>gi|26553493|ref|NP_757427.1| GTPase EngB [Mycoplasma penetrans HF-2] >gi|81748121|sp|Q8EX09|ENGB_MYCPE Probable GTP-binding protein engB >gi|26453499|dbj|BAC43831.1| predicted GTP-binding protein [Mycoplasma penetrans HF-2] (186 aa)
Score = 858, Expect = 1.4e-90, Identities = 186/186 (100%), Positives = 186/186 (100%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL
  S:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
>gi|167941410|ref|ZP_02528485.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 8] >gi|167960028|ref|ZP_02547096.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167973106|ref|ZP_02555383.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167974818|ref|ZP_02557095.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167976019|ref|ZP_02558296.1| ribosome biogenesis GTP-binding protein YsxC [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167988518|ref|ZP_02570189.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168337311|ref|ZP_02693926.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 10] >gi|168361987|ref|ZP_02695166.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168807521|ref|ZP_02828580.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 2] >gi|195867678|ref|ZP_03079680.1| ribosome biogenesis GTP-binding protein YsxC [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903533|gb|EDT49822.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209057|gb|EDU06100.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018849|gb|EDU56889.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997724|gb|EDU66821.1| ATP/GTP-binding protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659574|gb|EDX52954.1| ribosome biogenesis GTP-binding protein YsxC [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660735|gb|EDX53990.1| ribosome biogenesis GTP-binding protein YsxC [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (208 aa)
Score = 484, Expect = 3.0e-47, Identities = 103/186 (55%), Positives = 134/186 (72%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           M  FIKS    + +  D + EIC IGRSNVGKSSLINALAN KIA+TSNTPGRTQL NF+DF+ FRL+DLPGYG+A+VSK K  +L+ II +Y+  R+NL AVFQI DI+V+T+ D++MS    N+   H++VLNK DK  KS+FDNN  KIA  L    + ++CVSA+  TN+  L  L+  V++
  S:     1 MAKFIKSAQYFDQYPVDKQFEICVIGRSNVGKSSLINALANEKIARTSNTPGRTQLVNFFDFNSFRLVDLPGYGFARVSKDKQLDLATIIDQYLGYRQNLCAVFQICDINVLTNDDVEMSRYFENQNYAHFVVLNKVDKVNKSHFDNNKQKIAKFLNISVDRLLCVSAQKNTNVATLFALMKKVVI 186
>gi|168308581|ref|ZP_02691256.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902437|gb|EDT48726.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 1 str. ATCC 27813] (208 aa)
Score = 477, Expect = 1.9e-46, Identities = 105/186 (56%), Positives = 134/186 (72%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           M  FIKS    + +  D + EIC IGRSNVGKSSLINALAN KIA+TSNTPGRTQL NF+DF+ FRL+DLPGYG+AKVSK K  +L+ II +Y+  R+NL AVFQI DI+V+T+ D++MS    N+   H++VLNK DK  KSYF+NN  KIA  L    + ++CVSA+N  NI  L  L+  V++
  S:     1 MAKFIKSAHYFDQYPIDKQFEICVIGRSNVGKSSLINALANKKIARTSNTPGRTQLVNFFDFNNFRLVDLPGYGFAKVSKEKQTDLAAIIDQYLGYRQNLCAVFQICDINVLTNDDVEMSRYFENQKYAHFVVLNKLDKVNKSYFNNNKHKIAKFLNISTDRLLCVSAQNNINIITLFALMKKVVI 186
>gi|13357826|ref|NP_078100.1| GTPase EngB [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971952|ref|ZP_02554229.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282428|ref|ZP_02690095.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|170762083|ref|YP_001752349.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189037196|sp|B1AIQ5|ENGB_UREP2 Probable GTP-binding protein engB >gi|13124226|sp|Q9PQM5|ENGB_UREPA Probable GTP-binding protein engB >gi|11356756|pir||D82913 conserved hypothetical ATP/GTP-binding protein UU266 [imported] - Ureaplasma urealyticum >gi|6899237|gb|AAF30675.1|AE002123_8 conserved hypothetical ATP/GTP-binding protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827660|gb|ACA32922.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675765|gb|EDT87670.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700634|gb|EDU18916.1| ATP/GTP-binding protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (208 aa)
Score = 477, Expect = 1.9e-46, Identities = 105/186 (56%), Positives = 134/186 (72%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           M  FIKS    + +  D + EIC IGRSNVGKSSLINALAN KIA+TSNTPGRTQL NF+DF+ FRL+DLPGYG+AKVSK K  +L+ II +Y+  R+NL AVFQI DI+V+T+ D++MS    N+   H++VLNK DK  KSYF+NN  KIA  L    + ++CVSA+N  NI  L  L+  V++
  S:     1 MAKFIKSAHYFDQYPIDKQFEICVIGRSNVGKSSLINALANKKIARTSNTPGRTQLVNFFDFNNFRLVDLPGYGFAKVSKEKQTDLAAIIDQYLGYRQNLCAVFQICDINVLTNDDVEMSRYFENQKYAHFVVLNKLDKVNKSYFNNNKHKIAKFLNISTDRLLCVSAQNNINIITLFALMKKVVI 186
>gi|31544773|ref|NP_853351.1| ATP/GTP-binding protein [Mycoplasma gallisepticum R] >gi|81834120|sp|Q7NAR6|ENGB_MYCGA Probable GTP-binding protein engB >gi|31541619|gb|AAP56919.1| ATP/GTP-binding protein [Mycoplasma gallisepticum R] (189 aa)
Score = 430, Expect = 5.6e-41, Identities = 98/185 (52%), Positives = 128/185 (69%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           M  FIKS  S  D I D KKE+C IGRSNVGKS++IN LANAKIA+TS TPGRT   NFY+    R++DLPGYGYA++ KS+  E+S  +S+Y+  RKNLV +F I+D+ VITD D+++  LL+    ++YIV NK DK  KS + NN  KI   LK +++ I+ +SAKNK N+ NL   I  VI
  S:     4 MNRFIKSATSLKDCINDSKKEVCLIGRSNVGKSTIINGLANAKIAQTSKTPGRTVTMNFYEISNQRIVDLPGYGYARIKKSQKEEISLFLSDYLNHRKNLVGIFLILDLGVITDQDIEIVRLLTTLDVEYYIVFNKIDKYPKSAYINNKEKILDALKVNEDRILLISAKNKQNLNNLMLKIIDVI 188
>gi|13508220|ref|NP_110169.1| GTPase EngB [Mycoplasma pneumoniae M129] >gi|2501553|sp|P75303|ENGB_MYCPN Probable GTP-binding protein engB >gi|1674038|gb|AAB96008.1| GTP-binding, era-like [Mycoplasma pneumoniae M129] (193 aa)
Score = 310, Expect = 4.7e-27, Identities = 71/178 (39%), Positives = 108/178 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           F+KS         D  KE+CF+GRSNVGKSSLINA    K+AKTS TPGRTQL NF+++++ R +DLPGYG+AK+SK +   ++ ++++++  R+NL  V  +ID  V+T  D ++ + +        ++ NK DK  +S   +   K+A  LK +    + VSAK   N+  + K I
  S:     5 FLKSASDLESCPQDSVKEVCFMGRSNVGKSSLINAFFQKKLAKTSATPGRTQLLNFFEYNRKRFVDLPGYGFAKLSKVQKEAITNLLTQFLNFRQNLTGVVLVIDSGVVTVQDQEVVKTILQTGLNFLVIANKFDKLNQSERFHTQNKLAHFLKVNPNKCLFVSAKTGYNLQVMHKQI 182
>gi|54020515|ref|YP_115958.1| GTPase EngB [Mycoplasma hyopneumoniae 232] >gi|81603640|sp|Q600K7|ENGB_MYCH2 Probable GTP-binding protein engB >gi|53987688|gb|AAV27889.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (198 aa)
Score = 303, Expect = 2.8e-26, Identities = 82/178 (46%), Positives = 113/178 (63%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRL-IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           F+KSC  +       + +  FIGRSNVGKS+LINALAN KIAKTS  PGRTQL NFY  +  +L +DLPGYGYA VSK+K  ++ +II+ Y    + + AVF I+D  V  T+LD  M E +  +  + +I+ NK DK  +S      A +  + KK K N + +SAKNK N+  L++L+
  S:    26 FLKSCPEN----CYSEPQFAFIGRSNVGKSTLINALANKKIAKTSTKPGRTQLLNFYKNESEKLFVDLPGYGYAAVSKTKKHQIDRIIAGYFQKDQPISAVFLILDARVGFTNLDYIMIEYIIQQGFKLHILANKIDKTNQS----TRAILLNQCKKLKLNCLLISAKNKNNLSKLQELL 197
>gi|118581676|ref|YP_902926.1| GTPase EngB [Pelobacter propionicus DSM 2379] >gi|166225967|sp|A1AU48|ENGB_PELPD Probable GTP-binding protein engB >gi|118504386|gb|ABL00869.1| small GTP-binding protein [Pelobacter propionicus DSM 2379] (200 aa)
Score = 301, Expect = 4.7e-26, Identities = 75/168 (44%), Positives = 99/168 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVI-TDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           FIKS     D+  +   E+ F+GRSNVGKSSLIN LAN K + +TS+TPGRTQL NF+D +    L+DLPGYGYAK       +   +I  Y+  R NL AV  I+DI  I +D DLQM   L         VL K DK +K       A IA+ +K+D+  ++  SA ++
  S:     8 FIKSAVKPKDYPLETLPEVAFVGRSNVGKSSLINVLANRKSLVRTSSTPGRTQLINFFDINGVLTLVDLPGYGYAKAPPDVRKQWGPMIETYLARRGNLRAVVLILDIRRIPSDGDLQMLGWLETYDIPPIFVLTKCDKLSKVERAKQTALIASAIKRDRNELLHFSALSR 178
>gi|119369216|sp|Q4A7S3|ENGB_MYCH7 Probable GTP-binding protein engB >gi|144575461|gb|AAZ53816.2| GTP-binding protein [Mycoplasma hyopneumoniae 7448] (198 aa)
Score = 300, Expect = 5.7e-26, Identities = 83/178 (46%), Positives = 114/178 (64%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRL-IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           F+KSC    +  +D   +  FIGRSNVGKS+LINALAN KIAKTS  PGRTQL NFY  +  +L +DLPGYGYA VSK+K  ++ +II+ Y    + + AVF I+D  V  T+LD  M E +  +  + +I+ NK DK  +S      A +  + KK K N + +SAKNK N+  L++L+
  S:    26 FLKSC--PENCYSD--PQFAFIGRSNVGKSTLINALANKKIAKTSTKPGRTQLLNFYKNESEKLFVDLPGYGYAAVSKTKKHQIDRIIAGYFQKDQPISAVFLILDARVGFTNLDYIMIEYIIQQGFKLHILANKIDKTNQS----TRAILLNQCKKLKLNCLLISAKNKNNLSKLQELL 197
>gi|89895940|ref|YP_519427.1| hypothetical protein DSY3194 [Desulfitobacterium hafniense Y51] >gi|109649193|ref|ZP_01373085.1| GTP-binding [Desulfitobacterium hafniense DCB-2] >gi|119369191|sp|Q24SK9|ENGB_DESHY Probable GTP-binding protein engB >gi|89335388|dbj|BAE84983.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109639591|gb|EAT49148.1| GTP-binding [Desulfitobacterium hafniense DCB-2] (201 aa)
Score = 298, Expect = 1.1e-25, Identities = 70/165 (42%), Positives = 99/165 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           EI   GRSNVGKSSLIN   N + +A+T NTPG+TQ+ NFY   D++  +DLPGYGYAKVSK       K++ EY   R+NL AV Q++DI  +  + D +M   L NR     +V  KADK +K  +  + ++IA  L   D   I+  SA+    +P L + +  ++
  S:    26 EIALAGRSNVGKSSLINKFINRRNLARTGNTPGKTQMLNFYRINDQWSFVDLPGYGYAKVSKEIKANWGKMMEEYFSRRENLRAVIQVVDIRHVPSVEDQEMHAFLRNRGIPVLVVATKADKISKGQWGKHLSQIAKALHIPDWHIIITYSAETGLGVPELHEAVEEIL 194
>gi|72080781|ref|YP_287839.1| GTPase EngB [Mycoplasma hyopneumoniae 7448] (184 aa)
Score = 297, Expect = 1.2e-25, Identities = 83/178 (46%), Positives = 114/178 (64%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRL-IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           F+KSC    +  +D   +  FIGRSNVGKS+LINALAN KIAKTS  PGRTQL NFY  +  +L +DLPGYGYA VSK+K  ++ +II+ Y    + + AVF I+D  V  T+LD  M E +  +  + +I+ NK DK  +S      A +  + KK K N + +SAKNK N+  L++L+
  S:    12 FLKSC--PENCYSD--PQFAFIGRSNVGKSTLINALANKKIAKTSTKPGRTQLLNFYKNESEKLFVDLPGYGYAAVSKTKKHQIDRIIAGYFQKDQPISAVFLILDARVGFTNLDYIMIEYIIQQGFKLHILANKIDKTNQS----TRAILLNQCKKLKLNCLLISAKNKNNLSKLQELL 183
>gi|12045192|ref|NP_073003.1| GTPase EngB [Mycoplasma genitalium G37] >gi|1351548|sp|P47577|ENGB_MYCGE Probable GTP-binding protein engB >gi|3844914|gb|AAC71558.1| GTP-binding protein engB, putative [Mycoplasma genitalium G37] >gi|166079027|gb|ABY79645.1| GTP-binding protein engB, putative [synthetic Mycoplasma genitalium JCVI-1.0] (191 aa)
Score = 297, Expect = 1.3e-25, Identities = 73/178 (41%), Positives = 107/178 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           F+KS     D   D+  EICF+GRSNVGKSSLINA    K+AKTS TPGRTQL N++++   R +DLPGYG+AK++K+K   ++ ++++++  R NLV V  I+D  V+T  D ++ +++        IV NK DK  +S    +   IA  LK + +  V  S K   N+  + K I
  S:     5 FLKSASDLKDCPQDNIPEICFMGRSNVGKSSLINAFFKKKLAKTSATPGRTQLLNYFEYKDKRFVDLPGYGFAKINKNKKDFITNLLTQFLNFRSNLVGVVLIVDSGVVTVQDQEVVKIILQTGLNFLIVANKFDKLNQSERYFSLKNIANFLKVNFDKCVFASTKTHHNLALVHKKI 182
>gi|119369217|sp|Q4A9N9|ENGB_MYCHJ Probable GTP-binding protein engB >gi|144227637|gb|AAZ44532.2| putative GTP-binding protein [Mycoplasma hyopneumoniae J] (198 aa)
Score = 297, Expect = 1.4e-25, Identities = 78/161 (48%), Positives = 106/161 (65%)
  Q:    21 EICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRL-IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           +  FIGRSNVGKS+LINALAN KIAKTS  PGRTQL NFY  +  +L +DLPGYGYA VSK+K  ++ +II+ Y    + + AVF I+D  V  T+LD  M E +  +  + +I+ NK DK  +S      A +  + KK K N + +SAKNK N+  L++L+
  S:    39 QFAFIGRSNVGKSTLINALANKKIAKTSTKPGRTQLLNFYKNESEKLFVDLPGYGYAAVSKTKKDQIDRIIAGYFQKDQPISAVFLILDARVGFTNLDYIMIEYIIKQGFKLHILANKIDKTNQS----TRAILLNQCKKLKLNCLLISAKNKNNLSKLQELL 197
>gi|71893797|ref|YP_279243.1| GTPase EngB [Mycoplasma hyopneumoniae J] (184 aa)
Score = 294, Expect = 2.8e-25, Identities = 78/161 (48%), Positives = 106/161 (65%)
  Q:    21 EICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRL-IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           +  FIGRSNVGKS+LINALAN KIAKTS  PGRTQL NFY  +  +L +DLPGYGYA VSK+K  ++ +II+ Y    + + AVF I+D  V  T+LD  M E +  +  + +I+ NK DK  +S      A +  + KK K N + +SAKNK N+  L++L+
  S:    25 QFAFIGRSNVGKSTLINALANKKIAKTSTKPGRTQLLNFYKNESEKLFVDLPGYGYAAVSKTKKDQIDRIIAGYFQKDQPISAVFLILDARVGFTNLDYIMIEYIIKQGFKLHILANKIDKTNQS----TRAILLNQCKKLKLNCLLISAKNKNNLSKLQELL 183
>gi|114797282|ref|YP_759145.1| GTPase EngB [Hyphomonas neptunium ATCC 15444] >gi|119369205|sp|Q0C548|ENGB_HYPNA Probable GTP-binding protein engB >gi|114737456|gb|ABI75581.1| GTP-binding protein [Hyphomonas neptunium ATCC 15444] (220 aa)
Score = 292, Expect = 4.6e-25, Identities = 71/169 (42%), Positives = 103/169 (60%)
  Q:    18 DKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFD---KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV--ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN---IVCVSAKNKTNIPNLKKLIGSVIL 186
           D+ E+CF GRSNVGKSSLINAL   AK+A++S  PGRT+  N++D     K  L+DLPG+GYAKVSK++    +K+I  Y+  R +L  VF ++D     + D D ++ +L+      + +VL K DK  K   +    KIA KLKK       +   SA+    IP L+  I ++ +
  S:    41 DRSEVCFAGRSNVGKSSLINALTGRAKLARSSAEPGRTRELNYFDIGDEGKLYLVDLPGFGYAKVSKTQTAAWTKLIKSYLRGRPSLRRVFLLVDARRGDLMDTDEEVMDLMDGAAVTYQVVLTKVDKVPKGEVEKIVVKIADKLKKRGAAHPVVRMTSAEKGFGIPELRAEIAALAM 218
>gi|189423527|ref|YP_001950704.1| small GTP-binding protein [Geobacter lovleyi SZ] >gi|189419786|gb|ACD94184.1| small GTP-binding protein [Geobacter lovleyi SZ] (200 aa)
Score = 292, Expect = 4.7e-25, Identities = 74/169 (43%), Positives = 99/169 (58%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD----KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVI-TDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           +FIKS     D+   D  EI F GRSNVGKSSLIN +   K + +TS+TPGRTQL NF+          L+DLPGYGYAKV      +   ++  Y+  R++L  V  I+DI  I ++ DLQM   L +   +  IVL K DK  K+      A IAA+L+ DK  ++  SA +K
  S:     7 TFIKSAVKPADYPPVDLPEIAFAGRSNVGKSSLINVIVERKALVRTSSTPGRTQLINFFQVTGVPFSLNLVDLPGYGYAKVPLDVKRQWGPMMERYLSGRESLRGVVLILDIRRIPSEEDLQMLNWLRSYKRRPIIVLTKCDKVTKNERARQTAAIAARLEMDKSQLIHFSALSK 181
>gi|83319725|ref|YP_424232.1| GTPase EngB [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|119369215|sp|Q2SSN1|ENGB_MYCCT Probable GTP-binding protein engB >gi|83283611|gb|ABC01543.1| GTP-binding conserved hypothetical protein [Mycoplasma capricolum subsp. capricolum ATCC 27343] (196 aa)
Score = 289, Expect = 1.2e-24, Identities = 78/183 (42%), Positives = 114/183 (62%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           SFI S  + ++WI DD  EIC IGRSNVGKSS IN+L  N K+AK SNTPG+T+L NF++ +K  +RL+D PGYGYAKV  S   + +K++ EY   RKNL  VF ++D+    ++ D+ M + L +      I+  K DK  K+ +  N   I   +    +++ + +S  NKTNI    +LI  ++
  S:     6 SFITSAANKSNWINDDVSEICLIGRSNVGKSSFINSLTNNNKLAKISNTPGKTRLLNFFEINKGEYRLVDAPGYGYAKVDDSIKIQFAKMMEEYFINRKNLKGVFLLLDLRHKPSNDDIMMYQFLKHYNIPVVIIGTKLDKLKKNEYIKNEKMIKEAINFYQEDDFIKISNLNKTNIIKCYELINKLL 193
>gi|42560838|ref|NP_975289.1| GTPase EngB [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81829403|sp|Q6MTV5|ENGB_MYCMS Probable GTP-binding protein engB >gi|42492334|emb|CAE76931.1| GTP-binding protein [Mycoplasma mycoides subsp. mycoides SC str. PG1] (196 aa)
