = 6.7e-09, Identities = 37/98 (37%), Positives = 58/98 (59%)
  Q:    69 TKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           T PD+  ++     I +   L++  IETLAIIAY+ P TR++I E+R    +   +++L+E+  +    R    G+P  + VTP F D FGL+S +DLP
  S:    91 TAPDLGFLMQKE--IVETRKLSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTIDQLLEMEWIRLGRRRMTPGRPVTFVVTPSFLDHFGLESARDLP 187
>gi|145298419|ref|YP_001141260.1| segregation and condensation protein B [Aeromonas salmonicida subsp. salmonicida A449] >gi|142851191|gb|ABO89512.1| segregation and condensation protein B [Aeromonas salmonicida subsp. salmonicida A449] (189 aa)
Score = 153, Expect = 7.1e-09, Identities = 46/164 (28%), Positives = 91/164 (55%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K+++EAA+FIAG   +   +LKS            ++ ++ E  +D  +RG+ +++V   ++   + + ++ ++  +   ++ P  ++ ++ETL +IAY  P TR++I  +R     + ++  L + G V   G  E VG+P L   T +F D F L S++ LPE+
  S:     8 LKTLVEAAIFIAGRP-LTVSELKSGVLADYPVTGRYIQLLLAELRQDYSERGVELKEVASGWRFQARQEYAEELSRLW--SERAPRYSRAVMETLTLIAYRQPITRAEIEAIRGVAVSSQIVNTLKDRGWVRSVGHKEVVGRPELLATTREFLDYFNLQSLEQLPEL 171
>gi|186476491|ref|YP_001857961.1| segregation and condensation protein B [Burkholderia phymatum STM815] >gi|184192950|gb|ACC70915.1| segregation and condensation protein B [Burkholderia phymatum STM815] (360 aa)
Score = 153, Expect = 7.4e-09, Identities = 40/104 (38%), Positives = 58/104 (55%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE-QKIEELTYEEEINFFDTNRED 193
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T  F D  GL S++DLP +  P  Q   +L  +  I F D    D
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTRSFLDDLGLKSLEDLPPLDDPSAQSNMDLLAQHAIEFSDAAATD 193
>gi|94499318|ref|ZP_01305856.1| Predicted transcriptional regulator [Oceanobacter sp. RED65] >gi|94428950|gb|EAT13922.1| Predicted transcriptional regulator [Oceanobacter sp. RED65] (412 aa)
Score = 153, Expect = 7.4e-09, Identities = 52/192 (27%), Positives = 102/192 (53%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEK-LIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGD 196
           ++ ++EAAL  +G + +  D+++++       S Q  E +++ +   YEK   +G  ++KV   Y+   K D+S  V+  +  K +   ++ ++ETL+IIAY  P TR +I ++R    +  + K L E   ++  G  +  G+P +Y  T  F D F L+S+  LP +    ++I+E+        F+  + + G+
  S:     7 LEQIVEAALMASG-QTLSVDRMQTLFEEHEAPSKQRLEIIVQRI---YEKCEHKGYELKKVATGYRFQVKQDLSNWVSRLWEEKPQR-YSRALLETLSIIAYRQPVTRGEIEDVRGVAVSSHITKTLQEREWIQVVGHRDVPGRPAMYATTKMFLDYFNLESLDQLPTL----EEIQEIADANHALEFEDKQTEEGN 194
>gi|167587343|ref|ZP_02379731.1| putative transcriptional regulator [Burkholderia ubonensis Bu] (319 aa)
Score = 153, Expect = 7.7e-09, Identities = 35/87 (40%), Positives = 52/87 (59%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE 176
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE
  S:    75 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIE 162
>gi|121593576|ref|YP_985472.1| condensin subunit ScpB [Acidovorax sp. JS42] >gi|120605656|gb|ABM41396.1| condensin subunit ScpB [Acidovorax sp. JS42] (234 aa)
Score = 153, Expect = 7.7e-09, Identities = 50/170 (29%), Positives = 87/170 (51%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEE---------MIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLP 171
           S++ K V+E AL  A               +S++D   + ++         ++ E ++D   RG+ + +V   ++  ++P++ + +       +K P   +  +ETLAIIAY  P TR  I ++R      ++ K +E  G VE  G  E VG+P L+  T +F D  GL S+  LP +  P
  S:     3 SVDAKRVLETALICAPQP------------VSIRDLRTLFDDALGSDTVKMLLLELQQDWALRGVELVQVATGWRFQSRPEMREFLDRLH--PEKPPRYTRATLETLAIIAYRQPVTRGDIEDIRGVTVNSLIIKQLEDRGWVEVIGHRETVGRPALFATTRQFLDDLGLQSLDQLPTLEDP 170
>gi|62390309|ref|YP_225711.1| hypothetical protein cg1614 [Corynebacterium glutamicum ATCC 13032] >gi|41325646|emb|CAF21435.1| CONSERVED HYPOTHETICAL PROTEIN [Corynebacterium glutamicum ATCC 13032] (171 aa)
Score = 152, Expect = 9.2e-09, Identities = 45/147 (30%), Positives = 81/147 (55%)
  Q:    26 LKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           L  +  + V   EA+++EM FE  +    G+ +R+  E ++ +T+P+ + IV        +  L++  +ETLA++AY  P TRSQI  +R  +   ++  L   GLV+E    E+ G  + Y  T    ++ G+DS+  LP++  +LP+
  S:    17 LAGVLGIDVPATEAILKEMAFELSERGS-GIDLRETAEGWRYYTRPENADIVEQFLLDGNQTRLSRAALETLAVVAYRQPVTRSQISAVRGVNVDGVMRTLQLRGLVKEVDVDESTGA-HRYGTTELLLELLGIDSLDKLPDLAPLLPD 163
>gi|126734654|ref|ZP_01750400.1| putative transcriptional regulator [Roseobacter sp. CCS2] >gi|126715209|gb|EBA12074.1| putative transcriptional regulator [Roseobacter sp. CCS2] (216 aa)
Score = 152, Expect = 9.2e-09, Identities = 40/113 (35%), Positives = 68/113 (60%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN----PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ + KVG+ + + T  D+      GF ++++      L++  IETLAI+AY+ P TR++I E+R    +   +++LIE+  +    R    G+P  + VT  F D FGL++ +DLP
  S:    65 RGVNIVKVGDAWAIRTAGDL------GFLMQKETVETRKLSRAAIETLAIVAYHQPVTRAEIEEIRGVSVSRGTVDQLIELEWIRFGRRKMTPGRPVTFVVTQGFLDHFGLENARDLP 176
>gi|38233784|ref|NP_939551.1| hypothetical protein DIP1194 [Corynebacterium diphtheriae NCTC 13129] >gi|38200045|emb|CAE49721.1| Conserved hypothetical protein [Corynebacterium diphtheriae] (184 aa)
Score = 152, Expect = 9.5e-09, Identities = 41/134 (30%), Positives = 73/134 (54%)
  Q:    39 AVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEA----GRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +V+  M  E+E D   G+ VR+  E ++L+T    + +V           L++  +ETLA++AY  P TR+Q+  +R  +   ++  L   GL+ E     G     G  + Y+ T  F D+ G+DS++ LP++  +LP+
  S:    38 SVLRSMAQEFE-DRGSGIEVRESPEGWRLYTVKRNADVVEKFLLDGSHTKLSRAALETLAVVAYRQPATRAQVAAVRGVNVDGVMRTLQLRGLIREVAINPGTEGVNGSAHRYETTELFLDLLGIDSLERLPDLAPLLPD 176
>gi|160900457|ref|YP_001566039.1| segregation and condensation protein B [Delftia acidovorans SPH-1] >gi|160366041|gb|ABX37654.1| segregation and condensation protein B [Delftia acidovorans SPH-1] (278 aa)
Score = 152, Expect = 1.1e-08, Identities = 38/122 (31%), Positives = 65/122 (53%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQK 174
           Q+G+ + +V   ++  ++P++ ++       ++     +  +ETLAIIAY  P TR  I ++R      +L K +E  G +E  G  E VG+P L+  T +F D  GL S+  LP +  PE +
  S:    52 QKGVELVQVASGWRFQSRPEM-RVYLDRLHPEKPPRYTRATLETLAIIAYRQPVTRGDIEDIRGVTVNSLLIKQLEDRGWIEVIGHRETVGRPSLFATTRQFLDDLGLQSLDQLPMLEEPESQ 173
>gi|88859931|ref|ZP_01134570.1| hypothetical protein PTD2_18005 [Pseudoalteromonas tunicata D2] >gi|88817925|gb|EAR27741.1| hypothetical protein PTD2_18005 [Pseudoalteromonas tunicata D2] (196 aa)
Score = 152, Expect = 1.1e-08, Identities = 49/178 (27%), Positives = 97/178 (54%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSIS----RLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI-VLPEQKIEELTYEEEIN 185
           +IEA LF+AG   V  + LK+       +S++  +  + E+   Y     RG+ + +V   ++  + P ++  +   +   +K P  ++ ++ETL++IAY  P TR +I ++R     + ++++L +   ++  G  E  G+P LY  T  F D F L  + +LPE+  L + KI++L  +  ++
  S:    14 LIEATLFVAGKP-VSIEFLKNTVLDEFNVSLKRIKHNLSELQLHYS---SRGICLVEVASGFRFQSNPSLAPWLNKIW--PEKAPRYSRALLETLSLIAYRQPITRGEIEQVRGVAVSSQIMKQLQDREWIQIVGHKEVPGRPALYATTKLFLDYFSLTGLDNLPELPQLQQSKIDQLLRDPSVS 192
>gi|46201878|ref|ZP_00054138.2| COG1386: Predicted transcriptional regulator containing the HTH domain [Magnetospirillum magnetotacticum MS-1] (141 aa)
Score = 151, Expect = 1.2e-08, Identities = 32/84 (38%), Positives = 49/84 (58%)
  Q:    85 QKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           Q+  L++  +ETLAIIAY+ P TR++I E+R    +   ++ L   G +   GR    G+P  +  T  F D FGL+S+ DLP +
  S:     5 QERKLSRAAVETLAIIAYHQPVTRAEIEEVRGVALSKGTMDILFSAGWIRPKGRRRTPGRPLTWATTDGFLDHFGLESLSDLPGV 89
>gi|149907886|ref|ZP_01896554.1| hypothetical protein PE36_19500 [Moritella sp. PE36] >gi|149808892|gb|EDM68823.1| hypothetical protein PE36_19500 [Moritella sp. PE36] (192 aa)
Score = 151, Expect = 1.3e-08, Identities = 54/183 (29%), Positives = 90/183 (49%)
  Q:     6 KSVIEAALFIAGN----EGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           K +IEAA+F+A        + +D L     LS Q   A + E+  +Y     +G+ + +V   Y+   +  ++  +     + Q  P   ++  +ETLA+IAY  P +R  I  +R     +  +  L E   ++  GR E  G+P LY  T +F D FG+ SI++LP   L E  + +L   +E    D
  S:    11 KQIIEAAIFVAKKPLSLAALCRDVLAD-EDLSRQQVTAYISEISADYH---DKGIELVEVASGYRFQARSHLTPWLQR---MLQDKPAKYSRATLETLALIAYRQPVSRGDIEAVRGVAVSSQTIHMLEEREWIKVIGRKEVPGRPALYATTTQFLDYFGIKSIQELPP--LDEALLAKLAAMDEETLLD 191
>gi|121607090|ref|YP_994897.1| putative transcriptional regulator [Verminephrobacter eiseniae EF01-2] >gi|121551730|gb|ABM55879.1| condensin subunit ScpB [Verminephrobacter eiseniae EF01-2] (216 aa)
Score = 151, Expect = 1.4e-08, Identities = 45/165 (27%), Positives = 88/165 (53%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPM-LEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +++ K ++E AL I   + V   +L+ +    L     + +++E+  ++    QRG+ + +V   ++  ++P + + +       +K P   +  +ETLAI+AY  P TR  I ++R      + +++L + G VE  G  ++VG+P L+  T +F D  GL S+  LP
  S:     3 TVDAKRILETAL-ICAPQPVPLRELRVLFNDALGADTLKVLLQELQLDW---AQRGVELVQVASGWRFQSRPQMREYLDRLH--PEKPPRYTRATLETLAIMAYRQPVTRGDIEDIRGVAVNSLTIKQLEDRGWVEVIGHRDSVGRPALFATTRQFLDDLGLQSLDQLP 165
>gi|153869347|ref|ZP_01998983.1| conserved hypothetical protein [Beggiatoa sp. PS] >gi|152074134|gb|EDN71022.1| conserved hypothetical protein [Beggiatoa sp. PS] (369 aa)
Score = 150, Expect = 1.6e-08, Identities = 48/175 (27%), Positives = 90/175 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHK---DKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELT 179
           +KS++EAALF AG         +  +   R       AV++E+  +Y    + G+ + +V   Y+  TK D+   +      ++    ++ ++ET+AIIAY  P TR+ I ++R     T ++++LI+   +         G+P LY  T +F + F L ++ DLP ++  ++ I+  T
  S:    32 IKSILEAALFAAGKPLTMDHFVELFEENERPERSAIRAVLKELTADYT---EHGIELVQVASGYRFQTKQDLIPWLKR-LQPERSPRYSRALLETIAIIAYRQPITRADIEKIRGISVSTDLIKRLIDYNWIRVLAHRNTPGRPALYGTTREFLNYFNLKNLNDLPPLIELKEIIDAQT 206
>gi|127513175|ref|YP_001094372.1| putative transcriptional regulator [Shewanella loihica PV-4] >gi|126638470|gb|ABO24113.1| putative transcriptional regulator [Shewanella loihica PV-4] (210 aa)
Score = 150, Expect = 1.8e-08, Identities = 54/164 (32%), Positives = 90/164 (54%)
  Q:     5 VKSVIEAALFIAG--------NEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K +IEA+LF+          NE V  +   S+SR  V+   A +EE+  +Y+    RG+ + KV   Y+  +   +S  +   +  ++K P  ++  +ETLA+IAY  P TR+ I  +R     + +++ L +   ++  G  E  G+P LY  T +F   FGLD I DLP +
  S:    13 LKQLIEASLFVMARTVSIKHLNESVLANF--SVSRAKVK---AAIEELQQDYQG---RGIELVKVAGGYRFQSIETLSPYLQPLW--QEKAPRYSRATLETLAVIAYRQPVTRADIEFVRGVAVGSHIIKSLSDRHWIKIIGHKEVPGRPALYATTNEFLAYFGLDRIADLPPL 176
>gi|114798683|ref|YP_760744.1| segregation and condensation protein B [Hyphomonas neptunium ATCC 15444] >gi|114738857|gb|ABI76982.1| segregation and condensation protein B [Hyphomonas neptunium ATCC 15444] (339 aa)
Score = 149, Expect = 2.3e-08, Identities = 39/114 (34%), Positives = 63/114 (55%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +RG+ + +V   ++  T  D+S +      +++K  L Q  +ETL+IIAY  P TR++I  +R       +++ L+E G V   GR +  G P  Y  T KF + FGL+S+  LP
  S:    88 KRGVNLVEVAGKWRFQTAQDLSWLFVEERQVQKK--LGQAAMETLSIIAYGQPVTRAEIEAVRGVAVAKTVIDTLLETGWVRTRGRRKTPGLPICYGTTDKFLEHFGLESLDTLP 200
>gi|153886773|ref|ZP_02007927.1| putative transcriptional regulator [Ralstonia pickettii 12D] >gi|151576947|gb|EDN41349.1| putative transcriptional regulator [Ralstonia pickettii 12D] (389 aa)
Score = 149, Expect = 2.4e-08, Identities = 44/163 (26%), Positives = 88/163 (53%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           K V+E AL I   + +  + L+ +    +S      ++EE+  ++     RG+ +  +   ++L ++P++ ++       ++    ++ ++ETLAIIAY  P TR  I ++R  T  T +++++ + G +E  G  +  G+P LY  T +F D  GL S+ +LP +
  S:   119 KIVLETAL-ICAQDPLRVNDLRKLFDEDVSADTIRVLLEELRQDWL---NRGVELVALASGWRLQSRPEM-RVYLDRLHPEKPPKYSRAVMETLAIIAYRQPVTRGDIEDIRGVTVNTQVIKQIEDRGWIEVIGHRDVPGRPALYATTKQFLDDLGLRSLDELPPL 279
>gi|467154|gb|AAA50918.1| unknown [Mycobacterium leprae] (258 aa)
Score = 149, Expect = 2.6e-08, Identities = 48/172 (27%), Positives = 93/172 (54%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEY-EKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE-QKIEELT 179
           V+EA L +  +  V  + L + +   V    A +  M+ E+ E+D   G+ +R   E ++L+T+    P + +++  G     +  L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ E G     G   ++  T  F +  GL S+ +LP+I  +LP+   IE+++
  S:    58 VLEALLLVV-DTPVTVEALAAAAEQPVDRIAAKLRLMVNEFAERD--SGIDLRHSAEGWRLYTRARYAPYVERLLLDG----ARTKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEVGPEPDSGA-VMFATTELFLERLGLTSLAELPDIAPLLPDVDTIEDMS 229
>gi|30249691|ref|NP_841761.1| hypothetical protein NE1729 [Nitrosomonas europaea ATCC 19718] >gi|30180728|emb|CAD85640.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] (220 aa)
Score = 148, Expect = 2.7e-08, Identities = 40/133 (30%), Positives = 68/133 (51%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEI-GLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           D + + E +    EK    G+ +  V   ++  +KP++ ++       ++    ++ ++ETLAIIAY  P TR  I E+R    +  + K +E  G +E  G+ +  GKPYLY  T  F D   L S++ LP +
  S:    50 DKKTLHESLTILSEKWHDSGINLVSVAGGWRFQSKPEM-QVFLDRLNPQRPPRYSRAVMETLAIIAYRQPVTRGDIEEIRGVAVSTQIIKTLESRGWIETIGQRDIPGKPYLYATTRHFLDDLNLQSLEQLPSL 182
>gi|145589413|ref|YP_001156010.1| putative transcriptional regulator [Polynucleobacter sp. QLW-P1DMWA-1] >gi|145047819|gb|ABP34446.1| condensin subunit ScpB [Polynucleobacter sp. QLW-P1DMWA-1] (254 aa)
Score = 148, Expect = 2.9e-08, Identities = 52/173 (30%), Positives = 91/173 (52%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFE-AVMEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP--EIVLPEQKIEEL 178
           K VIEAAL  A       D    +SRL ++D   A ++E + E ++    RG+ +  +   ++  ++  + + +      ++    ++ ++ETLAIIAY  P TR +I E+R     + ++++L + G VE  G  E +G+P LY  T +F D   L +++ LP  E   P    E+L
