>gi|26553492|ref|NP_757426.1| hypothetical protein MYPE400 [Mycoplasma penetrans HF-2] >gi|29611891|sp|Q8EX10|Y040_MYCPE UPF0154 protein MYPE400 >gi|26453498|dbj|BAC43830.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (75 aa)
Score = 330, Expect = 1.3e-29, Identities = 75/75 (100%), Positives = 75/75 (100%)
  Q:     1 MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK
  S:     1 MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
>gi|31544774|ref|NP_853352.1| hypothetical protein MGA_0340 [Mycoplasma gallisepticum R] >gi|39932493|sp|Q7NAR5|Y570_MYCGA UPF0154 protein MYCGA5700 >gi|31541620|gb|AAP56920.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (73 aa)
Score = 213, Expect = 5.5e-16, Identities = 40/73 (54%), Positives = 58/73 (79%)
  Q:     3 LAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           + +GL LGL IP+ LI+GA +GY+ + K FK+Q+++NPPITE+QIR++Y QMGRKP+E Q+KQ+M  + K  K
  S:     1 MVLGLALGLSIPLCLIVGAFVGYFVSMKVFKRQMRKNPPITEAQIRSLYAQMGRKPSEAQVKQMMRAYTKETK 73
>gi|29611968|sp|Q9EXD7|Y482_MYCPN UPF0154 protein MG335.1 homolog (73 aa)
Score = 199, Expect = 2.0e-14, Identities = 39/67 (58%), Positives = 56/67 (83%)
  Q:     5 IGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           + L LGLGIP+SL++G +IGY+ + K FKKQ+++NPPITE+QI+AMY +MGRK +E Q+K+IM + K
  S:     4 LALALGLGIPLSLLVGVIIGYFISIKIFKKQIRDNPPITENQIKAMYAKMGRKLSETQVKEIMRSIK 70
>gi|12045193|ref|NP_073004.1| hypothetical protein MG_516 [Mycoplasma genitalium G37] >gi|66879739|ref|ZP_00404733.1| COG3763: Uncharacterized protein conserved in bacteria [Mycoplasma genitalium G-37] >gi|6226363|sp|Q49310|Y335A_MYCGE UPF0154 protein MG335.1 >gi|3844916|gb|AAC71560.1| hypothetical protein MG_516 [Mycoplasma genitalium G37] >gi|166078846|gb|ABY79464.1| conserved hypothetical protein [synthetic Mycoplasma genitalium JCVI-1.0] (73 aa)
Score = 196, Expect = 5.0e-14, Identities = 38/67 (56%), Positives = 56/67 (83%)
  Q:     5 IGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           + L LGLGIP+SL++G ++GY+ + K FKKQ+++NPPITE+QI+AMY +MGRK +E Q+K+IM + K
  S:     4 LALALGLGIPLSLLVGMILGYFISIKIFKKQMRDNPPITENQIKAMYAKMGRKLSETQVKEIMRSIK 70
>gi|47459280|ref|YP_016142.1| hypothetical protein MMOB4450 [Mycoplasma mobile 163K] >gi|81614190|sp|Q6KHJ9|Y4450_MYCMO UPF0154 protein MMOB4450 >gi|47458610|gb|AAT27931.1| conserved hypothetical protein [Mycoplasma mobile 163K] (75 aa)
Score = 186, Expect = 7.4e-13, Identities = 38/71 (53%), Positives = 52/71 (73%)
  Q:     1 MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           + LAIGL +GL I  + I+G V+G++   +YF+KQL+ENPPI E  IRAM+ QMGRKP+E  IK +M + K
  S:     3 IGLAIGLIVGLSILFT-IVGLVVGFFLTKRYFEKQLRENPPINEKMIRAMFLQMGRKPSESHIKSVMRSMK 72
>gi|162447541|ref|YP_001620673.1| putative surface-anchored protein [Acholeplasma laidlawii PG-8A] >gi|161985648|gb|ABX81297.1| conserved hypothetical surface-anchored protein [Acholeplasma laidlawii PG-8A] (72 aa)
Score = 179, Expect = 4.2e-12, Identities = 31/60 (51%), Positives = 48/60 (80%)
  Q:    16 SLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           +L+IGAV G++ A  +FKK L++NPP+ E  IR M++QMGR P+EKQ++Q++A+ K+N K
  S:    13 ALLIGAVAGFFIARAWFKKYLEKNPPMDERSIREMFRQMGRTPSEKQVRQVLASMKQNTK 72
>gi|13508221|ref|NP_110170.1| hypothetical protein MPN482 [Mycoplasma pneumoniae M129] >gi|11379529|gb|AAG34745.1|AE000034_8 conserved hypothetical protein [Mycoplasma pneumoniae M129] (64 aa)
Score = 178, Expect = 5.0e-12, Identities = 35/61 (57%), Positives = 52/61 (85%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           +GIP+SL++G +IGY+ + K FKKQ+++NPPITE+QI+AMY +MGRK +E Q+K+IM + K
  S:     1 MGIPLSLLVGVIIGYFISIKIFKKQIRDNPPITENQIKAMYAKMGRKLSETQVKEIMRSIK 61
>gi|160915965|ref|ZP_02078173.1| hypothetical protein EUBDOL_01990 [Eubacterium dolichum DSM 3991] >gi|158432441|gb|EDP10730.1| hypothetical protein EUBDOL_01990 [Eubacterium dolichum DSM 3991] (71 aa)
Score = 178, Expect = 5.6e-12, Identities = 35/59 (59%), Positives = 44/59 (74%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKN 73
           + L+IG  +G+YF  K F+K+LKENPPI E  IRAM+ QMGRKP+E QIKQIM +   N
  S:    12 VGLVIGGFLGFYFTRKKFEKELKENPPINEKMIRAMFLQMGRKPSEAQIKQIMKSVNAN 70
>gi|167941411|ref|ZP_02528486.1| hypothetical protein Uures_02140 [Ureaplasma urealyticum serovar 8] >gi|167960027|ref|ZP_02547095.1| hypothetical protein Uurese_01000007_0200003147 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973105|ref|ZP_02555382.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974819|ref|ZP_02557096.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167976018|ref|ZP_02558295.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988517|ref|ZP_02570188.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337312|ref|ZP_02693927.1| hypothetical protein Uureaserovar_00635 [Ureaplasma urealyticum serovar 10] >gi|168361988|ref|ZP_02695167.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168807522|ref|ZP_02828581.1| hypothetical protein Uurealyserovar_00595 [Ureaplasma urealyticum serovar 2] >gi|195867669|ref|ZP_03079671.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903349|gb|EDT49638.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209048|gb|EDU06091.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018839|gb|EDU56879.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997741|gb|EDU66838.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659657|gb|EDX53037.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660726|gb|EDX53981.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (109 aa)
Score = 176, Expect = 8.6e-12, Identities = 36/65 (55%), Positives = 50/65 (76%)
  Q:     2 ALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQI 66
           +LA+GL  G+GI + LI G VIGY+ + K  K+QLK+NPPI++  IR +YQQ+GRKP+E QI +I
  S:    39 SLAVGL--GIGIVLFLIAGLVIGYFVSMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEI 101
>gi|13357825|ref|NP_078099.1| hypothetical protein UU265 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762041|ref|YP_001752348.1| hypothetical protein UPA3_0273 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189039760|sp|B1AIQ4|Y273_UREP2 UPF0154 protein UPA3_0273 >gi|13959652|sp|Q9PQM6|Y265_UREPA UPF0154 protein UU265 >gi|11356789|pir||C82913 conserved hypothetical UU265 [imported] - Ureaplasma urealyticum >gi|6899236|gb|AAF30674.1|AE002123_7 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827618|gb|ACA32880.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] (109 aa)
Score = 176, Expect = 1.1e-11, Identities = 35/65 (53%), Positives = 50/65 (76%)
  Q:     2 ALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQI 66
           +LA+GL  G+GI + LI G +IGY+ + K  K+QLK+NPPI++  IR +YQQ+GRKP+E QI +I
  S:    39 SLAVGL--GIGIVLFLIAGLIIGYFISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEI 101