Score = 289, Expect = 1.3e-24, Identities = 78/183 (42%), Positives = 114/183 (62%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           SFI S  + ++WI DD  EIC IGRSNVGKSS IN+L  N K+AK SNTPG+T+L NF++ +K  +RL+D PGYGYAKV  +   + +K++ EY   R+NL  VF ++D+    ++ D+ M + L +      I+  K DK  KS +  N   I   +    +++ V +S  NKTNI    +LI  ++
  S:     6 SFITSSANKSNWIDDDVSEICLIGRSNVGKSSFINSLTNNNKLAKISNTPGKTRLLNFFEINKGEYRLVDAPGYGYAKVDDNLKIQFAKMMEEYFINRRNLKGVFLLLDLRHKPSNDDIMMYQFLKHYNIPVVIIGTKLDKLKKSEYVKNEKMIKETISFYQEDDFVKISNLNKTNIIKCYELIDKLL 193
>gi|188159637|ref|ZP_02998791.1| GTPase EngB [Mycoplasma mycoides subsp. mycoides LC str. GM12] (196 aa)
Score = 286, Expect = 2.8e-24, Identities = 77/183 (42%), Positives = 114/183 (62%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           SFI S  + ++WI DD  EIC IGRSNVGKSS IN+L  N K+AK SNTPG+T+L NF++ +K  +RL+D PGYGYAKV  +   + +K++ EY   RKNL  VF ++D+    ++ D+ M + L +      I+  K DK  KS +  N   I   +    +++ + +S  +KTNI    +LI  ++
  S:     6 SFITSAANKSNWINDDVSEICLIGRSNVGKSSFINSLTNNNKLAKISNTPGKTRLLNFFEINKGEYRLVDAPGYGYAKVDDNLKIQFAKMMEEYFINRKNLKGVFLLLDLRHKPSNDDIMMYQFLKHYNIPVVIIGTKLDKLKKSEYIKNEKMIKETINFYQEDDFIKISNLDKTNIIKCYELIDKLL 193
>gi|66879738|ref|ZP_00404732.1| COG0218: Predicted GTPase [Mycoplasma genitalium G-37] (176 aa)
Score = 285, Expect = 3.2e-24, Identities = 67/149 (44%), Positives = 99/149 (66%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVLNKADK--EAKSYFD----NNFAKI 152
           F+KS     D   D+  EICF+GRSNVGKSSLINA    K+AKTS TPGRTQL N++++   R +DLPGYG+AK++K+K   ++ ++++++  R NLV V  I+D  V+T  D ++ +++        IV NK DK  +++ YF      NF K+
  S:     5 FLKSASDLKDCPQDNIPEICFMGRSNVGKSSLINAFFKKKLAKTSATPGRTQLLNYFEYKDKRFVDLPGYGFAKINKNKKDFITNLLTQFLNFRSNLVGVVLIVDSGVVTVQDQEVVKIILQTGLNFLIVANKFDKLNQSERYFSLKNIANFLKV 159
>gi|50365173|ref|YP_053598.1| GTPase EngB [Mesoplasma florum L1] >gi|81827302|sp|Q6F1A9|ENGB_MESFL Probable GTP-binding protein engB >gi|50363729|gb|AAT75714.1| GTP-binding protein, endoglucanase/xylanase [Mesoplasma florum L1] (198 aa)
Score = 283, Expect = 6.3e-24, Identities = 74/171 (43%), Positives = 107/171 (62%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFD--KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI-VCVSAKNKTNI 174
           FIKS  + + WI D+  E+CF+GRSNVGKSS IN LA N K+AK +NTPG+T+L NF+D +   FRL+D PGYGYAK+S S   E   ++ +Y+  R+NL  V  ++D+    T+ D+QM + L        ++  K DK  ++    N   I   L+ D+ ++ V VS  +K NI
  S:     7 FIKSAANKSGWIEDNIPEVCFVGRSNVGKSSFINTLANNKKLAKVANTPGKTRLLNFFDINNSSFRLVDAPGYGYAKISNSMKVEFGIMMEDYLTTRENLKLVCMLVDLRHKPTNDDVQMYDFLKANDIPVLMIGTKLDKLKRNEIAKNEKLIKETLEFDQNDVFVKVSNLDKINI 182
>gi|191162237|ref|ZP_03024118.1| small GTP-binding protein [Geobacter sp. M21] >gi|190997027|gb|EDV72474.1| small GTP-binding protein [Geobacter sp. M21] (214 aa)
Score = 274, Expect = 7.0e-23, Identities = 73/168 (43%), Positives = 94/168 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           FIKS      +      EI F GRSNVGKSSL+N L N K + +TS+TPGRTQL NF+   D F L+DLPGYGYAKV  +   E   ++  Y+  R+NL  V  I+DI    T+ DLQM   L        IV+ K DK +K+      A I  K+   KE +   SA ++
  S:     8 FIKSATRPAHYPEGHLPEIAFAGRSNVGKSSLVNVLVNRKNLVRTSSTPGRTQLINFFQVNDDFMLVDLPGYGYAKVPLAVKKEWRPMMETYLSKRRNLRGVVLILDIRRTPTEEDLQMLTWLRAFSVPPVIVITKCDKVSKNERARQSAIIMEKMHLKKEELNYFSALSR 178
>gi|145617519|ref|ZP_01773584.1| small GTP-binding protein [Geobacter bemidjiensis Bem] >gi|144946308|gb|EDJ81368.1| small GTP-binding protein [Geobacter bemidjiensis Bem] >gi|197089536|gb|ACH40807.1| small GTP-binding protein [Geobacter bemidjiensis Bem] (214 aa)
Score = 273, Expect = 8.7e-23, Identities = 73/168 (43%), Positives = 96/168 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           FIKS      +   +  EI F GRSNVGKSSL+N L N K + +TS+TPGRTQL NF+   D F L+DLPGYGYAKV  +   E   ++  Y+  R+NL  V  I+DI    T+ DLQM   L        +V+ K DK +K+      A I  K++  KE +   SA +K
  S:     8 FIKSATKPAHYPEGNLPEIAFAGRSNVGKSSLVNVLVNRKNLVRTSSTPGRTQLINFFQVNDDFMLVDLPGYGYAKVPLAVKKEWRPMMETYLSKRRNLRGVVLILDIRRTPTEEDLQMLAWLRAFSVPPIVVITKCDKVSKNERARQSAVIMEKMQLKKEELNYFSALSK 178
>gi|193216921|ref|YP_002000163.1| GTPase protein YihA (EngB) [Mycoplasma arthritidis 158L3-1] >gi|193002244|gb|ACF07459.1| GTPase protein YihA (EngB) [Mycoplasma arthritidis 158L3-1] (183 aa)
Score = 272, Expect = 1.2e-22, Identities = 75/177 (42%), Positives = 107/177 (60%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLI-DLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNL 177
           M  FIKS    N+W+  D+ EI F GRSNVGKSSLINALA+ KIAKTS+TPGRT+L N+++  + ++I DLPGYG+A +SK    ++S II  Y    KN   +  +ID  +  + +DL+M + L +      I++ K DK  +S    +  K  A    D  NI  VS++ K  + +L
  S:     1 MWKFIKSATDQNNWLEHDQNEIVFWGRSNVGKSSLINALASQKIAKTSSTPGRTRLINYFETQRKKIIVDLPGYGFASMSKKAQSKISGIIDFYFRNSKNSKNICILIDAKIGFSYIDLEMIDYLKSLGLLFDIIITKIDKANQS--QKHRVKQQALTFSDDINIFMVSSEKKQGLSDL 177
>gi|126724908|ref|ZP_01740751.1| GTP-binding protein [Rhodobacterales bacterium HTCC2150] >gi|126706072|gb|EBA05162.1| GTP-binding protein [Rhodobacterales bacterium HTCC2150] (216 aa)
Score = 272, Expect = 1.2e-22, Identities = 67/182 (36%), Positives = 106/182 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           F+K   + +     D+ E+CF GRSNVGKS+LINAL   K +A+TSNTPGRTQ  NF+   +   L+DLPGYG+AK       +   ++  Y+  R+NL   F +ID    + D+D ++ +LL++      ++L KADK  ++  +   A+  A L K       I+  S++    I NL+ ++ ++I
  S:    29 FLKGVVAMDGMPPADRLEVCFAGRSNVGKSTLINALTGRKALARTSNTPGRTQEINFFTVAESHYLVDLPGYGFAKAPLPTVKKWQALLKAYLSGRQNLRRAFVLIDFRHGVKDVDDEIMQLLNSSAVTFQVILTKADKVKEADREKILAQTRAALAKHPAAYPEILVTSSEKGEGIENLRSIVNTLI 216
>gi|110835513|ref|YP_694372.1| GTP-binding protein [Alcanivorax borkumensis SK2] >gi|119368787|sp|Q0VL48|ENGB_ALCBS Probable GTP-binding protein engB >gi|110648624|emb|CAL18100.1| GTP-binding protein [Alcanivorax borkumensis SK2] (208 aa)
Score = 271, Expect = 1.5e-22, Identities = 64/155 (41%), Positives = 93/155 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           F++S    +    D+ +E+ F GRSN GKSS IN L   + +A+TS TPGRTQL NF+  D+  RL+DLPGYGYAKVSKSK  E  + +  Y+  R+ LV +  ++DI   + D DL M E  +      +I++ KADK       +   ++  +LK+
  S:    15 FLQSAQRLDQCPPDEGREVAFAGRSNAGKSSAINRLTGQRSLARTSKTPGRTQLLNFFQLDEERRLVDLPGYGYAKVSKSKRNEWQEHLDHYLSERQALVGLVLMMDIRHPLKDFDLMMLEWSAQANMPIHILMTKADKLKFGAAKSTLLQVQKQLKE 172
>gi|192361932|ref|YP_001983930.1| putative GTPase, involved in coordination of cell cycle (EngB) [Cellvibrio japonicus Ueda107] >gi|190688097|gb|ACE85775.1| putative GTPase, involved in coordination of cell cycle (EngB) [Cellvibrio japonicus Ueda107] (219 aa)
Score = 271, Expect = 1.5e-22, Identities = 69/183 (37%), Positives = 108/183 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK-----DKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           F+ S  S      +  +E+ F GRSN GKSS INAL N  ++A+TS TPGRTQL NF+    + +RL+DLPGYGYAKVS+    +  + +SEY+  RK L  +  ++DI   + + D  +           +I+L KADK ++S  +N   K+  +LK      +K ++   SA + + +  LK ++ S ++
  S:    12 FLTSAPSIRQCPPETGREVAFAGRSNAGKSSAINALTNNHRLARTSKTPGRTQLINFFTLGDEAYRLVDLPGYGYAKVSRELKEQWQRDLSEYLERRKTLQGLVLLMDIRHPLQEFDSAILHWAMQGQMPVHILLTKADKLSRSQVNNTLFKVHKELKNLGLHDNKLSLQPFSALSNSGVDELKSVLQSWLI 203
>gi|189502027|ref|YP_001957744.1| hypothetical protein Aasi_0617 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497468|gb|ACE06015.1| hypothetical protein Aasi_0617 [Candidatus Amoebophilus asiaticus 5a2] (210 aa)
Score = 269, Expect = 2.4e-22, Identities = 71/168 (42%), Positives = 100/168 (59%)
  Q:    18 DKKEICFIGRSNVGKSSLINA-LANAKIAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN---FAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           DK EI FIGRSNVGKSSL+N  L   K+AKTS  PG+TQL N F    K+ L+DLPGYG+A+ SK++    +K++++Y+  R+NL  +F ++DI +    +DL     L +      IVL KADK +K    N    F +  A   K+  N V  S+KN+         IG ++
  S:    22 DKAEIAFIGRSNVGKSSLVNMILGQKKLAKTSARPGKTQLINHFLVNQKYYLVDLPGYGWAQASKTQRIGWNKMVNQYLLYRENLACLFVLLDIRLPPQKIDLLFINFLIDNDIPFAIVLTKADKISKQQVVNQLATFKRTLAPSTKESLNYVVTSSKNQAGKIEALNCIGQIV 195
>gi|110599250|ref|ZP_01387490.1| Small GTP-binding protein domain:GTP-binding [Geobacter sp. FRC-32] >gi|110550005|gb|EAT63191.1| Small GTP-binding protein domain:GTP-binding [Geobacter sp. FRC-32] (207 aa)
Score = 267, Expect = 3.6e-22, Identities = 70/168 (41%), Positives = 95/168 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           FIKS   +  +   D  EI F GRSNVGKSSLIN L N K + +TS+TPGRTQL NF+D + +F L+DLPGYG+AKV  +   +   ++  Y+  R NL  V  I+DI       D+QM   L     +  +V+ K DK +K+        IA  L  + E +   SA N+
  S:     8 FIKSATRAAHYPPGDLPEIAFAGRSNVGKSSLINVLVNRKSLVRTSSTPGRTQLINFFDVNGQFTLVDLPGYGFAKVPLAVKKQWGPMMENYLAKRANLRGVILILDIRRTPVAEDIQMLHWLQAYSIKPILVITKCDKVSKNERGKQSRIIAQTLGVETEELNFFSALNR 178
>gi|108761214|ref|YP_631233.1| putative GTP-binding protein YihA [Myxococcus xanthus DK 1622] >gi|119369219|sp|Q1D7Z0|ENGB_MYXXD Probable GTP-binding protein engB >gi|108465094|gb|ABF90279.1| putative GTP-binding protein YihA [Myxococcus xanthus DK 1622] (206 aa)
Score = 267, Expect = 3.9e-22, Identities = 64/171 (37%), Positives = 95/171 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFD--------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNI 174
           F+ +      + TD   E+ F+GRSNVGKSS+INAL    K+ + SNTPGRT+  NF+D D        + RL DLPGYG+AK SK+   +  K+I+ Y+  R  L AV  I+D+ V  T  DL   + L     +  +V  K D+  K+       +++  +    E I+  S+  K  +
  S:     9 FVTTAVEPKGYPTDHTAEVAFVGRSNVGKSSMINALTGRRKLVRVSNTPGRTRTLNFFDVDLERGGVRHQIRLADLPGYGFAKASKADKAQWEKMITTYLEKRHRLEAVVSIVDVEVGPTPDDLTTLDYLQAHNRRVLVVATKVDRLTKARLKPRLVELSKLMDLPLEVILPFSSTEKLGV 189
>gi|171778306|ref|ZP_02919512.1| hypothetical protein STRINF_00354 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283006|gb|EDT48430.1| hypothetical protein STRINF_00354 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (203 aa)
Score = 267, Expect = 3.9e-22, Identities = 71/172 (41%), Positives = 101/172 (58%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNKTNI 174
           S + S  + + +  DD  E+   GRSNVGKSS IN L   K +A+TS+ PG+TQL NFY+ D K R +D+PGYGYAKVSK++  +  K+I EY+  R NL AV  ++D        D+QM E L        +V  KADK     ++ + + I  KL  DK +  V  S+ ++T +
  S:    17 SLLLSAANKSHYPQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFYNIDDKLRFVDVPGYGYAKVSKAERAKWGKMIEEYLVSRDNLRAVVSLVDFRHDPSADDIQMYEFLKYYEIPVIVVATKADKIPHGKWNKHESAIKKKLNFDKSDKFVVFSSVDRTGL 192
>gi|22537458|ref|NP_688309.1| GTPase EngB [Streptococcus agalactiae 2603V/R] >gi|76787685|ref|YP_329952.1| GTPase EngB [Streptococcus agalactiae A909] >gi|76798601|ref|ZP_00780829.1| GTP-binding protein [Streptococcus agalactiae 18RS21] >gi|77406717|ref|ZP_00783756.1| GTP-binding protein [Streptococcus agalactiae H36B] >gi|77409175|ref|ZP_00785887.1| GTP-binding protein [Streptococcus agalactiae COH1] >gi|77411147|ref|ZP_00787499.1| GTP-binding protein [Streptococcus agalactiae CJB111] >gi|77414086|ref|ZP_00790255.1| GTP-binding protein [Streptococcus agalactiae 515] >gi|81845418|sp|Q8DZ11|ENGB_STRA5 Probable GTP-binding protein engB >gi|119369268|sp|Q3K0K1|ENGB_STRA1 Probable GTP-binding protein engB >gi|22534336|gb|AAN00182.1|AE014252_5 GTP-binding protein [Streptococcus agalactiae 2603V/R] >gi|76562742|gb|ABA45326.1| GTP-binding protein [Streptococcus agalactiae A909] >gi|76586035|gb|EAO62565.1| GTP-binding protein [Streptococcus agalactiae 18RS21] >gi|77159884|gb|EAO71026.1| GTP-binding protein [Streptococcus agalactiae 515] >gi|77162765|gb|EAO73724.1| GTP-binding protein [Streptococcus agalactiae CJB111] >gi|77172221|gb|EAO75378.1| GTP-binding protein [Streptococcus agalactiae COH1] >gi|77174680|gb|EAO77510.1| GTP-binding protein [Streptococcus agalactiae H36B] (198 aa)
Score = 267, Expect = 4.7e-22, Identities = 70/172 (40%), Positives = 102/172 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD-KENIVCVSAKNKTNI 174
           S + S  + + +  DD  E+   GRSNVGKSS IN L   K +A+TS+ PG+TQL NFY+ D K R +D+PGYGYAKVSK++  +  K+I EY+  R NL  V  ++D        D+QM E L        IV  KADK  +  ++ + + I  KL  D K++ +  S+ ++T +
  S:    12 SILLSAANKSHYPQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFYNIDDKLRFVDVPGYGYAKVSKTERAKWGKMIEEYLVTRDNLRVVVSLVDFRHDPSADDIQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESSIKKKLNFDKKDHFIVFSSVDRTGL 187
>gi|170749902|ref|YP_001756162.1| GTP-binding protein HSR1-related [Methylobacterium radiotolerans JCM 2831] >gi|170656424|gb|ACB25479.1| GTP-binding protein HSR1-related [Methylobacterium radiotolerans JCM 2831] (217 aa)
Score = 266, Expect = 4.8e-22, Identities = 64/166 (38%), Positives = 96/166 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVIL 186
           EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ  NF+   ++  L+D+PGYGYA V K+K    +++I  Y+  R NL  VF +ID       +D  + + L      + +VL K D   K    +  A I A L K       ++  S+++ + +P+L+  I  +++
  S:    42 EIAFAGRSNVGKSSLINALTGRNTLARTSHTPGRTQQLNFFRIGERLSLVDMPGYGYAAVEKAKVEAWTRLIHSYLKGRTNLARVFMLIDARHGFKSIDTDVLDGLDKAAVSYQVVLTKGDSLKKGEVASRIAGIEAGLAKRPAAYPQVILTSSRDDSGVPDLRAAIAKLLV 213
>gi|157273342|gb|ABV27241.1| GTP-binding protein [Candidatus Chloracidobacterium thermophilum] (201 aa)
Score = 266, Expect = 4.8e-22, Identities = 62/157 (39%), Positives = 90/157 (57%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITD-LDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           +F+KS   + D+      E+ F+GRSNVGKSSLIN+L   + +A+TSNTPGRTQL NF++ ++  R +DLPGYGYA+V +        +I  Y+Y R  L     I+D+ +    LD  M E L        +V  KADK ++S   +  + + A    D
  S:     7 TFLKSATVAADYPPPTLPEVAFLGRSNVGKSSLINSLLGVRGLARTSNTPGRTQLINFFEINRELRFVDLPGYGYARVPQKIRERWRPMIESYLYHRSALALCVLIVDVRLAPQPLDRTMYEWLVATSRPFCLVATKADKLSRSQLLSQLSVLRAAYGPD 166
>gi|71894660|ref|YP_278768.1| GTPase EngB [Mycoplasma synoviae 53] >gi|119369218|sp|Q4A5B4|ENGB_MYCS5 Probable GTP-binding protein engB >gi|71851448|gb|AAZ44057.1| putative GTP-binding protein [Mycoplasma synoviae 53] (187 aa)
Score = 266, Expect = 6.1e-22, Identities = 74/183 (40%), Positives = 106/183 (57%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRL-IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGS 183
           M  F+KS     +W      EI F GRSNVGKSSL+NAL +  +AK S TPGRTQL NF++ +  ++ +DLPGYGYAK+SK    ++  +I EY+  R NL  ++ +ID  +  T +DL++   L      ++IV  K DK      +    KI   L+K+  N + VS++ K  I  LK+ I S
  S:     1 MFKFVKSSSDYTNWYFHKNSEIAFWGRSNVGKSSLLNALTSKGLAKVSKTPGRTQLINFFENELNQVYVDLPGYGYAKLSKDLKDKMMAMIEEYLLNRSNLKMLYLLIDSRLGFTKIDLEILSFLKENNLNYFIVFTKIDKLNTKEKNELNKKIKTYLEKESFNYLIVSSETKYQIDKLKENINS 185
>gi|195978195|ref|YP_002123439.1| probable GTP-binding protein EngB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195974900|gb|ACG62426.1| probable GTP-binding protein EngB [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (200 aa)
Score = 265, Expect = 7.7e-22, Identities = 66/160 (41%), Positives = 96/160 (60%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           S + S  + + +  DD  EI   GRSNVGKSS IN +   K +A+TS+ PG+TQL NF++ D K RL+D+PGYGYAKVSK++     K+I EY+  R+NL AV  ++D     +  D+QM E L        IV  KADK  +  ++ + + +   L  D+ +