  S:    14 KRVIEAALLCAQEPLTVAD----LSRLFIEDITTADIDEALVEIQRTWDDRGMELVHIATGWRFQSRLSMREYLDR-LTPEKPPKYSRAVMETLAIIAYRQPVTRGEIEEIRGVAVSSNVMKQLEDRGWVEVIGHKETIGRPGLYATTKQFLDDLSLTNLQSLPILEDAAPMAAAEQL 186
>gi|144899904|emb|CAM76768.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] (220 aa)
Score = 148, Expect = 3.0e-08, Identities = 51/161 (31%), Positives = 83/161 (51%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           V+EA LF +      +D ++ +   S  D  A++ E+  +Y     RG+ + +    +   T PD++  +       Q   L++  IE LAIIAYN P TR++I E+R    +   L+ L E G +   GR  + GKP  +  +  F D FGL+S++DLP +
  S:    12 VLEALLFASAQPLDERDLVEKLPPGS--DVLALLTELQNQYAG---RGVNLVRRDSKWAFRTAPDLAGQLV--IEQTQTRRLSRAAIEVLAIIAYNQPITRAEIEEVRGVALSKGTLDLLFEAGWIRPRGRRRSPGKPLQWGTSDGFLDHFGLESLEDLPSL 166
>gi|121997383|ref|YP_001002170.1| putative transcriptional regulator [Halorhodospira halophila SL1] >gi|121588788|gb|ABM61368.1| condensin subunit ScpB [Halorhodospira halophila SL1] (210 aa)
Score = 148, Expect = 3.0e-08, Identities = 49/165 (29%), Positives = 83/165 (50%)
  Q:    33 SVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIF---GLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           S  D    + E+  +Y+    RG+ +R+V   Y++    +++  V+    + ++ P   ++ ++ETLA+IAY  P TR +I ++R     T ++  L E G +   GR +  G+P +Y  T  F + F   GLD + DL  +  P+Q   EL         D    D GDE
  S:    37 SRDDIRRAVAELSADYQG---RGIEIREVAGGYRIQVGAEMAPWVSR---LWEERPARYSRAVLETLALIAYRQPITRGEIEQVRGVSVSTSIIRTLEERGWIRVVGRRDVPGRPAMYATTRGFLEHFNLRGLDQLPDLATLQDPDQAHLEL---------DLRLPDEGDE 192
>gi|34498842|ref|NP_903057.1| hypothetical protein CV_3387 [Chromobacterium violaceum ATCC 12472] >gi|34104694|gb|AAQ61051.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] (210 aa)
Score = 148, Expect = 3.4e-08, Identities = 53/173 (30%), Positives = 91/173 (52%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-----RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP------EIVLPEQKIEE 177
           +K V+E AL  A  E +   +LK   RL  +D +A +   I E   D Q     RG+ + K+   ++   + + +  + +    ++    ++ ++ETLAIIAY  P TR  I  +R     T +++ L+E G +E  G  +  G+P LY  T KF D     S+ DLP       +V+P+ + ++
  S:    10 LKIVLETALLTA-QEPLSVSQLK---RLFTEDVKAALINDILE---DIQGDWRGRGIELVKLASGWRFRARAEFTPYL-NRLNPEKPPRYSRAVMETLAIIAYKQPVTRGDIEAIRGVSVSTNVMQTLLERGWIEVIGHKDVPGRPGLYATTRKFLDDLSFVSLNDLPPLAELGSLVVPDPQTQD 186
>gi|118618583|ref|YP_906915.1| transcriptional regulator [Mycobacterium ulcerans Agy99] >gi|183982540|ref|YP_001850831.1| transcriptional regulator [Mycobacterium marinum M] >gi|118570693|gb|ABL05444.1| transcriptional regulator [Mycobacterium ulcerans Agy99] >gi|183175866|gb|ACC40976.1| transcriptional regulator [Mycobacterium marinum M] (235 aa)
Score = 148, Expect = 3.4e-08, Identities = 52/173 (30%), Positives = 92/173 (53%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEY-EKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE-QKIEELT 179
           SV+EA L +  +  V  + L ++    V    A +  M  E  E+D   G+ +R   E ++L+T+    P + K++  G     +  L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ E G  E  G    +  T  F +  GL S+ +LP+I  +LP+   IE+L+
  S:    34 SVLEALLLVI-DTPVTAETLATVIDQPVYRVAAKLRLMADELIERD--SGIDLRHNSEGWRLYTRSRFAPYVEKLLLDG----ARTKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEVGNDEDSGA-VTFATTELFLERLGLTSLTELPDIAPLLPDIDSIEDLS 206
>gi|77164553|ref|YP_343078.1| chromosome segregation and condensation protein ScpB [Nitrosococcus oceani ATCC 19707] >gi|76882867|gb|ABA57548.1| condensin subunit ScpB [Nitrosococcus oceani ATCC 19707] (222 aa)
Score = 148, Expect = 3.4e-08, Identities = 45/165 (27%), Positives = 91/165 (55%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFE-------AVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++K++IEA L +A         ++ +S+L  ++ +       +++EE+  ++     RG+ ++++   Y+   + ++S  + S    ++ +  ++  +ETLA+IAY  P TR +I E+R     + +++ L E   V   G  E  G+P LY  T KF D F L ++ +LP +
  S:     6 SLKNIIEAILLVADRPLT----IEQLSKLFDEEMQPSRSQIGSILEELAVDWR---NRGIELKEIHSGYRFQARRELSPWI-SRLWEERPSRYSRAFLETLALIAYRQPITRGEIEEIRGVSVSSSIMKTLQEREWVRVLGHREVPGRPALYGTTRKFLDQFNLRNLDELPSL 170
>gi|124267191|ref|YP_001021195.1| condensin subunit ScpB [Methylibium petroleiphilum PM1] >gi|124259966|gb|ABM94960.1| condensin subunit ScpB [Methylibium petroleiphilum PM1] (261 aa)
Score = 148, Expect = 3.4e-08, Identities = 46/165 (27%), Positives = 89/165 (53%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           + K V+E AL I   + +   +L+++   +L       +++E+  ++E    RG+ +  V   ++  ++P++ + +       +K P   +  +ETLAIIAY  P TR  I ++R  T  + +L++L + G +E  G  E  G+P L+  T +F D  GL +++ LP +
  S:     5 DAKRVLETAL-ICAQQPLPLRELRTLFDDQLGPDTLRVLLDELARDWE---DRGVELVAVANGWRFQSRPELREYLDRLH--PEKPPRYTRATLETLAIIAYRQPVTRGDIEDIRGVTVNSQLLKQLEDRGWIEAIGHRETPGRPALFATTRQFLDDLGLATLEQLPAL 167
>gi|111017943|ref|YP_700915.1| hypothetical protein RHA1_ro00926 [Rhodococcus sp. RHA1] >gi|110817473|gb|ABG92757.1| conserved hypothetical protein [Rhodococcus sp. RHA1] (230 aa)
Score = 147, Expect = 3.5e-08, Identities = 47/168 (27%), Positives = 87/168 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +++V+E+ L I  +     ++L S +  SV     V+  M  E       G+ +R  G+ ++L+T+    P + +++  G     ++ L +  +ETLA++AY  P TR++I  +R  +   ++  L+  GL+ EAG          Y  T  F +  GL S+ DLP +  +LP+
  S:    26 LEAVLESLLLIV-DSPAGAEQLASATGASVNRITDVLNRMSAELTARGS-GMDLRYAGDGWRLYTRTAYAPYVERLLLDG----ARSKLTRAALETLAVVAYRQPLTRARISAVRGVNVDGVVRTLLARGLIAEAGVDPDTNATQ-YSTTELFLERLGLASLADLPALAPLLPD 192
>gi|163841327|ref|YP_001625732.1| segregation and condensation protein [Renibacterium salmoninarum ATCC 33209] >gi|162954803|gb|ABY24318.1| segregation and condensation protein [Renibacterium salmoninarum ATCC 33209] (228 aa)
Score = 147, Expect = 3.7e-08, Identities = 39/138 (28%), Positives = 70/138 (50%)
  Q:    47 EYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEI 184
           ++++D Q RG  +R +   ++ +++ D + +V       Q   L Q  +ETLA+IAY  P +R++I  +R  +   ++  L + GL+ E       G   LY  T  F +  GL S+ +LP+I      +E L   +E+
  S:    86 DFDEDLQPRGFELRSIAGGWRFYSRSDFAPLVQRFVLEGQTARLTQAALETLAVIAYRQPVSRARISAIRGVNVDSVVRTLTQRGLITELETDPETGA-ILYGTTSYFLERLGLGSVDELPKIAPHLPGVENLEDFDEV 223
>gi|90416539|ref|ZP_01224470.1| hypothetical protein GB2207_05037 [marine gamma proteobacterium HTCC2207] >gi|90331738|gb|EAS46966.1| hypothetical protein GB2207_05037 [marine gamma proteobacterium HTCC2207] (278 aa)
Score = 147, Expect = 3.7e-08, Identities = 49/164 (29%), Positives = 84/164 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +K ++E AL  AG   +   +++S+     R      +A +EE+    E D + RG  +++    Y+   + D+++ V   +  K K   ++ M+ETLA+IAY  P TR  I ++R     + ++  L E   V   G  +  GKP LY  T  F D F + S++ LP +
  S:     6 IKRIVEGALLAAGKP-MDVARIESLFDEDERPPRDQIKAALEEV----EADCRGRGFELKQTASGYRFQVRQDLAEWVNRLWTEKPKR-YSRAMLETLALIAYRQPLTRGDIEQVRGVAVSSDIIRTLQERDWVRVVGFRDVPGKPALYATTKNFLDYFNIKSLEQLPAL 169
>gi|108799896|ref|YP_640093.1| condensin subunit ScpB [Mycobacterium sp. MCS] >gi|119869006|ref|YP_938958.1| condensin subunit ScpB [Mycobacterium sp. KMS] >gi|108770315|gb|ABG09037.1| condensin subunit ScpB [Mycobacterium sp. MCS] >gi|119695095|gb|ABL92168.1| condensin subunit ScpB [Mycobacterium sp. KMS] (231 aa)
Score = 147, Expect = 3.8e-08, Identities = 43/168 (25%), Positives = 87/168 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +++V+EA L +        D+L  ++         ++ EM  +       G+ +R+ G  ++++T+    P + +++  G     ++ L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ EAG     G    +  T  F +  GL S+ DLP+I  +LP+
  S:    25 LRNVLEALLLVVDTPAT-VDQLAEVTDQPGYRIATMLTEMAADLAAR-DSGIDLREAGGGWRMYTRSRYAPYVERLLLDG----ARSKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEAGTDPDSGA-VTFATTGLFLERLGLSSLADLPDIAPLLPD 191
>gi|126435524|ref|YP_001071215.1| condensin subunit ScpB [Mycobacterium sp. JLS] >gi|126235324|gb|ABN98724.1| condensin subunit ScpB [Mycobacterium sp. JLS] (231 aa)
Score = 147, Expect = 4.0e-08, Identities = 43/168 (25%), Positives = 87/168 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +++V+EA L +        D+L  ++         ++ EM  +       G+ +R+ G  ++++T+    P + +++  G     ++ L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ EAG     G    +  T  F +  GL S+ DLP+I  +LP+
  S:    25 LRNVLEALLLVVDTPAT-VDQLAEVTDQPGYRIATMLTEMAADLAAR-DSGIDLREAGGGWRMYTRSRYAPYVERLLLDG----ARSKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEAGTDPDSGA-VTFATTELFLERLGLSSLADLPDIAPLLPD 191
>gi|56478941|ref|YP_160530.1| putative transcriptional regulator,helix-turn-helix type [Azoarcus sp. EbN1] >gi|56314984|emb|CAI09629.1| putative transcriptional regulator,helix-turn-helix type [Azoarcus sp. EbN1] (197 aa)
Score = 147, Expect = 4.3e-08, Identities = 37/120 (30%), Positives = 66/120 (55%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEI-GLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQ 173
           RG  + +V   ++  T+P+    +     +KQ+ P   ++ ++ETL+IIAY  P TR  I ++R    +P + K +E  G ++  G  +  G+P L+  T +F D  GL S+ +LP +   E+
  S:    56 RGAELVQVASGWRFQTRPEYQVFLDR---LKQEKPPRYSRAVLETLSIIAYRQPVTRGDIEDIRGVAVSPNVLKTLESRGWIDIVGHRDTPGRPALFATTRRFLDDLGLRSLTELPALTEIER 175
>gi|113868285|ref|YP_726774.1| putative transcriptional regulator (Ypuh-like) [Ralstonia eutropha H16] >gi|113527061|emb|CAJ93406.1| putative transcriptional regulator (Ypuh-like) [Ralstonia eutropha H16] (284 aa)
Score = 146, Expect = 4.9e-08, Identities = 42/144 (29%), Positives = 78/144 (54%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEE-INFFD--TNREDNGDE 197
           RG+ +  +   ++  ++P++ + +      ++    ++ ++ETLAIIAY  P TR  I E+R  T  T +++KL +   +E  G  +  G+P LY  T  F D  GL ++ +LP +   + + +    E++ INF D   N+  + DE
  S:    53 RGVELVALASGWRFQSRPEMREYLDR-LNPEKPPKYSRAVMETLAIIAYRQPVTRGDIEEIRGVTVSTEVIKKLEDRSWIEVIGHRDVPGRPALYATTKAFLDDLGLRTLDELPPLEDAQAQAQATLLEQQAINFEDLAANKAASADE 199
>gi|74317275|ref|YP_315015.1| condensin subunit ScpB [Thiobacillus denitrificans ATCC 25259] >gi|74056770|gb|AAZ97210.1| Predicted transcriptional regulator [Thiobacillus denitrificans ATCC 25259] (221 aa)
Score = 146, Expect = 5.0e-08, Identities = 53/193 (27%), Positives = 99/193 (51%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGD 196
           ++K V+EAAL +A  E +   +LK +    LS +     ++E+   +     RG+ + +V + ++  T+ ++   ++    +K + P   ++ ++ETLAIIAY  P TR  I ++R     P +++ L E G +E  G  +  G+P L+  T  F    GL ++ +LP    P +++  L   +E       RE+  D
  S:    11 DLKVVLEAAL-LAAIEPLTPAELKRMFEHELSNETLRRALDELRAAWHG---RGVELIQVADGWRFQTRAEMQPWLSR---LKNEKPPRYSRAVLETLAIIAYRQPVTRGDIEDVRGVAVNPNIIKALEERGWIEAIGHRDVPGRPALFGTTGHFLSDLGLRTLSELP----PLEELGTLVTPDETALIPELREELQD 197
>gi|71083666|ref|YP_266386.1| segregation and condensation protein b [Candidatus Pelagibacter ubique HTCC1062] >gi|71062779|gb|AAZ21782.1| segregation and condensation protein b [Candidatus Pelagibacter ubique HTCC1062] (233 aa)
Score = 146, Expect = 5.1e-08, Identities = 38/115 (33%), Positives = 63/115 (54%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ +  +   +   T  ++S +++    +++K  L++  +ETLAII Y+ P TR++I E+R     T  LE L+E+  V+  GR +  GKP  Y  T  F   F L  + DLP +
  S:    66 RGINLVCISNKWSFRTSENLSNLMSQEKTVEKK--LSRAAVETLAIIVYHQPVTRAEIEEIRGVAFGTNTLEILMELNWVKPQGRKDVPGKPIQYGTTDDFLSHFSLQKLSDLPTV 179
>gi|91763293|ref|ZP_01265257.1| segregation and condensation protein b [Candidatus Pelagibacter ubique HTCC1002] >gi|91717706|gb|EAS84357.1| segregation and condensation protein b [Candidatus Pelagibacter ubique HTCC1002] (233 aa)
Score = 146, Expect = 5.2e-08, Identities = 38/115 (33%), Positives = 63/115 (54%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ +  +   +   T  ++S +++    +++K  L++  +ETLAII Y+ P TR++I E+R     T  LE L+E+  V+  GR +  GKP  Y  T  F   F L  + DLP +
  S:    66 RGINLVCISNKWSFRTSENLSNLMSQEKTVEKK--LSRAAVETLAIIVYHQPVTRAEIEEIRGVAFGTNTLEILMELNWVKPQGRKDVPGKPIQYGTTDDFLSHFSLQKLSDLPTV 179
>gi|118471424|ref|YP_888040.1| transcriptional regulator [Mycobacterium smegmatis str. MC2 155] >gi|118172711|gb|ABK73607.1| transcriptional regulator [Mycobacterium smegmatis str. MC2 155] (276 aa)
Score = 146, Expect = 5.3e-08, Identities = 51/191 (26%), Positives = 92/191 (48%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEY-EKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPEQKIEELTYEEEINFFDTNREDNGDE 197
           +V+EA L +  +  V  D L S +        A +  M  +  E+D   G+ +R+ G  ++++T+   +  V        +  L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ EAG     G    +  T  F +  GL S++DLP+I  +LP           +++  D   E+ GDE
  S:    74 AVLEALLLVV-DTPVTIDALASATEQPGYRIAAKLAAMAQDLAERD--SGIDLREAGGGWRMYTRAKYAPYVERLLLDGARTKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEAGTDPDTGAT-TFATTDLFLERLGLTSLEDLPDIAPLLP-----------DVDVIDDLSENLGDE 252
>gi|161524932|ref|YP_001579944.1| segregation and condensation protein B [Burkholderia multivorans ATCC 17616] >gi|189350318|ref|YP_001945946.1| segregation and condensation protein B [Burkholderia multivorans ATCC 17616] >gi|160342361|gb|ABX15447.1| segregation and condensation protein B [Burkholderia multivorans ATCC 17616] >gi|189334340|dbj|BAG43410.1| segregation and condensation protein B [Burkholderia multivorans ATCC 17616] (349 aa)
Score = 146, Expect = 5.4e-08, Identities = 34/87 (39%), Positives = 51/87 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE 176
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L +   +E  G  +  G+P LY  T +F D  GL ++ DLP +  P   IE
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRNWIEVIGHRDVPGRPALYATTKQFLDDLGLKALDDLPALEEPAANIE 175
>gi|73541720|ref|YP_296240.1| condensin subunit ScpB [Ralstonia eutropha JMP134] >gi|72119133|gb|AAZ61396.1| condensin subunit ScpB [Ralstonia eutropha JMP134] (311 aa)
Score = 146, Expect = 5.4e-08, Identities = 48/163 (29%), Positives = 87/163 (53%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEA-VMEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           K V+E AL I   E +   ++  + RL  +D  A  +  ++ E  +D  QRG+ +  +   ++  ++P++ + +      ++    ++ ++ETLAIIAY  P TR  I E+R  T  T +++KL +   +E  G  +  G+P LY  T  F D  GL ++ +LP +