>gi|167971953|ref|ZP_02554230.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282427|ref|ZP_02690094.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308580|ref|ZP_02691255.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902458|gb|EDT48747.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675606|gb|EDT87511.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700748|gb|EDU19030.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (109 aa)
Score = 175, Expect = 1.2e-11, Identities = 35/65 (53%), Positives = 50/65 (76%)
  Q:     2 ALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQI 66
           +LA+GL  G+GI + LI G +IGY+ + K  K+QLK+NPPI++  IR +YQQ+GRKP+E QI +I
  S:    39 SLAVGL--GIGIVLFLIAGLIIGYFISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEI 101
>gi|406440|gb|AAD12474.1| unknown [Mycoplasma genitalium] (63 aa)
Score = 174, Expect = 1.9e-11, Identities = 34/60 (56%), Positives = 51/60 (85%)
  Q:    12 GIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           GIP+SL++G ++GY+ + K FKKQ+++NPPITE+QI+AMY +MGRK +E Q+K+IM + K
  S:     1 GIPLSLLVGMILGYFISIKIFKKQMRDNPPITENQIKAMYAKMGRKLSETQVKEIMRSIK 60
>gi|110004683|emb|CAK99018.1| conserved hypothetical upf0154 transmembrane protein [Spiroplasma citri] (71 aa)
Score = 172, Expect = 3.0e-11, Identities = 36/67 (53%), Positives = 49/67 (73%)
  Q:     6 GLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           GL +G+G    L+IG V+G+    K  +KQL++NPPITE QIRAMY QMGRKP+E  IK++M + K+
  S:     6 GLIIGIG---CLVIGGVLGFLITKKNVQKQLRDNPPITEKQIRAMYMQMGRKPSEADIKKVMNSMKR 69
>gi|167756994|ref|ZP_02429121.1| hypothetical protein CLORAM_02543 [Clostridium ramosum DSM 1402] >gi|167703169|gb|EDS17748.1| hypothetical protein CLORAM_02543 [Clostridium ramosum DSM 1402] (66 aa)
Score = 160, Expect = 7.0e-10, Identities = 35/59 (59%), Positives = 47/59 (79%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMAT 69
           L I + LI+GA+IG++ A   FKKQL++NPPI E  IRAMY +MGRKP+E QIK+IM++
  S:     2 LNIILGLIVGAIIGFFAARYMFKKQLQKNPPINEKMIRAMYMEMGRKPSEAQIKKIMSS 60
>gi|152002550|dbj|BAF73574.1| hypothetical protein [Onion yellows phytoplasma OY-W] (71 aa)
Score = 159, Expect = 8.8e-10, Identities = 29/58 (50%), Positives = 45/58 (77%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           I  ++G V+G +   ++FKK L++NPPI+E QI+ M++QMGR P+EKQI+QIM + K+
  S:    12 IGFLLGGVLGAFLMFRWFKKHLQQNPPISEKQIKEMFRQMGRTPSEKQIRQIMNSMKQ 69
>gi|15828617|ref|NP_325977.1| hypothetical protein MYPU_1460 [Mycoplasma pulmonis UAB CTIP] >gi|29611901|sp|Q98R64|Y146_MYCPU UPF0154 protein MYPU_1460 >gi|14089559|emb|CAC13319.1| conserved hypothetical protein [Mycoplasma pulmonis] (75 aa)
Score = 159, Expect = 9.2e-10, Identities = 34/72 (47%), Positives = 51/72 (70%)
  Q:     1 MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           + LA+GL +GL I +  IIG V+ ++   + F+KQLKENPPI E  IRAM+ QMG K +E +I+Q+M + ++
  S:     3 IGLAVGLIVGLSI-LFFIIGGVVAFFVTRRLFQKQLKENPPINEKMIRAMFLQMGVKASESRIRQVMRSMQQ 73
>gi|50365164|ref|YP_053589.1| unknown transmembrane protein [Mesoplasma florum L1] >gi|50363720|gb|AAT75705.1| unknown transmembrane protein [Mesoplasma florum L1] (83 aa)
Score = 158, Expect = 1.1e-09, Identities = 35/74 (47%), Positives = 49/74 (66%)
  Q:     2 ALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
            + IG+ LG     ++I+GA+IG++      KKQLK+NPP+TE QIRAMY  MGRKP+E  IK+ M   ++  K
  S:    15 GMLIGVILG-----AIILGAIIGFFITRAMVKKQLKDNPPVTEKQIRAMYMSMGRKPSESDIKKTMRAMQQAKK 83
>gi|39938784|ref|NP_950550.1| hypothetical protein PAM298 [Onion yellows phytoplasma OY-M] >gi|39721893|dbj|BAD04383.1| uncharacterized BCR [Onion yellows phytoplasma OY-M] (71 aa)
Score = 158, Expect = 1.2e-09, Identities = 29/58 (50%), Positives = 44/58 (75%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           I  ++G V+G +    +FKK L++NPPI+E QI+ M++QMGR P+EKQI+QIM + K+
  S:    12 IGFLLGGVLGAFLMFHWFKKHLQQNPPISEKQIKEMFRQMGRTPSEKQIRQIMNSMKQ 69
>gi|54020260|ref|YP_116122.1| hypothetical protein mhp614 [Mycoplasma hyopneumoniae 232] >gi|53987433|gb|AAV27634.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] >gi|144227714|gb|AAZ44678.2| conserved hypothetical protein [Mycoplasma hyopneumoniae J] >gi|144575543|gb|AAZ53957.2| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (100 aa)
Score = 156, Expect = 2.0e-09, Identities = 32/61 (52%), Positives = 43/61 (70%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I  I+G +I    + K F+KQ++ENPPITE+ IRAMY QMGRKP+E QI+ +M + K   K
  S:    40 ILFIVGGIIALVVSKKMFEKQIRENPPITENMIRAMYMQMGRKPSEAQIRAVMRSVKNAKK 100
>gi|71893943|ref|YP_279389.1| hypothetical protein MHJ_0594 [Mycoplasma hyopneumoniae J] >gi|72080922|ref|YP_287980.1| hypothetical protein MHP7448_0594 [Mycoplasma hyopneumoniae 7448] (82 aa)
Score = 156, Expect = 2.1e-09, Identities = 32/61 (52%), Positives = 43/61 (70%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I  I+G +I    + K F+KQ++ENPPITE+ IRAMY QMGRKP+E QI+ +M + K   K
  S:    22 ILFIVGGIIALVVSKKMFEKQIRENPPITENMIRAMYMQMGRKPSEAQIRAVMRSVKNAKK 82
>gi|85057705|ref|YP_456621.1| hypothetical protein AYWB_425 [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789810|gb|ABC65542.1| conserved hypothetical protein [Aster yellows witches'-broom phytoplasma AYWB] (71 aa)
Score = 152, Expect = 6.2e-09, Identities = 28/58 (48%), Positives = 43/58 (74%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           I  ++G   G +   ++FKK L++NPPI+E QI+ M++QMGR P+EKQI+QIM + K+
  S:    12 IGFLLGGAFGAFLMFRWFKKHLQKNPPISEKQIKEMFRQMGRTPSEKQIRQIMNSMKQ 69
>gi|161507697|ref|YP_001577653.1| hypothetical protein lhv_1362 [Lactobacillus helveticus DPC 4571] >gi|172048314|sp|A8YVS5|Y1362_LACH4 UPF0154 protein lhv_1362 >gi|160348686|gb|ABX27360.1| hypothetical protein lhv_1362 [Lactobacillus helveticus DPC 4571] (72 aa)
Score = 146, Expect = 2.8e-08, Identities = 35/73 (47%), Positives = 48/73 (65%)
  Q:     3 LAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           + +GL + L I I+L++GAV G+Y A  Y KK  KENPPI+E  I AM  QMG+KP+ K++ Q+M   K   K
  S:     1 MNLGLAIFL-IIIALLVGAVAGFYGARAYMKKYFKENPPISEDMIVAMMSQMGQKPSNKKVHQVMNMMKHQQK 72
>gi|184155186|ref|YP_001843526.1| hypothetical protein LAF_0710 [Lactobacillus fermentum IFO 3956] >gi|183226530|dbj|BAG27046.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956] (84 aa)
Score = 144, Expect = 4.5e-08, Identities = 28/73 (38%), Positives = 50/73 (68%)
  Q:     3 LAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           + +GL + L I + +++GA+IG++ A +Y +  L+ NPPI+E  +R M  QMG+KP+++++ Q+M T K   K
  S:     8 ITVGLTIALVI-LGILVGALIGFFGARRYMENYLRNNPPISEDMLRTMMLQMGQKPSDRKLHQMMQTMKSQAK 79
>gi|171853874|emb|CAM11836.1| Conserved hypothetical protein [Candidatus Phytoplasma australiense] (68 aa)
Score = 144, Expect = 4.6e-08, Identities = 31/62 (50%), Positives = 47/62 (75%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           LGI I +++GA + +Y    +FKK L++NPPI E QI+ M++QMGR P+EKQI+QI+ + K+
  S:     9 LGILIGMVLGAFLMFY----WFKKYLQKNPPINERQIKEMFRQMGRTPSEKQIRQIINSMKQ 66
>gi|116492638|ref|YP_804373.1| hypothetical protein PEPE_0872 [Pediococcus pentosaceus ATCC 25745] >gi|122265898|sp|Q03FU1|Y872_PEDPA UPF0154 protein PEPE_0872 >gi|116102788|gb|ABJ67931.1| hypothetical protein PEPE_0872 [Pediococcus pentosaceus ATCC 25745] (73 aa)