  S:    14 SILLSAANKSHYPQDDLPEIALAGRSNVGKSSFINTILGRKSLARTSSKPGKTQLLNFFNVDDKLRLVDVPGYGYAKVSKAERARWGKMIEEYLTTRQNLRAVVSLVDFRHEPSQDDIQMYEFLKYYEIPVIIVATKADKVLRGRWNKHESMVKKSLNFDRTD 176
>gi|55820661|ref|YP_139103.1| GTPase EngB [Streptococcus thermophilus LMG 18311] >gi|55822552|ref|YP_140993.1| GTPase EngB [Streptococcus thermophilus CNRZ1066] >gi|81820325|sp|Q5M0S3|ENGB_STRT1 Probable GTP-binding protein engB >gi|81820489|sp|Q5M5A9|ENGB_STRT2 Probable GTP-binding protein engB >gi|55736646|gb|AAV60288.1| GTP-binding protein [Streptococcus thermophilus LMG 18311] >gi|55738537|gb|AAV62178.1| GTP-binding protein [Streptococcus thermophilus CNRZ1066] (199 aa)
Score = 264, Expect = 8.5e-22, Identities = 65/146 (44%), Positives = 88/146 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           DD  E+   GRSNVGKSS IN L   K +A+TS  PG+TQL NFY+ D K R +D+PGYGYA+VSK +  +  K+I EY+  R NL  V  ++D+    T  D+QM E L        +V  KADK  +  ++ + + I  KL  DK +
  S:    27 DDLPEVALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFYNIDDKLRFVDVPGYGYARVSKKERAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTQDDIQMYEFLKYYEIPVIVVATKADKIPRGKWNKHESIIKKKLNFDKND 175
>gi|116512007|ref|YP_809223.1| GTPase EngB [Lactococcus lactis subsp. cremoris SK11] >gi|125624159|ref|YP_001032642.1| GTPase EngB [Lactococcus lactis subsp. cremoris MG1363] >gi|123320395|sp|Q02Z21|ENGB_LACLS Probable GTP-binding protein engB >gi|13124218|sp|Q9L6G1|ENGB_LACLM Probable GTP-binding protein engB >gi|7546984|gb|AAF63739.1|AF236863_3 hypothetical GTP-binding protein [Lactococcus lactis] >gi|24935311|gb|AAN64304.1| YsxL protein [Lactococcus lactis subsp. cremoris] >gi|116107661|gb|ABJ72801.1| Predicted GTPase [Lactococcus lactis subsp. cremoris SK11] >gi|124492967|emb|CAL97930.1| Probable GTP-binding protein engB [Lactococcus lactis subsp. cremoris MG1363] (195 aa)
Score = 264, Expect = 1.0e-21, Identities = 70/169 (41%), Positives = 99/169 (58%)
  Q:     6 KSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNKTNI 174
           K  +  NDW      EI   GRSNVGKSS IN L N K  A+TS  PG+TQL NFY+ D +   +D+PGYGYA+VSK +  +  K+I EY+  R+NL AV  ++DI    ++ DL M E L        +V  KADK  +  ++ + + I   +K D  ++ +  S+ +KT I
  S:    17 KKQYPENDW-----PEIALAGRSNVGKSSFINTLLNRKNFARTSGQPGKTQLLNFYNIDDQLHFVDVPGYGYARVSKKEREKWGKMIEEYLTTRENLKAVVSLVDIRHEPSEDDLMMYEFLKYYHIPVILVATKADKVPRGKWNKHESIIKKAMKFDSTDDFIIFSSTDKTGI 184
>gi|19745954|ref|NP_607090.1| GTPase EngB [Streptococcus pyogenes MGAS8232] >gi|24418369|sp|Q8P1C8|ENGB_STRP8 Probable GTP-binding protein engB >gi|19748113|gb|AAL97589.1| conserved hypothetical GTP-binding protein [Streptococcus pyogenes MGAS8232] (199 aa)
Score = 263, Expect = 1.2e-21, Identities = 67/164 (40%), Positives = 97/164 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S + S  + + +  DD  EI   GRSNVGKSS IN +   K +A+TS+ PG+TQL NF++ D K R +D+PGYGYAKVSKS+  E  K+I EY+  R NL AV  ++D+    +  D+QM + L        +V  KADK  +  ++ + + +   L  DK +   V
  S:    13 SILLSAANKSHYPQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFFNIDDKLRFVDVPGYGYAKVSKSERAEWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDFLKYYDIPVIVVATKADKIPRGKWNKHESVVKKALNFDKSDTFIV 179
>gi|116627470|ref|YP_820089.1| GTPase EngB [Streptococcus thermophilus LMD-9] >gi|122267932|sp|Q03LM9|ENGB_STRTD Probable GTP-binding protein engB >gi|116100747|gb|ABJ65893.1| Predicted GTPase [Streptococcus thermophilus LMD-9] (199 aa)
Score = 263, Expect = 1.4e-21, Identities = 65/146 (44%), Positives = 87/146 (59%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           DD  E+   GRSNVGKSS IN L   K +A+TS  PG+TQL NFY+ D K R +D+PGYGYA+VSK    +  K+I EY+  R NL  V  ++D+    T  D+QM E L        +V  KADK  +  ++ + + I  KL  DK +
  S:    27 DDLPEVALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQLLNFYNIDDKLRFVDVPGYGYARVSKKARAKWGKMIEEYLVTRDNLRVVVSLVDLRHEPTQDDIQMYEFLKYYEIPVIVVATKADKIPRGKWNKHESIIKKKLNFDKND 175
>gi|28867574|ref|NP_790193.1| GTPase EngB [Pseudomonas syringae pv. tomato str. DC3000] >gi|38372197|sp|Q88AP4|ENGB_PSESM Probable GTP-binding protein engB >gi|28850809|gb|AAO53888.1| GTP-binding protein EngB [Pseudomonas syringae pv. tomato str. DC3000] (211 aa)
Score = 262, Expect = 1.4e-21, Identities = 61/156 (39%), Positives = 89/156 (57%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+  D+  RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD DL M +         +I+L KADK       N   K+ A+++K
  S:    15 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRLVDLPGYGYAKVPIPLKLHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDLLMLDWAIASHMPMHILLTKADKLTYGAAKNTLLKVQAEIRK 172
>gi|147677143|ref|YP_001211358.1| GTPase [Pelotomaculum thermopropionicum SI] >gi|189037182|sp|A5D451|ENGB_PELTS Probable GTP-binding protein engB >gi|146273240|dbj|BAF58989.1| predicted GTPase [Pelotomaculum thermopropionicum SI] (198 aa)
Score = 262, Expect = 1.4e-21, Identities = 71/179 (39%), Positives = 102/179 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIG 182
           FI S   + D+   +  E+   GRSNVGKSSL+N L N K +A+ S+TPGRT+L NF+  +  FRL+DLPGYGYAKVS  +     +++ EY+  R+NL  V  ++D     T LD+QM E L  +     +   KADK ++S    +   I   L    KE +V  SA+       + ++IG
  S:     8 FITSAAKTADYPAGNIPEVALAGRSNVGKSSLLNRLVNRKSLARISSTPGRTRLINFFLVNGLFRLVDLPGYGYAKVSARERQGWRRMVEEYLKTRENLKGVVLLVDSRHPPTVLDVQMYEWLKYQGIPAAVAATKADKISRSKRAQSLKVIREVLNLTAKEPLVFFSAETSEGREEMLEVIG 190
>gi|157151518|ref|YP_001450428.1| GTPase EngB [Streptococcus gordonii str. Challis substr. CH1] >gi|189037195|sp|A8AXB8|ENGB_STRGC Probable GTP-binding protein engB >gi|157076312|gb|ABV10995.1| GTP-binding protein [Streptococcus gordonii str. Challis substr. CH1] (197 aa)
Score = 262, Expect = 1.6e-21, Identities = 67/158 (42%), Positives = 98/158 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNKTNI 174
           DD  EI   GRSNVGKSS IN + N K +A+TS  PG+TQL NF++ D K R +D+PGYGYAKVSK++  +  ++I EY+  R+NL AV  ++D+       D+QM E L        +V  KADK  +  ++ + + I  KL  D+ +  +  S+ +KT +
  S:    23 DDIPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKLRFVDVPGYGYAKVSKTERAKWGRMIEEYLTSRENLRAVVSLVDLRHEPSADDVQMYEFLKYYEIPVILVATKADKIPRGKWNKHESAIKKKLNFDQADTFILFSSVDKTGL 184
>gi|25011424|ref|NP_735819.1| GTPase EngB [Streptococcus agalactiae NEM316] >gi|81845601|sp|Q8E4L9|ENGB_STRA3 Probable GTP-binding protein engB >gi|24412962|emb|CAD47041.1| unknown [Streptococcus agalactiae NEM316] (198 aa)
Score = 262, Expect = 1.7e-21, Identities = 69/172 (40%), Positives = 102/172 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD-KENIVCVSAKNKTNI 174
           S + S  + + +  DD  E+   GRSNVGKSS IN L   K +A+TS+ PG+TQL NFY+ D K R +D+PGYGYAKVSK++  +  K+I EY+  R NL  V  ++D        D+Q+ E L        IV  KADK  +  ++ + + I  KL  D K++ +  S+ ++T +
  S:    12 SILLSAANKSHYPQDDLPEVALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQLLNFYNIDDKLRFVDVPGYGYAKVSKTERAKWGKMIEEYLVTRDNLRVVVSLVDFRHDPSADDIQIYEFLKYYEIPVIIVATKADKIPRGKWNKHESSIKKKLNFDKKDHFIVFSSVDRTGL 187
>gi|15673134|ref|NP_267308.1| GTPase EngB [Lactococcus lactis subsp. lactis Il1403] >gi|18202795|sp|Q9CGE5|ENGB_LACLA Probable GTP-binding protein engB >gi|12724115|gb|AAK05250.1|AE006347_8 GTP-binding protein [Lactococcus lactis subsp. lactis Il1403] (195 aa)
Score = 262, Expect = 1.8e-21, Identities = 69/167 (41%), Positives = 98/167 (58%)
  Q:     6 KSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNKT 172
           K  +  NDW      EI   GRSNVGKSS IN L N K  A+TS  PG+TQL NFY+ D +   +D+PGYGYA+VSK +  +  K+I EY+  R+NL AV  ++DI    ++ DL M E L        +V  KADK  +  ++ + + I   +K D  ++ +  S+ +KT
  S:    17 KKQYPENDW-----PEIALAGRSNVGKSSFINTLLNRKNFARTSGQPGKTQLLNFYNIDDQLHFVDVPGYGYARVSKKEREKWGKMIEEYLTTRENLKAVVSLVDIRHEPSEDDLMMYEFLKYYHIPVILVATKADKVPRGKWNKHESIIKKAMKFDSTDDFIIFSSTDKT 182
>gi|115522672|ref|YP_779583.1| GTPase EngB [Rhodopseudomonas palustris BisA53] >gi|123026147|sp|Q07TY1|ENGB_RHOP5 Probable GTP-binding protein engB >gi|115516619|gb|ABJ04603.1| GTP-binding protein [Rhodopseudomonas palustris BisA53] (216 aa)
Score = 261, Expect = 1.9e-21, Identities = 66/161 (40%), Positives = 94/161 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLI 181
           E+ F GRSNVGKSSLINAL     +A+TS+TPGRTQ   F++      FRL+D+PGYGYA   K+K    +K+I +++  R  LV V+ +ID    I D+D ++   L      + IVL KAD+   +      A     L+K       IV  S++N + +P L+  I
  S:    40 EVAFAGRSNVGKSSLINALTGRNGLARTSHTPGRTQELIFFEGPADAGFRLVDMPGYGYAAAPKTKIASWTKLIHQFLQGRATLVRVYVLIDARHGIKDVDNEVLTTLDKSAVSYQIVLTKADQVKPAELAERVAATTEALRKHPAAFPEIVVTSSRNASGMPELRAAI 208
>gi|27383210|ref|NP_774739.1| GTPase EngB [Bradyrhizobium japonicum USDA 110] >gi|81734112|sp|Q89BP9|ENGB_BRAJA Probable GTP-binding protein engB >gi|27356384|dbj|BAC53364.1| GTP-binding protein [Bradyrhizobium japonicum USDA 110] (217 aa)
Score = 261, Expect = 2.1e-21, Identities = 65/168 (38%), Positives = 100/168 (59%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF---DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           D  EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ   F++       RL+D+PGYGYAK  KS+    +++I +++  R +L  V+ +ID    + D+DL++   L      + IVL KAD+   S   +  A+  A L K      N++  S+++ T +  L+  +  ++
  S:    37 DGVEIAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFFEVPGKKDLRLVDMPGYGYAKAPKSQVASWTELIHKFLLGRASLARVYVLIDARHGLKDVDLEILGTLDRSAVSYQIVLTKADQVKPSELASRIAETEAALAKHPAAFPNVLATSSRSATGMAELRAAMAKLL 212
>gi|160872432|ref|ZP_02062564.1| GTP-binding protein EngB [Rickettsiella grylli] >gi|159121231|gb|EDP46569.1| GTP-binding protein EngB [Rickettsiella grylli] (199 aa)
Score = 260, Expect = 2.6e-21, Identities = 62/140 (44%), Positives = 87/140 (62%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           F+KS    +    D   EI FIGRSN GKSS INA+   K +AK S TPGRTQL NF+  ++  RL+DLPGYG+AKVS ++  +  K I+ Y+ +RK+L  +   +DI   + D D  +   +S+     YI+L KADK  ++
  S:    11 FLKSVAQLDQLPPDKGAEIAFIGRSNSGKSSAINAITGKKGLAKISKTPGRTQLLNFFQLNENLRLVDLPGYGFAKVSDNRKIDWEKTITHYLKMRKSLKGLIMTMDIRHPLNDRDEVLLAFVSHYHIPTYILLTKADKLTRA 153
>gi|164686710|ref|ZP_02210738.1| hypothetical protein CLOBAR_00305 [Clostridium bartlettii DSM 16795] >gi|164604100|gb|EDQ97565.1| hypothetical protein CLOBAR_00305 [Clostridium bartlettii DSM 16795] (207 aa)
Score = 260, Expect = 2.7e-21, Identities = 63/157 (40%), Positives = 101/157 (64%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNKTNIPNL 177
           EI  +GRSNVGKSS +NAL N +  A+TS TPG+T+  NFY  + +F  +DLPGYGYAKV+KS+  +   I+  Y+  R+ L A+F ++DI    T+ D+ M E + +   +  ++  KADK ++  +  + + I  KL+ +K E I+ +S+  KT + ++
  S:    29 EIALVGRSNVGKSSCVNALLNRRNFARTSQTPGKTRTINFYLINNEFYFVDLPGYGYAKVAKSEKDKWGNIMETYLGDREELCAIFLLVDIRHEPTNDDVMMYEWIKHFGYECVVIATKADKISRGQYQKHMSIIRKKLQLEKDEKIIPLSSSKKTGVEDV 189
>gi|167730715|emb|CAO81627.1| putative GTP-binding protein engB [Candidatus Cloacamonas acidaminovorans] (203 aa)
Score = 260, Expect = 2.9e-21, Identities = 73/174 (41%), Positives = 103/174 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY-------DFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITD-LDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNL 177
           F+KS    +D+      E  F GRSNVGKS+LIN L N K +AKTS+TPG+T+L NF+       D D     +  DLPGYGYA+VS+++  +  ++I++Y   RK L ++  I+DI    D  D+ + E+L  R   + IV  KADK  K+        +A  L   +E I  VSA N T +  L
  S:     9 FVKSAIEPSDYPASAYPEFAFAGRSNVGKSTLINLLTNHKGLAKTSSTPGKTRLLNFFLIRYKIDDNDSSGFLQFTDLPGYGYAEVSQAEQEKWRRMINKYFEQRKQLRSLIVIVDIRHPADSKDIMLLEMLRLRGIDYCIVATKADKIPKTKVAKTVKDLAKGLGLKEEPIFPVSALNNTGLEPL 194
>gi|148266199|ref|YP_001232905.1| GTPase EngB [Geobacter uraniireducens Rf4] >gi|189037180|sp|A5G964|ENGB_GEOUR Probable GTP-binding protein engB >gi|146399699|gb|ABQ28332.1| small GTP-binding protein [Geobacter uraniireducens Rf4] (204 aa)
Score = 260, Expect = 3.0e-21, Identities = 69/151 (45%), Positives = 88/151 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAA 154
           FIKS      +   D  EI F GRSNVGKSSLIN L N K + +TS+TPGRTQL NF+D + +F L+DLPGYG+A+V  +   E   ++  Y+  R NL  V  I+DI       D+QM   L     +  IV+ K DK +K    N  AK AA
  S:     8 FIKSATRPAHYPAGDFPEIAFAGRSNVGKSSLINVLVNRKSLVRTSSTPGRTQLINFFDVNGEFTLVDLPGYGFARVPLAVKKEWGPMMETYLSKRSNLRGVILILDIRRTPVAEDVQMLHWLRAYSVKPIIVVTKCDKVSK----NERAKQAA 157
>gi|56808898|ref|ZP_00366607.1| COG0218: Predicted GTPase [Streptococcus pyogenes M49 591] >gi|94988379|ref|YP_596480.1| GTPase EngB [Streptococcus pyogenes MGAS9429] >gi|94990259|ref|YP_598359.1| GTPase EngB [Streptococcus pyogenes MGAS10270] >gi|94992261|ref|YP_600360.1| GTPase EngB [Streptococcus pyogenes MGAS2096] >gi|119369269|sp|Q1JC92|ENGB_STRPB Probable GTP-binding protein engB >gi|119369270|sp|Q1JM76|ENGB_STRPC Probable GTP-binding protein engB >gi|119369271|sp|Q1JHC1|ENGB_STRPD Probable GTP-binding protein engB >gi|94541887|gb|ABF31936.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS9429] >gi|94543767|gb|ABF33815.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS10270] >gi|94545769|gb|ABF35816.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS2096] (199 aa)
Score = 259, Expect = 3.3e-21, Identities = 66/164 (40%), Positives = 97/164 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S + S  + + +  DD  EI   GRSNVGKSS IN +   K +A+TS+ PG+TQL NF++ D K R +D+PGYGYAKVSKS+  +  K+I EY+  R NL AV  ++D+    +  D+QM + L        +V  KADK  +  ++ + + +   L  DK +   V
  S:    13 SILLSAANKSHYPQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFFNIDDKLRFVDVPGYGYAKVSKSERAKWGKMIEEYLTTRDNLRAVVSLVDLRHAPSKEDIQMYDFLKYYDIPVIVVATKADKIPRGKWNKHESVVKKALNFDKSDTFIV 179
>gi|114770123|ref|ZP_01447661.1| GTP-binding protein [alpha proteobacterium HTCC2255] >gi|114548960|gb|EAU51843.1| GTP-binding protein [alpha proteobacterium HTCC2255] (216 aa)
Score = 259, Expect = 3.4e-21, Identities = 67/182 (36%), Positives = 100/182 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFD---NNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           F+K     +     D+ E+CF GRSNVGKSSLINAL   K +A+TSNTPGRTQ  NF+   +   L+D+PGYG+A        +   ++  Y+  R +L  VF +ID    +  +D ++ ELL        +VL K+DK  K+  +   +   +I AK        V  S++    IP L+ +I ++I
  S:    29 FLKGVVGMDGMPPADRMEVCFAGRSNVGKSSLINALTGRKSLARTSNTPGRTQEINFFTLSESHYLVDVPGYGFANAPLPVVKKWQTLLKAYLSGRASLRRVFLLIDSRHGVKSVDEEIMELLGRSAVTFQVVLTKSDKPKKNDLEKVISETGRIVAKYPAAYPEFVLTSSEKGDGIPTLRHIIRTLI 216
>gi|121999169|ref|YP_001003956.1| GTP-binding protein, HSR1-related [Halorhodospira halophila SL1] >gi|121590574|gb|ABM63154.1| cell division checkpoint GTPase YihA [Halorhodospira halophila SL1] (206 aa)
Score = 259, Expect = 3.4e-21, Identities = 62/143 (43%), Positives = 86/143 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           D+  E+ F GRSNVGKSS++NAL    K+A+TS TPGRTQ  N +D D+ R LIDLPGYGYAKV ++      + + +Y+  R++L  V  I+D+    TDLDLQM    ++     + VL KADK  +    N    +     +D
  S:    25 DEGVEVAFAGRSNVGKSSVLNALTGQRKLARTSGTPGRTQAINCFDLDETRRLIDLPGYGYAKVPQAVKRRWERALPDYLRNRQSLYGVVVIMDVRHAPTDLDLQMLRWCADAGLVLHGVLTKADKLKRGAAHNRLQAVQRATAED 170
>gi|94501575|ref|ZP_01308092.1| GTP-binding protein [Oceanobacter sp. RED65] >gi|94426258|gb|EAT11249.1| GTP-binding protein [Oceanobacter sp. RED65] (200 aa)
Score = 259, Expect = 3.6e-21, Identities = 59/126 (46%), Positives = 84/126 (66%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           D+  E+ F GRSN GKSS +N LA   K+A+TS TPGRTQL NF++ ++  RL+DLPGYG+AKV +    E  K +SEY+  RK+L A+  ++DI   +++ DL M +   +     +I+L KADK  K