  S:    26 KIVLETAL-ICAQEPL---RVGDLRRLFAEDVGADTIRVLLDELRQDWRQRGVELVALASGWRFQSRPEMREYLDR-LNPEKPPKYSRAVMETLAIIAYRQPVTRGDIEEIRGVTVSTEVIKKLEDRSWIEVIGHRDVPGRPALYATTKAFLDDLGLRTLDELPPL 186
>gi|114776454|ref|ZP_01451499.1| segregation and condensation protein B [Mariprofundus ferrooxydans PV-1] >gi|114553284|gb|EAU55682.1| segregation and condensation protein B [Mariprofundus ferrooxydans PV-1] (188 aa)
Score = 146, Expect = 5.6e-08, Identities = 41/129 (31%), Positives = 72/129 (55%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPT-PMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPEQKIEELTYE 181
           QRG+ + +V   ++  T    ++ V   + ++    L++  +ETLAIIAY  P TR++I  LR    +  ++  L E   ++  GR +  G+P+LY    +F   F L+S+ DLPE   +L E +I++L  +
  S:    50 QRGIHLIQVAGGWQFRTADTHAEYVQRLWQVRPAR-LSRSALETLAIIAYRQPTTRAEIEALRGVKTSGSIIATLQEREWIKVLGRKDVPGRPHLYGTGRQFLVDFNLNSLDDLPEASQLLDEDEIQQLVSQ 180
>gi|15827714|ref|NP_301977.1| hypothetical protein ML1369 [Mycobacterium leprae TN] >gi|2065215|emb|CAB08280.1| hypothetical protein MLC1351.04c [Mycobacterium leprae] >gi|13093265|emb|CAC31750.1| conserved hypothetical protein [Mycobacterium leprae] (231 aa)
Score = 145, Expect = 6.0e-08, Identities = 48/172 (27%), Positives = 93/172 (54%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEY-EKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE-QKIEELT 179
           V+EA L +  +  V  + L + +   V    A +  M+ E+ E+D   G+ +R   E ++L+T+    P + +++  G     +  L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ E G     G   ++  T  F +  GL S+ +LP+I  +LP+   IE+++
  S:    31 VLEALLLVV-DTPVTVEALAAAAEQPVDRIAAKLRLMVNEFAERD--SGIDLRHSAEGWRLYTRARYAPYVERLLLDG----ARTKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEVGPEPDSGA-VMFATTELFLERLGLTSLAELPDIAPLLPDVDTIEDMS 202
>gi|90021366|ref|YP_527193.1| condensin subunit ScpB [Saccharophagus degradans 2-40] >gi|89950966|gb|ABD80981.1| condensin subunit ScpB [Saccharophagus degradans 2-40] (352 aa)
Score = 145, Expect = 6.4e-08, Identities = 51/183 (27%), Positives = 100/183 (54%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQ-DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP---EIVLPEQKIEELTYEEEI 184
           +I ++++IE A+  AG E +  D++ S+   + Q + + + + ++   EK+  RG  + +V   ++     DI+  V   +  K +   ++ ++ETLA++AY  P TR  I ++R     + +++ L+E   V+  G  +  G+P LY  T +F D F L S+ +LP   E+   +   E+L +EE +
  S:     5 NIQLQNIIEGAILAAG-EALSIDRILSLFDENEQPEKDDIKQALLAIQEKNAGRGFELVEVASGWRFQVVEDIAMWVNRLWDEKPQK-YSRALLETLALVAYRQPITRGDIEDVRGVAVSSHIIKTLVEREWVKVVGHRDVPGRPALYATTRQFLDYFNLKSLDELPTLGELKDIDGLNEDLAFEEAV 190
>gi|187923620|ref|YP_001895262.1| segregation and condensation protein B [Burkholderia phytofirmans PsJN] >gi|187714814|gb|ACD16038.1| segregation and condensation protein B [Burkholderia phytofirmans PsJN] (394 aa)
Score = 145, Expect = 6.6e-08, Identities = 36/99 (36%), Positives = 58/99 (58%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFD 188
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L + G +E  G  +  G+P LY  T +F D  GL ++ +LP +  P  ++  +L  +  I F D
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRGWIEVIGHRDVPGRPALYATTRQFLDDLGLTALDELPPLADPSAQLNADLLGQHAIEFAD 188
>gi|121604768|ref|YP_982097.1| putative transcriptional regulator [Polaromonas naphthalenivorans CJ2] >gi|120593737|gb|ABM37176.1| condensin subunit ScpB [Polaromonas naphthalenivorans CJ2] (221 aa)
Score = 145, Expect = 6.6e-08, Identities = 36/115 (31%), Positives = 67/115 (58%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ +  V   ++  ++P++ + +     ++ + P   ++  +ETLAIIAY  P TR  + ++R  T  + +L++L + G +E  G  E VG+P LY  T +F D  G++S+  LP +
  S:    53 RGVELVHVASGWRFQSRPEMREHLNR---LQPEKPPRYSRATLETLAIIAYRQPVTRGDMEDIRGVTINSLLLKQLEDRGWIEVIGHRETVGRPALYATTRQFLDDLGVESLAGLPAM 167
>gi|158431537|pdb|2Z99|A Chain A, Crystal Structure Of Scpb From Mycobacterium Tuberculosis (219 aa)
Score = 145, Expect = 6.8e-08, Identities = 46/168 (27%), Positives = 85/168 (50%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +K V+EA L +  +  V  D L + +   V    A ++ M  E       G+ +R   E ++++T+    P + K++  G     +  L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ E G     G    +  T  F +  GL S+ +LP+I  +LP+
  S:    16 LKRVLEALLLVI-DTPVTADALAAATEQPVYRVAAKLQLMADELTGR-DSGIDLRHTSEGWRMYTRARFAPYVEKLLLDG----ARTKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEVGTDADTGA-VTFATTELFLERLGLTSLSELPDIAPLLPD 182
>gi|68535953|ref|YP_250658.1| segregation and condensation protein B [Corynebacterium jeikeium K411] >gi|68263552|emb|CAI37040.1| segregation and condensation protein B [Corynebacterium jeikeium K411] (198 aa)
Score = 145, Expect = 6.9e-08, Identities = 40/132 (30%), Positives = 72/132 (54%)
  Q:    41 MEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           + E+  EYE     G  +R+    ++L+T+   S +V +      +  L++  +ETLA++AY  P TRSQ+  +R  +   ++  L   GL+ E G     G  +LY  T  F +  G++S+++LP++  +LPE
  S:    57 LHEIAAEYEARGN-GFELREHEGAFRLYTRRANSDVVEAKLLDGTQQRLSRAALETLAVVAYRQPVTRSQVAAVRGVNCDGVMRTLSLRGLIAETGEQ---GGAHLYSTTELFLEQIGIESLEELPDLAPLLPE 186
>gi|145224080|ref|YP_001134758.1| putative transcriptional regulator [Mycobacterium gilvum PYR-GCK] >gi|145216566|gb|ABP45970.1| condensin subunit ScpB [Mycobacterium gilvum PYR-GCK] (243 aa)
Score = 145, Expect = 7.5e-08, Identities = 51/186 (27%), Positives = 97/186 (52%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE-QKIEEL--TYEEEINFFDTN 190
           + SV+EA L +  +  V  D L  ++        A ++ +   Y      G+ +R+    ++++T+    P + K++  G     ++ L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ EAG ++A      +  T  F +  GL S+ DLP+I  +LP+   I++L  T  +E  F   N
  S:    40 LDSVLEALLLVV-DTPVTVDTLAGVTDAPSARVAARLQVLADGYAAR-DSGIDLREAAGGWRMYTRSRYAPYVEKLLLDG----ARSKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLMARGLITEAG-TDADSGAVTFATTELFLERLGLTSLTDLPDIAPLLPDVDVIDDLSETLSDEPRFMKLN 227
>gi|103486630|ref|YP_616191.1| putative transcriptional regulator [Sphingopyxis alaskensis RB2256] >gi|98976707|gb|ABF52858.1| condensin subunit ScpB [Sphingopyxis alaskensis RB2256] (197 aa)
Score = 144, Expect = 8.0e-08, Identities = 32/80 (40%), Positives = 47/80 (58%)
  Q:    89 LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           L++   E LAI+AY+ P +R++I  +R    +   L+ L+E   +  AGR E  G+P +Y+ T  F   FGL S KDLP I
  S:    85 LSRAAAEVLAIVAYHEPVSRAEIEAIRGVQTSKGTLDVLMEAEWIAPAGRREVPGRPLIYKTTDTFLQHFGLSSRKDLPGI 165
>gi|126640867|ref|YP_001083851.1| hypothetical protein A1S_0811 [Acinetobacter baumannii ATCC 17978] >gi|169634121|ref|YP_001707857.1| hypothetical protein ABSDF2648 [Acinetobacter baumannii SDF] >gi|169796998|ref|YP_001714791.1| hypothetical protein ABAYE2999 [Acinetobacter baumannii AYE] >gi|184157089|ref|YP_001845428.1| transcription regulator [Acinetobacter baumannii ACICU] >gi|126386751|gb|ABO11249.1| hypothetical protein A1S_0811 [Acinetobacter baumannii ATCC 17978] >gi|169149925|emb|CAM87819.1| conserved hypothetical protein [Acinetobacter baumannii] >gi|169152913|emb|CAP01954.1| conserved hypothetical protein [Acinetobacter baumannii] >gi|183208683|gb|ACC56081.1| predicted transcriptional regulator containing the HTH domain [Acinetobacter baumannii ACICU] (198 aa)
Score = 144, Expect = 8.4e-08, Identities = 30/80 (37%), Positives = 51/80 (63%)
  Q:    89 LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           L+  ++ETLA+IAY+ P TR+ I ++R  ++ + +L  L +   ++EAG  +  G+P L   TP+F + FGL S+  LP +
  S:   101 LSPSLLETLAVIAYHQPVTRADIEQIRGVSNNSQILRTLFDWNWIKEAGFRDLPGRPALLITTPQFLNAFGLASLGQLPPL 181
>gi|23465934|ref|NP_696537.1| hypothetical protein BL1372 [Bifidobacterium longum NCC2705] >gi|23326644|gb|AAN25173.1| hypothetical protein BL1372 [Bifidobacterium longum NCC2705] (238 aa)
Score = 144, Expect = 8.4e-08, Identities = 45/173 (26%), Positives = 83/173 (47%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGL-----VVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELT 179
           + +EA L +A ++     +L  I  L     E  ++ +  +YE D  RG+      +R+    ++  ++     +V+S     Q   L+Q  +E LAI+AY  P TR+Q+  +R  +   ++  L   GL++E G  +   +  L   +  F D  GL S+ +LP +      + E+T
  S:    52 ACLEAILMVA-DQPQTATELARILALDRNTVEEALQALHDDYEGDESRGVRPRGFELRRTARGWQFASRAAFEPVVSSFVTDGQTARLSQAALEALAIVAYRQPVTRAQVAAIRGVNSDGVIRSLTVRGLIKEDG-VDPESRAALLVTSEFFLDQMGLKSLDELPSLAPFLPSVAEMT 227
>gi|120554088|ref|YP_958439.1| putative transcriptional regulator [Marinobacter aquaeolei VT8] >gi|120323937|gb|ABM18252.1| condensin subunit ScpB [Marinobacter aquaeolei VT8] (221 aa)
Score = 144, Expect = 9.8e-08, Identities = 46/157 (29%), Positives = 80/157 (50%)
  Q:    40 VMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGD 196
           VME  +   E+  + RG  + KV   Y+L  + + +  V   +  K +   ++ ++ETLA+IAY  P TR +I ++R  T  + ++  L+E   V   G  +  G+P +Y  T +F D F L  + +LP +    + +EE+  E E N     + D+ D
  S:    43 VMEHALMMLEQSCEGRGFELSKVASGYRLQVREEFAPWVGRLYEEKPQR-YSRALLETLALIAYRQPITRGEIEDIRGVTVSSNIIRTLLEREWVRVVGHRDVPGRPAMYATTRQFLDYFNLTGLDELPPLS-EVRDLEEIGREIEQNMQGEIKFDSPD 199
>gi|46191024|ref|ZP_00120634.2| COG1386: Predicted transcriptional regulator containing the HTH domain [Bifidobacterium longum DJO10A] (225 aa)
Score = 143, Expect = 1.0e-07, Identities = 45/173 (26%), Positives = 83/173 (47%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGL-----VVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELT 179
           + +EA L +A ++     +L  I  L     E  ++ +  +YE D  RG+      +R+    ++  ++     +V+S     Q   L+Q  +E LAI+AY  P TR+Q+  +R  +   ++  L   GL++E G  +   +  L   +  F D  GL S+ +LP +      + E+T
  S:    39 ACLEAILMVA-DQPQTATELARILALDRNTVEEALQALHDDYEGDESRGIRPRGFELRRTARGWQFASRAAFEPVVSSFVTDGQTARLSQAALEALAIVAYRQPVTRAQVAAIRGVNSDGVIRSLTVRGLIKEDG-VDPESRAALLVTSEFFLDQMGLKSLDELPSLAPFLPSVAEMT 214
>gi|94310973|ref|YP_584183.1| condensin subunit ScpB [Ralstonia metallidurans CH34] >gi|93354825|gb|ABF08914.1| condensin subunit ScpB [Ralstonia metallidurans CH34] (302 aa)
Score = 143, Expect = 1.1e-07, Identities = 46/163 (28%), Positives = 85/163 (52%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           K V+E AL I   E +    L+ +    +       ++EE+  +++   QRG+ +  +   ++  ++P++ + +      ++    ++ ++ETLAIIAY  P TR  I E+R  T  T +++KL +   +E  G  +  G+P LY  T  F D  GL S+ +LP +
  S:     7 KIVLETAL-ICAQEPLRVGDLRRLFADDVGADTIRVLLEELRNDWQ---QRGVELVALASGWRFQSRPEMREFLDR-LNPEKPPKYSRAVMETLAIIAYRQPVTRGDIEEIRGVTVSTEVVKKLEDRDWIEVIGHRDVPGRPALYATTKAFLDDLGLRSLDELPPL 167
>gi|15608848|ref|NP_216226.1| hypothetical protein Rv1710 [Mycobacterium tuberculosis H37Rv] >gi|15841170|ref|NP_336207.1| hypothetical protein MT1751 [Mycobacterium tuberculosis CDC1551] >gi|31792897|ref|NP_855390.1| hypothetical protein Mb1737 [Mycobacterium bovis AF2122/97] >gi|121637618|ref|YP_977841.1| hypothetical protein BCG_1749 [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148661508|ref|YP_001283031.1| hypothetical protein MRA_1720 [Mycobacterium tuberculosis H37Ra] >gi|148822916|ref|YP_001287670.1| hypothetical protein TBFG_11725 [Mycobacterium tuberculosis F11] >gi|167967186|ref|ZP_02549463.1| hypothetical protein MtubH3_03742 [Mycobacterium tuberculosis H37Ra] >gi|194543958|ref|YP_002078987.1| conserved hypothetical protein [Mycobacterium tuberculosis C] >gi|2326753|emb|CAB10967.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv] >gi|13881391|gb|AAK46021.1| segregation and condensation protein B [Mycobacterium tuberculosis CDC1551] >gi|31618488|emb|CAD94440.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] >gi|121493265|emb|CAL71736.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|124600965|gb|EAY59975.1| conserved hypothetical protein [Mycobacterium tuberculosis C] >gi|134150063|gb|EBA42108.1| conserved hypothetical protein [Mycobacterium tuberculosis str. Haarlem] >gi|148505660|gb|ABQ73469.1| conserved hypothetical protein [Mycobacterium tuberculosis H37Ra] >gi|148721443|gb|ABR06068.1| conserved hypothetical protein [Mycobacterium tuberculosis F11] (231 aa)
Score = 143, Expect = 1.1e-07, Identities = 46/168 (27%), Positives = 85/168 (50%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE 172
           +K V+EA L +  +  V  D L + +   V    A ++ M  E       G+ +R   E ++++T+    P + K++  G     +  L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ E G     G    +  T  F +  GL S+ +LP+I  +LP+
  S:    28 LKRVLEALLLVI-DTPVTADALAAATEQPVYRVAAKLQLMADELTGR-DSGIDLRHTSEGWRMYTRARFAPYVEKLLLDG----ARTKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRTLLARGLITEVGTDADTGA-VTFATTELFLERLGLTSLSELPDIAPLLPD 194
>gi|84687538|ref|ZP_01015414.1| segregation and condensation protein B [Rhodobacterales bacterium HTCC2654] >gi|84664447|gb|EAQ10935.1| segregation and condensation protein B [Rhodobacterales bacterium HTCC2654] (216 aa)
Score = 143, Expect = 1.2e-07, Identities = 33/78 (42%), Positives = 50/78 (64%)
  Q:    89 LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           L++  IETLAIIAY+ P TR++I E+R    +   +++LIE+  +    R  + G+P  + VT  F D FGL+S +DLP
  S:   100 LSRAAIETLAIIAYHQPVTRAEIEEIRGVSVSRGTIDQLIEMEWIRFGRRRMSPGRPVTFVVTQGFLDHFGLESARDLP 178
>gi|27379863|ref|NP_771392.1| hypothetical protein bll4752 [Bradyrhizobium japonicum USDA 110] >gi|27353016|dbj|BAC50017.1| bll4752 [Bradyrhizobium japonicum USDA 110] (257 aa)
Score = 143, Expect = 1.2e-07, Identities = 39/131 (29%), Positives = 69/131 (52%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D +A +E++  +Y     RG+ + +V   +   T  D++ ++       +   L++  IE LAIIAY+ P TR++I E+R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+ + DLP
  S:    61 DVKAALEQLQADY---ASRGVNLVRVANKWTFRTAGDLAWLMTRES--TETRRLSRAAIEVLAIIAYHQPVTRAEIEEIRGVVTSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTEDFLSQFTLEQLGDLP 187
>gi|91782985|ref|YP_558191.1| condensin subunit ScpB [Burkholderia xenovorans LB400] >gi|91686939|gb|ABE30139.1| condensin subunit ScpB [Burkholderia xenovorans LB400] (408 aa)
Score = 142, Expect = 1.3e-07, Identities = 35/101 (34%), Positives = 58/101 (57%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEINFFDTN 190