Score = 142, Expect = 7.6e-08, Identities = 27/61 (44%), Positives = 43/61 (70%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I+L++GAV G++FA +Y +  LK NPPI E  +R M  QMG+KP++K++ Q+M   +  +K
  S:    12 IALLVGAVGGFFFARRYMENYLKNNPPINEDMLRTMMLQMGQKPSQKKLHQMMTAMQNQSK 72
>gi|58337554|ref|YP_194139.1| hypothetical protein LBA1278 [Lactobacillus acidophilus NCFM] >gi|75357523|sp|Q5FJL6|Y1278_LACAC UPF0154 protein LBA1278 >gi|58254871|gb|AAV43108.1| hypothetical protein LBA1278 [Lactobacillus acidophilus NCFM] (72 aa)
Score = 141, Expect = 1.0e-07, Identities = 31/63 (49%), Positives = 41/63 (65%)
  Q:    13 IPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I I+L++GA  G+Y A  Y KK  KENPPI+E  I AM  QMG+KP+ K++ Q+M   K   K
  S:    10 IIIALLVGATAGFYGARAYMKKYFKENPPISEEMIVAMMSQMGQKPSNKKVHQVMNMMKHQQK 72
>gi|116333962|ref|YP_795489.1| hypothetical protein LVIS_1358 [Lactobacillus brevis ATCC 367] >gi|122269354|sp|Q03QR4|Y1358_LACBA UPF0154 protein LVIS_1358 >gi|116099309|gb|ABJ64458.1| hypothetical protein LVIS_1358 [Lactobacillus brevis ATCC 367] (74 aa)
Score = 138, Expect = 2.8e-07, Identities = 29/63 (46%), Positives = 46/63 (73%)
  Q:    13 IPISLIIG---AVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I I +++G   A  G+Y A KY +  LK+NPPI E Q+RAM  QMG+KP+++++ Q+MA  ++N +
  S:     7 ILIVIVVGLACAAGGFYGARKYMENYLKDNPPINEDQLRAMMLQMGQKPSQRKLHQMMAAMQQNAR 72
>gi|81428884|ref|YP_395884.1| putative small extracellular protein precursor [Lactobacillus sakei subsp. sakei 23K] >gi|123564045|sp|Q38W56|Y1273_LACSS UPF0154 protein LSA1273 >gi|78610526|emb|CAI55577.1| Hypothetical small extracellular protein precursor [Lactobacillus sakei subsp. sakei 23K] (76 aa)
Score = 135, Expect = 5.2e-07, Identities = 30/67 (44%), Positives = 48/67 (71%)
  Q:     9 LGLGIPISLI---IGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           +G+G+ I +I   +GAV G++ A  Y KK  +ENPP+ E  ++AM  QMG+KP+EK++ Q+M++ K   K
  S:     3 IGIGVLIFVIGALLGAVAGFFGARAYMKKYFEENPPVNEDMLKAMMMQMGQKPSEKKLNQMMSSMKAQQK 72
>gi|29376284|ref|NP_815438.1| hypothetical protein EF1734 [Enterococcus faecalis V583] >gi|38258724|sp|Q834D2|Y1734_ENTFA UPF0154 protein EF_1734 >gi|29343747|gb|AAO81508.1| conserved hypothetical protein [Enterococcus faecalis V583] (72 aa)
Score = 133, Expect = 1.0e-06, Identities = 25/61 (40%), Positives = 40/61 (65%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I+L++GA  G++ A KY +   K+NPP+ E  +R M   MG+KP+EK+++Q+M   K   K
  S:    12 IALLVGAAGGFFLARKYMQDYFKKNPPVNEDMLRMMMASMGQKPSEKKVRQMMQQMKNQGK 72
>gi|194246637|ref|YP_002004276.1| Conserved hypothetical protein [Candidatus Phytoplasma mali] >gi|193806994|emb|CAP18429.1| Conserved hypothetical protein [Candidatus Phytoplasma mali] (65 aa)
Score = 133, Expect = 1.0e-06, Identities = 29/56 (51%), Positives = 39/56 (69%)
  Q:    17 LIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           L +G +IG       F+K L +NPP+ E QIR M++QMGR P+EKQIKQI+ + KK
  S:     8 LFLGTIIGAVSMFFGFRKYLTKNPPVNEKQIREMFKQMGRTPSEKQIKQIVESMKK 63
>gi|83319560|ref|YP_424577.1| hypothetical protein MCAP_0609 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283446|gb|ABC01378.1| Uncharacterised membrane protein, UPF0154 family [Mycoplasma capricolum subsp. capricolum ATCC 27343] (81 aa)
Score = 132, Expect = 1.2e-06, Identities = 29/40 (72%), Positives = 31/40 (77%)
  Q:    33 KKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           KKQLKENPPITE QIRAMY  MGRKP+E  IK+ M   KK
  S:    40 KKQLKENPPITEKQIRAMYMSMGRKPSEADIKKTMNAIKK 79
>gi|42560913|ref|NP_975364.1| hypothetical protein MSC_0371 [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492410|emb|CAE77006.1| conserved hypothetical transmembrane protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (81 aa)
Score = 131, Expect = 1.5e-06, Identities = 27/40 (67%), Positives = 31/40 (77%)
  Q:    33 KKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           KKQLK+NPPITE QIRAMY  MGRKP+E  IK+ M   K+
  S:    40 KKQLKDNPPITEKQIRAMYMSMGRKPSEADIKKTMNAIKR 79
>gi|167925540|ref|ZP_02512631.1| hypothetical protein Mmycm_03001 [Mycoplasma mycoides subsp. mycoides LC str. GM12] (81 aa)
Score = 131, Expect = 1.7e-06, Identities = 27/40 (67%), Positives = 31/40 (77%)
  Q:    33 KKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           KKQLK+NPPITE QIRAMY  MGRKP+E  IK+ M   K+
  S:    40 KKQLKDNPPITEKQIRAMYMSMGRKPSEADIKKTMNAIKR 79
>gi|169827266|ref|YP_001697424.1| hypothetical protein Bsph_1698 [Lysinibacillus sphaericus C3-41] >gi|168991754|gb|ACA39294.1| conserved hypothetical protein [Lysinibacillus sphaericus C3-41] (78 aa)
Score = 131, Expect = 1.7e-06, Identities = 28/51 (54%), Positives = 34/51 (66%)
  Q:    25 YYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           +YFA +   K LKENPPI E  IR M  QMGR P+EKQ++Q+MA   K  K
  S:    28 FYFARQAMMKYLKENPPINEQMIRMMMAQMGRTPSEKQVRQMMAQMNKFQK 78
>gi|152002506|dbj|BAF73530.1| hypothetical protein [Onion yellows phytoplasma OY-W] (47 aa)
Score = 130, Expect = 1.9e-06, Identities = 25/43 (58%), Positives = 37/43 (86%)
  Q:    30 KYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           ++FKK L++NPPI+E QI+ M++QMGR P+EKQI+QIM + K+
  S:     3 RWFKKHLQQNPPISEKQIKEMFRQMGRTPSEKQIRQIMNSMKQ 45
>gi|71894614|ref|YP_278722.1| hypothetical protein MS53_0604 [Mycoplasma synoviae 53] >gi|71851402|gb|AAZ44011.1| conserved hypothetical protein [Mycoplasma synoviae 53] (81 aa)
Score = 130, Expect = 2.0e-06, Identities = 24/51 (47%), Positives = 39/51 (76%)
  Q:    21 AVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           A++ + +  K F+KQ++ENPPI+E  I+ M++QMGR  ++KQIKQ+M + K
  S:    25 AIVTFIYVKKLFEKQMRENPPISEKMIKVMFEQMGRPASQKQIKQVMNSMK 75
>gi|28378692|ref|NP_785584.1| hypothetical protein lp_2061 [Lactobacillus plantarum WCFS1] >gi|38258749|sp|Q88VI8|Y2061_LACPL UPF0154 protein lp_2061 >gi|28271529|emb|CAD64433.1| unknown [Lactobacillus plantarum WCFS1] (78 aa)
Score = 129, Expect = 2.5e-06, Identities = 26/75 (34%), Positives = 50/75 (66%)
  Q:     1 MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           M ++ G+ + L + I +++G   G++ A  Y +  LK+NPPI+E  +R+M  QMG++P+EK++ Q++ + K  +K
  S:     1 MTVSTGIWI-LIVVIGVLVGLTGGFFGARHYMQNYLKQNPPISEEMLRSMMMQMGQRPSEKKLHQMLNSMKAASK 74
>gi|90961518|ref|YP_535434.1| hypothetical protein LSL_0542 [Lactobacillus salivarius UCC118] >gi|122449192|sp|Q1WUI4|Y542_LACS1 UPF0154 protein LSL_0542 >gi|90820712|gb|ABD99351.1| Conserved hypothetical protein [Lactobacillus salivarius UCC118] (74 aa)
Score = 129, Expect = 2.6e-06, Identities = 27/59 (45%), Positives = 40/59 (67%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKN 73
           I+ ++G V G++ A KY +  LK+NPPI E  +R M  QMG+KP+EK++ Q+M   K N
  S:    12 IAAVLGFVGGFFAARKYMEDYLKKNPPINEQMMRTMMIQMGQKPSEKKLHQMMNAMKNN 70
>gi|163791104|ref|ZP_02185524.1| hypothetical protein CAT7_11830 [Carnobacterium sp. AT7] >gi|159873660|gb|EDP67744.1| hypothetical protein CAT7_11830 [Carnobacterium sp. AT7] (78 aa)
Score = 128, Expect = 3.5e-06, Identities = 29/61 (47%), Positives = 45/61 (73%)