  S:    23 DNGAEVAFAGRSNAGKSSALNTLAQQNKLARTSKTPGRTQLINFFEIEEGLRLVDLPGYGFAKVPERMKREWQKNMSEYLEQRKSLKAMVLVMDIRHPLSEFDLMMCQWALDCNMPTHILLTKADKLKK 151
>gi|116618614|ref|YP_818985.1| GTPase EngB [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|122271186|sp|Q03W10|ENGB_LEUMM Probable GTP-binding protein engB >gi|116097461|gb|ABJ62612.1| Predicted GTPase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (194 aa)
Score = 258, Expect = 4.5e-21, Identities = 66/158 (41%), Positives = 91/158 (57%)
  Q:     5 IKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           + S  S++ + TD K EI  +GRSNVGKSSL N L   K  A+TS+ PG+TQ  NFYD  DK   +D+PGYGYAKVSK++      +I EYI  RK L  V  ++D     ++ D+ M E L        +V  K+DK ++  F+   + I   L  D E+
  S:     9 VMSAVSASQYPTDGKPEIALVGRSNVGKSSLTNTLIQRKNFARTSSQPGKTQTLNFYDVEDKLYFVDVPGYGYAKVSKAQREAFGVMIEEYITSRKQLRGVISLVDARHEPSEDDISMYEWLHYYNIPILVVATKSDKISRGKFNKAESVIKKALGFDNED 169
>gi|89092189|ref|ZP_01165143.1| hypothetical protein MED92_05238 [Oceanospirillum sp. MED92] >gi|89083277|gb|EAR62495.1| hypothetical protein MED92_05238 [Oceanospirillum sp. MED92] (218 aa)
Score = 258, Expect = 4.5e-21, Identities = 70/175 (40%), Positives = 95/175 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV---SAKNKTNIPNLK 178
           F KS    +    D   E+ F GRSN GKSS IN L N  K+A+TS TPGRTQL NF+D   +  RL+DLPGYGYAKV         K + EY+  R+ L  V  ++DI   + + D  M E   N     +++L KADK  K    +   K+  +L+    ++V V   SA  K  +  L+
  S:    15 FNKSAAKLHQCPEDIGAEVAFAGRSNAGKSSAINTLTNNGKLARTSKTPGRTQLINFFDLNLEGVRLVDLPGYGYAKVPVEMKVHWQKHLGEYLEKRQCLQGVVLVMDIRHPMKEFDQMMVEWCENSQMPLHVLLTKADKLKKGPAQSTMLKLRKELQAVLGDLVTVQTFSALKKQGVDQLR 196
>gi|84515674|ref|ZP_01003035.1| GTP-binding protein [Loktanella vestfoldensis SKA53] >gi|84510116|gb|EAQ06572.1| GTP-binding protein [Loktanella vestfoldensis SKA53] (215 aa)
Score = 258, Expect = 4.9e-21, Identities = 64/182 (35%), Positives = 97/182 (53%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           +F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+      ++DLPGYG+A    +   +  +++ +Y+  R+ L  VF +ID       +D ++  LL        +V+ K DK        + AK  A L K       ++  SA+    IP L+ +I  +
  S:    28 TFVKGVVAMDGLPPADRIEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTAGDIYVVDLPGYGFANAPVAVVEKWQRLLKQYLQGRQTLRRVFVLIDARHGAKAVDEEIMSLLDASAVTFQVVMTKVDKLRGDALAESLAKTRAALVKHPAAYPELILTSAEKGEGIPTLRAIIAGI 214
>gi|15674911|ref|NP_269085.1| GTPase EngB [Streptococcus pyogenes M1 GAS] >gi|71910505|ref|YP_282055.1| GTPase EngB [Streptococcus pyogenes MGAS5005] >gi|24418393|sp|Q9A088|ENGB_STRP1 Probable GTP-binding protein engB >gi|13622052|gb|AAK33806.1| conserved hypothetical GTP-binding protein [Streptococcus pyogenes M1 GAS] >gi|71853287|gb|AAZ51310.1| GTP-binding protein [Streptococcus pyogenes MGAS5005] (199 aa)
Score = 258, Expect = 5.0e-21, Identities = 66/164 (40%), Positives = 97/164 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S + S  + + +  DD  EI   GRSNVGKSS IN +   K +A+TS+ PG+TQL NF++ D K R +D+PGYGYAKVSKS+  +  K+I EY+  R NL AV  ++D+    +  D+QM + L        +V  KADK  +  ++ + + +   L  DK +   V
  S:    13 SILLSAANKSHYPQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFFNIDDKLRFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDFLKYYDIPVIVVATKADKIPRGKWNKHESVVKKALNFDKSDTFIV 179
>gi|167769426|ref|ZP_02441479.1| hypothetical protein ANACOL_00756 [Anaerotruncus colihominis DSM 17241] >gi|167668394|gb|EDS12524.1| hypothetical protein ANACOL_00756 [Anaerotruncus colihominis DSM 17241] (202 aa)
Score = 258, Expect = 5.1e-21, Identities = 60/123 (48%), Positives = 77/123 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSNVGKSS+IN L N K +A+ S  PG+T   NF+  D  R  DLPGYGYAKVSK +    S++IS Y    ++L  VFQ+ID+    T  DL M   + +R     +VL KADK +K+
  S:    25 EIAFAGRSNVGKSSMINKLFNRKQLARVSAVPGKTATINFFRADGLRFADLPGYGYAKVSKGEKRRWSELISGYFEQDRDLRLVFQLIDMRHAPTAGDLTMINYMIDREIPFVVVLTKADKLSKT 149
>gi|119503604|ref|ZP_01625687.1| GTP-binding protein EngB [marine gamma proteobacterium HTCC2080] >gi|119460666|gb|EAW41758.1| GTP-binding protein EngB [marine gamma proteobacterium HTCC2080] (221 aa)
Score = 257, Expect = 5.4e-21, Identities = 64/154 (41%), Positives = 91/154 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           SF++S  S  +  +D   E+ F GRSN GKSS IN L +N K+A+TS TPGRTQL NF+   D  RL+DLPGYGYAKV      E ++ +++Y+  R++L  +  ++DI   +TD D QM    S      + +L KADK  +         + A+L
  S:    20 SFMQSASSLGNAPSDTGSEVAFAGRSNAGKSSAINTLTSNRKLARTSRTPGRTQLINFFSLSDSQRLVDLPGYGYAKVPLKMKQEWNRHMADYLQRRESLRGLILLMDIRHPLTDADEQMIGWASKAQMPIHALLTKADKLKRGPAKATLLSVQARL 176
>gi|119369236|sp|Q4ZZT0|ENGB_PSEU2 Probable GTP-binding protein engB (211 aa)
Score = 257, Expect = 5.7e-21, Identities = 60/156 (38%), Positives = 89/156 (57%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+  D+  RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD D+ M +         +I+L KADK       N   K+ A+++K
  S:    15 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRLVDLPGYGYAKVPIPLKLHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDVLMLDWAIASNMPMHILLTKADKLTYGAAKNTLLKVQAEIRK 172
>gi|66043539|ref|YP_233380.1| GTPase EngB [Pseudomonas syringae pv. syringae B728a] >gi|63254246|gb|AAY35342.1| GTP-binding protein, HSR1-related [Pseudomonas syringae pv. syringae B728a] (235 aa)
Score = 257, Expect = 5.7e-21, Identities = 60/156 (38%), Positives = 89/156 (57%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+  D+  RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD D+ M +         +I+L KADK       N   K+ A+++K
  S:    39 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRLVDLPGYGYAKVPIPLKLHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDVLMLDWAIASNMPMHILLTKADKLTYGAAKNTLLKVQAEIRK 196
>gi|81096806|ref|ZP_00875136.1| Small GTP-binding protein domain:GTP-binding [Streptococcus suis 89/1591] >gi|80977158|gb|EAP40711.1| Small GTP-binding protein domain:GTP-binding [Streptococcus suis 89/1591] (195 aa)
Score = 257, Expect = 6.0e-21, Identities = 67/156 (42%), Positives = 91/156 (58%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           S  S   +  DD  EI   GRSNVGKSS IN L   K +A+TS  PG+TQ  NFY+ D K R +D+PGYGYAKVSK++  +  K+I EY+  R+NL  V  ++D+       D+QM + L        IV  KADK  +  ++ + + I  KL  DK +
  S:    13 SAVSKAQYPGDDIPEIALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQQLNFYNIDDKIRFVDVPGYGYAKVSKTERAKWGKMIEEYLTTRENLRVVVSLVDMRHEPSADDVQMYDFLKYYEIPVIIVATKADKIPQGKWNKHESMIKKKLDFDKND 171
>gi|50914055|ref|YP_060027.1| GTPase EngB [Streptococcus pyogenes MGAS10394] >gi|94994180|ref|YP_602278.1| GTPase EngB [Streptococcus pyogenes MGAS10750] >gi|139473949|ref|YP_001128665.1| GTPase EngB [Streptococcus pyogenes str. Manfredo] >gi|166225987|sp|A2RF16|ENGB_STRPG Probable GTP-binding protein engB >gi|73919335|sp|Q5XCL9|ENGB_STRP6 Probable GTP-binding protein engB >gi|119369272|sp|Q1J740|ENGB_STRPF Probable GTP-binding protein engB >gi|50903129|gb|AAT86844.1| YihA [Streptococcus pyogenes MGAS10394] >gi|94547688|gb|ABF37734.1| GTP-binding protein YihA [Streptococcus pyogenes MGAS10750] >gi|134272196|emb|CAM30442.1| putative GTP-binding protein [Streptococcus pyogenes str. Manfredo] (199 aa)
Score = 257, Expect = 6.4e-21, Identities = 66/164 (40%), Positives = 97/164 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S + S  + + +  DD  EI   GRSNVGKSS IN +   K +A+TS+ PG+TQL NF++ D K R +D+PGYGYAKVSKS+  +  K+I EY+  R NL AV  ++D+    +  D+QM + L        +V  KADK  +  ++ + + +   L  DK +   V
  S:    13 SILLSAANKSHYPQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFFNIDNKLRFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDFLKYYDIPVIVVATKADKIPRGKWNKHESVVKKALNFDKSDTFIV 179
>gi|67154994|ref|ZP_00416739.1| GTP-binding domain [Azotobacter vinelandii AvOP] >gi|67089127|gb|EAM08593.1| GTP-binding domain [Azotobacter vinelandii AvOP] (231 aa)
Score = 257, Expect = 6.5e-21, Identities = 62/156 (39%), Positives = 86/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+ S    +    DD  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV           +  Y+  R++L  V  ++DI   +TD D  M +         +I+L KADK A     N   K+  ++ K
  S:    30 AFMLSAARVDQCPADDGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFRLDDRRRLVDLPGYGYAKVPIPLKQHWQHHLEAYLGSRRSLAGVVLLMDIRHPLTDFDRMMLDWAGASGMPMHILLTKADKLAFGAAKNALLKVRREIHK 187
>gi|196194064|gb|EDX89023.1| GTPase, putative [Alcanivorax sp. DG881] (203 aa)
Score = 257, Expect = 6.7e-21, Identities = 60/136 (44%), Positives = 85/136 (62%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           F++S    +    D+  E+ F GRSN GKSS IN L + + +A+TS TPGRTQL NF+  D+  RL+DLPGYGYAKV+KS   E  + +  Y+  R+ LV +  ++DI   + D DL M E  +      +I++ KADK
  S:    15 FLQSAQRLDQCPPDEGLEVAFAGRSNAGKSSAINRLTSQRTLARTSKTPGRTQLLNFFQLDEERRLVDLPGYGYAKVAKSTRNEWQQHLDHYLSERQALVGLVLMMDIRHPLKDFDLLMLEWSAQANMPIHILMTKADK 153
>gi|125717924|ref|YP_001035057.1| GTPase EngB [Streptococcus sanguinis SK36] >gi|166226980|sp|A3CMV2|ENGB_STRSV Probable GTP-binding protein engB >gi|125497841|gb|ABN44507.1| GTP-binding protein, putative [Streptococcus sanguinis SK36] (195 aa)
Score = 257, Expect = 6.8e-21, Identities = 65/146 (44%), Positives = 90/146 (61%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           DD  EI   GRSNVGKSS IN L N K +A+TS  PG+TQL NF++ D K R +D+PGYGYA+VSK +  +  ++I EY+  R+NL AV  ++D+       D+QM E L        +V  KADK  +  ++ + + I  KL  DK +
  S:    23 DDIPEIALAGRSNVGKSSFINTLLNRKNLARTSGKPGKTQLLNFFNIDDKLRFVDVPGYGYARVSKKEREKWGRMIEEYLTSRENLRAVVSLVDLRHDPSADDVQMYEFLKYYDIPVILVATKADKIPRGKWNKHESAIKKKLDFDKND 171
>gi|146284373|ref|YP_001174526.1| GTPase EngB [Pseudomonas stutzeri A1501] >gi|145572578|gb|ABP81684.1| GTP-binding protein EngB [Pseudomonas stutzeri A1501] (227 aa)
Score = 256, Expect = 6.8e-21, Identities = 62/156 (39%), Positives = 89/156 (57%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         + +  Y+  R++LV VF ++DI   +T+ D  M +  +      +I+L K+DK A     N    I   ++K
  S:    26 SFMISAAKVDQCPADEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFRLDDERRLVDLPGYGYAKVPIPLKQHWQRHLEAYLGSRESLVGVFLMMDIRHPLTEFDRMMLDWANASDMPLHILLTKSDKLAFGAAKNALLAIQRDIRK 183
>gi|71736746|ref|YP_272563.1| GTPase EngB [Pseudomonas syringae pv. phaseolicola 1448A] >gi|119369231|sp|Q48PV6|ENGB_PSE14 Probable GTP-binding protein engB >gi|71557299|gb|AAZ36510.1| GTP-binding protein XF1430 [Pseudomonas syringae pv. phaseolicola 1448A] (211 aa)
Score = 256, Expect = 7.5e-21, Identities = 60/156 (38%), Positives = 88/156 (56%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+  D+  RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD DL M +         +I+L KADK       N   K+  +++K
  S:    15 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFGLDEDRRLVDLPGYGYAKVPIPLKLHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDLLMLDWAIASNMPMHILLTKADKLTYGAAKNTLLKVQTEIRK 172
>gi|69933089|ref|ZP_00628291.1| Small GTP-binding protein domain:GTP-binding [Paracoccus denitrificans PD1222] >gi|119383630|ref|YP_914686.1| GTPase EngB [Paracoccus denitrificans PD1222] >gi|119373397|gb|ABL68990.1| small GTP-binding protein [Paracoccus denitrificans PD1222] (216 aa)
Score = 256, Expect = 8.8e-21, Identities = 64/181 (35%), Positives = 99/181 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSN GKSSLINAL   K +A+ SNTPGRTQ  N++   ++  L+DLPGYG+AK   +   +   ++  Y+  R  L   F +ID    + D+D ++ +LL        +VL KADK      +   A++   L+K       +V  S++    I  L+ +I S+
  S:    29 FLKGVVAMDGLPPADRPEVCFAGRSNAGKSSLINALTGRKSLARASNTPGRTQEINYFTLGERAYLVDLPGYGFAKAPVAVVAKWQALLKNYLSGRPTLRRAFTLIDSRHGVKDVDHEIMKLLDRSAVPFQVVLTKADKIGAQAMEATVAQVQEALQKHPAAYPELVITSSEKGQGIATLRAIIASL 215
>gi|56695444|ref|YP_165792.1| GTPase EngB [Silicibacter pomeroyi DSS-3] >gi|81558731|sp|Q5LW13|ENGB_SILPO Probable GTP-binding protein engB >gi|56677181|gb|AAV93847.1| GTP-binding protein [Silicibacter pomeroyi DSS-3] (217 aa)
Score = 255, Expect = 8.9e-21, Identities = 70/181 (38%), Positives = 99/181 (54%)
  Q:     2 PS-FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY-DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIG 182
           PS F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+    +  L+DLPGYGYA        +  K++ +Y+  R+ L   F +ID    +  +D ++ +LL         VL KADK   +  D   A++ A L K       IV  S++    I  L+ +I 
  S:    27 PSEFVKGVVAMSGLPPADRVEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFFTQGPELYLVDLPGYGYANAPLKVVEKWQKLLKQYLSGRQTLRRAFVLIDARHGVKAVDDEIMKLLDTSAVTFQCVLTKADKVKAAERDKVLAQVRAALAKHPAAYPEIVLTSSEKGDGIATLRSIIA 214
>gi|47459175|ref|YP_016037.1| GTPase EngB [Mycoplasma mobile 163K] >gi|81614262|sp|Q6KHV1|ENGB_MYCMO Probable GTP-binding protein engB >gi|47458504|gb|AAT27826.1| GTP-binding protein [Mycoplasma mobile 163K] (181 aa)
Score = 255, Expect = 9.2e-21, Identities = 61/143 (42%), Positives = 90/143 (62%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           M  FIKS    ++W+ + K EICF+GRSNVGKSSLINAL   ++ K   TPG+T+L NF++ ++   ++DLPGYGYAK+SK    E+S +I E++  R  +  +F +ID  +  T +D +  + L     +  IV  K DK  +S
  S:     1 MLKFIKSSTKESEWLKNPKNEICFVGRSNVGKSSLINALFKTRVVKVGKTPGKTKLINFFEDERGNSVVDLPGYGYAKLSKEAQSEISDMIFEFLTKRVEIKKLFLLIDSRLGFTPIDQEFYDFLKEAPFEIIIVATKRDKLNQS 145
>gi|15828710|ref|NP_326070.1| GTPase EngB [Mycoplasma pulmonis UAB CTIP] >gi|24418391|sp|Q98QX1|ENGB_MYCPU Probable GTP-binding protein engB >gi|14089652|emb|CAC13412.1| GTP-BINDING PROTEIN [Mycoplasma pulmonis] (186 aa)
Score = 255, Expect = 9.4e-21, Identities = 77/183 (42%), Positives = 113/183 (61%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRL-IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGS 183
           M  FIKS  +S  W   DK EICFIGRSNVGKSSLIN+L+N+ ++K SNTPGRTQL NF++ D+  + +DLPGYG+A++ K K  ++ ++I EY+  RKNL  +  + D    I D DL              ++  K DK  ++    +   ++ K    +++++ VS+  +TNI NLKKL+ S
  S:     1 MLHFIKSASNSQSWYNHDKVEICFIGRSNVGKSSLINSLSNSAVSKVSNTPGRTQLINFFEDDQKNVYVDLPGYGFAQMPKDKLEKMHQMIDEYLQNRKNLKTIVLLFDSRRGILDQDLDFINWAQQAKKNIILLATKIDKLNQA--QKHKLLVSLKELNLEKSVLLVSSLKRTNIDNLKKLLAS 183
>gi|77164078|ref|YP_342603.1| GTP-binding protein [Nitrosococcus oceani ATCC 19707] >gi|119369224|sp|Q3JDM3|ENGB_NITOC Probable GTP-binding protein engB >gi|76882392|gb|ABA57073.1| cell division checkpoint GTPase YihA [Nitrosococcus oceani ATCC 19707] (200 aa)
Score = 255, Expect = 9.4e-21, Identities = 64/172 (37%), Positives = 96/172 (55%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK--DKENIVCVSAKNKTNIPNLK 178
           S ++ +    D+  E+ F GRSNVGKSS INA+     +A+TS TPGRTQ+ NF+  D  R L+DLPGYGYAKV ++   +  + +S Y+  R+ L  +  ++DI  +    DLQM E   +R     I+L K+DK  +   +    K    L++      +   SA N T I  ++
  S:    13 SAYTLSQLPPDEGMEVAFAGRSNVGKSSAINAITGIGGLARTSKTPGRTQMINFFQLDARRYLVDLPGYGYAKVPEAVKRQWQQTLSAYLEQRRALCGIVLVVDIRRLYQPFDLQMLEWCRSRGLPVRILLTKSDKLKRGAANQALQKATTHLQEVFPMARVQLFSAVNHTGIEAIQ 189
>gi|153813471|ref|ZP_01966139.1| hypothetical protein RUMOBE_03891 [Ruminococcus obeum ATCC 29174] >gi|149830415|gb|EDM85507.1| hypothetical protein RUMOBE_03891 [Ruminococcus obeum ATCC 29174] (201 aa)