           ++ ++ETLAIIAY  P TR  I E+R  T  T ++++L +   +E  G  +  G+P LY  T +F D  GL ++ +LP +  P  ++  +L  +  I F D +
  S:    88 SRAVLETLAIIAYRQPVTRGDIEEIRGVTVNTQVVKQLEDRNWIEVIGHRDVPGRPALYATTRQFLDDLGLKALDELPPLADPSAQLNADLLGQHAIEFADAD 190
>gi|57641897|ref|YP_184375.1| YpuH-like family transcriptional regulator [Thermococcus kodakarensis KOD1] >gi|57160221|dbj|BAD86151.1| predicted transcription regulator, YpuH-like family [Thermococcus kodakarensis KOD1] (194 aa)
Score = 142, Expect = 1.3e-07, Identities = 47/154 (30%), Positives = 83/154 (53%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           K+++EAALF+AG     K+  K++   S++  E ++E +  EY +      VVR + + Y +  K + S+ V     +  K  L  G ++TLA+IAY  P  +S+I +LR +     +++L+E+GLV     +E   +  L   T KF +++G 
  S:     7 KALVEAALFVAGRPLSLKELSKALGIKSLEYLEKLIELIAAEYAERKSAIEVVRVLEDKYVMQVKQEYSQRV---IHLMPKPDLRTGELKTLALIAYLQPVEQSKIIKLRGSQAYEHIKRLVEMGLV----YAEPYERTKLLGTTKKFAELYGF 153
>gi|90424012|ref|YP_532382.1| putative transcriptional regulator [Rhodopseudomonas palustris BisB18] >gi|90106026|gb|ABD88063.1| condensin subunit ScpB [Rhodopseudomonas palustris BisB18] (256 aa)
Score = 142, Expect = 1.3e-07, Identities = 39/131 (29%), Positives = 69/131 (52%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D +A + ++  +Y     RG+ + +V   +   T  D++ ++       +   L++  IE LAIIAY+ P TR++I ++R    +   L+ L+E G V+  GR +  G+P  +  T  F   F L+S+ DLP
  S:    70 DVKAALLQLQADY---AHRGVNLVRVANKWTFRTAGDLAWLMTRE--STETRRLSRAAIEMLAIIAYHQPVTRAEIEDIRGVVTSKGTLDVLLETGWVKPRGRRKTPGRPLTFGTTEAFLSQFSLESLGDLP 196
>gi|163750231|ref|ZP_02157473.1| hypothetical protein KT99_10233 [Shewanella benthica KT99] >gi|161330087|gb|EDQ01071.1| hypothetical protein KT99_10233 [Shewanella benthica KT99] (216 aa)
Score = 142, Expect = 1.4e-07, Identities = 50/168 (29%), Positives = 81/168 (48%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPE 172
           +K +IEA+LF+ G + V    LK    +S       ++  I E ++D Q RG+ +  V   Y+  T   +S  +   +  K     ++  +ETLA+IAY  P TR  I  +R     +  ++ L +   ++  G  E  G+P LY  T  F   FGL+ + DLP +   E
  S:    16 LKQLIEASLFVLG-KMVSIKSLKETVLVSFSVTRVKIKAAIEELQQDYQGRGVELVSVAGGYRFQTIEALSPYLQPLWQEKAAK-YSRATLETLAVIAYRQPVTRGDIEFVRGVAVSSHTIKSLTDRQWIKTVGHKEVPGRPALYATTTDFLAYFGLERLADLPPLTDTE 183
>gi|91773462|ref|YP_566154.1| condensin subunit ScpB [Methanococcoides burtonii DSM 6242] >gi|91712477|gb|ABE52404.1| condensin subunit ScpB [Methanococcoides burtonii DSM 6242] (367 aa)
Score = 142, Expect = 1.4e-07, Identities = 48/177 (27%), Positives = 90/177 (50%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEE 182
           + +IEA LF AG E V    L  +   S ++   V+  ++ EY    + G+ +  +G  Y +  KP  + +++     + K P+    + TL+++AY+ P  +S++ ++R       + +L + G +E        G+  L Q TP F D FGLD  ++ PE +  ++KI EL+ ++
  S:     4 REIIEAVLFAAG-EAVDTQTLAKLINKSAKNVTPVIRSLMEEYSTR-ESGMEIIDLGGRYVMQVKPKYTDVISPIAPKELKAPI----LRTLSMVAYHQPVVQSELVDMRGNSVYDHIRELKDRGFIEAVPH----GRTKLLQTTPLFADYFGLD--RNEPESI--KKKIVELSRQQ 166
>gi|94984866|ref|YP_604230.1| putative transcriptional regulator [Deinococcus geothermalis DSM 11300] >gi|94555147|gb|ABF45061.1| putative transcriptional regulator [Deinococcus geothermalis DSM 11300] (176 aa)
Score = 142, Expect = 1.4e-07, Identities = 33/74 (44%), Positives = 46/74 (62%)
  Q:    95 ETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           E LA+IAY  P TR++I  +R      ++  L E  LV+  GRS+AVG+P LY  T +F   FGL S++DLP +
  S:    93 EVLAVIAYRQPITRAEIEAMRGGSAGTVV-TLQERELVKVVGRSDAVGQPLLYGTTERFLLEFGLTSLEDLPPL 165
>gi|126729737|ref|ZP_01745550.1| Predicted transcriptional regulator containing the HTH domain [Sagittula stellata E-37] >gi|126709856|gb|EBA08909.1| Predicted transcriptional regulator containing the HTH domain [Sagittula stellata E-37] (229 aa)
Score = 142, Expect = 1.5e-07, Identities = 35/102 (34%), Positives = 59/102 (57%)
  Q:    65 YKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           + + T PD+  ++     + +   L++  +ETLAIIAY+ P TR++I E+R    +   +++LIE+  +    R    G+P  + VT  F D FGL+S +DLP
  S:    87 WAMRTAPDLGYLMQRE--MVETRKLSRAAVETLAIIAYHQPVTRAEIEEIRGVAVSRGTVDQLIEMDWIRFGRRRMTPGRPVTFVVTQGFLDHFGLESARDLP 187
>gi|50954352|ref|YP_061640.1| hypothetical protein Lxx05700 [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950834|gb|AAT88535.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str. CTCB07] (204 aa)
Score = 142, Expect = 1.5e-07, Identities = 36/116 (31%), Positives = 64/116 (55%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RG  +R+VG  ++++ + +   +V SG+ ++Q  P L+Q  +ETLA+IAY  P +R  I  +R  +   ++  L+  GL+ E       G    Y  T       G++SI++LP+I
  S:    75 RRGFELREVGGGWRVYVRAEFDAVV-SGYVLQQNPPRLSQAALETLAVIAYKQPISRGAIASIRAVNVDSVVRTLLGRGLITELFADSDTGA-INYGTTDLLLTQLGVNSIEELPKI 189
>gi|114570460|ref|YP_757140.1| condensin subunit ScpB [Maricaulis maris MCS10] >gi|114340922|gb|ABI66202.1| condensin subunit ScpB [Maricaulis maris MCS10] (269 aa)
Score = 142, Expect = 1.6e-07, Identities = 54/159 (33%), Positives = 91/159 (57%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQ-DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQK-NPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPT-PMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++EA LF A  E + ++ L  I RL ++ + + ++ ++  EY    +RG+ + +VG  ++  T PD++ ++     +KQ+   L+Q  +ETL+IIAY+ P TR++I E+R    +   L+ L E+  V   GR    G+P  Y  T  F + F L SI DLP
  S:    57 ILEALLFAAA-EPLDEETL--IGRLPLEANIQDLLGKLRDEY---AERGVHLSEVGGRWRFETAPDLADVLVE---VKQEPRKLSQAALETLSIIAYHQPVTRAEIEEIRGVAVSRGTLDLLFELRWVRPRGRRRTPGRPVTYGTTQGFMEYFSLQSIGDLP 209
>gi|120404252|ref|YP_954081.1| putative transcriptional regulator [Mycobacterium vanbaalenii PYR-1] >gi|119957070|gb|ABM14075.1| condensin subunit ScpB [Mycobacterium vanbaalenii PYR-1] (241 aa)
Score = 142, Expect = 1.6e-07, Identities = 41/136 (30%), Positives = 71/136 (52%)
  Q:    55 GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI--VLPE-QKIEEL--TYEEEINFFDTN 190
           G+ +R+    ++++T+   +  V        ++ L +  +ETLA+IAY  P TR+++  +R  +   ++  L+  GL+ EAG     G    +  T  F +  GL S+ DLP+I  +LP    I++L  T  EE  F   N
  S:    85 GIDLREAAGGWRMYTRSKYAPFVEKLLLDGARSKLTRAALETLAVIAYRQPVTRARVSAVRGVNVDAVIRTLLARGLITEAGTDSDSGA-VTFSTTELFLERLGLTSLTDLPDIAPLLPNVDVIDDLSETLSEEPRFMKLN 224
>gi|118051073|ref|ZP_01519622.1| putative transcriptional regulator [Comamonas testosteroni KF-1] >gi|118001744|gb|EAV15899.1| putative transcriptional regulator [Comamonas testosteroni KF-1] (384 aa)
Score = 141, Expect = 1.7e-07, Identities = 47/165 (28%), Positives = 89/165 (53%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVM-----EEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +++ K V+E AL I   + V   +L+S+       F+ V+     ++++ + +KD   +G+ + +V   ++  ++P++ ++       ++     +  +ETLAIIAY  P TR  I ++R      ++ K +E  G +E  G  E VG+P L+  T +F D  GL S+  LP
  S:     3 TVDAKRVLETAL-ICAPQPVTLRELRSL-------FDDVLGSDTVKDLLLDLQKDWALKGVELVQVASGWRFQSRPEM-RVYLDKLHPEKPPKYTRATLETLAIIAYRQPVTRGDIEDIRGVTVNSLIIKQLEDRGWIEVIGHRETVGRPALFATTRQFLDDLGLQSLDQLP 165
>gi|91788476|ref|YP_549428.1| condensin subunit ScpB [Polaromonas sp. JS666] >gi|91697701|gb|ABE44530.1| condensin subunit ScpB [Polaromonas sp. JS666] (244 aa)
Score = 141, Expect = 1.9e-07, Identities = 41/137 (29%), Positives = 72/137 (52%)
  Q:    32 LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPM-LEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           L+    + V+E++  ++     RG+ +  V   ++  ++P + + +       +K P   +  +ETLAIIAY  P TR  + ++R      M L++L + G VE  G  E VG+P LY  T +F D  G++S+  LP +
  S:    34 LTADSLKLVLEDLQNDWAG---RGVELVHVATGWRFQSRPQMREYLDRLH--PEKPPRYTRATLETLAIIAYRQPVTRGDMEDIRGVTINSMILKQLEDRGWVEVIGHRETVGRPALYATTRQFLDDLGVESLDQLPAM 167
>gi|86740159|ref|YP_480559.1| condensin subunit ScpB [Frankia sp. CcI3] >gi|86567021|gb|ABD10830.1| condensin subunit ScpB [Frankia sp. CcI3] (191 aa)
Score = 141, Expect = 2.0e-07, Identities = 42/143 (29%), Positives = 71/143 (49%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTK----PDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           + E ++ ++  +Y +D  RG  +R  G  ++ +T     P + + V +G    Q   L+Q  +ETLA++AY  P +R +I  +R      ++  L   GLVEE G     G   LY  T  F +  GL  + +LP +      I+E+
  S:    45 EVERLLAQLAEQYVRD-GRGFRLRHTGGGWRFYTADECAPWVERFVLAG----QSARLSQAALETLAVVAYQQPVSRGRISAVRGVSADGVIRTLTARGLVEEVGHDPETGA-ILYGTTDYFLERMGLRGLDELPPLAPLLPGIDEI 185
>gi|161618841|ref|YP_001592728.1| segregation and condensation protein B [Brucella canis ATCC 23365] >gi|161335652|gb|ABX61957.1| segregation and condensation protein B [Brucella canis ATCC 23365] (241 aa)
Score = 141, Expect = 2.0e-07, Identities = 41/113 (36%), Positives = 64/113 (56%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+   KVG  +   T PD++ I+       Q+  L++  +E LAIIAY+ P TR+++ ++R  + +   L+ L+E G ++  GR    G+P  Y  T  F D FGL  I+DLP
  S:    76 RGVHFVKVGSGWAFRTAPDLAFIMNRE--TVQQRKLSRAAMEVLAIIAYHQPVTRAELEDIRGVETSKGTLDVLMETGWIKLRGRRRTPGRPVTYGTTDAFLDHFGLSEIRDLP 187
>gi|17546004|ref|NP_519406.1| hypothetical protein RSc1285 [Ralstonia solanacearum GMI1000] >gi|17428299|emb|CAD14987.1| conserved hypothetical protein [Ralstonia solanacearum] (304 aa)
Score = 140, Expect = 2.2e-07, Identities = 46/163 (28%), Positives = 84/163 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISR-LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           K V+E AL  A +     D  K     +S      ++EE+  ++     RG+ +  +   ++L ++P++ +        ++    ++ ++ETLAIIAY  P TR  I ++R  T  T +++++ + G VE  G  +  G+P LY  T +F D  GL S+ +LP +
  S:     7 KIVLETALICAQDPLRVSDLRKLFDEDVSADTIRVLLEELRQDWL---DRGVELVALASGWRLQSRPEM-RAYLDRLHPEKPPKYSRAVMETLAIIAYRQPVTRGDIEDIRGVTVNTQVIKQIEDRGWVEVIGHRDVPGRPALYATTKQFLDDLGLRSLDELPPL 167
>gi|83647425|ref|YP_435860.1| segregation and condensation protein B [Hahella chejuensis KCTC 2396] >gi|83635468|gb|ABC31435.1| segregation and condensation protein B [Hahella chejuensis KCTC 2396] (211 aa)
Score = 140, Expect = 2.3e-07, Identities = 48/168 (28%), Positives = 90/168 (53%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDF--------EAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           M++N+  +IEA LF A ++ +  D+L +   + V+DF        +A ++++   Y     R + + +V   Y+   + + +  V     + ++ P   ++ M+ETLAIIAY  P TR  I ++R     + +++ L E   V   G  +  G+P L+  T +F D F L ++  LP +
  S:     3 MAVNLTQLIEAMLF-ASDKPLTVDQLMT---MFVEDFTPPQRDEIKAALKKLTAVY---ADRAVNLVEVASGYRFQVRDEFAPWVGR---LTEERPQRYSRAMLETLAIIAYRQPITRGDIEDIRGVAVSSQIMKTLQEREWVRVVGHKDVPGRPALFATTRQFLDYFNLKTLDQLPPL 171
>gi|17987368|ref|NP_540002.1| putative cytoplasmic protein [Brucella melitensis 16M] >gi|17983054|gb|AAL52266.1| Hypothetical Cytosolic Protein [Brucella melitensis 16M] (230 aa)
Score = 140, Expect = 2.3e-07, Identities = 41/113 (36%), Positives = 64/113 (56%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+   KVG  +   T PD++ I+       Q+  L++  +E LAIIAY+ P TR+++ ++R  + +   L+ L+E G ++  GR    G+P  Y  T  F D FGL  I+DLP
  S:    65 RGVHFVKVGSGWAFRTAPDLAFIMNRE--TVQQRKLSRATMEVLAIIAYHQPVTRAELEDIRGVETSKGTLDVLMETGWIKLRGRRRTPGRPVTYGTTDAFLDHFGLPEIRDLP 176
>gi|119505055|ref|ZP_01627131.1| putative transcriptional regulator [marine gamma proteobacterium HTCC2080] >gi|119459037|gb|EAW40136.1| putative transcriptional regulator [marine gamma proteobacterium HTCC2080] (302 aa)
Score = 140, Expect = 2.4e-07, Identities = 48/161 (29%), Positives = 84/161 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++E AL +AG E +   +L  +     R +  D    ++E+    E    RG  + +V   Y+   + ++S  V     + Q+ P   ++ ++ETL++IAY  P TR +I E+R     T +++ L E   V   G  +  G+P +Y  T +F D F L S++DLP +
  S:     9 ILEGALMVAG-EALSIQRLSQLFDEFDRPANTDLREALDEVGRRCEG---RGYELVQVATGYRFQVRQNLSTWVGR---LWQERPPRYSRALLETLSLIAYRQPITRGEIEEIRGVAVSTNIVKTLQERDWVRIVGHRDVPGRPAMYATTRQFLDYFNLKSLEDLPPL 169
>gi|50084074|ref|YP_045584.1| hypothetical protein ACIAD0862 [Acinetobacter sp. ADP1] >gi|49530050|emb|CAG67762.1| conserved hypothetical protein [Acinetobacter sp. ADP1] (196 aa)
Score = 140, Expect = 2.8e-07, Identities = 29/80 (36%), Positives = 51/80 (63%)
  Q:    89 LNQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           L+  ++ET+A+IAY+ P TR+ I ++R  ++ + +L  L E   ++E+G  +  G+P L   TP+F + FGL S+  LP +
  S:    99 LSPSLLETIAVIAYHQPVTRADIEQIRGVSNNSQILRMLFEWNWIKESGFRDLPGRPALLITTPQFLNAFGLVSLGQLPPL 179
>gi|18978393|ref|NP_579750.1| hypothetical protein PF2021 [Pyrococcus furiosus DSM 3638] >gi|18894231|gb|AAL82145.1| hypothetical protein [Pyrococcus furiosus DSM 3638] (188 aa)
Score = 140, Expect = 2.8e-07, Identities = 46/157 (29%), Positives = 83/157 (52%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           I  K+++EAALF+AG     K+  K++   S+   E ++E +  EY +      +V+  G+ + +  K + S+ V     +  K  L+ G ++TLA+IAY  P  +S+I +LR +     + KL+E+GL+     +E   +  L   T KF +++G 
  S:     4 IEDKALVEAALFVAGRPLSLKELSKALGIKSLDYLEKLIELIASEYAERKSAIEIVKVAGDKWVMQVKQEYSQRVIP---LMPKPELSTGELKTLALIAYLQPVEQSKIVKLRGSQAYEHIRKLLEMGLI----YAEPYERTRLLGTTEKFAELYGF 153
>gi|62289826|ref|YP_221619.1| hypothetical protein BruAb1_0893 [Brucella abortus bv. 1 str. 9-941] >gi|82699751|ref|YP_414325.1| hypothetical protein BAB1_0900 [Brucella melitensis biovar Abortus 2308] >gi|148559591|ref|YP_001258855.1| segregation and condensation protein B [Brucella ovis ATCC 25840] >gi|163843152|ref|YP_001627556.1| segregation and condensation protein B [Brucella suis ATCC 23445] >gi|189024067|ref|YP_001934835.1| Conserved hypothetical protein 281 [Brucella abortus S19] >gi|62195958|gb|AAX74258.1| conserved hypothetical protein TIGR00281 [Brucella abortus biovar 1 str. 9-941] >gi|82615852|emb|CAJ10856.1| Conserved hypothetical protein 281 [Brucella melitensis biovar Abortus 2308] >gi|148370848|gb|ABQ60827.1| segregation and condensation protein B [Brucella ovis ATCC 25840] >gi|163673875|gb|ABY37986.1| segregation and condensation protein B [Brucella suis ATCC 23445] >gi|189019639|gb|ACD72361.1| Conserved hypothetical protein 281 [Brucella abortus S19] (241 aa)