  Q:     9 LGLGIPISLII-----GAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMAT 69
           + LG+ I LII     GAV G++ A +Y     K+NPP+ E+ +R +  QMG+KP+EK+IKQ+M++
  S:     1 MNLGLAIFLIILALVGGAVGGFFIARRYMMDYFKKNPPVDENMLRMLMMQMGQKPSEKKIKQMMSS 66
>gi|126650147|ref|ZP_01722380.1| hypothetical protein BB14905_02715 [Bacillus sp. B14905] >gi|126593319|gb|EAZ87281.1| hypothetical protein BB14905_02715 [Bacillus sp. B14905] (72 aa)
Score = 128, Expect = 4.1e-06, Identities = 28/51 (54%), Positives = 34/51 (66%)
  Q:    25 YYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           +YFA +   K LKENPPI E  IR M  QMGR P+EKQ++Q+MA   K  K
  S:    22 FYFARQAMMKYLKENPPINEQMIRMMMAQMGRTPSEKQVRQMMAQMNKFQK 72
>gi|148543911|ref|YP_001271281.1| hypothetical protein Lreu_0679 [Lactobacillus reuteri F275] >gi|148530945|gb|ABQ82944.1| protein of unknown function UPF0154 [Lactobacillus reuteri F275] (70 aa)
Score = 127, Expect = 4.7e-06, Identities = 25/61 (40%), Positives = 41/61 (67%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++L++G VIG++ A KY +  L+ NPPI+E  +R M  QMG+KP+ +++ Q+M   K   K
  S:     5 LALLVGLVIGFFGARKYMENYLRNNPPISEEMLRTMMLQMGQKPSSRKLHQMMQAMKAQAK 65
>gi|184153307|ref|YP_001841648.1| hypothetical protein LAR_0652 [Lactobacillus reuteri F275] >gi|194468457|ref|ZP_03074443.1| protein of unknown function UPF0154 [Lactobacillus reuteri 100-23] >gi|183224651|dbj|BAG25168.1| conserved hypothetical protein [Lactobacillus reuteri F275] >gi|194453310|gb|EDX42208.1| protein of unknown function UPF0154 [Lactobacillus reuteri 100-23] (75 aa)
Score = 126, Expect = 5.4e-06, Identities = 25/61 (40%), Positives = 41/61 (67%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++L++G VIG++ A KY +  L+ NPPI+E  +R M  QMG+KP+ +++ Q+M   K   K
  S:    10 LALLVGLVIGFFGARKYMENYLRNNPPISEEMLRTMMLQMGQKPSSRKLHQMMQAMKAQAK 70
>gi|169350464|ref|ZP_02867402.1| hypothetical protein CLOSPI_01232 [Clostridium spiroforme DSM 1552] >gi|169292784|gb|EDS74917.1| hypothetical protein CLOSPI_01232 [Clostridium spiroforme DSM 1552] (67 aa)
Score = 126, Expect = 5.6e-06, Identities = 28/44 (63%), Positives = 34/44 (77%)
  Q:    32 FKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           FKKQL++NPPI E  IRAMY +MGRKP+E QIK+IMA+     K
  S:    24 FKKQLRKNPPINEKMIRAMYMEMGRKPSETQIKRIMASIMAQYK 67
>gi|104774233|ref|YP_619213.1| hypothetical protein Ldb1354 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514321|ref|YP_813227.1| hypothetical protein LBUL_1263 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423314|emb|CAI98155.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093636|gb|ABJ58789.1| hypothetical protein LBUL_1263 [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (74 aa)
Score = 125, Expect = 8.0e-06, Identities = 30/63 (47%), Positives = 40/63 (63%)
  Q:     9 LGLGIPISLII-----GAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           + LG+ I LII     GAV G+Y A  Y K   K+NPPIT   +  M  QMG+KP+ K++ Q+M   K
  S:     1 MNLGLAIFLIILAALLGAVAGFYGARTYMKNYFKKNPPITREMVETMMSQMGQKPSAKKVNQVMNMIK 68
>gi|172057135|ref|YP_001813595.1| hypothetical protein Exig_1099 [Exiguobacterium sibiricum 255-15] >gi|171989656|gb|ACB60578.1| protein of unknown function UPF0154 [Exiguobacterium sibiricum 255-15] (76 aa)
Score = 124, Expect = 9.6e-06, Identities = 22/61 (36%), Positives = 39/61 (63%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           + L+ G  +G+Y A +Y    L++NPPI E  I+ +  QMG+KP++K++ Q+M +   + K
  S:    12 LCLVAGVALGFYIARRYMMNYLEQNPPINEDMIKTLMMQMGQKPSQKKVNQVMRSMSGSMK 72
>gi|187605819|ref|ZP_02992005.1| protein of unknown function UPF0154 [Exiguobacterium sp. AT1b] >gi|187482156|gb|EDU20174.1| protein of unknown function UPF0154 [Exiguobacterium sp. AT1b] (77 aa)
Score = 124, Expect = 1.1e-05, Identities = 24/52 (46%), Positives = 36/52 (69%)
  Q:    16 SLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIM 67
           +LI G  IG++ A KY    L++NPPI E  IR +  QMG+KP++K++ Q+M
  S:    13 ALIGGIAIGFFIARKYMMNYLEQNPPINEDMIRTLMMQMGQKPSQKKVNQVM 64
>gi|116495076|ref|YP_806810.1| hypothetical protein LSEI_1594 [Lactobacillus casei ATCC 334] >gi|191638579|ref|YP_001987745.1| Putative uncharacterized protein [Lactobacillus casei] >gi|116105226|gb|ABJ70368.1| hypothetical protein LSEI_1594 [Lactobacillus casei ATCC 334] >gi|190712881|emb|CAQ66887.1| Putative uncharacterized protein [Lactobacillus casei BL23] (73 aa)
Score = 122, Expect = 2.0e-05, Identities = 24/61 (39%), Positives = 40/61 (65%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I+L++G   G++ A  Y KK  ++NPP+ E  +R M  QMG+KP+ K++ Q+MA  K+  +
  S:    10 IALLVGLAGGFFGARAYMKKYFQDNPPVNEEMLRTMMMQMGQKPSAKKLNQMMAQMKQAQR 70
>gi|23099131|ref|NP_692597.1| hypothetical protein OB1676 [Oceanobacillus iheyensis HTE831] >gi|29611917|sp|Q8EQL9|Y1676_OCEIH UPF0154 protein OB1676 >gi|22777359|dbj|BAC13632.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] (74 aa)
Score = 121, Expect = 2.5e-05, Identities = 23/52 (44%), Positives = 36/52 (69%)
  Q:    16 SLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIM 67
           +L+ G  +G++ A KY    LK+NPPI E  +R +  QMG+KP++K+I Q+M
  S:    13 ALVAGVALGFFIARKYMMSYLKKNPPINEQMLRTLMMQMGQKPSQKKINQMM 64
>gi|15614913|ref|NP_243216.1| hypothetical protein BH2350 [Bacillus halodurans C-125] >gi|13959672|sp|Q9KAD9|Y2350_BACHD UPF0154 protein BH2350 >gi|10174970|dbj|BAB06069.1| BH2350 [Bacillus halodurans C-125] (72 aa)
Score = 120, Expect = 2.9e-05, Identities = 26/62 (41%), Positives = 39/62 (62%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           L I + ++IG  IG++ A K     LK+NPPI E  +R M  QMG+ P++K+I Q+M   +K
  S:     7 LWITLGIVIGIAIGFFIARKTMMSYLKKNPPINEQMLRVMLMQMGQNPSQKKINQMMKAMQK 68
>gi|56963927|ref|YP_175658.1| hypothetical protein ABC2162 [Bacillus clausii KSM-K16] >gi|56910170|dbj|BAD64697.1| conserved hypothetical protein [Bacillus clausii KSM-K16] (71 aa)
Score = 120, Expect = 3.2e-05, Identities = 25/62 (40%), Positives = 40/62 (64%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKK 72
           +G  ++++ G  IG++ A K     LK+NPPI E  +R M QQMG+ P++K+I Q+M   +K
  S:     6 IGYTVAVLAGLAIGFFIARKTMMSYLKKNPPINEQMLRVMMQQMGQNPSQKKITQMMKAMQK 67
>gi|24380093|ref|NP_722048.1| hypothetical protein SMU.1719c [Streptococcus mutans UA159] >gi|29611914|sp|Q8DSQ4|Y1719_STRMU UPF0154 protein SMU_1719c >gi|24378088|gb|AAN59354.1|AE015000_12 conserved hypothetical protein [Streptococcus mutans UA159] (82 aa)
Score = 119, Expect = 3.5e-05, Identities = 24/53 (45%), Positives = 37/53 (69%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIM 67
           I+L+ G V G + A K  +K L+ENPP+ E  IR M  QMG+KP+E +++Q++
  S:    12 IALLAGLVGGTFIARKQMEKYLEENPPLNEDVIRNMMSQMGQKPSEAKVQQVV 64