Score = 255, Expect = 9.5e-21, Identities = 67/164 (40%), Positives = 95/164 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIGSV 184
           E+ F G+SNVGKSSLIN L N K +A+TS  PG+TQ  NFY   D+  L+DLPGYGYA+V+ ++  +  K+I  Y++   NL AVF +IDI       D QM E + +   +  I+  K DK  +S    N   I   L+ K    ++  SA+ K     + +LI S+
  S:    25 EVAFAGKSNVGKSSLINGLMNRKALARTSAQPGKTQTINFYKINDELDLVDLPGYGYARVTPAEKEKWGKMIENYLHTSHNLKAVFLLIDIRHDPSANDRQMYEWILHNGYEPIIIATKLDKLKRSQVQKNLKAIREGLQLKKGTTVIPYSAETKQGRDEIWELIESL 192
>gi|21910141|ref|NP_664409.1| GTPase EngB [Streptococcus pyogenes MGAS315] >gi|28896160|ref|NP_802510.1| GTPase EngB [Streptococcus pyogenes SSI-1] >gi|25452936|sp|Q8K7V8|ENGB_STRP3 Probable GTP-binding protein engB >gi|21904334|gb|AAM79212.1| putative GTP-binding protein [Streptococcus pyogenes MGAS315] >gi|28811410|dbj|BAC64343.1| conserved hypothetical GTP-binding protein [Streptococcus pyogenes SSI-1] (199 aa)
Score = 255, Expect = 9.9e-21, Identities = 66/164 (40%), Positives = 96/164 (58%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S + S  + + +  DD  EI   GRSNVGKSS IN +   K +A+TS+ PG+TQL NF++ D K R +D+PGYGYAKVSKS+  +  K+I EY+  R NL AV  ++D+    +  D+QM + L        +V  KADK     ++ + + +   L  DK +   V
  S:    13 SILLSAANKSHYPQDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFFNIDDKLRFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDFLKYYDIPVIVVATKADKIPHGKWNKHESVVKKALNFDKSDTFIV 179
>gi|83595990|gb|ABC25349.1| GTP-binding protein [uncultured marine bacterium Ant29B7] (215 aa)
Score = 255, Expect = 1.0e-20, Identities = 72/161 (44%), Positives = 95/161 (59%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFD--KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           SFIKS   + +       E  FIGRSNVGKSSLIN L  N  +AK S  PG+TQL N +  +  ++ L+DLPGYGYAKVSK +  E S++I+ Y+  RKNLV VF ++D       LDL   + L N      IV  K DK + S    N A + + L K+ +N+
  S:    15 SFIKSSARNEECPDLHVPEYAFIGRSNVGKSSLINRLVGNKYLAKISGRPGKTQLINHFSIEDGQWALVDLPGYGYAKVSKIQRTEFSRMIAYYLRNRKNLVNVFVLVDGRHEPQKLDLAFVKKLGNWGIPFSIVFTKMDKLSNSDSGKNQALMNSTLLKEWDNL 179
>gi|152988688|ref|YP_001351602.1| GTPase EngB [Pseudomonas aeruginosa PA7] >gi|166225968|sp|A6VEW7|ENGB_PSEA7 Probable GTP-binding protein engB >gi|150963846|gb|ABR85871.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] (215 aa)
Score = 255, Expect = 1.1e-20, Identities = 60/156 (38%), Positives = 89/156 (57%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+  D+  RL+DLPGYGYAKV         + +  Y+  R++L  VF ++DI   +TD D  M +         ++++ KADK A     N   K+  ++++
  S:    15 SFLISAAQVDQCPPDEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFSLDESRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLSSRESLAGVFLMMDIRHPLTDFDRLMLDWAQASQLPIHVLMTKADKLAFGAAKNALLKVRREVQQ 172
>gi|94495880|ref|ZP_01302459.1| GTP-binding protein [Sphingomonas sp. SKA58] >gi|94424572|gb|EAT09594.1| GTP-binding protein [Sphingomonas sp. SKA58] (215 aa)
Score = 255, Expect = 1.1e-20, Identities = 65/161 (40%), Positives = 94/161 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD---KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD---KENIVCVSAKNKTNIPNLKKLI 181
           E+ F GRSNVGKSSL+NAL N   +A+TSNTPGRTQ  NF+D     +FRL+D+PGYGYAK  K    +   ++++Y+  R  L     +ID    I D+D  M ++L      + IVL KADK   S       + A  ++K      +I+  S++    +P L+  +
  S:    40 EVAFAGRSNVGKSSLLNALTNRNGLARTSNTPGRTQELNFFDVGDPLRFRLVDMPGYGYAKAPKDMVKKWRFLVNDYLRGRAALKRTLVLIDSRHGIKDVDTDMLDMLDGAAVSYRIVLTKADKIKASALAAVTQQTADAIRKRPAAHPDIIATSSEKGMGLPELRAAV 208
>gi|53803258|ref|YP_115009.1| GTP-binding protein [Methylococcus capsulatus str. Bath] >gi|81681069|sp|Q604E1|ENGB_METCA Probable GTP-binding protein engB >gi|53757019|gb|AAU91310.1| GTP-binding protein [Methylococcus capsulatus str. Bath] (210 aa)
Score = 255, Expect = 1.1e-20, Identities = 60/154 (38%), Positives = 90/154 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK 157
           +++S     D   D   E+ F GRSN GKSS IN LAN   +A+ S TPGRT++ NF+  D   RL+DLPGYGYAKV    H      + +Y+  R++L  VF ++D+    T++D  M E  ++R    ++ L K+DK ++    N  A++ AK +
  S:    10 YLRSILELKDAPPDQGCEVAFAGRSNAGKSSAINTLANVGGLARVSKTPGRTRMINFFSIDDGRRLVDLPGYGYAKVPGEIHRRWEAALEQYLRYRQSLRGVFLLMDVRHPFTEMDEVMIEWCAHRSIALHVALTKSDKLSRGAAMN--ARLMAKTR 164
>gi|120556475|ref|YP_960826.1| GTP-binding protein, HSR1-related [Marinobacter aquaeolei VT8] >gi|120326324|gb|ABM20639.1| cell division checkpoint GTPase YihA [Marinobacter aquaeolei VT8] (214 aa)
Score = 255, Expect = 1.1e-20, Identities = 66/171 (38%), Positives = 98/171 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK--ENIVCVSAKNKTNI 174
           F+ S    ++   D   E+ F GRSN GKSS +NA+ AN K+A+TS TPGRT+L NF+  ++   RL+DLPGYGYAKVS+    +  + +  Y+  R+ L  +  ++DI   +TD D  M E   +      I+  KADK            IA KLK+ +  E+++  SA +K  +
  S:    17 FLISASKLDECPPDHGAEVAFAGRSNAGKSSALNAITANGKLARTSKTPGRTRLINFFSLNREHARLVDLPGYGYAKVSRDMKDDWQQHLGHYLNDRRCLRGLVLVMDIRHPLTDFDQMMVEWCEHNHLPLMILATKADKLKFGQAKTAMLGIAKKLKEYQCVEHLIMFSATSKRGV 193
>gi|182684523|ref|YP_001836270.1| GTP-binding protein [Streptococcus pneumoniae CGSP14] >gi|182629857|gb|ACB90805.1| GTP-binding protein [Streptococcus pneumoniae CGSP14] (197 aa)
Score = 255, Expect = 1.1e-20, Identities = 63/146 (43%), Positives = 89/146 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           D+  EI   GRSNVGKSS IN + N K +A+TS  PG+TQL NF++ D K R +D+PGYGYA+VSK +  +  ++I EY+  R+NL AV  ++D+       D+QM E L        IV  KADK  +  ++ + + I  KL  D  +
  S:    25 DELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSD 173
>gi|134300397|ref|YP_001113893.1| small GTP-binding protein [Desulfotomaculum reducens MI-1] >gi|172044336|sp|A4J7L5|ENGB_DESRM Probable GTP-binding protein engB >gi|134053097|gb|ABO51068.1| small GTP-binding protein [Desulfotomaculum reducens MI-1] (205 aa)
Score = 254, Expect = 1.2e-20, Identities = 71/182 (39%), Positives = 100/182 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNKTNIPNLKKLIGSVI 185
           F+ S  +   +   +  E+ F+GRSNVGKSSLIN + N K +AKTS+TPGRTQL NF++   D+F ++DLPGYGYAKV      +  K+I  Y+  R+ L  V  +ID     T  D QM E L        +V  K DK + + +    A I   L   KE+ ++  SA+       L K++   I
  S:     8 FVTSAVNPGGYPPGNLPEVAFVGRSNVGKSSLINKVVNRKGLAKTSSTPGRTQLINFFNINNDQFLMVDLPGYGYAKVPTDVRIKWGKMIEGYLKERECLKGVVLLIDSRHTPTAQDKQMYEWLQYYHVPTVVVATKVDKLSNNQWAKQQAVIKKSLPLSKEHQLISFSAETGRGKEKLLKVLDEFI 194
>gi|160933533|ref|ZP_02080921.1| hypothetical protein CLOLEP_02379 [Clostridium leptum DSM 753] >gi|156867410|gb|EDO60782.1| hypothetical protein CLOLEP_02379 [Clostridium leptum DSM 753] (199 aa)
Score = 254, Expect = 1.2e-20, Identities = 57/122 (46%), Positives = 76/122 (62%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D  EI F G+SNVGKSSLIN L N K +A+ S TPG+T   NFY  D+ RL+DLPGYGYAKVS ++    ++++  Y    +NL  V Q++D+    T  DL M E L +      + L K+DK
  S:    22 DLPEIVFSGKSNVGKSSLINKLLNRKNLARVSATPGKTATINFYRLDQARLVDLPGYGYAKVSLAEKKRWAELVEGYFQQERNLALVVQLVDMRHPPTKDDLHMIEFLCDGGFPFLVALTKSDK 145
>gi|169832607|ref|YP_001694973.1| GTP-binding protein [Streptococcus pneumoniae Hungary19A-6] >gi|168995109|gb|ACA35721.1| GTP-binding protein [Streptococcus pneumoniae Hungary19A-6] (195 aa)
Score = 254, Expect = 1.2e-20, Identities = 63/146 (43%), Positives = 89/146 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           D+  EI   GRSNVGKSS IN + N K +A+TS  PG+TQL NF++ D K R +D+PGYGYA+VSK +  +  ++I EY+  R+NL AV  ++D+       D+QM E L        IV  KADK  +  ++ + + I  KL  D  +
  S:    23 DELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGRMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSD 171
>gi|188581559|ref|YP_001925004.1| GTP-binding protein HSR1-related protein [Methylobacterium populi BJ001] >gi|179345057|gb|ACB80469.1| GTP-binding protein HSR1-related protein [Methylobacterium populi BJ001] (218 aa)
Score = 254, Expect = 1.3e-20, Identities = 64/165 (38%), Positives = 94/165 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ  NF+    +  L+D+PGYGYA V K+K    +K+I  Y+  R NL  V+ +ID    + ++D  + + L      + +VL K D   KS  +   A I A L K       ++  S+++   +  L+  I  ++
  S:    43 EIAFAGRSNVGKSSLINALTGRNTLARTSHTPGRTQQLNFFRIGGRLMLVDMPGYGYAAVEKAKVEAWTKLIHAYLKGRSNLARVYLLIDSRHGLKEIDTDLLDGLDKAAVSYQVVLTKGDALKKSEIEKRIAGIQAALAKRPAAYPEVLLTSSRDDRGVAELRASIARLL 213
>gi|119369233|sp|Q4KKJ8|ENGB_PSEF5 Probable GTP-binding protein engB (213 aa)
Score = 254, Expect = 1.4e-20, Identities = 60/156 (38%), Positives = 88/156 (56%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D  RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD DL M +         +I+L KADK       N   K+ ++++K
  S:    15 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFKLDDDRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDLLMLDWAVASGMPMHILLTKADKLTYGAAKNTLLKVQSQIRK 172
>gi|70733595|ref|YP_257235.1| GTPase EngB [Pseudomonas fluorescens Pf-5] >gi|68347894|gb|AAY95500.1| GTP-binding protein EngB [Pseudomonas fluorescens Pf-5] (268 aa)
Score = 254, Expect = 1.4e-20, Identities = 60/156 (38%), Positives = 88/156 (56%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D  RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD DL M +         +I+L KADK       N   K+ ++++K
  S:    70 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFKLDDDRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDLLMLDWAVASGMPMHILLTKADKLTYGAAKNTLLKVQSQIRK 227
>gi|160902807|ref|YP_001568388.1| small GTP-binding protein [Petrotoga mobilis SJ95] >gi|189037183|sp|A9BHV0|ENGB_PETMO Probable GTP-binding protein engB >gi|160360451|gb|ABX32065.1| small GTP-binding protein [Petrotoga mobilis SJ95] (196 aa)
Score = 254, Expect = 1.5e-20, Identities = 72/182 (39%), Positives = 100/182 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI-VCVSAKNKTNIPNLKKLIGSVI 185
            IK+ +   D    DKKEI F GRSNVGKSS +NA+   KIAK S+TPG+T+  N+Y   DK+  +DLPGYG+A VSK +    + +++EY   R +L AV  +ID   +   LD  M E L +       +L K+DK  KS     F  I        E I +  S+K K  +  + K IG ++
  S:     8 LIKTVYKIEDLPPPDKKEIAFAGRSNVGKSSFLNAILGIKIAKVSSTPGKTRSINYYLVNDKYYFVDLPGYGFASVSKQEKERWNVLMNEYFKTRFSLSAVSLLIDHRHMPQKLDYAMVEWLKDLGTPFLFILTKSDKLTKSEKAKLFEDIKRSFSTYGEYIYMPFSSKTKEGLKEVLKTIGEIL 192
>gi|156450105|ref|ZP_02056486.1| GTP-binding protein, HSR1-related [Methylobacterium chloromethanicum CM4] >gi|163851773|ref|YP_001639816.1| GTPase EngB [Methylobacterium extorquens PA1] >gi|156191208|gb|EDO23396.1| GTP-binding protein, HSR1-related [Methylobacterium chloromethanicum CM4] >gi|163663378|gb|ABY30745.1| GTP-binding protein HSR1-related [Methylobacterium extorquens PA1] (256 aa)
Score = 254, Expect = 1.5e-20, Identities = 63/165 (38%), Positives = 95/165 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           EI F GRSNVGKSSL+NAL     +A+TS+TPGRTQ  NF+   ++  L+D+PGYGYA V K+K    +K+I  Y+  R NL  V+ +ID    + ++D  + + L      + IVL K D   K+  +   A I A L K       ++  S+++   +  L+  I  ++
  S:    81 EIAFAGRSNVGKSSLVNALTGRNTLARTSHTPGRTQQLNFFRIGERLTLVDMPGYGYAAVEKAKVEAWTKLIHAYLKGRSNLARVYLLIDSRHGLKEIDTDLLDGLDKAAVSYQIVLTKGDALKKAEIEKRIAGIHAALAKRPAAYPEVLLTSSRDDRGVAELRASIARLL 251
>gi|77456283|ref|YP_345788.1| GTPase EngB [Pseudomonas fluorescens PfO-1] >gi|119369235|sp|Q3KKA7|ENGB_PSEPF Probable GTP-binding protein engB >gi|77380286|gb|ABA71799.1| cell division checkpoint GTPase YihA [Pseudomonas fluorescens PfO-1] (214 aa)
Score = 253, Expect = 1.5e-20, Identities = 64/172 (37%), Positives = 96/172 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNI 174
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD DL M +         +I+L KADK       N   K+ ++++K   D+  I   SA  +  +
  S:    15 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFKLDDERRLVDLPGYGYAKVPIPLKQHWQRHLEAYLGGRESLKGLILMMDIRHPMTDFDLLMLDWAVAAGMPMHILLTKADKLTYGAAKNTLLKVQSEIRKGWGDQVTIQLFSAPKRMGL 191
>gi|52840380|ref|YP_094179.1| GTPase EngB [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|148358283|ref|YP_001249490.1| GTPase EngB [Legionella pneumophila str. Corby] >gi|166225963|sp|A5I9U4|ENGB_LEGPC Probable GTP-binding protein engB >gi|81603580|sp|Q5ZZ86|ENGB_LEGPH Probable GTP-binding protein engB >gi|52627491|gb|AAU26232.1| GTP binding protein EngB [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|148280056|gb|ABQ54144.1| GTP binding protein EngB [Legionella pneumophila str. Corby] (200 aa)
Score = 253, Expect = 1.7e-20, Identities = 68/178 (38%), Positives = 101/178 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           F+KS    N    D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N +  D + RL+DLPGYGYAKV+     E  K ++ Y+  R+ L  +  ++D+   + DLD  +     +R    +I+L KADK ++S   N   K+  +  +  E++V V A +      +++LI
  S:    11 FLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNCLTNNKNLARTSKTPGRTQLINLFSLDEQRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLEARQCLRGLILLMDVRHPLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLKV-RQYYELAEHLVSVQAFSSVKKDGVEELI 190
>gi|54293086|ref|YP_125501.1| GTPase EngB [Legionella pneumophila str. Lens] >gi|54296120|ref|YP_122489.1| GTPase EngB [Legionella pneumophila str. Paris] >gi|81601577|sp|Q5X097|ENGB_LEGPL Probable GTP-binding protein engB >gi|81602058|sp|Q5X8V4|ENGB_LEGPA Probable GTP-binding protein engB >gi|53749905|emb|CAH11287.1| hypothetical protein [Legionella pneumophila str. Paris] >gi|53752918|emb|CAH14354.1| hypothetical protein [Legionella pneumophila str. Lens] (200 aa)
Score = 253, Expect = 1.7e-20, Identities = 68/178 (38%), Positives = 101/178 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           F+KS    N    D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N +  D + RL+DLPGYGYAKV+     E  K ++ Y+  R+ L  +  ++D+   + DLD  +     +R    +I+L KADK ++S   N   K+  +  +  E++V V A +      +++LI
  S:    11 FLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNCLTNNKNLARTSKTPGRTQLINLFSLDEQRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLEARQCLRGLILLMDVRHPLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLKV-RQYYELAEHLVSVQAFSSVKKDGVEELI 190
>gi|160947714|ref|ZP_02094881.1| hypothetical protein PEPMIC_01649 [Peptostreptococcus micros ATCC 33270] >gi|158446848|gb|EDP23843.1| hypothetical protein PEPMIC_01649 [Peptostreptococcus micros ATCC 33270] (196 aa)
Score = 253, Expect = 1.7e-20, Identities = 68/168 (40%), Positives = 99/168 (58%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVC-VSAKNKTNIPNLKKLIGSVI 185
           D KE+ F GRSNVGKSS INA  N K +A+TS+ PG+T+  NFY  +  FRL+DLPGYGYA+VSKS+  +   II  Y+  R+NL  V  I+DI    +  D+ M   L       Y++  KADK +K  ++ +   +   L  +  N+V   S+ +K N+  +   I  ++
  S:    22 DLKEVAFAGRSNVGKSSFINAFINRKNLARTSSKPGKTRTVNFYKINNSFRLVDLPGYGYAQVSKSEKEKWGVIIETYLSNRENLCEVILIVDIRHAPSKEDVMMYNWLLEYGFSGYVIATKADKISKGQWNKHLKVVRETLGINDMNLVIPFSSDSKANLEAVHNKIEEIL 193
>gi|90415434|ref|ZP_01223368.1| hypothetical protein GB2207_08961 [marine gamma proteobacterium HTCC2207] >gi|90332757|gb|EAS47927.1| hypothetical protein GB2207_08961 [marine gamma proteobacterium HTCC2207] (236 aa)
Score = 253, Expect = 1.8e-20, Identities = 67/180 (37%), Positives = 99/180 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKN-----KTNIPNLKKLIG 182
           +F+ S  S      D   E+ F GRSN GKSS IN L   + +A+TS TPGRTQL NF+D   DK RL+DLPGYGYAKV      E  + ++EY+ LR++L  +  ++DI   + + DLQM    +      +I+L K+DK  +    N    +   L+        +S +      K  +P L+ ++ 