Score = 140, Expect = 2.8e-07, Identities = 41/113 (36%), Positives = 64/113 (56%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+   KVG  +   T PD++ I+       Q+  L++  +E LAIIAY+ P TR+++ ++R  + +   L+ L+E G ++  GR    G+P  Y  T  F D FGL  I+DLP
  S:    76 RGVHFVKVGSGWAFRTAPDLAFIMNRE--TVQQRKLSRAAMEVLAIIAYHQPVTRAELEDIRGVETSKGTLDVLMETGWIKLRGRRRTPGRPVTYGTTDAFLDHFGLPEIRDLP 187
>gi|148255778|ref|YP_001240363.1| condensin subunit ScpB [Bradyrhizobium sp. BTAi1] >gi|146407951|gb|ABQ36457.1| condensin subunit ScpB [Bradyrhizobium sp. BTAi1] (385 aa)
Score = 140, Expect = 2.9e-07, Identities = 39/131 (29%), Positives = 70/131 (53%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D +A + ++  EY     RG+ + +V   +   T  D++ ++       +K  L++  IE LAI+AY+ P TR++I E+R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+++ DLP
  S:    55 DIKAALAQLQAEY---ANRGVNLVRVANKWTFRTAGDLAWLMTRESTETRK--LSRAAIEVLAIVAYHQPVTRAEIEEIRGVVTSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTDAFLAQFSLETLGDLP 181
>gi|75675995|ref|YP_318416.1| chromosome segregation and condensation protein ScpB [Nitrobacter winogradskyi Nb-255] >gi|74420865|gb|ABA05064.1| condensin subunit ScpB [Nitrobacter winogradskyi Nb-255] (248 aa)
Score = 139, Expect = 2.9e-07, Identities = 36/131 (27%), Positives = 69/131 (52%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D ++ + ++  +Y     RG+ + ++   +   T  D++ ++       +   L++  IE LAIIAY+ P TR++I E+R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+++ DLP
  S:    55 DIKSALAQLQADY---ASRGVNLVRIANKWTFRTAGDLAWLMTRES--TETRRLSRAAIEVLAIIAYHQPVTRAEIEEIRGVVTSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTEAFLSQFSLENLGDLP 181
>gi|23501767|ref|NP_697894.1| segregation and condensation protein B [Brucella suis 1330] >gi|23347696|gb|AAN29809.1| segregation and condensation protein B [Brucella suis 1330] (241 aa)
Score = 139, Expect = 2.9e-07, Identities = 41/113 (36%), Positives = 64/113 (56%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+   KVG  +   T PD++ I+       Q+  L++  +E LAIIAY+ P TR+++ ++R  + +   L+ L+E G ++  GR    G+P  Y  T  F D FGL  I+DLP
  S:    76 RGVHFVKVGSGWAFRTAPDLAFIMNRE--TVQQRKLSRAAMEVLAIIAYHQPVTRAELEDIRGVETSKGTLDVLMETGWIKLRGRRRTPGRPVTYGTTDAFLDHFGLPEIRDLP 187
>gi|92117307|ref|YP_577036.1| putative transcriptional regulator [Nitrobacter hamburgensis X14] >gi|91800201|gb|ABE62576.1| condensin subunit ScpB [Nitrobacter hamburgensis X14] (248 aa)
Score = 139, Expect = 3.3e-07, Identities = 35/113 (30%), Positives = 61/113 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ + +V   +   T  D++ ++       +   L++  IE LAIIAY+ P TR+++ E+R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+S+ DLP
  S:    70 RGVNLVRVANKWTFRTAGDLAWLMTRE--STETKRLSRAAIEMLAIIAYHQPVTRAELEEIRGVVTSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTEAFLSQFTLESLGDLP 181
>gi|146340977|ref|YP_001206025.1| hypothetical protein BRADO4048 [Bradyrhizobium sp. ORS278] >gi|146193783|emb|CAL77800.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278] (389 aa)
Score = 139, Expect = 3.3e-07, Identities = 38/131 (29%), Positives = 70/131 (53%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D +A + ++  +Y     RG+ + +V   +   T  D++ ++       +K  L++  IE LAI+AY+ P TR++I E+R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+++ DLP
  S:    64 DIKAALAQLQADY---ANRGVNLVRVANKWSFRTAGDLAWLMTRESTETRK--LSRAAIEVLAIVAYHQPVTRAEIEEIRGVVTSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTDAFLTQFSLETLGDLP 190
>gi|153009674|ref|YP_001370889.1| putative transcriptional regulator [Ochrobactrum anthropi ATCC 49188] >gi|151561562|gb|ABS15060.1| putative transcriptional regulator [Ochrobactrum anthropi ATCC 49188] (242 aa)
Score = 139, Expect = 3.5e-07, Identities = 52/163 (31%), Positives = 89/163 (54%)
  Q:     4 NVKSVIEAALFIAGNEGVHKDKLKSISRLSVQ-DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++  ++EA +F A +E V +  L    RL    D   V++ +   YE    RG+ + +VG  +   T PD++ +++      Q+  L++  +E LAIIAY+ P TR+++ ++R  + +   L+ L+E G ++  GR    G+P  Y  T  F D FGL  I+DLP
  S:    32 DLARIVEAIVF-ASSEPVSERALAE--RLPANVDVAPVLKHLQKIYET---RGVHLVQVGSAWAFRTAPDLAFLMSRE--AVQQRKLSRAAMEVLAIIAYHQPVTRAELEDIRGVETSKGTLDVLMETGWIKLRGRRRTPGRPVTYGTTDSFLDHFGLPEIRDLP 188
>gi|163759451|ref|ZP_02166536.1| hypothetical protein HPDFL43_08867 [Hoeflea phototrophica DFL-43] >gi|162283048|gb|EDQ33334.1| hypothetical protein HPDFL43_08867 [Hoeflea phototrophica DFL-43] (259 aa)
Score = 139, Expect = 3.5e-07, Identities = 42/118 (35%), Positives = 68/118 (57%)
  Q:    49 EKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQK----NPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           E+   RG+ + +VG+ +   T  D+      GF I+Q+      L++  +E L+ IAY+ P TR++I ++R    +   L+ L+E G V   GR  + G+P  Y  TP F D FGL+ ++DLP
  S:    87 ERYAHRGVNLVRVGDGWAFRTAADL------GFLIRQEETEVKKLSRAGLEVLSTIAYHQPVTRAEIEDVRGVATSKGTLDVLMETGWVRMRGRRRSPGRPVTYGTTPAFLDHFGLEDLRDLP 203
>gi|21227131|ref|NP_633053.1| hypothetical protein MM_1029 [Methanosarcina mazei Go1] >gi|20905462|gb|AAM30725.1| hypothetical protein MM_1029 [Methanosarcina mazei Go1] (371 aa)
Score = 139, Expect = 3.8e-07, Identities = 53/171 (30%), Positives = 90/171 (52%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           +IEAALF AG   V  +KL  I+    ++  + ++E++  Y      GL +  +G+ Y +  KP+ S++      +++  P  L+   + TL++IAY+ P  +S + E+R +     ++ LIE G VE    S   G+      TP F D FGL   K+ P+ +  ++KI EL
  S:     6 IIEAALFAAG-RAVSLEKLMKITGKPKKNVSSAVQELMGAYSSR-MSGLEILDLGDRYVMQVKPEYSEL------MREVAPKELSAPKLRTLSMIAYHQPLLQSDLIEMRGSGAYDHIKDLIERGFVE----SVPCGRSRQLSTTPLFADYFGLK--KNDPKAI--KEKIIEL 162
>gi|83858685|ref|ZP_00952207.1| hypothetical protein OA2633_04261 [Oceanicaulis alexandrii HTCC2633] >gi|83853508|gb|EAP91360.1| hypothetical protein OA2633_04261 [Oceanicaulis alexandrii HTCC2633] (254 aa)
Score = 138, Expect = 4.2e-07, Identities = 52/161 (32%), Positives = 89/161 (55%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQ-DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++EA LF A +E +  D L++  RL    D   ++  +  +Y      G+ + +VG  ++  T  D+S ++ +    ++   L+Q  +ETLAIIAY+ P TR++I E+R    +   L++L+E+  +   GR    G+P  Y VT  F D FGL ++ DLP +
  S:    46 IVEALLF-AASEPLDLDTLRA--RLPEDTDVRGLINALQSKY---ADAGVNLVEVGGRWRFQTAEDLSWLLRTER--EEPRKLSQAALETLAIIAYHQPVTRAEIEEIRGVAVSKGTLDQLLEMKWIRLRGRRRTPGRPVTYGVTDAFMDYFGLANLSDLPGV 200
>gi|111221682|ref|YP_712476.1| segregation and condensation protein B [Frankia alni ACN14a] >gi|111149214|emb|CAJ60899.1| Segregation and condensation protein B [Frankia alni ACN14a] (232 aa)
Score = 138, Expect = 4.4e-07, Identities = 43/155 (27%), Positives = 73/155 (47%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           + +++EA L +A    V   +L +    S ++ E ++ ++   Y +D  RG  +R VG  ++ +T  + +  V       Q   L+Q  +ETLA++AY  P +R +I  +R      ++  L    LVEE G     G   LY  T  F +  GL
  S:    56 LAALLEAVLMVA-ERPVGVAELATGLGASAREIERLLPDLAENYVRD-GRGFRLRHVGAGWRFYTADECAPWVEGFVLAGQSARLSQAALETLAVVAYQQPVSRGRIAAVRGVSADGVIRTLTARRLVEEIGHDPETGA-ILYGTTDYFLERMGL 207
>gi|119898402|ref|YP_933615.1| putative segregation and condensation protein B [Azoarcus sp. BH72] >gi|119670815|emb|CAL94728.1| putative segregation and condensation protein B [Azoarcus sp. BH72] (202 aa)
Score = 138, Expect = 4.5e-07, Identities = 37/120 (30%), Positives = 64/120 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEI-GLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQ 173
           RG+ +  +   ++  T+PD    +     +K + P   ++ ++ETLAIIAY  P TR  I ++R    +  + K +E  G V+  G  +  G+P L+  T +F D  GL S+ +LP +   E+
  S:    59 RGVELVLLASGWRFQTRPDCQPYLDR---LKDERPPRYSRAVMETLAIIAYRQPVTRGDIEDIRGVAVSANVLKTLEARGWVDIVGHRDTPGRPALFATTRRFLDDMGLRSLTELPALAEIER 178
>gi|88705954|ref|ZP_01103662.1| segregation and condensation protein B [gamma proteobacterium KT 71] >gi|88699668|gb|EAQ96779.1| segregation and condensation protein B [Congregibacter litoralis KT71] (251 aa)
Score = 138, Expect = 4.7e-07, Identities = 49/167 (29%), Positives = 84/167 (50%)
  Q:     2 SINVKSVIEAALFIAGNEGVHKDKLKSI----SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           S  +  +IEAAL  AG   +   +L ++     R + +D  A + E+    E+   RG  +  V   ++L  +  +S  V+    + Q+ P   ++ ++ETLA++AY  P TR +I E+R     T ++  L E   +   G  +  G+P +Y  T  F D F L S+  LP +
  S:     4 STGLVQIIEAALLAAGKP-LTVAQLGALFEEHERPANEDIRAALAEV---GERCEGRGFELVDVASGFRLQVREQLSPWVSR---LWQERPQKYSRALLETLALVAYRQPITRGEIEEIRGVAVSTNIIRTLHERDWIRVVGHRDVPGRPAMYATTRDFLDYFNLKSLDQLPAL 170
>gi|85716509|ref|ZP_01047480.1| chromosome segregation and condensation protein ScpB [Nitrobacter sp. Nb-311A] >gi|85696698|gb|EAQ34585.1| chromosome segregation and condensation protein ScpB [Nitrobacter sp. Nb-311A] (248 aa)
Score = 137, Expect = 5.6e-07, Identities = 34/113 (30%), Positives = 61/113 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           RG+ + ++   +   T  D++ ++       +   L++  IE LAIIAY+ P TR++I E+R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+++ DLP
  S:    70 RGVNLVRIANKWTFRTAGDLAWLMTRE--STETRRLSRAAIEVLAIIAYHQPVTRAEIEEIRGVVTSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTEAFLSQFSLENLGDLP 181
>gi|134095615|ref|YP_001100690.1| putative transcriptional regulator, (ScpB) [Herminiimonas arsenicoxydans] (261 aa)
Score = 137, Expect = 5.9e-07, Identities = 40/137 (29%), Positives = 68/137 (49%)
  Q:    41 MEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           + +M+ E   D   +G+ V  +   ++  ++P++ KI       ++    ++  +ETLAII Y  P TR  I E+R         K++E  G +E  G  +  G+P L+  T  F D  GL S+  LP    P Q++E+
  S:    19 IRQMLDELRDDWADKGIEVVSLSTGWRFQSRPEM-KIYLERLNPEKPLKYSRATLETLAIITYRQPVTRGDIEEIRGVTVNSQTIKMLEDRGWIEAIGHRDVPGRPALFATTKHFLDDLGLSSLDQLP----PLQQVEK 152
>gi|71908074|ref|YP_285661.1| condensin subunit ScpB [Dechloromonas aromatica RCB] >gi|71847695|gb|AAZ47191.1| condensin subunit ScpB [Dechloromonas aromatica RCB] (178 aa)
Score = 136, Expect = 6.8e-07, Identities = 45/172 (26%), Positives = 88/172 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE 176
           +K V+EAAL +A  E +    +K +     S +    +++++  E+ + P   + + ++   ++  T+ +    +      ++    ++ ++ETLAIIAY  P TR  I E+R     T +++ L E G ++  G  +  G+P L+  T +F D  GL S+ +LP +    Q +E
  S:     6 IKRVLEAAL-LAAREPMTPSDMKKMFDEEFSSETLRKLLDQLREEWAERP---VELIQLASGWRFRTRAEYLPYIER-LNPERPPKYSRAVLETLAIIAYRQPVTRGDIEEIRGVAVNTNVVKTLEERGWIDVVGHRDTPGRPALFATTKQFLDDLGLRSVSELPPLEQISQTLE 175
>gi|154243679|ref|YP_001409252.1| putative transcriptional regulator [Xanthobacter autotrophicus Py2] >gi|154162801|gb|ABS70016.1| putative transcriptional regulator [Xanthobacter autotrophicus Py2] (241 aa)
Score = 136, Expect = 7.1e-07, Identities = 52/160 (32%), Positives = 82/160 (51%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQD--FEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFG-IKQKNPLNQGMIETLAIIAYNHPCTRSQIHEL-RKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +EA +F A    V +D L   +R+  +D   E V+E+ I +  +D    LV   V   ++L T+P  ++ + + FG      PL+Q  +  LA IAY+ P TR ++  +  K      +  L  +G V    RS   G PY Y  T  F   FGLD+++DLP++
  S:    31 VEAVIFAAPGP-VERDVL---ARVVGRDCSLELVIED-IRDALRDRPYELV--PVAGGWQLRTRPRHAESIHAAFGSAPAPVPLSQTEMLVLASIAYHQPVTRGELSNMIGKQVSRDTIGYLRSLGFVAAGPRSPQPGAPYTYVTTKGFLAHFGLDTLRDLPDM 187
>gi|58581785|ref|YP_200801.1| hypothetical protein XOO2162 [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426379|gb|AAW75416.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] (424 aa)
Score = 136, Expect = 7.4e-07, Identities = 34/116 (29%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RG+ + +V   ++   K D+   VA     +++    +  +ETLA+IAY  P TR +I ++R     + +++ L E   +   G  +  GKP L+  T  F D FGL  + +LP +
  S:    79 ERGVELVEVASGFRFQVKADVHGWVAR-LWTERRTKYTRATLETLALIAYRQPITRGEIEQVRGVAVSSNIIQALEERDWIRVVGHRDVPGKPALFGTTKGFLDYFGLKRLDELPPL 194
>gi|78048072|ref|YP_364247.1| hypothetical protein XCV2516 [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78036502|emb|CAJ24193.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] (423 aa)
Score = 136, Expect = 7.6e-07, Identities = 34/116 (29%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RG+ + +V   ++   K D+   VA     +++    +  +ETLA+IAY  P TR +I ++R     + +++ L E   +   G  +  GKP L+  T  F D FGL  + +LP +
  S:    79 ERGVELVEVASGFRFQVKADVHGWVAR-LWTERRTKYTRATLETLALIAYRQPITRGEIEQVRGVAVSSNIIQALEEREWIRVVGHRDVPGKPALFGTTKGFLDYFGLKRLDELPPL 194
>gi|71276225|ref|ZP_00652504.1| Conserved hypothetical protein 281 [Xylella fastidiosa Dixon] >gi|71898736|ref|ZP_00680905.1| Conserved hypothetical protein 281 [Xylella fastidiosa Ann-1] >gi|170730717|ref|YP_001776150.1| putative transcriptional regulator [Xylella fastidiosa M12] >gi|71162986|gb|EAO12709.1| Conserved hypothetical protein 281 [Xylella fastidiosa Dixon] >gi|71731501|gb|EAO33563.1| Conserved hypothetical protein 281 [Xylella fastidiosa Ann-1] >gi|167965510|gb|ACA12520.1| putative transcriptional regulator [Xylella fastidiosa M12] (254 aa)
Score = 136, Expect = 7.8e-07, Identities = 35/116 (30%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +R + + +V   ++   K D+   V S    ++K   ++  +ETLA+IAY  P TR +I ++R     + ++  L E   +   G  +A GKP L+  T  F D FGL  + +LP +
  S:    63 ERSVELVEVASGFRFQLKADVHAWV-SPLWTERKTKYSRATLETLALIAYRQPITRGEIEQIRGVAVNSNIIHTLEEREWIRVVGHRDAPGKPALFGTTKAFLDYFGLKRLDELPPL 178
>gi|86749863|ref|YP_486359.1| putative transcriptional regulator [Rhodopseudomonas palustris HaA2] >gi|86572891|gb|ABD07448.1| condensin subunit ScpB [Rhodopseudomonas palustris HaA2] (358 aa)
Score = 136, Expect = 8.1e-07, Identities = 36/131 (27%), Positives = 68/131 (51%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D +A + ++  +Y     RG+ + ++   +   T  D++ ++       +   L++  IE LAIIAY+ P TR++I ++R    +   L+ L+E G +   GR +  G+P  +  T  F   F L+++ DLP
  S:    62 DVKAALAQLQADY---AHRGVNLVRIASKWTFRTAGDLAWLMTRE--TTETRKLSRAAIEMLAIIAYHQPITRAEIEDIRGVVTSKGTLDVLLETGWIRPRGRRKTPGRPLTFGTTESFLSQFSLEALSDLP 188
>gi|83748670|ref|ZP_00945687.1| ScpB [Ralstonia solanacearum UW551] >gi|83724632|gb|EAP71793.1| ScpB [Ralstonia solanacearum UW551] (319 aa)