>gi|15673265|ref|NP_267439.1| hypothetical protein L113060 [Lactococcus lactis subsp. lactis Il1403] >gi|116512126|ref|YP_809342.1| hypothetical protein LACR_1404 [Lactococcus lactis subsp. cremoris SK11] >gi|125624016|ref|YP_001032499.1| hypothetical protein llmg_1186 [Lactococcus lactis subsp. cremoris MG1363] >gi|123025381|sp|Q02YQ2|Y1404_LACLS UPF0154 protein LACR_1404 >gi|166228907|sp|A2RKG9|Y1186_LACLM UPF0154 protein llmg_1186 >gi|13959667|sp|Q9CG27|YNBE_LACLA UPF0154 protein ynbE >gi|12724259|gb|AAK05381.1|AE006360_10 HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis Il1403] >gi|116107780|gb|ABJ72920.1| hypothetical protein LACR_1404 [Lactococcus lactis subsp. cremoris SK11] >gi|124492824|emb|CAL97779.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] (79 aa)
Score = 117, Expect = 5.9e-05, Identities = 22/61 (36%), Positives = 37/61 (60%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           + L+ G  +G +F+ +  KK L +NPP+ E  +R M   MGRKP+E Q++Q++   +   K
  S:    12 VCLLAGFFLGTWFSQRQTKKLLMDNPPLNEDAVRLMMGSMGRKPSEVQVQQVLRQIRAAAK 72
>gi|73662724|ref|YP_301505.1| hypothetical protein SSP1415 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82582352|sp|Q49XD7|Y1415_STAS1 UPF0154 protein SSP1415 >gi|72495239|dbj|BAE18560.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (79 aa)
Score = 115, Expect = 1.2e-04, Identities = 29/63 (46%), Positives = 42/63 (66%)
  Q:    13 IPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I ++LI+G V G++ A KY    LK+NPPI E  +R M  QMG+KP++K+I Q+M    KN +
  S:    10 IVLALILGLVGGFFLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKNQQ 72
>gi|70726565|ref|YP_253479.1| hypothetical protein SH1564 [Staphylococcus haemolyticus JCSC1435] >gi|82582357|sp|Q4L652|Y1564_STAHJ UPF0154 protein SH1564 >gi|68447289|dbj|BAE04873.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (80 aa)
Score = 110, Expect = 4.6e-04, Identities = 30/63 (47%), Positives = 41/63 (65%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKN 73
           L I ++LI G V G++ A KY    LK+NPPI E  +R M  QMG+KP++K+I Q+M    KN
  S:     8 LLIIVALIGGLVGGFFLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKN 70
>gi|116629452|ref|YP_814624.1| hypothetical protein LGAS_0795 [Lactobacillus gasseri ATCC 33323] >gi|122273610|sp|Q044D6|Y795_LACGA UPF0154 protein LGAS_0795 >gi|116095034|gb|ABJ60186.1| hypothetical protein LGAS_0795 [Lactobacillus gasseri ATCC 33323] (73 aa)
Score = 109, Expect = 5.1e-04, Identities = 24/54 (44%), Positives = 34/54 (62%)
  Q:    22 VIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           V G+Y A  Y KK  ++NPPI+E  I AM  QMG+KP+ K++ Q+M   K   +
  S:    19 VGGFYGARAYMKKYFQDNPPISEDMIAAMMAQMGQKPSTKKLNQVMNMMKHQQQ 72
>gi|42519378|ref|NP_965308.1| hypothetical protein LJ1506 [Lactobacillus johnsonii NCC 533] >gi|81667680|sp|Q74IR1|Y1506_LACJO UPF0154 protein LJ_1506 >gi|41583666|gb|AAS09274.1| hypothetical protein LJ_1506 [Lactobacillus johnsonii NCC 533] (73 aa)
Score = 109, Expect = 5.3e-04, Identities = 24/54 (44%), Positives = 34/54 (62%)
  Q:    22 VIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           V G+Y A  Y KK  ++NPPI+E  I AM  QMG+KP+ K++ Q+M   K   +
  S:    19 VGGFYGARAYMKKYFQDNPPISEDMIAAMMAQMGQKPSAKKLNQVMNMMKHQQQ 72
>gi|16078854|ref|NP_389674.1| hypothetical protein BSU17910 [Bacillus subtilis subsp. subtilis str. 168] >gi|1176638|sp|P45708|YNEF_BACSU UPF0154 protein yneF >gi|870924|emb|CAA61115.1| orf [Bacillus subtilis] >gi|1405448|emb|CAA97618.1| YneF [Bacillus subtilis] >gi|2634175|emb|CAB13675.1| yneF [Bacillus subtilis subsp. subtilis str. 168] (72 aa)
Score = 107, Expect = 9.5e-04, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           M L +G+ +G+   ++L+IG  +G++ A KY    LK+NPPI E  +R M  QMG KP++K+I Q+M       K
  S:     1 MTLWVGILVGV---VALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 72
>gi|87160745|ref|YP_493937.1| hypothetical protein SAUSA300_1240 [Staphylococcus aureus subsp. aureus USA300] >gi|88195067|ref|YP_499867.1| hypothetical protein SAOUHSC_01338 [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148267831|ref|YP_001246774.1| hypothetical protein SaurJH9_1404 [Staphylococcus aureus subsp. aureus JH9] >gi|161509513|ref|YP_001575172.1| hypothetical protein USA300HOU_1280 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|87126719|gb|ABD21233.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202625|gb|ABD30435.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147740900|gb|ABQ49198.1| protein of unknown function UPF0154 [Staphylococcus aureus subsp. aureus JH9] >gi|160368322|gb|ABX29293.1| hypothetical protein USA300HOU_1280 [Staphylococcus aureus subsp. aureus USA300_TCH1516] (95 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/61 (45%), Positives = 39/61 (63%)
  Q:    13 IPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKN 73
           I  +LI+G + G+  A KY    LK+NPPI E  +R M  QMG+KP++K+I Q+M    KN
  S:    25 IVAALILGLIGGFLLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKN 85
>gi|151221467|ref|YP_001332289.1| hypothetical protein NWMN_1255 [Staphylococcus aureus subsp. aureus str. Newman] >gi|150374267|dbj|BAF67527.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] (96 aa)
Score = 106, Expect = 1.2e-03, Identities = 28/61 (45%), Positives = 39/61 (63%)
  Q:    13 IPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKN 73
           I  +LI+G + G+  A KY    LK+NPPI E  +R M  QMG+KP++K+I Q+M    KN
  S:    26 IVAALILGLIGGFLLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKN 86
>gi|15924333|ref|NP_371867.1| hypothetical protein SAV1343 [Staphylococcus aureus subsp. aureus Mu50] >gi|15926924|ref|NP_374457.1| hypothetical protein SA1178 [Staphylococcus aureus subsp. aureus N315] >gi|21282959|ref|NP_646047.1| hypothetical protein MW1230 [Staphylococcus aureus subsp. aureus MW2] >gi|49483535|ref|YP_040759.1| hypothetical protein SAR1353 [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486187|ref|YP_043408.1| hypothetical protein SAS1283 [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650347|ref|YP_186231.1| hypothetical protein SACOL1378 [Staphylococcus aureus subsp. aureus COL] >gi|82750937|ref|YP_416678.1| hypothetical protein SAB1201 [Staphylococcus aureus RF122] >gi|150393893|ref|YP_001316568.1| hypothetical protein SaurJH1_1431 [Staphylococcus aureus subsp. aureus JH1] >gi|156979663|ref|YP_001441922.1| hypothetical protein SAHV_1332 [Staphylococcus aureus subsp. aureus Mu3] >gi|168727376|ref|ZP_02759653.1| hypothetical protein Sauraur_03267 [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123549106|sp|Q2YXS4|Y1201_STAAB UPF0154 protein SAB1201 >gi|166200365|sp|A7X1Z8|Y1332_STAA1 UPF0154 protein SAHV_1332 >gi|189038693|sp|A6U1G3|Y1431_STAA2 UPF0154 protein SaurJH1_1431 >gi|54040048|sp|P67291|Y1178_STAAN UPF0154 protein SA1178 >gi|54040049|sp|P67292|Y1230_STAAW UPF0154 protein MW1230 >gi|54042701|sp|P67290|Y1343_STAAM UPF0154 protein SAV1343 >gi|56749714|sp|Q6G9L5|Y1283_STAAS UPF0154 protein SAS1283 >gi|56749743|sp|Q6GH63|Y1353_STAAR UPF0154 protein SAR1353 >gi|81694561|sp|Q5HG76|Y1378_STAAC UPF0154 protein SACOL1378 >gi|13701141|dbj|BAB42436.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247114|dbj|BAB57505.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] >gi|21204398|dbj|BAB95095.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] >gi|49241664|emb|CAG40352.1| putative exported protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244630|emb|CAG43061.1| putative exported protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284533|gb|AAW36627.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus COL] >gi|82656468|emb|CAI80890.1| probable exported protein [Staphylococcus aureus RF122] >gi|149946345|gb|ABR52281.1| protein of unknown function UPF0154 [Staphylococcus aureus subsp. aureus JH1] >gi|156721798|dbj|BAF78215.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] (80 aa)