  S:    36 TFLTSAPSIKQCPEDSGCEVAFAGRSNAGKSSAINTLTRIRGLARTSKTPGRTQLINFFDLGNDK-RLVDLPGYGYAKVPIEMKREWDRDLAEYLQLRQSLAGLVLLMDIRHPLQEFDLQMLNWAAQAGLPVHILLTKSDKLKRGPGQNALLMVERHLRDMDPGCTLLSVQTFSSLKKQGLPELESVLA 223
>gi|153955957|ref|YP_001396722.1| GTPase EngB [Clostridium kluyveri DSM 555] >gi|189037173|sp|A5N2K5|ENGB_CLOK5 Probable GTP-binding protein engB >gi|146348815|gb|EDK35351.1| EngB [Clostridium kluyveri DSM 555] (197 aa)
Score = 253, Expect = 1.9e-20, Identities = 73/182 (40%), Positives = 104/182 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNKTNIPNLKKLIGSVI 185
           FI S    + +  D + EI F+GRSNVGKSSLINAL N  K+ K S TPG+T+L NF+   ++F  +DLPGYGYAK+SK++     K++ +Y+  R+ L  V  ++D     T+ D+ M + L        IV  K DK +KS    N   I   LK +  + I+  S+ NK       K++ SVI
  S:     8 FIISAVHPSQYPKDKRIEIAFVGRSNVGKSSLINALTNRKKLVKVSGTPGKTRLINFFLINNEFYFVDLPGYGYAKISKTEKKSWGKVVEDYLRGREELKRVILLLDCRHKPTNDDITMYKWLKYYNYNTIIVATKVDKVSKSQLFKNLKIIKDTLKPETGDEILTFSSLNKQGKEEFLKVLESVI 193
>gi|188996268|ref|YP_001930519.1| small GTP-binding protein [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931335|gb|ACD65965.1| small GTP-binding protein [Sulfurihydrogenibium sp. YO3AOP1] (197 aa)
Score = 252, Expect = 2.0e-20, Identities = 75/182 (41%), Positives = 103/182 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVL-NKADKEAKSYFDNNFAKIAAKLKKDKE-NIVCVSAKNKTNIPNLKKLIGSVI 185
           F+KS     D+   DK EI  +GRSNVGKSSLINA+    IAK S TPG+T+L NF+   D    +DLPGYG+A VS  +     ++I +Y+  R+NL  +  ++D     T+LD+ M E L + F + YIV+  K DK  +S        I   L   K+  +  VSAK  TNI  L   I S++
  S:     9 FVKSAVKPEDFPPPDKPEIAIVGRSNVGKSSLINAIFKRSIAKVSATPGKTKLINFFLLNDDIYFVDLPGYGFAAVSHKEKQNWKRMIEDYLLNRENLNLIIMLVDTRYPPTNLDILMKEWLES-FEKPYIVVGTKIDKLNQSEKAKAEKVIRETLDLSKDVPVYLVSAKEGTNIDKLTSDILSMV 193
>gi|83950485|ref|ZP_00959218.1| GTP-binding protein [Roseovarius nubinhibens ISM] >gi|83838384|gb|EAP77680.1| GTP-binding protein [Roseovarius nubinhibens ISM] (216 aa)
Score = 252, Expect = 2.0e-20, Identities = 65/182 (35%), Positives = 98/182 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+   D   L+DLPGYGYA        +   ++  Y+  R NL   F +ID    +  +D ++  LL +       VL KADK  ++  +    ++ ++L         ++  S++    IP L+  I S++
  S:    29 FLKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEVNFFTMADSHYLVDLPGYGYANAPLPIVAKWQALLKSYLSGRANLRRAFVLIDARHGVKAVDEEIMALLDSSAVTFQTVLTKADKVKEAEREKILTQVRSRLATHPAAFPELIVTSSEKGWGIPTLRATIASLV 216
>gi|196477275|gb|ACG76803.1| GTP-binding protein CgpA [Phenylobacterium zucineum HLK1] (213 aa)
Score = 252, Expect = 2.1e-20, Identities = 66/164 (40%), Positives = 95/164 (57%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLI 181
           D  E+ F GRSNVGKSSLINA+   K +A+ SN PGRT+  NF+  D K RL+DLPGYG+A+ SKS   +   +  +Y+  R NL  V+ +ID    + D+D +  + L      + IVL KADK   +  +   A+   K+ K       ++  S++  T IP L+  I
  S:    38 DLPEVAFAGRSNVGKSSLINAVTGRKDLARASNEPGRTREVNFFVADEKLRLVDLPGYGWARASKSVARKFQNLGRDYLRGRPNLKRVYLLIDARHGLKDVDKEALDALDVAAVSYQIVLTKADKLRAAEVEKVVAETLQKVSKRPAAFPRVLATSSEKGTGIPELRAEI 207
>gi|148545398|ref|YP_001265500.1| GTPase EngB [Pseudomonas putida F1] >gi|166225971|sp|A5VWQ6|ENGB_PSEP1 Probable GTP-binding protein engB >gi|148509456|gb|ABQ76316.1| cell division checkpoint GTPase YihA [Pseudomonas putida F1] (210 aa)
Score = 252, Expect = 2.1e-20, Identities = 58/142 (40%), Positives = 81/142 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           D   E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         K +  Y+  R+ L  V  ++D+   +TD D  M +         +I+L KADK       N   K+ ++++K
  S:    29 DQGYEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKHLEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASSMPMHILLTKADKLTHGAGKNTLLKVQSEIRK 172
>gi|26986869|ref|NP_742294.1| GTPase EngB [Pseudomonas putida KT2440] >gi|38372202|sp|Q88RK5|ENGB_PSEPK Probable GTP-binding protein engB >gi|24981471|gb|AAN65758.1|AE016202_1 GTP-binding protein, putative [Pseudomonas putida KT2440] (210 aa)
Score = 252, Expect = 2.1e-20, Identities = 58/142 (40%), Positives = 81/142 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           D   E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         K +  Y+  R+ L  V  ++D+   +TD D  M +         +I+L KADK       N   K+ ++++K
  S:    29 DQGYEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKHLEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASSMPMHILLTKADKLTHGAGKNTLLKVQSEIRK 172
>gi|148258512|ref|YP_001243097.1| GTPase EngB [Bradyrhizobium sp. BTAi1] >gi|146410685|gb|ABQ39191.1| putative GTP-binding protein engB [Bradyrhizobium sp. BTAi1] (220 aa)
Score = 252, Expect = 2.1e-20, Identities = 61/165 (36%), Positives = 98/165 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY---DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ   F+   D+   RL+D+PGYGYA  +K+K    +K+I +++  R +L  V+ +ID    + ++D ++ + L      + +VL KAD+          A+  A L K       ++  S+++ T +P L+  +  ++
  S:    43 EIAFAGRSNVGKSSLINALTGQNALARTSHTPGRTQELIFFEGPDYAPLRLVDMPGYGYAAAAKTKVASWTKLIHQFLLGRASLARVYVLIDARHGLKEVDQEIFKTLDRSAVSYQLVLTKADQVKPPELAARIAETEAALAKHPAAFPQVLATSSRSGTGMPELRAAMARLL 215
>gi|163745581|ref|ZP_02152941.1| GTPase EngB [Oceanibulbus indolifex HEL-45] >gi|161382399|gb|EDQ06808.1| GTPase EngB [Oceanibulbus indolifex HEL-45] (216 aa)
Score = 252, Expect = 2.4e-20, Identities = 63/183 (34%), Positives = 101/183 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           +F+K   + +     D+ E+CF GRSNVGKS+LINAL   K +A+ SNTPGRTQ  NF+   ++  L+DLPGYGYA        +  +++ +Y+  R+ L   F +ID    +  +D ++  LL +      +VL K DK  ++       ++   L K       IV  S++    IP L+ +I +++
  S:    28 TFVKGVVAMDGLPPPDRMEVCFAGRSNVGKSTLINALTGMKALARASNTPGRTQEINFFTAGEEHYLVDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHGVKKVDNEIMSLLDSSAVTFQVVLTKGDKVKEAERTKILEQVKEALSKHPAAYPEIVVTSSEKGWGIPTLRAIIATLV 216
>gi|158521131|ref|YP_001529001.1| GTP-binding protein HSR1-related [Desulfococcus oleovorans Hxd3] >gi|158509957|gb|ABW66924.1| GTP-binding protein HSR1-related [Desulfococcus oleovorans Hxd3] (197 aa)
Score = 252, Expect = 2.5e-20, Identities = 63/168 (37%), Positives = 95/168 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           F+ S    + +   D  EI F GRSNVGKSS+IN L N K + KTS+TPG+T+L NF+D + +   +DLPGYGYAKVS+ +      ++  Y+  RK L  +  ++D+      + +  E L  ++  HY     +VL KADK  K+  D    +IA  +    + ++  S   K
  S:     8 FVISAVQPSQYPDTDLPEIAFAGRSNVGKSSMINLLVNRKNLVKTSSTPGKTRLINFFDINGQLMFVDLPGYGYAKVSRKEQKTWGPMVERYLSSRKTLRGLMLLMDLR----REPREDEFLMMQWCAHYDIPWKMVLTKADKFKKTAADRRRHEIARAVGIGADEMILFSTLQK 178
>gi|167031160|ref|YP_001666391.1| GTPase EngB [Pseudomonas putida GB-1] >gi|189037186|sp|B0KG04|ENGB_PSEPG Probable GTP-binding protein engB >gi|166857648|gb|ABY96055.1| small GTP-binding protein [Pseudomonas putida GB-1] (210 aa)
Score = 252, Expect = 2.5e-20, Identities = 58/142 (40%), Positives = 81/142 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           D   E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         K +  Y+  R+ L  V  ++D+   +TD D  M +         +I+L KADK       N   K+ ++++K
  S:    29 DQGYEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKHLEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASGMPMHILLTKADKLTHGAGKNTLLKVQSEIRK 172
>gi|71903337|ref|YP_280140.1| GTPase EngB [Streptococcus pyogenes MGAS6180] >gi|119369273|sp|Q48U21|ENGB_STRPM Probable GTP-binding protein engB >gi|71802432|gb|AAX71785.1| GTP-binding protein [Streptococcus pyogenes MGAS6180] (199 aa)
Score = 251, Expect = 2.6e-20, Identities = 65/164 (39%), Positives = 96/164 (58%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S + S  + + +  DD  EI   GRSNVGKSS IN +   K +A+TS+ PG+TQL NF++ D K R +D+PGYGYAKVSKS+  +  K+I EY+  R NL AV  ++D+    +  D+QM + L        +V  KADK  +  ++ + + +   L  D  +   V
  S:    13 SILLSAANKSHYPKDDLPEIALAGRSNVGKSSFINTILGRKNLARTSSKPGKTQLLNFFNIDDKLRFVDVPGYGYAKVSKSERAKWGKMIEEYLTSRDNLRAVVSLVDLRHAPSKEDIQMYDFLKYYDIPVIVVATKADKIPRGKWNKHESVVKKALNFDNSDTFIV 179
>gi|84685376|ref|ZP_01013274.1| GTP-binding protein [Rhodobacterales bacterium HTCC2654] >gi|84666533|gb|EAQ13005.1| GTP-binding protein [Rhodobacterales bacterium HTCC2654] (218 aa)
Score = 251, Expect = 2.6e-20, Identities = 69/181 (38%), Positives = 97/181 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY-DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + N    DD+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+   D   L+DLPGYG+A    +   +  K++  Y+  R +L   F +ID    I  +D ++  LL         VL KADK   +  D    ++  KL K       +V  S++    I  L+ +I  +
  S:    31 FLKGVVAMNGLPPDDRIEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTTTDGPYLVDLPGYGFANAPVAVVEKWQKLLKSYLSGRASLRRAFVLIDTRHGIKAVDEEIMTLLDKSAVTFQAVLTKADKVKAADRDKILKQVREKLSKHPAAYPELVMTSSEKGDGIATLRAIIAGL 217
>gi|104779390|ref|YP_605888.1| GTPase EngB [Pseudomonas entomophila L48] >gi|166225969|sp|Q1IGY1|ENGB_PSEE4 Probable GTP-binding protein engB >gi|95108377|emb|CAK13071.1| putative GTP-binding protein EngB [Pseudomonas entomophila L48] (210 aa)
Score = 251, Expect = 2.8e-20, Identities = 62/155 (40%), Positives = 86/155 (55%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNK 171
           D   E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         K +  Y+  R+ L  V  ++D+   +TD D  M +         +I+L KADK       N   K+ ++++K   D   I   SA  +
  S:    29 DQGYEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKHLEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWARASGMPMHILLTKADKLTHGAGKNTLLKVQSEIRKGWGDSTTIQLFSAPKR 188
>gi|149913106|ref|ZP_01901640.1| GTP-binding protein [Roseobacter sp. AzwK-3b] >gi|149813512|gb|EDM73338.1| GTP-binding protein [Roseobacter sp. AzwK-3b] (216 aa)
Score = 251, Expect = 2.9e-20, Identities = 67/181 (37%), Positives = 98/181 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K IA+ SNTPGRTQ  NF+   +   L+DLPGYGYA     K      ++ +Y+  R++L   F ++D    I  +D ++  LL +       VL KADK      +    ++ AKL K       I+  S++    I  L+ +I ++
  S:    29 FLKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGRKAIARASNTPGRTQEINFFALGESHYLVDLPGYGYANAPLDKVAAWQALLKKYLSGRQSLRRAFVLVDTRHGIKSVDEEIMSLLDSSAVTFQCVLTKADKVKDKDREAVLEQVRAKLAKHPAAYPEIIMTSSEKGDGIATLRAVIATL 215
>gi|146278899|ref|YP_001169058.1| GTPase EngB [Rhodobacter sphaeroides ATCC 17025] >gi|145557140|gb|ABP71753.1| GTP-binding protein, HSR1-related [Rhodobacter sphaeroides ATCC 17025] (217 aa)
Score = 251, Expect = 3.2e-20, Identities = 65/181 (35%), Positives = 99/181 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   +       D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++     R L+DLPGYGYA+  K       +++  Y+  R+ L   F +ID    I  +D ++  LL        +V+ KADK +++  +    ++   LKK       +V  S++    I  L+ +I ++
  S:    30 FVKGVTTMEALPPADRIEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINYFALGPSRYLVDLPGYGYAEAPKPIVERWQRLLKGYLAGRQTLRRAFVLIDTRHGIKSVDEEILNLLDRSAVTFQVVMTKADKVSQAEREAVLGQVRGALKKHPAAYPELVMTSSEKGLGIETLRTIIATL 216
>gi|15903469|ref|NP_359019.1| GTPase EngB [Streptococcus pneumoniae R6] >gi|15459080|gb|AAL00230.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] (197 aa)
Score = 250, Expect = 3.7e-20, Identities = 63/146 (43%), Positives = 88/146 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           D+  EI   GRSNVGKSS IN + N K +A+TS  PG+TQL NF++ D K R +D+PGYGYA+VSK +  +   +I EY+  R+NL AV  ++D+       D+QM E L        IV  KADK  +  ++ + + I  KL  D  +
  S:    25 DELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSD 173
>gi|49078162|gb|AAT49757.1| PA5492 [synthetic construct] (216 aa)
Score = 250, Expect = 3.9e-20, Identities = 60/156 (38%), Positives = 87/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D  RL+DLPGYGYAKV         + +  Y+  R +L  VF ++DI   +TD D  M +         ++++ KADK A     N   K+  ++++
  S:    15 SFLISAAQVDQCPPDEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFALDDSRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLSSRASLAGVFLMMDIRHPLTDFDRLMLDWAQASQLPIHVLMTKADKLAFGAAKNALLKVRREVQQ 172
>gi|116053642|ref|YP_793969.1| GTPase EngB [Pseudomonas aeruginosa UCBPP-PA14] >gi|122256338|sp|Q02DL7|ENGB_PSEAB Probable GTP-binding protein engB >gi|115588863|gb|ABJ14878.1| putative GTP-binding protein [Pseudomonas aeruginosa UCBPP-PA14] (215 aa)
Score = 250, Expect = 3.9e-20, Identities = 60/156 (38%), Positives = 87/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D  RL+DLPGYGYAKV         + +  Y+  R +L  VF ++DI   +TD D  M +         ++++ KADK A     N   K+  ++++
  S:    15 SFLISAAQVDQCPPDEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFALDDSRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLSSRASLAGVFLMMDIRHPLTDFDRLMLDWAQASQLPIHVLMTKADKLAFGAAKNALLKVRREVQQ 172
>gi|15600685|ref|NP_254179.1| GTPase EngB [Pseudomonas aeruginosa PAO1] >gi|107104594|ref|ZP_01368512.1| hypothetical protein PaerPA_01005673 [Pseudomonas aeruginosa PACS2] >gi|194554029|ref|YP_002089056.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] >gi|13124210|sp|Q9HT81|ENGB_PSEAE Probable GTP-binding protein engB >gi|9951827|gb|AAG08877.1|AE004962_1 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] >gi|126196422|gb|EAZ60485.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] (215 aa)
Score = 250, Expect = 3.9e-20, Identities = 60/156 (38%), Positives = 87/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D  RL+DLPGYGYAKV         + +  Y+  R +L  VF ++DI   +TD D  M +         ++++ KADK A     N   K+  ++++
  S:    15 SFLISAAQVDQCPPDEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFALDDSRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLSSRASLAGVFLMMDIRHPLTDFDRLMLDWAQASQLPIHVLMTKADKLAFGAAKNALLKVRREVQQ 172
>gi|24379393|ref|NP_721348.1| GTPase EngB [Streptococcus mutans UA159] >gi|81845282|sp|Q8DUH9|ENGB_STRMU Probable GTP-binding protein engB >gi|24377323|gb|AAN58654.1|AE014935_6 putative GTP-binding protein [Streptococcus mutans UA159] (197 aa)
Score = 250, Expect = 4.2e-20, Identities = 68/172 (39%), Positives = 100/172 (58%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNKTNI 174
           S + S  + + +  DD  EI   GRSNVGKSS IN L   K +A+TS+ PG+TQ  NFY+ D K R +D+PGYGYAKVSK +  +  K+I EY+  R+NL AV  ++D     +  D+QM + L        +V  KADK  +  ++   + I  KL  D  +  +  S+ ++T +
  S:    11 SILLSAVNKSHYPQDDLPEIALAGRSNVGKSSFINTLLGRKNLARTSSKPGKTQSLNFYNIDDKLRFVDVPGYGYAKVSKKERAKWGKMIEEYLTSRENLRAVVSLVDFRHDPSSDDVQMYDFLKYYEIPVILVATKADKVPRGKWNKQESAIKKKLDFDSNDAFIIFSSVDRTGL 186
>gi|94968624|ref|YP_590672.1| small GTP-binding protein [Acidobacteria bacterium Ellin345] >gi|119368786|sp|Q1IRA2|ENGB_ACIBL Probable GTP-binding protein engB >gi|94550674|gb|ABF40598.1| Small GTP-binding protein [Acidobacteria bacterium Ellin345] (203 aa)
Score = 249, Expect = 4.5e-20, Identities = 58/128 (45%), Positives = 78/128 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDK-------FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           EI F+GRSNVGKSSLINA+  +KIAKTS+TPGRTQ  NF++  +       +   DLPGYGYA+V K    E  K I  Y++ R  L     I+D+SV     DL++   L +      +V  K D+ + +   NN
  S:    24 EIAFLGRSNVGKSSLINAIVGSKIAKTSSTPGRTQTINFFEIRRPGKPRPDWIFADLPGYGYARVPKELTAEWPKFIDPYLHERPTLALCVSIVDVSVPPQKKDLELLNWLRHVGRPFVVVGTKIDRVSGNQLRNN 159