Score = 135, Expect = 8.6e-07, Identities = 31/79 (39%), Positives = 49/79 (62%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRK-TDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++ ++ETLAIIAY  P TR  I ++R  T  T +++++ + G VE  G  +  G+P LY  T +F D  GL S+ +LP +
  S:   101 SRAVMETLAIIAYRQPVTRGDIEDIRGVTVNTQVIKQIEDRGWVEVIGHRDVPGRPALYATTKQFLDDLGLRSLDELPPL 180
>gi|71901987|ref|ZP_00684036.1| Conserved hypothetical protein 281 [Xylella fastidiosa Ann-1] >gi|71728254|gb|EAO30436.1| Conserved hypothetical protein 281 [Xylella fastidiosa Ann-1] (247 aa)
Score = 135, Expect = 8.6e-07, Identities = 35/116 (30%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +R + + +V   ++   K D+   V S    ++K   ++  +ETLA+IAY  P TR +I ++R     + ++  L E   +   G  +A GKP L+  T  F D FGL  + +LP +
  S:    63 ERSVELVEVASGFRFQLKADVHAWV-SPLWTERKTKYSRATLETLALIAYRQPITRGEIEQIRGVAVNSNIIHTLEEREWIRVVGHRDAPGKPALFGTTKAFLDYFGLKRLDELPPL 178
>gi|28199351|ref|NP_779665.1| hypothetical protein PD1470 [Xylella fastidiosa Temecula1] >gi|182682077|ref|YP_001830237.1| segregation and condensation protein B [Xylella fastidiosa M23] >gi|28057457|gb|AAO29314.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] >gi|182632187|gb|ACB92963.1| segregation and condensation protein B [Xylella fastidiosa M23] (247 aa)
Score = 135, Expect = 8.9e-07, Identities = 35/116 (30%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +R + + +V   ++   K D+   V S    ++K   ++  +ETLA+IAY  P TR +I ++R     + ++  L E   +   G  +A GKP L+  T  F D FGL  + +LP +
  S:    63 ERSVELVEVASGFRFQLKADVHAWV-SPLWTERKTKYSRATLETLALIAYRQPITRGEIEQIRGVAVNSNIIHTLEEREWIRVVGHRDAPGKPALFGTTKAFLDYFGLKRLDELPPL 178
>gi|84623688|ref|YP_451060.1| hypothetical protein XOO_2031 [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367628|dbj|BAE68786.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] (411 aa)
Score = 135, Expect = 9.0e-07, Identities = 34/116 (29%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RG+ + +V   ++   K D+   VA     +++    +  +ETLA+IAY  P TR +I ++R     + +++ L E   +   G  +  GKP L+  T  F D FGL  + +LP +
  S:    66 ERGVELVEVASGFRFQVKADVHGWVAR-LWTERRTKYTRATLETLALIAYRQPITRGEIEQVRGVAVSSNIIQALEERDWIRVVGHRDVPGKPALFGTTKGFLDYFGLKRLDELPPL 181
>gi|166712398|ref|ZP_02243605.1| hypothetical protein Xoryp_13320 [Xanthomonas oryzae pv. oryzicola BLS256] (401 aa)
Score = 135, Expect = 9.1e-07, Identities = 34/116 (29%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RG+ + +V   ++   K D+   VA     +++    +  +ETLA+IAY  P TR +I ++R     + +++ L E   +   G  +  GKP L+  T  F D FGL  + +LP +
  S:    54 ERGVELVEVASGFRFQVKADVHGWVAR-LWTERRTKYTRATLETLALIAYRQPITRGEIEQVRGVAVSSNIIQALEERDWIRVVGHRDVPGKPALFGTTKGFLDYFGLKRLDELPPL 169
>gi|92112978|ref|YP_572906.1| condensin subunit ScpB [Chromohalobacter salexigens DSM 3043] >gi|91796068|gb|ABE58207.1| condensin subunit ScpB [Chromohalobacter salexigens DSM 3043] (287 aa)
Score = 135, Expect = 9.2e-07, Identities = 34/101 (33%), Positives = 54/101 (53%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTN 190
           ++ ++ETLA+IAY  P TR  I E+R     + ++  L E G +   G+ +  G+P +Y  T  F D FGL ++  LP   + E K  E  +EE +   D +
  S:    92 SRALLETLALIAYRQPVTRGDIEEVRGVSVSSSIVRTLTERGWIRVVGQRDVPGRPSVYATTRTFLDDFGLKTLDALPP--MHELKEFEARFEEALGHTDAS 191
>gi|33592371|ref|NP_880015.1| hypothetical protein BP1243 [Bordetella pertussis Tohama I] >gi|33572016|emb|CAE41539.1| conserved hypothetical protein [Bordetella pertussis Tohama I] (362 aa)
Score = 135, Expect = 9.6e-07, Identities = 31/116 (26%), Positives = 65/116 (56%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RGL + ++   ++  ++P + + +      ++    ++ ++ETLAI+A+  P TR  I ++R    +  + K++E  G +E  G  +A G+P L+  T +F D  GL ++ +LP +
  S:    54 ERGLELVQLASGWRFQSRPQMQRYLER-LNPEKPPKYSRAVLETLAIVAWRQPVTRGDIEDIRGVTVSSQIVKVLEDRGWIEVIGHRDAPGRPALFATTRQFLDDLGLRALDELPPL 169
>gi|33596479|ref|NP_884122.1| hypothetical protein BPP1858 [Bordetella parapertussis 12822] >gi|33602226|ref|NP_889786.1| hypothetical protein BB3250 [Bordetella bronchiseptica RB50] >gi|33566248|emb|CAE37159.1| conserved hypothetical protein [Bordetella parapertussis] >gi|33576664|emb|CAE33742.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] (364 aa)
Score = 135, Expect = 9.6e-07, Identities = 31/116 (26%), Positives = 65/116 (56%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RGL + ++   ++  ++P + + +      ++    ++ ++ETLAI+A+  P TR  I ++R    +  + K++E  G +E  G  +A G+P L+  T +F D  GL ++ +LP +
  S:    56 ERGLELVQLASGWRFQSRPQMQRYLER-LNPEKPPKYSRAVLETLAIVAWRQPVTRGDIEDIRGVTVSSQIVKVLEDRGWIEVIGHRDAPGRPALFATTRQFLDDLGLRALDELPPL 171
>gi|171463772|ref|YP_001797885.1| segregation and condensation protein B [Polynucleobacter necessarius STIR1] >gi|171193310|gb|ACB44271.1| segregation and condensation protein B [Polynucleobacter necessarius STIR1] (246 aa)
Score = 135, Expect = 9.8e-07, Identities = 51/173 (29%), Positives = 89/173 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFE-AVMEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP--EIVLPEQKIEEL 178
           K VIE AL  A       D    +SRL V+D   A ++E + E ++    +G+ +  +   ++  ++  + + +      ++    ++ ++ETLAIIAY  P TR +I E+R     + ++++L + G V   G  E VG+P LY  T +F D   L +++ LP  E   P    E+L
  S:     6 KRVIETALLCAQEPLTVAD----LSRLFVEDITTANIDEALVELQRAWDDKGMELVHIATGWRFQSRLSMREYLDR-LTPEKPPKYSRAVMETLAIIAYRQPVTRGEIEEIRGVAVSSNVMKQLEDRGWVGVIGHKETVGRPGLYATTKQFLDDLSLTNLQSLPILEDAAPMAAAEQL 178
>gi|21231652|ref|NP_637569.1| hypothetical protein XCC2213 [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66768226|ref|YP_242988.1| hypothetical protein XC_1905 [Xanthomonas campestris pv. campestris str. 8004] >gi|21113348|gb|AAM41493.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66573558|gb|AAY48968.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] (401 aa)
Score = 135, Expect = 1.0e-06, Identities = 34/116 (29%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +RG+ + +V   ++   K D+   VA     +++    +  +ETLA+IAY  P TR +I ++R     + +++ L E   +   G  +  GKP L+  T  F D FGL  + +LP +
  S:    79 ERGVELVEVASGFRFQVKADLHGWVAR-LWTERRTKYTRATLETLALIAYRQPITRGEIEQVRGVAVSSNIIQALEEREWIRVVGHRDVPGKPALFGTTKGFLDYFGLKRLDELPPL 194
>gi|148264298|ref|YP_001231004.1| putative transcriptional regulator [Geobacter uraniireducens Rf4] >gi|146397798|gb|ABQ26431.1| condensin subunit ScpB [Geobacter uraniireducens Rf4] (189 aa)
Score = 135, Expect = 1.0e-06, Identities = 47/174 (27%), Positives = 94/174 (54%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI-SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           +KS++E+ +F++ +  +  D+L S+       D  A +E +  +Y +  +RG+ + +V   Y+  ++P+ +  +       +    +   +ETLAIIAY  P TR+++  LR  D   +L+ L+E  L+   G+ +  GKP +Y  + +F ++F L  +  LP +    ++I+EL
  S:     6 LKSIVESLIFVS-DLPITLDRLCSVLEEHERGDIRAAVEALKEDY-RQAERGIFLDEVAGGYQFRSRPENADYLRR-LTRSKTVKFSPSALETLAIIAYRQPITRAEVEYLRGVDSGGVLKTLLEKKLLRILGKKDIPGKPLIYGTSREFLELFNLKDLSSLPTL----KEIQEL 173
>gi|115524701|ref|YP_781612.1| putative transcriptional regulator [Rhodopseudomonas palustris BisA53] >gi|115518648|gb|ABJ06632.1| condensin subunit ScpB [Rhodopseudomonas palustris BisA53] (242 aa)
Score = 135, Expect = 1.0e-06, Identities = 38/131 (29%), Positives = 70/131 (53%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D +A + ++  +Y     RG+ + +V   +   T  D++ ++       +K  L++  IE LAIIAY+ P TR++I ++R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+++ DLP
  S:    55 DVKAALLQLQADY---AHRGVNLVRVAGKWTFRTAGDLAWLMTRESTETRK--LSRAAIEMLAIIAYHQPVTRAEIEDIRGVITSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTEAFLAQFSLETLGDLP 181
>gi|14520504|ref|NP_125979.1| hypothetical protein PAB2162 [Pyrococcus abyssi GE5] >gi|5457719|emb|CAB49210.1| Transcriptional regulator, putative (ypuH-like) [Pyrococcus abyssi GE5] (192 aa)
Score = 134, Expect = 1.1e-06, Identities = 44/154 (28%), Positives = 82/154 (53%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           K+++EAALF+AG     K+  K++   S+   E ++E +  EY +      +V+  G+ + +  K + S+ V     +  K  L  G ++TLA+IAY  P  +S+I +LR +     +++L+E+GL+     +E   +  L   T KF +++G 
  S:     7 KALVEAALFVAGRPLSVKELSKALGIKSLDYLEKLIELIASEYSERKSAIEIVKVAGDKWVMQVKQEYSQKVIH---LMPKPELTAGELKTLALIAYLQPVEQSKIVKLRGSQAYEHIKRLLEMGLI----YAEPYERTKLLGTTEKFAELYGF 153
>gi|92109635|ref|YP_571922.1| putative transcriptional regulator [Nitrobacter hamburgensis X14] >gi|91802717|gb|ABE65090.1| putative transcriptional regulator [Nitrobacter hamburgensis X14] (236 aa)
Score = 134, Expect = 1.2e-06, Identities = 46/160 (28%), Positives = 77/160 (48%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQ-RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAI--IAYNHPCTRSQIHELR-KTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +EAA+F +      +   + I R        V++E+I +   + + R   +  V   ++  +K   ++ + +  G ++  P +    E+L I  IAY  P TRS I  L  K     ++ KL  + L+    R    G P+ Y  TP F  +FGL S++DLPEI
  S:    30 VEAAIFASPTPVPRETLARLIGR------ACVLDELIADIRDELKPRPYELVFVAGGFQHRSKARFTEAIRAVLGGRETGPPDLSKTESLVISAIAYLQPVTRSSISRLLGKAISRDIIAKLKRLDLIGAGPRMAEPGAPFSYVTTPTFLSVFGLASLRDLPEI 187
>gi|39935915|ref|NP_948191.1| hypothetical protein RPA2850 [Rhodopseudomonas palustris CGA009] >gi|39649769|emb|CAE28291.1| conserved unknown protein [Rhodopseudomonas palustris CGA009] (432 aa)
Score = 134, Expect = 1.3e-06, Identities = 38/118 (32%), Positives = 62/118 (52%)
  Q:    49 EKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           E    RG+ + ++   +   T  D++ ++       +K  L++  IE LAIIAY+ P TR +I E+R    +   L+ L+E G V+  GR +  G+P  +  T  F   F L+S+ DLP
  S:    73 EDYASRGVNLVRIANKWTFRTASDLAWLMTRESTETRK--LSRAAIEMLAIIAYHQPITRVEIEEIRGVATSKGTLDVLLETGWVKPRGRRKTPGRPLTFGTTEAFLSQFSLESLTDLP 189
>gi|91977261|ref|YP_569920.1| chromosome segregation and condensation protein ScpB [Rhodopseudomonas palustris BisB5] >gi|91683717|gb|ABE40019.1| condensin subunit ScpB [Rhodopseudomonas palustris BisB5] (389 aa)
Score = 134, Expect = 1.4e-06, Identities = 36/131 (27%), Positives = 68/131 (51%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D +A + ++  +Y     RG+ + ++   +   T  D++ ++       +   L++  IE LAIIAY+ P TR++I ++R    +   L+ L+E G +   GR +  G+P  +  T  F   F L+++ DLP
  S:    62 DVKAALAQLQADY---AHRGVNLVRIANKWTFRTAGDLAWLMTRE--TTETRKLSRAAIEMLAIIAYHQPITRAEIEDIRGVVTSKGTLDVLLETGWIRPRGRRKTPGRPLTFGTTEAFLSQFSLEALGDLP 188
>gi|157364370|ref|YP_001471137.1| putative transcriptional regulator [Thermotoga lettingae TMO] >gi|157314974|gb|ABV34073.1| putative transcriptional regulator [Thermotoga lettingae TMO] (172 aa)
Score = 133, Expect = 1.5e-06, Identities = 39/162 (24%), Positives = 84/162 (51%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSI 162
           M + + +++EA +F   ++G+   +L  I+ ++ +  E  + E+   Y  + + G+ ++K+G+ Y+ +TKP+ S+ V    G    + L+   +E +A I  N P T   ++E+R  D + ++  L + G++         G  YLYQ++  F D   ++ +
  S:     1 MGLKLNAIMEALIF--ASKGMTVQQLAKIAEITEEQAEKALYELSRHYGGE-EHGVELKKIGDVYRFYTKPEYSEFVKK-IGKTIYSKLSAAQMEIVAAIILNGPSTVQSLNEMRGKDSSAIVRFLHKSGILVRKRH----GNSYLYQLSENFKDFLMIEEV 154
>gi|21243052|ref|NP_642634.1| hypothetical protein XAC2317 [Xanthomonas axonopodis pv. citri str. 306] >gi|21108564|gb|AAM37170.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] (412 aa)
Score = 133, Expect = 1.5e-06, Identities = 34/115 (29%), Positives = 59/115 (51%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + +V   ++   K D+   VA     +++    +  +ETLA+IAY  P TR +I ++R     + +++ L E   +   G  +  GKP L+  T  F D FGL  + +LP +
  S:    67 RGVELVEVASGFRFQVKADVHGWVAR-LWTERRTKYTRATLETLALIAYRQPITRGEIEQVRGVAVSSNIIQALEEREWIRVVGHRDVPGKPALFGTTKGFLDYFGLKRLDELPPL 181
>gi|54023978|ref|YP_118220.1| hypothetical protein nfa20100 [Nocardia farcinica IFM 10152] >gi|54015486|dbj|BAD56856.1| hypothetical protein [Nocardia farcinica IFM 10152] (225 aa)
Score = 133, Expect = 1.6e-06, Identities = 42/159 (26%), Positives = 79/159 (49%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAG-RSEAVGKPYLYQVTPKFYDIFGLDSIKD 164
           +S +EA L +  +     ++L +    + +  EA + +M  E       G+ +R VG+ ++ +T+ + +  V        +  L +  +ETLA++AY  P TR+++  +R  +   ++  L+  GL+ EAG   E  G   LY+ T  F +  GL S+ D
  S:    26 RSALEAMLLVV-DAPAPVEQLAAALDDTTERVEATLRQMSAELTARGS-GIDLRFVGDGWRFYTRTEYAPYVERVLLDGARTKLTRAALETLAVVAYRQPVTRNRVSAVRGVNVDGVMRTLLARGLIAEAGVDPETNGT--LYRTTELFLERIGLASLSD 181
>gi|167365278|ref|ZP_02299422.1| segregation and condensation protein B [Rhodopseudomonas palustris TIE-1] >gi|192291563|ref|YP_001992168.1| segregation and condensation protein B [Rhodopseudomonas palustris TIE-1] >gi|192285312|gb|ACF01693.1| segregation and condensation protein B [Rhodopseudomonas palustris TIE-1] (432 aa)
Score = 132, Expect = 2.1e-06, Identities = 37/118 (31%), Positives = 62/118 (52%)
  Q:    49 EKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           E    RG+ + ++   +   T  D++ ++       +K  L++  IE LAIIAY+ P TR +I E+R    +   L+ L+E G ++  GR +  G+P  +  T  F   F L+S+ DLP
  S:    73 EDYASRGVNLVRIANKWTFRTAGDLAWLMTRESTETRK--LSRAAIEMLAIIAYHQPITRVEIEEIRGVATSKGTLDVLLETGWIKPRGRRKTPGRPLTFGTTEAFLSQFSLESLTDLP 189
>gi|163857449|ref|YP_001631747.1| transcriptional regulator [Bordetella petrii DSM 12804] >gi|163261177|emb|CAP43479.1| predicted transcriptional regulator [Bordetella petrii] (350 aa)
Score = 132, Expect = 2.1e-06, Identities = 30/115 (26%), Positives = 63/115 (54%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + ++   ++  ++P + + +      ++    ++ ++ETLAI+A+  P TR  I ++R    +  + K +E  G +E  G  +A G+P L+  T +F D  GL ++ +LP +
  S:    55 RGMDLVQLASGWRFQSRPQMQRYLER-LNPEKPPKYSRAVMETLAIVAWRQPVTRGDIEDIRGVTVSSQIVKTLEDRGWIETIGHRDAPGRPALFGTTRQFLDDLGLRALDELPPL 169
>gi|159184880|ref|NP_354695.2| hypothetical protein Atu1707 [Agrobacterium tumefaciens str. C58] >gi|159140160|gb|AAK87480.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] (216 aa)
Score = 132, Expect = 2.2e-06, Identities = 41/114 (35%), Positives = 67/114 (58%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           +RG+ + +VG  +   T  D+S ++ +    ++K P  L++  +E LAIIAY+ P TR++I E+R    +   L+ L+E G V   GR    G+P     T +F D FGL+ ++DLP