Score = 106, Expect = 1.3e-03, Identities = 28/61 (45%), Positives = 39/61 (63%)
  Q:    13 IPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKN 73
           I  +LI+G + G+  A KY    LK+NPPI E  +R M  QMG+KP++K+I Q+M    KN
  S:    10 IVAALILGLIGGFLLARKYMMDYLKKNPPINEEMLRMMMMQMGQKPSQKKINQMMTMMNKN 70
>gi|154686204|ref|YP_001421365.1| hypothetical protein RBAM_017710 [Bacillus amyloliquefaciens FZB42] >gi|189039008|sp|A7Z558|Y1771_BACA2 UPF0154 protein RBAM_017710 >gi|154352055|gb|ABS74134.1| YneF [Bacillus amyloliquefaciens FZB42] (72 aa)
Score = 106, Expect = 1.4e-03, Identities = 30/75 (40%), Positives = 46/75 (61%)
  Q:     1 MALAIGLCLGLGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           M L +G+ +G+   ++L+IG  +G++ A KY    LK+NPPI E  +R M  QMG KP++K+I Q+M       K
  S:     1 MTLWVGILVGV---VALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQAK 72
>gi|116491002|ref|YP_810546.1| hypothetical protein OEOE_0972 [Oenococcus oeni PSU-1] >gi|116091727|gb|ABJ56881.1| hypothetical protein OEOE_0972 [Oenococcus oeni PSU-1] (68 aa)
Score = 104, Expect = 2.3e-03, Identities = 24/59 (40%), Positives = 34/59 (57%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKN 73
           I L+IG   G   +    K  LK+NPPI E  ++ +   MGR  ++KQI Q+M+  KKN
  S:     9 IGLVIGLAAGMVISRFTLKSYLKKNPPINEQMLKQIGASMGRNLSQKQINQMMSQMKKN 67
>gi|171780259|ref|ZP_02921163.1| hypothetical protein STRINF_02047 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281607|gb|EDT47042.1| hypothetical protein STRINF_02047 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (80 aa)
Score = 104, Expect = 2.3e-03, Identities = 22/51 (43%), Positives = 34/51 (66%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQ 65
           ++L  G V G + A K F+K++ E+P +T   IR M  QMG+KP+E +I+Q
  S:    12 VALFGGLVGGVFIARKQFEKEIGEHPRLTPDAIREMMSQMGQKPSEAKIQQ 62
>gi|193216452|ref|YP_001999694.1| conserved hypothetical protein [Mycoplasma arthritidis 158L3-1] >gi|193001775|gb|ACF06990.1| conserved hypothetical protein [Mycoplasma arthritidis 158L3-1] (74 aa)
Score = 102, Expect = 3.9e-03, Identities = 21/33 (63%), Positives = 25/33 (75%)
  Q:    39 NPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           NPPI E  IR MYQQMGRK +E Q+KQ+M + K
  S:    39 NPPINEKMIRIMYQQMGRKASEAQVKQVMRSIK 71
>gi|170017346|ref|YP_001728265.1| hypothetical protein LCK_00994 [Leuconostoc citreum KM20] >gi|169804203|gb|ACA82821.1| UPF0154 domain-containing protein [Leuconostoc citreum KM20] (77 aa)
Score = 99, Expect = 9.2e-03, Identities = 29/67 (43%), Positives = 46/67 (68%)
  Q:     9 LGLGIPI---SLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           LG GI I    L+IG VIG++ A    K  L +NPPI+E  +++M   MG+KP++K++ Q+MA  K+ ++
  S:     3 LGFGILIFVLGLVIGLVIGFFVARNSMKSYLAKNPPISEEMMKSMMMSMGQKPSQKKLNQMMAQMKQQSE 72
>gi|25011690|ref|NP_736085.1| hypothetical protein gbs1650 [Streptococcus agalactiae NEM316] >gi|76788590|ref|YP_330219.1| hypothetical protein SAK_1616 [Streptococcus agalactiae A909] >gi|77408479|ref|ZP_00785217.1| Unknown-related protein [Streptococcus agalactiae COH1] >gi|123601416|sp|Q3JZT4|Y1616_STRA1 UPF0154 protein SAK_1616 >gi|29611916|sp|Q8E3V6|Y1650_STRA3 UPF0154 protein gbs1650 >gi|24413230|emb|CAD47309.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563647|gb|ABA46231.1| conserved hypothetical protein [Streptococcus agalactiae A909] >gi|77172921|gb|EAO76052.1| Unknown-related protein [Streptococcus agalactiae COH1] (79 aa)
Score = 98, Expect = 1.1e-02, Identities = 24/65 (36%), Positives = 38/65 (58%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           L I ++L  G V G + A K  +K++ E+P +T   IR M  QMG+KP+E +++Q      K+ K
  S:     8 LLIIVALFGGLVGGIFIARKQIEKEIGEHPRLTPDAIREMMSQMGQKPSEAKVQQTYRNIVKHAK 72
>gi|52080413|ref|YP_079204.1| hypothetical protein BL02936 [Bacillus licheniformis ATCC 14580] >gi|52785792|ref|YP_091621.1| hypothetical protein BLi02038 [Bacillus licheniformis ATCC 14580] >gi|81385459|sp|Q65J36|Y2936_BACLD UPF0154 protein BLi02038/BL02936 >gi|52003624|gb|AAU23566.1| conserved hypothetical protein YneF [Bacillus licheniformis ATCC 14580] >gi|52348294|gb|AAU40928.1| YneF [Bacillus licheniformis DSM 13] (72 aa)
Score = 98, Expect = 1.2e-02, Identities = 25/61 (40%), Positives = 38/61 (62%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++L+ G  +G++ A KY    LK+NPPI E  +R M  QMG KP++K+I Q+M   +   K
  S:    12 LALLAGVALGFFIARKYMMNYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMENQTK 72
>gi|22537741|ref|NP_688592.1| hypothetical protein SAG1601 [Streptococcus agalactiae 2603V/R] >gi|29611915|sp|Q8DY91|Y1601_STRA5 UPF0154 protein SAG1601 >gi|22534631|gb|AAN00465.1|AE014264_20 conserved hypothetical protein [Streptococcus agalactiae 2603V/R] (79 aa)
Score = 97, Expect = 1.3e-02, Identities = 24/65 (36%), Positives = 38/65 (58%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           L I ++L  G V G + A K  +K++ E+P +T   IR M  QMG+KP+E +++Q      K+ K
  S:     8 LLIIVALFGGLVGGIFIARKQIEKEIGEHPRLTPDAIREMMSQMGQKPSEAKVQQTYRNIVKHAK 72
>gi|149183285|ref|ZP_01861727.1| hypothetical protein BSG1_17085 [Bacillus sp. SG-1] >gi|148849012|gb|EDL63220.1| hypothetical protein BSG1_17085 [Bacillus sp. SG-1] (71 aa)
Score = 97, Expect = 1.4e-02, Identities = 26/61 (42%), Positives = 39/61 (63%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++ + G  +G++ A KY    LK+NPPI E  +R M  QMG+KP++K+I Q+M    KN K
  S:    11 LAALAGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGQKPSQKKINQMMNAMNKNMK 71
>gi|157692468|ref|YP_001486930.1| hypothetical protein BPUM_1692 [Bacillus pumilus SAFR-032] >gi|194015036|ref|ZP_03053653.1| conserved domain protein [Bacillus pumilus ATCC 7061] >gi|166980195|sp|A8FDQ3|Y1692_BACP2 UPF0154 protein BPUM_1692 >gi|157681226|gb|ABV62370.1| hypothetical membrane protein [Bacillus pumilus SAFR-032] >gi|194014062|gb|EDW23627.1| conserved domain protein [Bacillus pumilus ATCC 7061] (72 aa)
Score = 96, Expect = 1.6e-02, Identities = 25/61 (40%), Positives = 37/61 (60%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++L+ G  +G++ A KY    LK+NPPI E  +R M  QMG KP++K+I Q+M       K
  S:    12 VALLAGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQAK 72
>gi|89098452|ref|ZP_01171335.1| hypothetical protein B14911_09582 [Bacillus sp. NRRL B-14911] >gi|89086697|gb|EAR65815.1| hypothetical protein B14911_09582 [Bacillus sp. NRRL B-14911] (71 aa)
Score = 96, Expect = 1.6e-02, Identities = 25/60 (41%), Positives = 39/60 (65%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNN 74