>gi|15901411|ref|NP_346015.1| GTPase EngB [Streptococcus pneumoniae TIGR4] >gi|111658474|ref|ZP_01409147.1| hypothetical protein SpneT_02000374 [Streptococcus pneumoniae TIGR4] >gi|116515393|ref|YP_816858.1| GTPase EngB [Streptococcus pneumoniae D39] >gi|148984920|ref|ZP_01818173.1| GTPase EngB [Streptococcus pneumoniae SP3-BS71] >gi|148988622|ref|ZP_01820055.1| GTPase EngB [Streptococcus pneumoniae SP6-BS73] >gi|148990171|ref|ZP_01821402.1| GTP-binding protein [Streptococcus pneumoniae SP6-BS73] >gi|148993406|ref|ZP_01822923.1| GTP-binding protein [Streptococcus pneumoniae SP9-BS68] >gi|148997364|ref|ZP_01824969.1| GTP-binding protein [Streptococcus pneumoniae SP11-BS70] >gi|149003199|ref|ZP_01828095.1| GTP-binding protein [Streptococcus pneumoniae SP14-BS69] >gi|149007516|ref|ZP_01831151.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74] >gi|149007879|ref|ZP_01831466.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74] >gi|149012699|ref|ZP_01833675.1| GTP-binding protein [Streptococcus pneumoniae SP19-BS75] >gi|149022038|ref|ZP_01836000.1| GTPase EngB [Streptococcus pneumoniae SP23-BS72] >gi|168483553|ref|ZP_02708505.1| GTP-binding protein [Streptococcus pneumoniae CDC1873-00] >gi|168486831|ref|ZP_02711339.1| GTP-binding protein [Streptococcus pneumoniae CDC1087-00] >gi|168488709|ref|ZP_02712908.1| GTP-binding protein [Streptococcus pneumoniae SP195] >gi|168491538|ref|ZP_02715681.1| GTP-binding protein [Streptococcus pneumoniae CDC0288-04] >gi|168493473|ref|ZP_02717616.1| GTP-binding protein [Streptococcus pneumoniae CDC3059-06] >gi|168575234|ref|ZP_02721197.1| GTP-binding protein [Streptococcus pneumoniae MLV-016] >gi|194397246|ref|YP_002038200.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus pneumoniae G54] >gi|122278296|sp|Q04JI0|ENGB_STRP2 Probable GTP-binding protein engB >gi|54037058|sp|P64073|ENGB_STRR6 Probable GTP-binding protein engB >gi|54040981|sp|P64072|ENGB_STRPN Probable GTP-binding protein engB >gi|14973059|gb|AAK75655.1| GTP-binding protein [Streptococcus pneumoniae TIGR4] >gi|116075969|gb|ABJ53689.1| GTP-binding protein [Streptococcus pneumoniae D39] >gi|147756419|gb|EDK63460.1| GTP-binding protein [Streptococcus pneumoniae SP11-BS70] >gi|147758659|gb|EDK65656.1| GTP-binding protein [Streptococcus pneumoniae SP14-BS69] >gi|147760606|gb|EDK67580.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74] >gi|147760875|gb|EDK67845.1| GTP-binding protein [Streptococcus pneumoniae SP18-BS74] >gi|147763299|gb|EDK70237.1| GTP-binding protein [Streptococcus pneumoniae SP19-BS75] >gi|147922942|gb|EDK74058.1| GTPase EngB [Streptococcus pneumoniae SP3-BS71] >gi|147924438|gb|EDK75527.1| GTP-binding protein [Streptococcus pneumoniae SP6-BS73] >gi|147925823|gb|EDK76898.1| GTPase EngB [Streptococcus pneumoniae SP6-BS73] >gi|147927961|gb|EDK78981.1| GTP-binding protein [Streptococcus pneumoniae SP9-BS68] >gi|147929882|gb|EDK80871.1| GTPase EngB [Streptococcus pneumoniae SP23-BS72] >gi|172043175|gb|EDT51221.1| GTP-binding protein [Streptococcus pneumoniae CDC1873-00] >gi|183570230|gb|EDT90758.1| GTP-binding protein [Streptococcus pneumoniae CDC1087-00] >gi|183572689|gb|EDT93217.1| GTP-binding protein [Streptococcus pneumoniae SP195] >gi|183574254|gb|EDT94782.1| GTP-binding protein [Streptococcus pneumoniae CDC0288-04] >gi|183576321|gb|EDT96849.1| GTP-binding protein [Streptococcus pneumoniae CDC3059-06] >gi|183578703|gb|EDT99231.1| GTP-binding protein [Streptococcus pneumoniae MLV-016] >gi|194356913|gb|ACF55361.1| ribosome biogenesis GTP-binding protein YsxC [Streptococcus pneumoniae G54] (195 aa)
Score = 249, Expect = 4.5e-20, Identities = 63/146 (43%), Positives = 88/146 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           D+  EI   GRSNVGKSS IN + N K +A+TS  PG+TQL NF++ D K R +D+PGYGYA+VSK +  +   +I EY+  R+NL AV  ++D+       D+QM E L        IV  KADK  +  ++ + + I  KL  D  +
  S:    23 DELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSD 171
>gi|114765425|ref|ZP_01444540.1| GTP-binding protein [Roseovarius sp. HTCC2601] >gi|114542268|gb|EAU45298.1| GTP-binding protein [Roseovarius sp. HTCC2601] (217 aa)
Score = 249, Expect = 4.7e-20, Identities = 67/181 (37%), Positives = 99/181 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K     +    DD+ E+CF GRSNVGKSSLINAL   K IA+ SNTPGRTQ  NF+   + R L+DLPGYG+A    +   +  +++ +Y+  R +L   F +ID    +  +D ++  LL         VL KADK  +   +   A++  KL K       +V  S++    I  L+ +I  +
  S:    30 FLKGVVGMDGLPPDDRVEVCFAGRSNVGKSSLINALTGRKGIARASNTPGRTQEINFFTLGEERYLVDLPGYGFANAPVAVVEKWQRLLKQYLSGRVSLRRAFVLIDARHGVKPVDEEIMTLLDRSAVTFQAVLTKADKVKEKGREKVLAQVREKLAKHPAAFPELVLTSSEKGDGIALLRAIIAGL 216
>gi|95931072|ref|ZP_01313799.1| GTP-binding [Desulfuromonas acetoxidans DSM 684] >gi|95132881|gb|EAT14553.1| GTP-binding [Desulfuromonas acetoxidans DSM 684] (202 aa)
Score = 249, Expect = 5.4e-20, Identities = 64/168 (38%), Positives = 93/168 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           F+KS     ++   ++ EI F GRSNVGKSSL+N +   K + +TS+TPGRTQL NF+D  ++  L+DLPGYG+AKV  +   +   +I  Y+  R++L AV  + DI  V  + DLQ+ + L         V+ K DK +++      A IA       E     SA  K
  S:     8 FVKSATRPGNYPPAERPEIAFAGRSNVGKSSLLNVMVQRKSLVRTSSTPGRTQLINFFDLNEEIYLVDLPGYGFAKVPMAVKKQWGPMIQTYLQSRQSLCAVVVLFDIRRVPREEDLQLLDWLEEYEVPTIPVITKVDKVSRNRRAAQIAPIAEATGLPAEAFSLFSALTK 178
>gi|194548812|ref|YP_002083840.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] >gi|126169758|gb|EAZ55269.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] (215 aa)
Score = 248, Expect = 5.8e-20, Identities = 60/156 (38%), Positives = 87/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D  RL+DLPGYGYAKV         + +  Y+  R +L  VF ++DI   +TD D  M +         ++++ KADK A     N   K+  ++++
  S:    15 SFLISAAQVDQCPPDEGLEVAFAGRSNAGKSSALNTLTHANLARTSKTPGRTQLLNFFVLDDSRRLVDLPGYGYAKVPIPLKQHWQRHLEAYLSSRASLAGVFLMMDIRHPLTDFDRLMLDWAQASQLPIHVLMTKADKLAFGAAKNALLKVRREVQQ 172
>gi|16079871|ref|NP_390697.1| GTPase EngB [Bacillus subtilis subsp. subtilis str. 168] >gi|586754|sp|P38424|ENGB_BACSU Probable GTP-binding protein engB >gi|49259156|pdb|1SUL|A Chain A, Crystal Structure Of The Apo-Ysxc >gi|49259157|pdb|1SUL|B Chain B, Crystal Structure Of The Apo-Ysxc >gi|49259162|pdb|1SVI|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ysxc Complexed With Gdp >gi|49259165|pdb|1SVW|A Chain A, Crystal Structure Of Ysxc Complexed With Gmppnp >gi|49259166|pdb|1SVW|B Chain B, Crystal Structure Of Ysxc Complexed With Gmppnp >gi|496558|emb|CAA53985.1| unnamed protein product [Bacillus subtilis] >gi|1770079|emb|CAA99541.1| hypothetical protein [Bacillus subtilis] >gi|2635284|emb|CAB14779.1| ysxC [Bacillus subtilis subsp. subtilis str. 168] (195 aa)
Score = 248, Expect = 5.9e-20, Identities = 64/151 (42%), Positives = 92/151 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           EI   GRSNVGKSS IN+L N K +A+TS+ PG+TQ  NFY   D+   +D+PGYG+AKVSKS+     ++I  YI  R+ L AV QI+D+    ++ D+QM E L        ++  KADK  K  +D +   +   L  D E+ ++  S++ K
  S:    25 EIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWDKHAKVVRQTLNIDPEDELILFSSETK 179
>gi|170724261|ref|YP_001751949.1| small GTP-binding protein [Pseudomonas putida W619] >gi|169762264|gb|ACA75580.1| small GTP-binding protein [Pseudomonas putida W619] (210 aa)
Score = 248, Expect = 6.0e-20, Identities = 57/142 (40%), Positives = 81/142 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           D   E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         + +  Y+  R+ L  V  ++D+   +TD D  M +         +I+L KADK       N   K+ ++++K
  S:    29 DQGYEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQRHLEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWARASGMPMHILLTKADKLTHGAGKNTLLKVQSEIRK 172
>gi|194334829|ref|YP_002016689.1| small GTP-binding protein [Prosthecochloris aestuarii DSM 271] >gi|194312647|gb|ACF47042.1| small GTP-binding protein [Prosthecochloris aestuarii DSM 271] (192 aa)
Score = 248, Expect = 6.3e-20, Identities = 62/137 (45%), Positives = 84/137 (61%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL--DLQMSELLSNRFNQHYIVLNKADK 139
           +F KSC            EI F+GRSNVGKS+L+N L   K +AKTS+TPG+TQL N++   D+   +DLPGYGYAKV+K + +E  +++  YI  R+ +  V  +ID S   D+  D QM E L      + IVL K DK
  S:     7 TFYKSCSELKGLPVSSLPEIVFVGRSNVGKSTLLNTLTGRKALAKTSSTPGKTQLINYFTINDRLYFVDLPGYGYAKVAKGQRYEWGRLLGGYISEREEISLVVLLID-SRHPDMESDQQMIEFLEYYQRPYGIVLTKYDK 146
>gi|116333988|ref|YP_795515.1| GTPase EngB [Lactobacillus brevis ATCC 367] >gi|122269328|sp|Q03QN8|ENGB_LACBA Probable GTP-binding protein engB >gi|116099335|gb|ABJ64484.1| Predicted GTPase [Lactobacillus brevis ATCC 367] (197 aa)
Score = 248, Expect = 6.5e-20, Identities = 64/168 (38%), Positives = 94/168 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNK 171
            + S      + T    EI  +GRSNVGKSSL N L N    A+TS+ PG+TQ  NFY+  D+   +D+PGYGYAKVSK++  +  ++I  Y+  R  L  V  ++D     T+ D+QM   L+       IV  K+DK A+  ++   ++I   L+  + +NIV  SA  K
  S:     8 LVMSAVDPAQYPTTGYPEIALVGRSNVGKSSLTNVLINRNSYARTSSQPGKTQTLNFYNVEDQLYFVDVPGYGYAKVSKTEREKWGQMIETYLTQRDQLRGVISLVDARHAPTEDDIQMYRWLAYYELPTLIVATKSDKIARGKWNQAVSQIKKSLELPNTDNIVMFSAPKK 179
>gi|167628601|ref|YP_001679100.1| GTP-binding protein [Heliobacterium modesticaldum Ice1] >gi|167591341|gb|ABZ83089.1| GTP-binding protein [Heliobacterium modesticaldum Ice1] (205 aa)
Score = 247, Expect = 7.7e-20, Identities = 63/166 (37%), Positives = 95/166 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE-NIVCVSAK 169
           F+ S      +  D+  E+  +GRSNVGKSSLIN L N + +A+TS+TPG+TQ  NFY  ++   ++DLPGYGYA VSK++      ++  Y+  R  L  V Q++DI    T  D+ M E L++      ++  KADK  +  +  +  +I   L   KE  I+  SA+
  S:     8 FVISAVKGEQYPEDNLPEVALVGRSNVGKSSLINKLCNRRHLARTSSTPGKTQTLNFYRINQAAYIVDLPGYGYASVSKTQRASWGPMMEHYLKKRLQLRGVIQLVDIRHPPTKDDIAMREWLNHFKIGAAVIATKADKINRGRYAKHVKQIRQDLAIPKEIPIIVFSAE 177
>gi|42522382|ref|NP_967762.1| GTP-binding protein [Bdellovibrio bacteriovorus HD100] >gi|81829281|sp|Q6MPP2|ENGB_BDEBA Probable GTP-binding protein engB >gi|39574914|emb|CAE78755.1| GTP-binding protein [Bdellovibrio bacteriovorus HD100] (200 aa)
Score = 247, Expect = 7.8e-20, Identities = 60/149 (40%), Positives = 87/149 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI--SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKI 152
           FIKS     D+    K E+   GRSN GKSS INAL   KIAK S+TPG+T+L NF++ D+ + ++D+PGYG+A  S  +  E  ++I  Y+  R+ L  +  ++DI  S   D +L + E    R     +VL KADK ++S      AK+
  S:    16 FIKSAVLEKDFPVHKKAEVAIAGRSNAGKSSFINALTKNKIAKVSSTPGKTRLLNFFELDQSYVMVDMPGYGFAARSGDEMREWHRMIETYLMNREQLRGLLLVMDIRRSWTEDEEL-LKEFSERRGFPLAVVLTKADKMSRSQMLQAVAKV 166
>gi|84499799|ref|ZP_00998087.1| GTP-binding protein [Oceanicola batsensis HTCC2597] >gi|84392943|gb|EAQ05154.1| GTP-binding protein [Oceanicola batsensis HTCC2597] (216 aa)
Score = 247, Expect = 8.4e-20, Identities = 63/181 (34%), Positives = 97/181 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   + +A+ SNTPGRTQ  N++   D+  L+DLPGYGYA        +  +++ +Y+  R+ L   F +ID    +  +D ++  LL +      +VL K DK  +S  D       + L K       +V  S++    I  L+ +I  +
  S:    29 FVKGVVAMDGLPPADRMEVCFAGRSNVGKSSLINALTGTRNLARASNTPGRTQEINYFTLGDRGYLVDLPGYGYANAPLPVVEKWQRLLRQYLSGRQTLRRAFVLIDARHGVKKVDEEIMSLLDSAAVTFEVVLTKIDKVRRSDLDRALDVTRSALSKHPAAYPELVLTSSEKGDGIATLRSIIAGI 215
>gi|114322004|ref|YP_743687.1| cell division checkpoint GTPase YihA [Alkalilimnicola ehrlichei MLHE-1] >gi|119368788|sp|Q0A4P0|ENGB_ALHEH Probable GTP-binding protein engB >gi|114228398|gb|ABI58197.1| cell division checkpoint GTPase YihA [Alkalilimnicola ehrlichei MLHE-1] (206 aa)
Score = 247, Expect = 8.4e-20, Identities = 56/123 (45%), Positives = 78/123 (63%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D  +E+ F GRSNVGKSS IN L N K +A+TS TPGRTQL N +   D+  L+DLPGYGYAKV  +      +++ EY+  R+ L  V  ++D+   +TD D QM +   +     +++L KADK
  S:    23 DQGREVAFAGRSNVGKSSAINTLTNQKSLARTSKTPGRTQLINVFPITDEAALVDLPGYGYAKVPAAVRRRWDQVLPEYLAGRRALRGVVLVMDLRHPLTDFDRQMLDWCGHIGVPLHVLLTKADK 148
>gi|146305196|ref|YP_001185661.1| GTPase EngB [Pseudomonas mendocina ymp] >gi|166225970|sp|A4XNL3|ENGB_PSEMY Probable GTP-binding protein engB >gi|145573397|gb|ABP82929.1| cell division checkpoint GTPase YihA [Pseudomonas mendocina ymp] (216 aa)
Score = 247, Expect = 9.5e-20, Identities = 61/156 (39%), Positives = 87/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+ S    +    D   E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         K +  Y+  R++L  +  ++DI   +T+ D  M +         +I+L KADK A     N   K+  +++K
  S:    15 SFLISAAKVDQCPEDSGLEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFRLDDERRLVDLPGYGYAKVPIPLKQHWQKHLEAYLGSRESLCGLVLMMDIRHPLTEFDRMMLDWSVASGMPLHILLTKADKLAFGAAKNALLKVRQEIRK 172
>gi|92115232|ref|YP_575160.1| cell division checkpoint GTPase YihA [Chromohalobacter salexigens DSM 3043] >gi|119369183|sp|Q1QSU7|ENGB_CHRSD Probable GTP-binding protein engB >gi|91798322|gb|ABE60461.1| cell division checkpoint GTPase YihA [Chromohalobacter salexigens DSM 3043] (207 aa)
Score = 246, Expect = 9.8e-20, Identities = 54/123 (43%), Positives = 75/123 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF---DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D   E+ F GRSN GKSS IN L   K +A+TS TPGRTQL NF+     + +RL+DLPGYG+AKV      E  + +SEY+Y R  L  +  ++D+   +++ D  M      +    +I+L KADK
  S:    27 DQGAEVAFAGRSNAGKSSAINTLTQQKALARTSKTPGRTQLINFFTLANDETYRLVDLPGYGFAKVPDQVKLEWQRHLSEYLYERATLRGLMLVMDVRHPLSEFDQMMLGWADEKAMPVHILLTKADK 154
>gi|157959931|ref|YP_001499965.1| GTPase EngB [Shewanella pealeana ATCC 700345] >gi|189037190|sp|A8GYP3|ENGB_SHEPA Probable GTP-binding protein engB >gi|157844931|gb|ABV85430.1| GTP-binding protein HSR1-related [Shewanella pealeana ATCC 700345] (225 aa)
Score = 246, Expect = 1.0e-19, Identities = 57/123 (46%), Positives = 74/123 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +N L   KIA+TS TPGRTQL N +  DK  RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E           +L KADK  +S
  S:    34 EIAFAGRSNAGKSSALNLLTEQKIARTSKTPGRTQLINVFRLDKHRRLVDLPGYGFAQVPLALKLKWQESLGEYLLKRDCLSGVVVLMDIRHPLKDLDMQMIEWAVESHIPVLALLTKADKLGQS 158
>gi|83856735|ref|ZP_00950264.1| GTP-binding protein [Croceibacter atlanticus HTCC2559] >gi|83850535|gb|EAP88403.1| GTP-binding protein [Croceibacter atlanticus HTCC2559] (202 aa)
Score = 246, Expect = 1.2e-19, Identities = 63/140 (45%), Positives = 82/140 (58%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           D   E  FIGRSNVGKSSLIN + N  K+AKTS+TPG+TQL N F   D++ L+DLPGYGYA+ SK       K I++Y   R  LV  F ++D       +DL+  E L        I+  K DK  K  +D NF   ++K+
  S:    21 DKLPEYAFIGRSNVGKSSLINMMTNNKKLAKTSSTPGKTQLINHFIINDEWYLVDLPGYGYARTSKKTKKVFQKFITDYFVKRSQLVCAFVLVDSRHAPQKIDLEFMEWLGTNSIPFAIIFTKTDKLKKGEWDRNFKVYSSKM 163
>gi|150388895|ref|YP_001318944.1| GTP-binding protein, HSR1-related [Alkaliphilus metalliredigens QYMF] >gi|166920106|sp|A6TM67|ENGB_ALKMQ Probable GTP-binding protein engB >gi|149948757|gb|ABR47285.1| GTP-binding protein, HSR1-related [Alkaliphilus metalliredigens QYMF] (208 aa)
Score = 246, Expect = 1.2e-19, Identities = 64/157 (40%), Positives = 93/157 (59%)
  Q:    21 EICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNKTNIPNL 177