  S:    47 ERGVNLVQVGGQWAFRTAGDLSFVIRT----EEKEPKKLSRAALEVLAIIAYHQPVTRAEIEEIRGVQTSRGTLDVLMEAGWVRFRGRRRTPGRPVTIGTTVEFLDHFGLEELRDLP 159
>gi|152981579|ref|YP_001354189.1| segregation and condensation protein B [Janthinobacterium sp. Marseille] >gi|151281656|gb|ABR90066.1| segregation and condensation protein B [Janthinobacterium sp. Marseille] (322 aa)
Score = 131, Expect = 2.6e-06, Identities = 40/137 (29%), Positives = 68/137 (49%)
  Q:    41 MEEMIFEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEE 177
           +++M+ E   D   +G+ V  +   ++  ++P++ KI       ++    +   +ETLAII Y  P TR  I E+R         K++E  G +E  G  +  G+P L+  T  F D  GL S+  LP    P Q++E+
  S:    45 IKQMLEELRDDWVDKGIEVVSLSTGWRFQSRPEM-KIYLERLNPEKPPKYSHATLETLAIITYRQPVTRGDIEEIRGVTVNSQTIKMLEDRGWIESIGHRDVPGRPALFATTKHFLDDLGLTSLDQLP----PLQQVEK 178
>gi|15839043|ref|NP_299731.1| hypothetical protein XF2452 [Xylella fastidiosa 9a5c] >gi|9107648|gb|AAF85251.1|AE004054_3 conserved hypothetical protein [Xylella fastidiosa 9a5c] (327 aa)
Score = 131, Expect = 2.9e-06, Identities = 34/116 (29%), Positives = 60/116 (51%)
  Q:    53 QRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           +R + + +V   ++   K D+   V +    ++K   ++  +ETLA+IAY  P TR +I ++R     + ++  L E   +   G  +A GKP L+  T  F D FGL  + +LP +
  S:    63 ERSVELVEVASGFRFQLKADVHAWV-TPLWTERKTKYSRATLETLALIAYRQPITRGEIEQIRGVAVNSNIIHTLEEREWIRVVGHRDAPGKPALFGTTKAFLDYFGLKRLDELPPL 178
>gi|20093120|ref|NP_619195.1| hypothetical protein MA4332 [Methanosarcina acetivorans C2A] >gi|19918457|gb|AAM07675.1| hypothetical protein (multi-domain) [Methanosarcina acetivorans C2A] (374 aa)
Score = 130, Expect = 3.3e-06, Identities = 46/152 (30%), Positives = 78/152 (51%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           +IEAALF AG   V  +KL  I+    ++    ++E++ E       G+ +  +GE Y +  KP+ S++      +++  P  L+   + TL++IAY+ P  +S + E+R +     ++ LIE G V+    S   G+      TP F D FGL
  S:     9 IIEAALFAAG-RAVSLEKLMKITGKPKKNVSLAVQELM-EVYSSRDSGIEILDLGERYVMQVKPEYSEL------MREVAPKELSAPKLRTLSMIAYHQPLLQSDLIEMRGSGAYDHIKDLIERGFVD----SVPCGRSRQLSTTPLFADYFGL 150
>gi|88855488|ref|ZP_01130152.1| hypothetical protein A20C1_01656 [marine actinobacterium PHSC20C1] >gi|88815395|gb|EAR25253.1| hypothetical protein A20C1_01656 [marine actinobacterium PHSC20C1] (229 aa)
Score = 130, Expect = 3.8e-06, Identities = 37/123 (30%), Positives = 64/123 (52%)
  Q:    46 FEYEKD-PQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           F+ E D P+RG  +R+VG  ++++ + D    V      +  + L+Q  +ETLA+IAY  P +R  +  +R  +   ++  L+  GL+ EA      G  + Y+ T       G++SI +LP I
  S:    92 FDGEGDGPRRGFELREVGGGWRIYVRSDYDAAVRDFVFTQNPSRLSQAALETLAVIAYKQPISRGAVAAVRAVNVDSVVRTLLGRGLITEAFTDNETGAIH-YETTELMLVQLGINSIAELPPI 214
>gi|32474559|ref|NP_867553.1| putative transcriptional regulator [Rhodopirellula baltica SH 1] >gi|32445098|emb|CAD75100.1| conserved hypothetical protein-putative transcriptional regulator [Rhodopirellula baltica SH 1] (297 aa)
Score = 130, Expect = 4.1e-06, Identities = 44/163 (26%), Positives = 86/163 (52%)
  Q:     6 KSVIEAALFIAGNEGV--HKDKLKSISR-LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYL---YQVTPKFYDIFGLDSIKDLPEI 168
           ++++EAALF+   E +     +L SI R  S ++   +++++   Y  + Q   +V + G  Y++   PD+  + A+  G  ++  LNQ  +E L+++AY    T +++ +LR  D   +L +++   LV E  R    G   L   +    +   + GL++I DLP +
  S:   126 EAIVEAALFVGHPENLPLTPPRLASIMRGFSPEEVVDIIDKLNASYRAERQGMRIVEQDG-GYRMVVAPDVESVRAAFTGKIRETRLNQSAVEVLSLVAYQPGITSARVTDLRGRDSGSLLNQMVRRRLV-EVKREPGEGSDKLVSRFYPAERLLVLLGLETIDDLPHV 292
>gi|187478888|ref|YP_786912.1| hypothetical protein BAV2398 [Bordetella avium 197N] >gi|115423474|emb|CAJ50008.1| conserved hypothetical protein [Bordetella avium 197N] (331 aa)
Score = 130, Expect = 4.1e-06, Identities = 30/115 (26%), Positives = 62/115 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIE-IGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           RG+ + ++   ++  ++P + + +      ++    ++ ++ETLAI+A+  P TR  I ++R    +  + K +E  G +E  G  +A G+P L+  T  F D  GL ++ +LP +
  S:    55 RGMELAQLASGWRFQSRPSMQRYLER-LNPERPPKYSRAVLETLAIVAWRQPVTRGDIEDIRGVTVSSQIVKALEDRGWIEVIGHRDAPGRPALFGTTRHFLDDLGLRALDELPPL 169
>gi|154253466|ref|YP_001414290.1| putative transcriptional regulator [Parvibaculum lavamentivorans DS-1] >gi|154157416|gb|ABS64633.1| putative transcriptional regulator [Parvibaculum lavamentivorans DS-1] (260 aa)
Score = 129, Expect = 4.4e-06, Identities = 44/131 (33%), Positives = 72/131 (54%)
  Q:    36 DFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           D  AV+E++   Y+   +RG+ + ++   +   T  D+S ++     ++Q+     GM ETLAI+AY+ P TR++I E+R    +   L+ L+E G V   GR    G+P  Y  T  F   FGL+++ DLP
  S:    77 DVGAVIEDLQTAYQ---ERGVNLVRIANKWMFRTADDLSFLMERE-AVEQRRLSRAGM-ETLAIVAYHQPVTRAEIEEIRGVSVSKGTLDVLMETGWVRLRGRRRTPGRPVTYGTTEAFLVHFGLENVGDLP 203
>gi|26991182|ref|NP_746607.1| hypothetical protein PP_4497 [Pseudomonas putida KT2440] >gi|24986229|gb|AAN70071.1|AE016647_1 conserved hypothetical protein TIGR00281 [Pseudomonas putida KT2440] (277 aa)
Score = 129, Expect = 4.5e-06, Identities = 32/115 (27%), Positives = 62/115 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           R   +++V   Y+L  + D +  V   +  ++    ++ ++ETLA+IAY  P TR +I ++R     + +++ ++E   +   G  E  G+P ++  T  F D F L S++DLP +
  S:    80 RAFELKEVASGYRLQIREDYAPWVGRLWE-ERPQRYSRALLETLALIAYRQPITRGEIEDVRGVAVNSNIIKTMMEREWIRVVGYREVPGRPAMFATTKAFLDHFNLKSLEDLPAL 194
>gi|147919563|ref|YP_686697.1| putative chromosome segregation/condensation protein B [uncultured methanogenic archaeon RC-I] >gi|110622093|emb|CAJ37371.1| putative chromosome segregation/condensation protein B [uncultured methanogenic archaeon RC-I] (197 aa)
Score = 129, Expect = 4.8e-06, Identities = 45/157 (28%), Positives = 79/157 (50%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           ++ K+++EAALF AG   +   +LK++   S      +M+++I EY        ++R  G+ Y +  KP+ S  V S         L+ G++ TL+IIAY  P  ++++  +R       +  L++ GL+E+       G+ +    TP F D FGL
  S:     2 VDEKNLLEAALFAAGGP-ITDAQLKALINRSSAYVAQIMDQLIDEYRSRGSPLEIIRLDGK-YVMQLKPEYSSKVMS----VSPKELSPGVLRTLSIIAYYQPIFQNELVNIRGQSVYDHVAVLLDRGLIEKTKE----GRSFKITTTPAFCDYFGL 148
>gi|119510036|ref|ZP_01629177.1| Predicted transcriptional regulator [Nodularia spumigena CCY9414] >gi|119465360|gb|EAW46256.1| Predicted transcriptional regulator [Nodularia spumigena CCY9414] (179 aa)
Score = 129, Expect = 4.8e-06, Identities = 45/147 (30%), Positives = 75/147 (51%)
  Q:    38 EAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIE-ELTYEEEI 184
           E +ME M     +D    +V    G  Y L  + D   +V +   ++    L  G + TLA IA N+P  +S + ELR +     + +L+E+G V +  R +   + Y  QVTPKF+  F L+ +  + E    E+++E +LT +EE+
  S:    36 EGIMELMDNYAHRDSALEVVETPTG--YSLQLRSDFQDLVQTLIPVE----LGLGALRTLAAIALNNPILQSDLIELRGSGVYQHVPELVELGFVRK--RRDNESRSYSLQVTPKFHQYFQLEQLPQILEYSHKEEQLELDLTPKEEV 175
>gi|14591635|ref|NP_143717.1| hypothetical protein PH1891 [Pyrococcus horikoshii OT3] >gi|3258330|dbj|BAA31013.1| 195aa long hypothetical protein [Pyrococcus horikoshii OT3] (195 aa)
Score = 129, Expect = 5.3e-06, Identities = 43/154 (27%), Positives = 81/154 (52%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGL 159
           K+++EAALF+AG     K+  K++   S+   E ++E +  EY +      V +  G+ + +  K + S+ V     +  K  L  G ++TLA+IA+  P  +S+I +LR +     +++L+E+GL+     +E   +  L   T KF +++G 
  S:    10 KALVEAALFVAGRPLSVKELSKALGIKSLDYLEKLIELIASEYAERKSAIEVTKVAGDKWVMQVKQEYSQRVIH---LMPKPELTAGELKTLALIAFLQPVEQSKIVKLRGSQAYEHIKRLLEMGLI----YAEPYERTKLLGTTEKFAELYGF 156
>gi|121634537|ref|YP_974782.1| hypothetical protein NMC0693 [Neisseria meningitidis FAM18] >gi|161869682|ref|YP_001598849.1| segregation and condensation protein B [Neisseria meningitidis 053442] >gi|120866243|emb|CAM09984.1| hypothetical protein [Neisseria meningitidis FAM18] >gi|161595235|gb|ABX72895.1| segregation and condensation protein B [Neisseria meningitidis 053442] (200 aa)
Score = 128, Expect = 5.6e-06, Identities = 37/100 (37%), Positives = 58/100 (57%)
  Q:    84 KQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP------EIVLPEQKIEELTYEEE 183
           +Q+ P  ++ ++ETLAIIAY  P TR  I  +R    +  +++ L + G +E  G  + +GKP L+  T  F     LD +++LP      E+VLP+      T EEE
  S:    82 EQRAPRYSRAVMETLAIIAYQQPVTRGDIEGIRGVAVSQNVMQTLQDRGWIEVIGHRDTLGKPALWATTATFLSDLRLDGLEELPPLTELGELVLPDLMEMPPTDEEE 189
>gi|15793908|ref|NP_283730.1| hypothetical protein NMA0951 [Neisseria meningitidis Z2491] >gi|121051870|emb|CAM08176.1| hypothetical protein NMA0951 [Neisseria meningitidis Z2491] (200 aa)
Score = 128, Expect = 6.7e-06, Identities = 37/100 (37%), Positives = 58/100 (57%)
  Q:    84 KQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP------EIVLPEQKIEELTYEEE 183
           +Q+ P  ++ ++ETLAIIAY  P TR  I  +R    +  +++ L + G +E  G  + +GKP L+  T  F     LD +++LP      E+VLP+      T EEE
  S:    82 EQRAPRYSRAVMETLAIIAYQQPVTRGDIEGIRGVAVSQNVIQTLQDRGWIEVIGHRDTLGKPALWATTATFLSDLRLDGLEELPPLTELGELVLPDLMEMPPTDEEE 189
>gi|28869019|ref|NP_791638.1| hypothetical protein PSPTO_1813 [Pseudomonas syringae pv. tomato str. DC3000] >gi|28852259|gb|AAO55333.1| conserved hypothetical protein TIGR00281 [Pseudomonas syringae pv. tomato str. DC3000] (257 aa)
Score = 127, Expect = 7.3e-06, Identities = 38/135 (28%), Positives = 68/135 (50%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           R   +++V   Y+L  +   S  V   +  ++    ++ M+ETLA+IAY  P TR +I ++R     + +++ L+E   +   G  +  GKP ++  T  F D F L S+ +LP    P   + E+  E  ++F D
  S:    58 RAFELKEVASGYRLQIRDRFSPWVGRLWE-ERPQRYSRAMLETLALIAYRQPITRGEIEDVRGVAVNSHIVKTLLEREWIRVVGYRDVPGKPAMFATTKGFLDHFNLKSLDELP----PLADLREMETEPVLDFED 188
>gi|11499175|ref|NP_070409.1| hypothetical protein AF1580 [Archaeoglobus fulgidus DSM 4304] >gi|2648974|gb|AAB89663.1| conserved hypothetical protein [Archaeoglobus fulgidus DSM 4304] (166 aa)
Score = 127, Expect = 7.8e-06, Identities = 46/159 (28%), Positives = 83/159 (52%)
  Q:     3 INVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDS 161
           + +K ++EA LF + +E V   +L+ I+     +    + E+I +YE      + + KVGE Y +  KP  ++ V   F +++    ++G + TLA+IA   P T +++ ++R       ++KL E GLV    ++E  G+  +   T +F   FGLDS
  S:     1 MELKKIVEAILF-SSSEPVDARELRKITGKDKVEILNAIGELIKDYESR-DTSIEIIKVGEKYLMRVKPQYAEYVER-FTVRE---FDRGTLRTLAVIALKQPITLAKVAKIRGNKCYEHVKKLQERGLV----KAEKKGRSTILTTTEEFATYFGLDS 149
>gi|119476914|ref|ZP_01617195.1| hypothetical protein GP2143_10187 [marine gamma proteobacterium HTCC2143] >gi|119449721|gb|EAW30958.1| hypothetical protein GP2143_10187 [marine gamma proteobacterium HTCC2143] (286 aa)
Score = 127, Expect = 7.9e-06, Identities = 26/79 (32%), Positives = 47/79 (59%)
  Q:    90 NQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++ ++ETL++IAY  P TR  I ++R     + +++ L+E   V   G  +  G+P +Y  T +F D F L +++DLP +
  S:    92 SRALLETLSLIAYRQPITRGDIEDIRGVAVSSNIVKTLLEREWVRVVGHKDVPGRPAMYATTRRFLDYFNLKNLEDLPTL 171
>gi|59800764|ref|YP_207476.1| hypothetical protein NGO0317 [Neisseria gonorrhoeae FA 1090] >gi|194098043|ref|YP_002001091.1| Segregation and condensation protein B [Neisseria gonorrhoeae NCCP11945] >gi|59717659|gb|AAW89064.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] >gi|193933333|gb|ACF29157.1| Segregation and condensation protein B [Neisseria gonorrhoeae NCCP11945] (200 aa)
Score = 127, Expect = 8.6e-06, Identities = 37/100 (37%), Positives = 58/100 (57%)
  Q:    84 KQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP------EIVLPEQKIEELTYEEE 183
           +Q+ P  ++ ++ETLAIIAY  P TR  I  +R    +  +++ L + G +E  G  + +GKP L+  T  F     LD +++LP      E+VLP+      T EEE
  S:    82 EQRAPRYSRAVMETLAIIAYQQPVTRGDIEGIRGVAVSQNVMQTLQDRGWIEVIGHRDTLGKPALWATTATFLSDLRLDGLEELPPLTELGELVLPDLIEMPPTDEEE 189
>gi|148546655|ref|YP_001266757.1| putative transcriptional regulator [Pseudomonas putida F1] >gi|148510713|gb|ABQ77573.1| condensin subunit ScpB [Pseudomonas putida F1] (255 aa)
Score = 127, Expect = 8.6e-06, Identities = 32/115 (27%), Positives = 62/115 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           R   +++V   Y+L  + D +  V   +  ++    ++ ++ETLA+IAY  P TR +I ++R     + +++ ++E   +   G  E  G+P ++  T  F D F L S++DLP +
  S:    58 RAFELKEVASGYRLQIREDYAPWVGRLWE-ERPQRYSRALLETLALIAYRQPITRGEIEDVRGVAVNSNIIKTMMEREWIRVVGYREVPGRPAMFATTKAFLDHFNLKSLEDLPAL 172
>gi|118589119|ref|ZP_01546526.1| chromosome segregation and condensation protein ScpB [Stappia aggregata IAM 12614] >gi|118438448|gb|EAV45082.1| chromosome segregation and condensation protein ScpB [Stappia aggregata IAM 12614] (235 aa)
Score = 126, Expect = 1.1e-05, Identities = 47/159 (29%), Positives = 87/159 (54%)
  Q:     8 VIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP 166
           ++EA LF A +E +  ++L ++      D   ++E++   Y     RG+ + KV   +   T  D++ ++     ++++  L++  +ETLAIIAY+ P TR++I E+R    +   L+ L+E   +   GR    G+P  Y  T +F   FGL++++DLP
  S:    29 MVEALLF-ASSEPLSLEEL-TLRLPEGTDVLTLLEQLQVTY---ASRGVNLVKVAGKWCFRTAEDLAYLMHRN--VEEQRKLSRAALETLAIIAYHQPVTRAEIEEIRGVSTSKGTLDVLLETTWIRMRGRRRTPGRPVTYGTTDQFLIHFGLENVRDLP 181
>gi|150396381|ref|YP_001326848.1| putative transcriptional regulator [Sinorhizobium medicae WSM419] >gi|150027896|gb|ABR60013.1| putative transcriptional regulator [Sinorhizobium medicae WSM419] (242 aa)
Score = 125, Expect = 1.2e-05, Identities = 39/114 (34%), Positives = 66/114 (57%)
  Q:    55 GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           G+ + +V +++   T  D+S +V +    ++   L++  +E LAIIAY+ P TR++I ++R    +   L+ L+E G V   GR  + G+P  +  T  F D FGL+ I+DLP I
  S:    76 GVNLVQVADHWAFRTAADLSFVVQTEE--QEVRKLSRAALEVLAIIAYHQPVTRAEIEDIRGVQTSKGTLDVLMEAGWVRFRGRRRSPGRPVTFGTTRDFLDHFGLEEIRDLPGI 188
>gi|82703436|ref|YP_413002.1| putative transcriptional regulator [Nitrosospira multiformis ATCC 25196] >gi|82411501|gb|ABB75610.1| condensin subunit ScpB [Nitrosospira multiformis ATCC 25196] (211 aa)