           ++LI G  +G++ A KY    LK+NPPI E  ++ M  QMG KP++K+I Q+M+   K +
  S:    10 LALIAGVALGFFIARKYMMSYLKKNPPINEQMLKMMMMQMGMKPSQKKINQMMSAMNKQS 69
>gi|76799034|ref|ZP_00781229.1| Hypothetical UPF0154 protein gbs1650-related protein [Streptococcus agalactiae 18RS21] >gi|76585620|gb|EAO62183.1| Hypothetical UPF0154 protein gbs1650-related protein [Streptococcus agalactiae 18RS21] (79 aa)
Score = 96, Expect = 2.0e-02, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           L I ++L  G V G + A K  +K++ E+P +T   IR M  QMG+KP E +++Q      K+ K
  S:     8 LLIIVALFGGLVGGIFIARKQIEKEIGEHPRLTPDAIREMMSQMGQKPXEAKVQQTYRNIVKHAK 72
>gi|15674510|ref|NP_268684.1| hypothetical protein SPy_0359 [Streptococcus pyogenes M1 GAS] >gi|19745518|ref|NP_606654.1| hypothetical protein spyM18_0409 [Streptococcus pyogenes MGAS8232] >gi|21909797|ref|NP_664065.1| hypothetical protein SpyM3_0261 [Streptococcus pyogenes MGAS315] >gi|28896510|ref|NP_802860.1| hypothetical protein SPs1598 [Streptococcus pyogenes SSI-1] >gi|50913674|ref|YP_059646.1| hypothetical protein M6_Spy0328 [Streptococcus pyogenes MGAS10394] >gi|56808576|ref|ZP_00366307.1| COG3763: Uncharacterized protein conserved in bacteria [Streptococcus pyogenes M49 591] >gi|71902957|ref|YP_279760.1| hypothetical protein M28_Spy0291 [Streptococcus pyogenes MGAS6180] >gi|71910116|ref|YP_281666.1| hypothetical protein M5005_Spy_0302 [Streptococcus pyogenes MGAS5005] >gi|94987931|ref|YP_596032.1| hypothetical protein MGAS9429_Spy0300 [Streptococcus pyogenes MGAS9429] >gi|94989805|ref|YP_597905.1| hypothetical protein MGAS10270_Spy0296 [Streptococcus pyogenes MGAS10270] >gi|94991815|ref|YP_599914.1| hypothetical protein MGAS2096_Spy0318 [Streptococcus pyogenes MGAS2096] >gi|94993691|ref|YP_601789.1| hypothetical protein MGAS10750_Spy0295 [Streptococcus pyogenes MGAS10750] >gi|139474363|ref|YP_001129079.1| hypothetical protein SpyM51556 [Streptococcus pyogenes str. Manfredo] >gi|123640459|sp|Q48V51|Y291_STRPM UPF0154 protein M28_Spy0291 >gi|166228934|sp|Q1J8B6|Y295_STRPF UPF0154 protein MGAS10750_Spy0295 >gi|166228936|sp|Q1JIG2|Y296_STRPD UPF0154 protein MGAS10270_Spy0296 >gi|166229356|sp|Q1JNB1|Y300_STRPC UPF0154 protein MGAS9429_Spy0300 >gi|166229403|sp|Q1JDD8|Y318_STRPB UPF0154 protein MGAS2096_Spy0318 >gi|166231405|sp|A2RG98|Y1556_STRPG UPF0154 protein SpyM51556 >gi|54039920|sp|P67296|Y261_STRP3 UPF0154 protein SpyM3_0261/SPs1598 >gi|54039953|sp|P67297|Y409_STRP8 UPF0154 protein spyM18_0409 >gi|54042703|sp|P67295|Y359_STRP1 UPF0154 protein SPy_0359/M5005_Spy0302 >gi|73921109|sp|Q5XDQ0|Y328_STRP6 UPF0154 protein M6_Spy0328 >gi|13621613|gb|AAK33405.1| hypothetical protein SPy_0359 [Streptococcus pyogenes M1 GAS] >gi|19747637|gb|AAL97153.1| hypothetical protein [Streptococcus pyogenes MGAS8232] >gi|21903982|gb|AAM78868.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] >gi|28811764|dbj|BAC64693.1| hypothetical protein [Streptococcus pyogenes SSI-1] >gi|50902748|gb|AAT86463.1| Hypothetical exported protein [Streptococcus pyogenes MGAS10394] >gi|71802052|gb|AAX71405.1| hypothetical exported protein [Streptococcus pyogenes MGAS6180] >gi|71852898|gb|AAZ50921.1| hypothetical exported protein [Streptococcus pyogenes MGAS5005] >gi|94541439|gb|ABF31488.1| hypothetical exported protein [Streptococcus pyogenes MGAS9429] >gi|94543313|gb|ABF33361.1| hypothetical exported protein [Streptococcus pyogenes MGAS10270] >gi|94545323|gb|ABF35370.1| hypothetical exported protein [Streptococcus pyogenes MGAS2096] >gi|94547199|gb|ABF37245.1| hypothetical exported protein [Streptococcus pyogenes MGAS10750] >gi|134272610|emb|CAM30877.1| putative exported protein [Streptococcus pyogenes str. Manfredo] (80 aa)
Score = 96, Expect = 2.0e-02, Identities = 22/61 (36%), Positives = 36/61 (59%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++L +G   G + A K  +K++ E+P +T   IR M  QMG+KP+E +I+Q      K +K
  S:    12 VALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIREMMSQMGQKPSEAKIQQTYRNIIKQSK 72
>gi|195978748|ref|YP_002123992.1| hypothetical protein Sez_1648 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975453|gb|ACG62979.1| hypothetical protein Sez_1648 [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (80 aa)
Score = 95, Expect = 2.6e-02, Identities = 24/65 (36%), Positives = 37/65 (56%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           L I ++L  G   G + A K  +K++ E+P +T   IR M  QMG+KP+E +I+Q      K +K
  S:     8 LLIIVALTAGLFGGIFIARKQIEKEIGEHPRLTPEAIREMMSQMGQKPSEAKIQQTYRNIVKQSK 72
>gi|116618303|ref|YP_818674.1| hypothetical protein LEUM_1203 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097150|gb|ABJ62301.1| hypothetical protein LEUM_1203 [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (78 aa)
Score = 95, Expect = 2.7e-02, Identities = 24/60 (40%), Positives = 41/60 (68%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNN 74
           ++LIIG V G++ A    K  L +NPPI+E  +++M   MG+KP++K++ Q+MA  K+ +
  S:    13 LTLIIGLVGGFFLARNSMKSYLAKNPPISEEMMKSMMMSMGQKPSQKKLNQMMAQMKQQS 72
>gi|146319361|ref|YP_001199073.1| hypothetical protein SSU05_1707 [Streptococcus suis 05ZYH33] >gi|146321566|ref|YP_001201277.1| hypothetical protein SSU98_1719 [Streptococcus suis 98HAH33] >gi|166234786|sp|A4VX34|Y1707_STRSY UPF0154 protein SSU05_1707 >gi|166234789|sp|A4W3D8|Y1719_STRS2 UPF0154 protein SSU98_1719 >gi|145690167|gb|ABP90673.1| Uncharacterized protein conserved in bacteria [Streptococcus suis 05ZYH33] >gi|145692372|gb|ABP92877.1| Uncharacterized protein conserved in bacteria [Streptococcus suis 98HAH33] (78 aa)
Score = 93, Expect = 4.3e-02, Identities = 21/67 (31%), Positives = 40/67 (59%)
  Q:     9 LGLGIPISLII-----GAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           + LG+ I LI+     G  +G Y + +  +  + + P + E+ +R M  QMG+KP+E +++Q++   K   K
  S:     1 MNLGLAILLIVLAFAGGVALGIYLSRRQVENYIADKPILDENALRLMMSQMGQKPSEAKVQQVLRQIKSQQK 72
>gi|152976058|ref|YP_001375575.1| hypothetical protein Bcer98_2334 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189039717|sp|A7GR22|Y2334_BACCN UPF0154 protein Bcer98_2334 >gi|152024810|gb|ABS22580.1| protein of unknown function UPF0154 [Bacillus cereus subsp. cytotoxis NVH 391-98] (72 aa)
Score = 92, Expect = 4.8e-02, Identities = 24/61 (39%), Positives = 40/61 (65%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++L+ G  +G++ A KY    L++NPPI E  ++ M  QMG+KP++K+I Q+M+   K  K
  S:    12 VALLAGVALGFFIARKYMMNYLQKNPPINEQMLKMMMMQMGQKPSQKKINQMMSAMNKQMK 72
>gi|167014596|ref|ZP_02277129.1| hypothetical protein LmonFS_07768 [Listeria monocytogenes FSL J1-194] (85 aa)
Score = 90, Expect = 8.5e-02, Identities = 24/61 (39%), Positives = 37/61 (60%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I L+ G   G++ A +Y    LK NPPI E  ++ M  QMG+KP++K+I Q+M+   K  +
  S:    10 ICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQE 70
>gi|153166683|ref|ZP_01927206.1| hypothetical protein LMHG_01485 [Listeria monocytogenes FSL N1-017] >gi|167214375|ref|ZP_02284682.1| hypothetical protein LmonoFSL_10168 [Listeria monocytogenes FSL R2-503] >gi|133727443|gb|EBA29141.1| hypothetical protein LMHG_01485 [Listeria monocytogenes FSL N1-017] (77 aa)