Score = 125, Expect = 1.2e-05, Identities = 53/180 (29%), Positives = 97/180 (53%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP-LNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLP------EIVLPEQKIEELTYEEEI 184
           VK V+EAAL +   E +   +LK +    L  +    +++E+  ++E    RG+ + +V   ++   + ++ + +       QK P  ++ ++ETLAIIAY  P TR  I E+R     + +L+ L   G +   G  E  G+P LY  T +F +  GL S+++LP       ++ P++ +E+L   E +
  S:    21 VKKVLEAAL-LTSPEPLPLAELKKLFAGELGSEILRRLLDELNRDWEG---RGVELVQVAGGWRFQARAEMQEFLDRLN--PQKPPRYSRAVLETLAIIAYRQPATRGDIEEIRGVAVASSVLKALESRGWISAVGHREVPGRPILYATTVEFLNDLGLRSLEELPPLEELGSLIEPKESVEQLPDPENM 204
>gi|71733312|ref|YP_275688.1| segregation and condensation protein B [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553865|gb|AAZ33076.1| segregation and condensation protein B [Pseudomonas syringae pv. phaseolicola 1448A] (255 aa)
Score = 125, Expect = 1.4e-05, Identities = 38/135 (28%), Positives = 68/135 (50%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           R   +++V   Y+L  +   S  V   +  ++    ++ M+ETLA+IAY  P TR +I ++R     + +++ L+E   +   G  +  GKP ++  T  F D F L S+ +LP    P   + E+  E  ++F D
  S:    58 RAFELKEVASGYRLQIRDRFSPWVGRLWE-ERPQRYSRAMLETLALIAYRQPITRGEIEDVRGVAVNSHIVKTLLEREWIRVVGYRDVPGKPAMFATTKGFLDHFNLKSLDELP----PLADLREMETEPVLDFED 188
>gi|15965280|ref|NP_385633.1| hypothetical protein SMc02069 [Sinorhizobium meliloti 1021] >gi|15074460|emb|CAC46106.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] (239 aa)
Score = 124, Expect = 1.8e-05, Identities = 39/114 (34%), Positives = 65/114 (57%)
  Q:    55 GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           G+ + +V +++   T  D+S +V +    ++   L++  +E LAIIAY+ P TR++I ++R    +   L+ L+E G V   GR    G+P  +  T  F D FGL+ I+DLP I
  S:    73 GVNLVQVADHWAFRTAADLSFVVNTDE--QEVRKLSRAALEVLAIIAYHQPVTRAEIEDIRGVQTSKGTLDVLMEAGWVRFRGRRRTPGRPVTFGTTRDFLDHFGLEEIRDLPGI 185
>gi|87306570|ref|ZP_01088717.1| hypothetical protein DSM3645_09562 [Blastopirellula marina DSM 3645] >gi|87290749|gb|EAQ82636.1| hypothetical protein DSM3645_09562 [Blastopirellula marina DSM 3645] (250 aa)
Score = 124, Expect = 2.1e-05, Identities = 34/162 (20%), Positives = 83/162 (51%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSISRL---SVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           ++++E+ LF+   +       +  +R+   +V +   ++EE+   Y +D      +   G  +++  + + +++    +G  ++  L+Q  ++ LA++AYN   TR ++ ++R     P+L +L+   L++     +   K   Y  T +F ++F L ++ DLP+
  S:    79 RTILESMLFVGSPDNAPLSAERGSARMRGVAVDEIADLVEELNQAY-RDEGCPYEIVASGGGFRMKLRDEFTRLREKFYGKVREAKLSQPAVDVLALVAYNQNVTREKVDKMRGKPSGPLLNQLVRRELLKLERTGKGKEKQKTYATTERFLEMFQLSTLDDLPQ 242
>gi|84687067|ref|ZP_01014949.1| hypothetical protein RB2654_23198 [Rhodobacterales bacterium HTCC2654] >gi|84664838|gb|EAQ11320.1| hypothetical protein RB2654_23198 [Rhodobacterales bacterium HTCC2654] (197 aa)
Score = 124, Expect = 2.1e-05, Identities = 46/159 (28%), Positives = 75/159 (47%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISR-----LSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIK-QKNPLNQGMIETLAIIAYNHPCTRSQIHEL-RKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           +EA LF +      +D  + + +     L + D  A +E   FE          V +VGE + L T+   +  + +   +  Q   L    +  LA IAY+ P TR  + E+  +T    ++ +L + GL+    RS   G PY +  T  F   FGL+S+ DLP+
  S:    26 VEAVLFASAAPVGREDLARVVGQGVSVDLLIDDLAADLEGRAFE----------VVRVGEGWMLRTRVAYAPAIRAAADVGGQSLDLRAFDVAVLAAIAYHQPITRDGLAEIFGRTISRELIGRLHDRGLIGTGPRSPRRGAPYTFVTTQGFLAAFGLESLADLPD 181
>gi|110347340|ref|YP_666157.1| putative transcriptional regulator [Mesorhizobium sp. BNC1] >gi|110287516|gb|ABG65574.1| putative transcriptional regulator [Mesorhizobium sp. BNC1] (245 aa)
Score = 123, Expect = 2.5e-05, Identities = 33/107 (30%), Positives = 50/107 (46%)
  Q:    61 VGENYKLFTKPDISKIVASGFGIK-----QKNPLNQGMIETLAIIAYNHPCTRSQIHEL-RKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPE 167
           V   ++  T+P  +  + S FG           L Q  +  L  IAY  P TR+++     K     ++  L   G++    RS   G PY Y  T  F   FGLD+++DLP+
  S:    91 VAGGFRHLTRPAYADAIRSAFGTTVGGSGGAGDLTQSEVLVLMCIAYFQPITRAELSSFFGKEISRDLIAHLRGAGMIASGPRSPTPGAPYTYVTTKAFLLEFGLDTLRDLPD 203
>gi|167034998|ref|YP_001670229.1| segregation and condensation protein B [Pseudomonas putida GB-1] >gi|166861486|gb|ABY99893.1| segregation and condensation protein B [Pseudomonas putida GB-1] (256 aa)
Score = 122, Expect = 2.8e-05, Identities = 31/115 (26%), Positives = 62/115 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           R   +++V   Y+L  + D +  V   +  ++    ++ ++ETLA+IAY  P TR +I ++R     + +++ ++E   +   G  E  G+P ++  T  F D F L S+++LP +
  S:    58 RAFELKEVASGYRLQIREDYAPWVGRLWE-ERPQRYSRALLETLALIAYRQPITRGEIEDVRGVAVNSNIIKTMMEREWIRVVGYREVPGRPAMFATTKAFLDHFNLKSLEELPAL 172
>gi|186685111|ref|YP_001868307.1| putative transcriptional regulator [Nostoc punctiforme PCC 73102] >gi|186467563|gb|ACC83364.1| putative transcriptional regulator [Nostoc punctiforme PCC 73102] (180 aa)
Score = 122, Expect = 3.3e-05, Identities = 47/161 (29%), Positives = 77/161 (47%)
  Q:     9 IEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQR--GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIV 169
           IEA L++ G        L  I+  +  D  AV E +I   +    R   L V +  + Y L  + D   +V +   ++    L  G + TLA IA N P  +S +  LR +     + +L+E+G + +  R ++  + Y  QVTPKF+  F    I+ LP+I+
  S:     9 IEAILYLKGK----PLSLGEIAEYAACDRAAVKEGIIELMDNYAHRDSALEVIETPDGYSLQLRSDFQDLVQTMIPVE----LGVGALRTLAAIALNSPILQSDLINLRGSGVYQHVPELVELGFIRK--RRDSDSRSYSLQVTPKFHQYF---QIEQLPQIL 158
>gi|66046812|ref|YP_236653.1| hypothetical protein Psyr_3583 [Pseudomonas syringae pv. syringae B728a] >gi|63257519|gb|AAY38615.1| Conserved hypothetical protein 281 [Pseudomonas syringae pv. syringae B728a] (255 aa)
Score = 122, Expect = 3.4e-05, Identities = 37/133 (27%), Positives = 67/133 (50%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINF 186
           R   +++V   Y+L  +   S  V   +  ++    ++ M+ETLA+IAY  P TR +I ++R     + +++ L+E   +   G  +  GKP ++  T  F D F L S+ +LP    P   + E+  E  ++F
  S:    58 RAFELKEVASGYRLQIRDRFSPWVGRLWE-ERPQRYSRAMLETLALIAYRQPITRGEIEDVRGVAVNSHIVKTLLEREWIRVVGYRDVPGKPAMFATTKGFLDHFNLKSLDELP----PLADLREMETEPVLDF 186
>gi|104782897|ref|YP_609395.1| hypothetical protein PSEEN3901 [Pseudomonas entomophila L48] >gi|95111884|emb|CAK16608.1| conserved hypothetical protein [Pseudomonas entomophila L48] (256 aa)
Score = 122, Expect = 3.5e-05, Identities = 31/115 (26%), Positives = 61/115 (53%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           R   +++V   Y+L  + D +  V   +  ++    ++ ++ET+A+IAY  P TR +I ++R     + +++ L+E   +   G  E  G+P ++  T  F D F L S+ +LP +
  S:    58 RAFELKEVASGYRLQIREDYAPWVGRLWE-ERPQRYSRALLETMALIAYRQPITRGEIEDVRGVAVNSNIIKTLMEREWIRIVGYREVPGRPAMFATTKAFLDHFNLKSLDELPAL 172
>gi|194366463|ref|YP_002029073.1| segregation and condensation protein B [Stenotrophomonas maltophilia R551-3] >gi|194349267|gb|ACF52390.1| segregation and condensation protein B [Stenotrophomonas maltophilia R551-3] (291 aa)
Score = 121, Expect = 3.8e-05, Identities = 28/85 (32%), Positives = 46/85 (54%)
  Q:    84 KQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           ++K    +  +ETLA+IAY  P TR +I ++R     + +++ L E   +   G  +  GKP L+  T  F D FGL  + +LP +
  S:    84 ERKTRYTRATLETLALIAYRQPITRGEIEQVRGVAVSSNIIQALEEREWIRVVGHRDVPGKPALFGTTKGFLDYFGLKRLDELPPL 169
>gi|149174511|ref|ZP_01853137.1| hypothetical protein PM8797T_09569 [Planctomyces maris DSM 8797] >gi|148846621|gb|EDL60958.1| hypothetical protein PM8797T_09569 [Planctomyces maris DSM 8797] (251 aa)
Score = 121, Expect = 4.4e-05, Identities = 48/163 (29%), Positives = 82/163 (50%)
  Q:     6 KSVIEAALFIAGNEGVHKDKLKSI--SRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKN-PLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           + +IEAALF+ G     K KL S+     S    + +++++  +Y ++  R   +R     Y+L  + D  +I    +G   K   L+Q  +E LA++AY  P ++ QI E  K     +L +L+   L+    R+E       Y  T +F  +FGL +I++LP I
  S:    83 RHIIEAALFVGGKPLTTK-KLCSLLNDEYSSSYVDDLLDDLNRQYIEEA-RPYEIRMEEGGYRLILRHDFERIRNRVYGFGPKEVKLSQDALEVLALVAYQQPISKEQIIEAGKDKANGILRQLLRRELIA-IERNEDKKAEVKYITTARFLQVFGLGNIEELPYI 245
>gi|16126247|ref|NP_420811.1| hypothetical protein CC_2004 [Caulobacter crescentus CB15] >gi|13423475|gb|AAK23979.1| conserved hypothetical protein [Caulobacter crescentus CB15] (221 aa)
Score = 120, Expect = 4.9e-05, Identities = 49/164 (29%), Positives = 84/164 (51%)
  Q:     5 VKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNP--LNQGMIETLAIIAYNHPCTRSQIHELRKTDPTP-MLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEI 168
           V+  IEA LF A       D  K +   +  D  A ++ +   YE    RG+ +  V   ++  T  D+S ++      +++ P  L++   ETLAI+AY+ P TR++I  +R    +   ++ L+E+GL+   GR    G+P  +  T  F + +GL ++ DLP I
  S:     9 VERCIEALLFAAAEPLSDVDLAKRLPEGA--DIAAGIDALRVRYEG---RGVELACVAGRWRFQTAADLSFLMTE----EREEPRRLSKAAQETLAIVAYHQPVTRAEIEAVRGVQASRGTIDVLLELGLIRMRGRRRTPGRPVTFGTTDAFMEHYGLATLADLPGI 166
>gi|75908629|ref|YP_322925.1| condensin subunit ScpB [Anabaena variabilis ATCC 29413] >gi|75702354|gb|ABA22030.1| condensin subunit ScpB [Anabaena variabilis ATCC 29413] (177 aa)
Score = 120, Expect = 5.6e-05, Identities = 50/178 (28%), Positives = 83/178 (46%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQR--GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           M+    + IEA L++ G        +  I+  +  D   V E +I   +    R   L V +  + Y L  + D   +V +   ++    L  G + TLA IA N P  +S + ELR +     + +L+E+G V +  R +   + Y  QVTPKF+  F    I+ LP+    +QK ++L
  S:     1 MNTATATKIEAILYLKGK----PLSVSEIAEYAACDRATVEEGIIELMDSYAHRDSALEVVETTDGYSLQLRSDFQDLVQTMIPVE----LGLGALRTLAAIALNSPILQSDLIELRGSGVYQHVPELVELGFVRK--RRDNESRSYSLQVTPKFHQYF---QIEQLPQPFDNDQKEQQL 167
>gi|67155816|ref|ZP_00417443.1| Conserved hypothetical protein 281 [Azotobacter vinelandii AvOP] >gi|67086760|gb|EAM06228.1| Conserved hypothetical protein 281 [Azotobacter vinelandii AvOP] (263 aa)
Score = 120, Expect = 5.8e-05, Identities = 32/117 (27%), Positives = 59/117 (50%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVL 170
           R   +++V   Y+L  +   +  V   +  ++    ++ ++ETLA+IAY  P +R +I E+R     + ++  L E   +   G  E  G+P L+  T  F D F L S+ +LP + +
  S:    58 RAFELKEVASGYRLQVRERFAPWVGRLWE-ERPQRYSRALLETLALIAYRQPISRGEIEEVRGVAVSSNIIRTLQEREWIRVVGYREVPGRPALFATTRAFLDHFNLKSLDELPPLAV 174
>gi|77457717|ref|YP_347222.1| condensin subunit ScpB [Pseudomonas fluorescens PfO-1] >gi|77381720|gb|ABA73233.1| condensin subunit ScpB [Pseudomonas fluorescens PfO-1] (337 aa)
Score = 119, Expect = 6.3e-05, Identities = 35/135 (25%), Positives = 69/135 (51%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           R   +++V   Y+L  +   +  V   +  ++    ++ ++ET+A+IAY  P TR +I ++R     T +++ L+E   +   G  +  GKP ++  T  F D F L ++ DLP    P  ++ E+  +  ++F D
  S:    58 RAFELKEVASGYRLQIREKFAPWVGRLWE-ERPQRYSRALLETMALIAYRQPITRGEIEDVRGVAVNTNIVKTLMEREWIRIVGYRDVPGKPAMFATTKAFLDHFNLKNLDDLP----PLAELREIEADPVLDFDD 188
>gi|70728992|ref|YP_258726.1| segregation and condensation protein B [Pseudomonas fluorescens Pf-5] >gi|68343291|gb|AAY90897.1| segregation and condensation protein B [Pseudomonas fluorescens Pf-5] (343 aa)
Score = 119, Expect = 6.4e-05, Identities = 36/135 (26%), Positives = 68/135 (50%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTD-PTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           R   +++V   Y+L  +   +  V   +  ++    ++ M+ET+A+IAY  P TR +I ++R     + +++ L+E   +   G  +  GKP ++  T  F D F L ++ DLP    P  ++ E+  E  + F D
  S:    58 RAFELKEVASGYRLQIREKFAPWVGRLWE-ERPQRYSRAMLETMALIAYRQPITRGEIEDVRGVAVNSHIVKTLLEREWIRVVGYRDVPGKPAMFATTKAFLDHFNLKNLDDLP----PLAELREIEAEPVLEFDD 188
>gi|17232658|ref|NP_489206.1| hypothetical protein all5166 [Nostoc sp. PCC 7120] >gi|17134304|dbj|BAB76865.1| all5166 [Nostoc sp. PCC 7120] (198 aa)
Score = 118, Expect = 8.0e-05, Identities = 50/178 (28%), Positives = 83/178 (46%)
  Q:     1 MSINVKSVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQR--GLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEEL 178
           M+    + IEA L++ G        +  I+  +  D   V E +I   +    R   L V +  + Y L  + D   +V +   ++    L  G + TLA IA N P  +S + ELR +     + +L+E+G V +  R +   + Y  QVTPKF+  F    I+ LP+    +QK ++L
  S:     1 MNTATATKIEAILYLKGK----PLSVGEIAEYAACDRATVEEGIIELMDSYAHRDSALEVVETTDGYSLQLRSDFQDLVQTMIPVE----LGLGALRTLAAIALNSPILQSDLIELRGSGVYQHVPELVELGFVRK--RRDNESRSYSLQVTPKFHQYF---QIEQLPQPFDNDQKEQQL 167
>gi|146306870|ref|YP_001187335.1| condensin subunit ScpB [Pseudomonas mendocina ymp] >gi|145575071|gb|ABP84603.1| condensin subunit ScpB [Pseudomonas mendocina ymp] (264 aa)
Score = 118, Expect = 8.2e-05, Identities = 37/135 (27%), Positives = 65/135 (48%)
  Q:    54 RGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEK-LIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFD 188
           R   +++V   Y+L  +   +  V   +  ++    ++ ++ETLA+IAY  P TR +I ++R       + K L+E   +   G  +  G+P ++  T  F D F L S+ +LP    P   + EL  E E+   D
  S:    58 RAFELKEVASGYRLQVRERFAPWVGRLWE-ERPQRYSRALLETLALIAYRQPITRGEIEDVRGVAVNSNITKTLLEREWIRVVGYRDVPGRPAMFATTKGFLDHFNLKSLDELP----PLAALRELGPEPELALDD 188
>gi|150021182|ref|YP_001306536.1| putative transcriptional regulator [Thermosipho melanesiensis BI429] >gi|149793703|gb|ABR31151.1| putative transcriptional regulator [Thermosipho melanesiensis BI429] (181 aa)
Score = 118, Expect = 9.6e-05, Identities = 49/191 (25%), Positives = 93/191 (48%)
  Q:     7 SVIEAALFIAGNEGVHKDKLKSISRLSVQDFEAVMEEMIFEYEKDPQRGLVVRKVGENYKLFTKPDISKIVASGFGIKQKNPLNQGMIETLAIIAYNHPCTRSQIHELRKTDPTPMLEKLIEIGLVEEAGRSEAVGKPYLYQVTPKFYDIFGLDSIKDLPEIVLPEQKIEELTYEEEINFFDTNREDNGDE 197
           ++IE+ +F   ++G+ K+K+  I+++S +DF+ +++ +  +Y  + + G+ +R +   +K FTK   +  +      +  N L    +E + ++A     T+ QI E+R  D T +L++L+  G+V    +    G+ Y+Y +T  F +                E  IEEL  E     FDT R  N  E
  S:     7 AIIESLIF--ASKGIQKEKILEIAQVSEKDFDDIVKILEQKYNLNNESGIELRNIDGFFKFFTKKKYAIYIEKIIKRRSLNTLTTSQLEIVILLASKKKATKRQIDEIRGKDSTNILKQLLMSGVV----KRRKSGRSYIYSLTDTFKE----------------ETFIEELLDELGGVHFDTERSQNDIE 175