Score = 90, Expect = 1.0e-01, Identities = 24/61 (39%), Positives = 37/61 (60%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           I L+ G   G++ A +Y    LK NPPI E  ++ M  QMG+KP++K+I Q+M+   K  +
  S:    10 ICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMSAMNKQQE 70
>gi|77414380|ref|ZP_00790535.1| Unknown-related protein [Streptococcus agalactiae 515] >gi|77159570|gb|EAO70726.1| Unknown-related protein [Streptococcus agalactiae 515] (67 aa)
Score = 89, Expect = 1.3e-01, Identities = 20/55 (36%), Positives = 33/55 (60%)
  Q:    11 LGIPISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQ 65
           L I ++L  G V G + A K  +K++ E+P +T   IR M   MG+KP+E ++ +
  S:     8 LLIIVALFGGLVGGIFIARKQIEKEIGEHPRLTPDAIREMMSXMGQKPSEAKVHK 62
>gi|55820351|ref|YP_138793.1| hypothetical protein stu0254 [Streptococcus thermophilus LMG 18311] >gi|55822241|ref|YP_140682.1| hypothetical protein str0254 [Streptococcus thermophilus CNRZ1066] >gi|116627187|ref|YP_819806.1| hypothetical protein STER_0301 [Streptococcus thermophilus LMD-9] >gi|55736336|gb|AAV59978.1| conserved hypothetical protein [Streptococcus thermophilus LMG 18311] >gi|55738226|gb|AAV61867.1| conserved hypothetical protein [Streptococcus thermophilus CNRZ1066] >gi|116100464|gb|ABJ65610.1| Uncharacterized protein conserved in bacteria [Streptococcus thermophilus LMD-9] (81 aa)
Score = 88, Expect = 1.4e-01, Identities = 20/61 (32%), Positives = 32/61 (52%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFKKNNK 75
           ++L+ G   G YF+ K  +K+L ENP +    +R M    G+KP E +++Q      K  K
  S:    12 VALLGGFYGGAYFSRKQIEKELAENPRLNVDAVRTMMSAAGQKPNEAKVRQTYNQIIKQQK 72
>gi|46907533|ref|YP_013922.1| hypothetical protein LMOf2365_1324 [Listeria monocytogenes str. 4b F2365] >gi|47094287|ref|ZP_00231992.1| uncharacterized protein family UPF0154 superfamily [Listeria monocytogenes str. 4b H7858] >gi|153202148|ref|ZP_01943777.1| hypothetical protein LMSG_00631 [Listeria monocytogenes HPB2262] >gi|167217445|ref|ZP_02287081.1| hypothetical protein LmonocFSL_10415 [Listeria monocytogenes FSL J1-175] >gi|167453938|ref|ZP_02320161.1| hypothetical protein LmonocytoFSL_09060 [Listeria monocytogenes FSL J2-064] >gi|67462060|sp|Q720B5|Y1324_LISMF UPF0154 protein LMOf2365_1324 >gi|46880801|gb|AAT04099.1| conserved hypothetical protein [Listeria monocytogenes str. 4b F2365] >gi|47017331|gb|EAL08159.1| uncharacterized protein family UPF0154 superfamily [Listeria monocytogenes str. 4b H7858] >gi|133735431|gb|EBA37129.1| hypothetical protein LMSG_00631 [Listeria monocytogenes HPB2262] (79 aa)
Score = 87, Expect = 2.2e-01, Identities = 23/54 (42%), Positives = 35/54 (64%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMA 68
           I L+ G   G++ A +Y    LK NPPI E  ++ M  QMG+KP++K+I Q+M+
  S:    10 ICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMS 63
>gi|16800412|ref|NP_470680.1| hypothetical protein lin1344 [Listeria innocua Clip11262] >gi|16803346|ref|NP_464831.1| hypothetical protein lmo1306 [Listeria monocytogenes EGD-e] >gi|47096931|ref|ZP_00234508.1| uncharacterized protein family UPF0154 superfamily [Listeria monocytogenes str. 1/2a F6854] >gi|116872737|ref|YP_849518.1| hypothetical protein lwe1321 [Listeria welshimeri serovar 6b str. SLCC5334] >gi|153174388|ref|ZP_01929916.1| hypothetical protein LMIG_01417 [Listeria monocytogenes FSL N3-165] >gi|153179380|ref|ZP_01932599.1| hypothetical protein LMMG_00269 [Listeria monocytogenes F6900] >gi|153183669|ref|ZP_01934486.1| hypothetical protein LMOG_00356 [Listeria monocytogenes J0161] >gi|153190711|ref|ZP_01938074.1| hypothetical protein LMPG_00841 [Listeria monocytogenes J2818] >gi|153196085|ref|ZP_01940493.1| hypothetical protein LMRG_00756 [Listeria monocytogenes 10403S] >gi|167343529|ref|ZP_02289426.1| hypothetical protein LmonocyFSL_09736 [Listeria monocytogenes FSL J1-208] >gi|167404303|ref|ZP_02309105.1| hypothetical protein LmonocytFSL_10230 [Listeria monocytogenes FSL J2-003] >gi|168265831|ref|ZP_02687796.1| hypothetical protein LmonFSL_07851 [Listeria monocytogenes FSL J2-071] >gi|123466235|sp|A0AIA7|Y1321_LISW6 UPF0154 protein lwe1321 >gi|54040097|sp|P67289|Y1344_LISIN UPF0154 protein lin1344 >gi|54042700|sp|P67288|Y1306_LISMO UPF0154 protein lmo1306 >gi|16410722|emb|CAC99384.1| lmo1306 [Listeria monocytogenes] >gi|16413817|emb|CAC96575.1| lin1344 [Listeria innocua] >gi|47014691|gb|EAL05647.1| uncharacterized protein family UPF0154 superfamily [Listeria monocytogenes str. 1/2a F6854] >gi|116741615|emb|CAK20739.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] >gi|126943321|gb|EBA21042.1| hypothetical protein LMOG_00356 [Listeria monocytogenes J0161] >gi|127634367|gb|EBA23753.1| hypothetical protein LMRG_00756 [Listeria monocytogenes 10403S] >gi|127765695|gb|EBA26040.1| hypothetical protein LMPG_00841 [Listeria monocytogenes J2818] >gi|133730336|gb|EBA32034.1| hypothetical protein LMIG_01417 [Listeria monocytogenes FSL N3-165] >gi|133732865|gb|EBA34563.1| hypothetical protein LMMG_00269 [Listeria monocytogenes F6900] (79 aa)
Score = 87, Expect = 2.2e-01, Identities = 23/54 (42%), Positives = 35/54 (64%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIMA 68
           I L+ G   G++ A +Y    LK NPPI E  ++ M  QMG+KP++K+I Q+M+
  S:    10 ICLLAGLAGGFFIARRYMMSYLKNNPPINEQMLQMMMAQMGQKPSQKKINQMMS 63
>gi|163763280|ref|ZP_02170342.1| transposase IS3/IS911 family protein [Bacillus selenitireducens MLS10] >gi|160356074|gb|EDP82725.1| transposase IS3/IS911 family protein [Bacillus selenitireducens MLS10] (54 aa)
Score = 83, Expect = 5.3e-01, Identities = 16/36 (44%), Positives = 25/36 (69%)
  Q:    36 LKENPPITESQIRAMYQQMGRKPTEKQIKQIMATFK 71
           +K+NPPI E  +R M  QMG+ P++K+I Q+M   +
  S:    14 MKKNPPINEKMLRVMMMQMGQNPSQKKINQMMKAMQ 49
>gi|56419869|ref|YP_147187.1| hypothetical protein GK1334 [Geobacillus kaustophilus HTA426] >gi|56379711|dbj|BAD75619.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] (70 aa)
Score = 83, Expect = 5.9e-01, Identities = 25/53 (47%), Positives = 34/53 (64%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIM 67
           ++LI G  IG++ A K     LK+NPPI E  IR M  QMG  P++K+I Q+M
  S:    10 LALIAGVAIGFFVARKTMINYLKKNPPINEQMIRMMMMQMGMTPSQKKINQMM 62
>gi|138894853|ref|YP_001125306.1| hypothetical protein GTNG_1189 [Geobacillus thermodenitrificans NG80-2] >gi|196248576|ref|ZP_03147277.1| protein of unknown function UPF0154 [Geobacillus sp. G11MC16] >gi|134266366|gb|ABO66561.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] >gi|196212301|gb|EDY07059.1| protein of unknown function UPF0154 [Geobacillus sp. G11MC16] (70 aa)
Score = 81, Expect = 8.8e-01, Identities = 24/53 (45%), Positives = 34/53 (64%)
  Q:    15 ISLIIGAVIGYYFAGKYFKKQLKENPPITESQIRAMYQQMGRKPTEKQIKQIM 67
           ++LI G  +G++ A K     LK+NPPI E  IR M  QMG  P++K+I Q+M
  S:    10 LALIAGMALGFFIARKTMINYLKKNPPINEQMIRMMMMQMGMTPSQKKINQMM 62