           EI   GRSNVGKSSLIN + N  K+A+ S++PG+T+  NFY  +K F L+DLPGYGYA+VSK +     K++  Y+  R NL  V  +IDI    ++ D QM + + +      +V  K+DK A+S    +F  I   L    E+ ++ +S+  K  I  L
  S:    25 EIALAGRSNVGKSSLINTILNRKKLARVSSSPGKTRTLNFYLINKEFHLVDLPGYGYARVSKGEKSSWGKMLETYLSNRPNLYEVVLLIDIRHEPSEQDQQMYQWIRHYGYGTIVVATKSDKIARSQHQKHFKMIRDTLGMSPEDRLIPISSLKKLGIEQL 185
>gi|126728215|ref|ZP_01744031.1| GTP-binding protein [Sagittula stellata E-37] >gi|126711180|gb|EBA10230.1| GTP-binding protein [Sagittula stellata E-37] (216 aa)
Score = 246, Expect = 1.2e-19, Identities = 64/181 (35%), Positives = 98/181 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +    DD+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++     R L+DLPGYG+A    +   +   ++  Y+  R +L   F +ID    +  +D ++  LL        +V+ KADK   +  D    ++  +L K       IV  S++    I  L+ +I ++
  S:    29 FLKGVVAMDGLPPDDRAEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINYFTLGSERYLVDLPGYGFANAPVAVVAKWQALLKAYLAGRVSLRRAFVLIDHRHGVKAVDNEIMTLLDRSAVTFQVVMTKADKVKGAEHDKILEQVRGQLAKHPAAYPEIVVTSSEKGDGIGTLRSIIATL 215
>gi|110678769|ref|YP_681776.1| GTPase EngB [Roseobacter denitrificans OCh 114] >gi|119369250|sp|Q16AA3|ENGB_ROSDO Probable GTP-binding protein engB >gi|109454885|gb|ABG31090.1| GTP-binding protein [Roseobacter denitrificans OCh 114] (216 aa)
Score = 246, Expect = 1.2e-19, Identities = 64/178 (35%), Positives = 97/178 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLI 181
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+   +   L+DLPGYGYA        +  +++ +Y+  R+ L   F +ID    +  +D ++  LL +      +VL KADK  +   +    ++   L K       +V  S++    IP L+ +I
  S:    29 FVKGVVAMSGLPDPDRLEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTAGESHYLVDLPGYGYANAPVPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHGVKKVDEEILSLLDSAAVTFQVVLTKADKVKEKEREKVLDQVRTALSKHPAAFPELVITSSEKGWGIPTLRSII 212
>gi|77464647|ref|YP_354151.1| GTPase EngB [Rhodobacter sphaeroides 2.4.1] >gi|119369248|sp|Q3IYY4|ENGB_RHOS4 Probable GTP-binding protein engB >gi|77389065|gb|ABA80250.1| Probable GTP-binding protein [Rhodobacter sphaeroides 2.4.1] (217 aa)
Score = 245, Expect = 1.3e-19, Identities = 63/181 (34%), Positives = 99/181 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   +       D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++     R L+DLPGYGYA+  K       +++  Y+  R+ L   F +ID    +  +D ++  LL        +V+ KADK +++  +    ++   LKK       +V  S++    I  L+ ++ ++
  S:    30 FVKGVTTMEALPPADRIEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINYFALGPSRYLVDLPGYGYAEAPKPIVQRWQRLLKGYLAGRQTLRRAFVLIDTRHGVKSVDEEILTLLDRSAVTFQVVMTKADKVSQAEREAVLDQVRGALKKHPAAYPELVMTSSEKGMGIETLRTIVATL 216
>gi|126463487|ref|YP_001044601.1| GTPase EngB [Rhodobacter sphaeroides ATCC 17029] >gi|126105151|gb|ABN77829.1| GTP-binding protein, HSR1-related [Rhodobacter sphaeroides ATCC 17029] (217 aa)
Score = 245, Expect = 1.4e-19, Identities = 63/181 (34%), Positives = 99/181 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   +       D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++     R L+DLPGYGYA+  K       +++  Y+  R+ L   F +ID    +  +D ++  LL        +V+ KADK +++  +    ++   LKK       +V  S++    I  L+ ++ ++
  S:    30 FVKGVTTMEALPPADRIEVCFAGRSNVGKSSLINALTGRKSLARASNTPGRTQEINYFALGPSRYLVDLPGYGYAEAPKPIVERWQRLLKGYLAGRQTLRRAFVLIDTRHGVKSVDEEILTLLDRSAVTFQVVMTKADKVSQAEREAVLDQVRGALKKHPAAYPELVMTSSEKGMGIETLRTIVATL 216
>gi|167626126|ref|YP_001676420.1| GTPase EngB [Shewanella halifaxensis HAW-EB4] >gi|189037189|sp|B0TNM9|ENGB_SHEHH Probable GTP-binding protein engB >gi|167356148|gb|ABZ78761.1| GTP-binding protein HSR1-related [Shewanella halifaxensis HAW-EB4] (226 aa)
Score = 245, Expect = 1.4e-19, Identities = 57/123 (46%), Positives = 74/123 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +N L   KIA+TS TPGRTQL N +  DK  RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E           +L KADK  +S
  S:    34 EIAFAGRSNAGKSSALNLLTEQKIARTSKTPGRTQLINVFKLDKHRRLVDLPGYGFAQVPLALKLKWQQALGEYLLKRDCLSGVVVLMDIRHPLKDLDMQMIEWAVESHIPVLALLTKADKLGQS 158
>gi|15603376|ref|NP_246450.1| GTPase EngB [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431508|sp|P57947|ENGB_PASMU Probable GTP-binding protein engB >gi|12721898|gb|AAK03595.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] (205 aa)
Score = 245, Expect = 1.4e-19, Identities = 66/167 (39%), Positives = 92/167 (55%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVCVSAKNKTNIPNLKKLIGS 183
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ + + RL+DLPGYGYA V +    +  K + EY+  R+ L  V  ++DI   + DLD QM E          ++L KADK ++S        +   +   +    +   SA NKT I  L   + S
  S:    26 DSGIEIAFAGRSNAGKSTALNALTNQKSLARTSKTPGRTQLINLFEVEPQCRLVDLPGYGYAAVPEQMKIQWQKALGEYLQKRQCLAGVVILMDIRHPLKDLDQQMIEWAVASELPVLLLLTKADKLSQSARSKQVKMVREAILPFQGDVQVEAFSALNKTGIDRLAAKLDS 197
>gi|52426052|ref|YP_089189.1| GTPase EngB [Mannheimia succiniciproducens MBEL55E] >gi|81609396|sp|Q65R06|ENGB_MANSM Probable GTP-binding protein engB >gi|52308104|gb|AAU38604.1| unknown [Mannheimia succiniciproducens MBEL55E] (205 aa)
Score = 245, Expect = 1.4e-19, Identities = 59/140 (42%), Positives = 87/140 (62%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           F+ S  + +    D+  EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ + +++L+DLPGYGYA V +    +  K + EY+  R+ L  V  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    13 FMTSAANIHQLPKDEGMEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPQYKLVDLPGYGYAAVPEQMKLQWQKSLGEYLQHRECLKGVVILMDIRHPLKDLDQQMIEWAVSSDLPVLLLLTKADKLSQS 155
>gi|88798525|ref|ZP_01114109.1| predicted GTPase [Reinekea sp. MED297] >gi|88778625|gb|EAR09816.1| predicted GTPase [Reinekea sp. MED297] (207 aa)
Score = 245, Expect = 1.5e-19, Identities = 60/154 (38%), Positives = 91/154 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK 157
           F+ S    +   TD   E+ F GRSN GKSS +NAL  N+K+A+TS TPGRTQL NF+    D+ RL+DLPGYGYAKV+++   +  + I EY+  R +L  +  ++DI   +T+ D  + +           +L KADK  +    + + K+  +L+
  S:    10 FLTSAAKFSQCPTDTGAEVAFAGRSNAGKSSALNALTRNSKLARTSKTPGRTQLLNFFTLSSDEHRLVDLPGYGYAKVNRNMKQDWEEHIGEYLAERLSLRGLVLVMDIRHPMTEFDQMIIDWAVETEMPLLALLTKADKLKRGPAKSTWLKVRNQLQ 167
>gi|15644215|ref|NP_229266.1| hypothetical protein TM1466 [Thermotoga maritima MSB8] >gi|13124246|sp|Q9X1H7|ENGB_THEMA Probable GTP-binding protein engB >gi|4982031|gb|AAD36534.1|AE001797_14 conserved hypothetical protein [Thermotoga maritima MSB8] (195 aa)
Score = 245, Expect = 1.5e-19, Identities = 60/136 (44%), Positives = 82/136 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
            +K   +  D+    K E+ F+GRSNVGKSSL+NAL N KIA  S TPG+T+  NFY  + K+  +DLPGYGYAKVSK +     +++ +Y   R +L  VF ++D  +   D DL M E + +      IVL K DK
  S:     8 LVKVARTPGDYPPPLKGEVAFVGRSNVGKSSLLNALFNRKIAFVSKTPGKTRSINFYLVNSKYYFVDLPGYGYAKVSKKERMLWKRLVEDYFKNRWSLQMVFLLVDGRIPPQDSDLMMVEWMKSLNIPFTIVLTKMDK 145
>gi|83854935|ref|ZP_00948465.1| GTP-binding protein [Sulfitobacter sp. NAS-14.1] >gi|83941458|ref|ZP_00953920.1| GTP-binding protein [Sulfitobacter sp. EE-36] >gi|83842778|gb|EAP81945.1| GTP-binding protein [Sulfitobacter sp. NAS-14.1] >gi|83847278|gb|EAP85153.1| GTP-binding protein [Sulfitobacter sp. EE-36] (216 aa)
Score = 245, Expect = 1.7e-19, Identities = 64/181 (35%), Positives = 97/181 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYD-FDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKS+LINAL   K +A+ SNTPGRTQ  N++   D   L+DLPGYGYA        +  +++ +Y+  R+ L   F +ID    +  +D ++  LL +       VL KADK  +        ++   L K       IV  S++    IP L+ +I ++
  S:    29 FVKGVVAMDGLPPADRMEVCFAGRSNVGKSTLINALTGTKALARASNTPGRTQEINYFTAADDHYLVDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHGVKKVDDEIMSLLDSSAVTFQCVLTKADKVKEVERQKVLDQVRGALAKHPAAYPEIVVTSSEKGWGIPTLRAIIATL 215
>gi|51891500|ref|YP_074191.1| GTP-binding protein [Symbiobacterium thermophilum IAM 14863] >gi|81610694|sp|Q67SJ6|ENGB_SYMTH Probable GTP-binding protein engB >gi|51855189|dbj|BAD39347.1| GTP-binding protein [Symbiobacterium thermophilum IAM 14863] (233 aa)
Score = 244, Expect = 1.7e-19, Identities = 71/166 (42%), Positives = 101/166 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDF--------------DK--------------------FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAK--LKKDKENIVCVSAK 169
           F+ S  +   +  D   E+  +GRSNVGKSSLINAL  N K+A+TSNTPGRTQ  NFY                DK                    F L+D+PGYG+A+VS+++  E +++I  Y+  R  L  V QI+D+    T  D+ M E + +       V  KADK  ++ +  +   IA +  L  D E +V  SA+
  S:     7 FVLSAVAQGQFPQDGLPEVALVGRSNVGKSSLINALVRNRKLARTSNTPGRTQALNFYRVWPQGKPRPEGEPQPDKDAGRTALSGPVLQAARESGAFYLVDMPGYGFARVSEAQRREWARLIEGYLLTRGALRGVLQIVDLRHPPTRDDVTMREWIRHHRLPSLCVATKADKIGRTAWPRHRQVIARELGLDGDGEPLVLFSAE 210
>gi|119475280|ref|ZP_01615633.1| GTP-binding protein XF1430 [marine gamma proteobacterium HTCC2143] >gi|119451483|gb|EAW32716.1| GTP-binding protein XF1430 [marine gamma proteobacterium HTCC2143] (202 aa)
Score = 244, Expect = 1.9e-19, Identities = 63/167 (37%), Positives = 98/167 (58%)
  Q:    13 DWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNKTNIPNLKK 179
           D  +DD  E+ F GRSN GKSS IN L  N ++A+TS TPGRTQL NF+D  ++ RL+DLPGYG+AKV  +   +  + + EY+  R++L  +  ++D    + + D  M           +I+L KADK  K   ++   K+  +LK+ +  +I   SA  +T +  L++
  S:    22 DCPSDDGCEVAFAGRSNAGKSSAINTLTDNKRMARTSKTPGRTQLLNFFDVGERQRLVDLPGYGFAKVPLAVKEKWQRHLGEYLRERESLAGLVLLMDCRHPLQEFDRMMLAWAEGCEMPVHILLTKADKLKKGPANSVLLKVREELKQQELVSIQLFSALKRTGLDQLRE 192
>gi|160944173|ref|ZP_02091403.1| hypothetical protein FAEPRAM212_01680 [Faecalibacterium prausnitzii M21/2] >gi|158444849|gb|EDP21853.1| hypothetical protein FAEPRAM212_01680 [Faecalibacterium prausnitzii M21/2] (200 aa)
Score = 244, Expect = 1.9e-19, Identities = 70/178 (39%), Positives = 96/178 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI---------VCVSAKNKTNIPNLKKLI 181
           FI S   S+     D+ E+ F GRSNVGKSSLIN L + K +A+ S+TPG+T   NFY  D    +DLPGYGYAKVS +       +I+ Y    ++   + Q++D     +  DLQM   L      + + L KADK  KS          AK ++D ENI         V  S +N   IP L+ ++
  S:     8 FIASYGISSQLPESDRPELSFSGRSNVGKSSLINKLCSRKNLARVSSTPGKTATINFYSVDDCYFVDLPGYGYAKVSNADRERWDDLINSYFEAPRHHTLLVQLLDCRHAPSADDLQMLRYLHYHRIPYVVALTKADKLKKSQL--------AKTQEDFENICRPYGCQKVVLTSGENGYGIPELQAVL 188
>gi|3820578|gb|AAC69623.1| GTP-binding protein; CgpA [Caulobacter crescentus] (199 aa)
Score = 244, Expect = 2.1e-19, Identities = 69/179 (38%), Positives = 97/179 (54%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFA---KIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           SFI      +     D  E+ F GRSNVGKSSLIN L N K +A+ SN PGRT+  NF+   +K RL+DLPGYG+A+VS+S   +   +   Y+  R NL  V+ +ID    +  +DL+  + L      + IVL KADK   +  D   A   K  AK       ++  S++    +P L+  I
  S:     8 SFIMGAVRMDAMPPSDLPEVAFAGRSNVGKSSLINGLVNQKYLARASNEPGRTRQINFFLLAEKVRLVDLPGYGFARVSRSIADKFQDLGRAYLRGRANLKRVYVLIDARHGLKKVDLEALDALDVAAVSYQIVLTKADKIKPAEVDKVVAETQKAIAKRAAAFPRVLATSSEKGLGMPELRAEI 192
>gi|125524375|gb|EAY72489.1| hypothetical protein OsI_000336 [Oryza sativa (indica cultivar-group)] (246 aa)
Score = 244, Expect = 2.2e-19, Identities = 54/121 (44%), Positives = 77/121 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+ +R +L  +  ++DI   + DLD QM +   +      ++L KADK A
  S:    62 EVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVEDGIRLVDLPGYGYAEVPEEMKRKWQRALGEYLQMRNSLKGLVVLMDIRHPLKDLDQQMIQWAVDVGTPVLVLLTKADKLA 185
>gi|116621147|ref|YP_823303.1| small GTP-binding protein [Solibacter usitatus Ellin6076] >gi|116224309|gb|ABJ83018.1| small GTP-binding protein [Solibacter usitatus Ellin6076] (191 aa)
Score = 243, Expect = 2.2e-19, Identities = 61/140 (43%), Positives = 81/140 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           F+ S    + + +D   EI F+GRSNVGKSSLINAL  + K+A TSNTPGRTQ  NFY  D KF L+DLPGYGYA+V      +   +I  Y+  R+ L     I+D      + DL +   L +    + +V  K DK  +S
  S:     8 FVVSSGKPDTFPSDRLPEIAFLGRSNVGKSSLINALTGHKKLAFTSNTPGRTQTINFYRVDEKFYLVDLPGYGYARVPAGFAEQWKVLIEHYLEFRETLKFSCLILDTRRGWMEKDLDLKRWLDHHGRPYLVVATKTDKLNQS 150
>gi|89210982|ref|ZP_01189363.1| GTP-binding [Halothermothrix orenii H 168] >gi|89159440|gb|EAR79107.1| GTP-binding [Halothermothrix orenii H 168] (199 aa)
Score = 243, Expect = 2.6e-19, Identities = 52/107 (48%), Positives = 71/107 (66%)
  Q:     2 PSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID 108
           P F+ S +  +D+ T +  E  F GRSNVGKSSLIN L N  K+A+TS+ PGRTQ  NF++ D +F L+DLPGYG+A V +    E  ++I  Y+  R NL  + QI+D
  S:     6 PRFVISAYDFDDFPTHNWPEFAFSGRSNVGKSSLINTLVNRRKLARTSSRPGRTQSINFFNIDDRFYLVDLPGYGFANVPRKVKEEWGRLIEGYLNNRPNLAGIVQIVD 114
>gi|126734529|ref|ZP_01750275.1| GTP-binding protein [Roseobacter sp. CCS2] >gi|126715084|gb|EBA11949.1| GTP-binding protein [Roseobacter sp. CCS2] (215 aa)
Score = 243, Expect = 2.7e-19, Identities = 60/182 (32%), Positives = 96/182 (52%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           F+K   + +     D+ E+CF GRSNVGKSSLINA+   K +A+ SNTPGRTQ  NF+      ++DLPGYG+A    +   +  +++ +Y+  R+ L  VF +ID       +D ++  LL +      +V+ K DK        +  K  A L K       ++  S++    I  L+ +I  ++
  S:    29 FVKGVVAMDGLPPADRVEVCFAGRSNVGKSSLINAITGRKGLARASNTPGRTQEINFFTAGDIYVVDLPGYGFATAPVAVVEKWQRLLKQYLQGRQTLRRVFVLIDARHGAKAVDEEIMSLLDSSAVTFQVVMTKVDKLKGEALQASLDKTRAALAKHPAAFPELILTSSEKGDGIKTLRAIIAGIV 215
>gi|16125019|ref|NP_419583.1| GTPase EngB [Caulobacter crescentus CB15] >gi|13638031|sp|Q9ZG89|ENGB_CAUCR GTP-binding protein engB (GTP-binding protein cgpA) >gi|13422003|gb|AAK22751.1| GTP-binding protein CgpA [Caulobacter crescentus CB15] (199 aa)
Score = 243, Expect = 2.7e-19, Identities = 69/179 (38%), Positives = 97/179 (54%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFA---KIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           SFI      +     D  E+ F GRSNVGKSSLIN L N K +A+ SN PGRT+  NF+   +K RL+DLPGYG+A+VS+S   +   +   Y+  R NL  V+ +ID    +  +DL+  + L      + IVL KADK   +  D   A   K  AK       ++  S++    +P L+  I
  S:     8 SFIMGAVRMDAMPPSDLPEVAFAGRSNVGKSSLINGLVNQKYLARASNEPGRTREINFFLLAEKVRLVDLPGYGFARVSRSIADKFQDLGRAYLRGRANLKRVYVLIDARHGLKKVDLEALDALDVAAVSYQIVLTKADKIKPAEVDKVVAETQKAIAKRAAAFPRVLATSSEKGLGMPELRAEI 192
>gi|29376444|ref|NP_815598.1| GTPase EngB [Enterococcus faecalis V583] >gi|81838891|sp|Q833M8|ENGB_ENTFA Probable GTP-binding protein engB >gi|29343908|gb|AAO81668.1| GTP-binding protein [Enterococcus faecalis V583] (193 aa)
Score = 242, Expect = 2.9e-19, Identities = 64/142 (45%), Positives = 84/142 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           EI   GRSNVGKSS IN L N K +A+TS  PG+TQ  NFY   D    +D+PGYGYAKVSK++  +  K+I  YI  R+ L AV  +ID+    T  D+QM E L        IV  KADK  +  ++ + + I   L  DK++
  S:    25 EIALAGRSNVGKSSFINTLINRKNLARTSGKPGKTQTLNFYLIEDALHFVDVPGYGYAKVSKTERAKWGKMIETYITQREQLRAVVSLIDLRHPPTQDDIQMYEFLKYYDLPVIIVATKADKIPRGKWNKHESVIKKALNFDKQD 169
>gi|125973114|ref|YP_001037024.1| GTP-binding protein [Clostridium thermocellum ATCC 27405] >gi|196252590|ref|ZP_03151245.1| GTP-binding protein HSR1-related [Clostridium thermocellum DSM 4150] >gi|125713339|gb|ABN51831.1| GTP-binding protein [Clostridium thermocellum ATCC 27405] >gi|196198007|gb|EDX92849.1| GTP-binding protein HSR1-related [Clostridium thermocellum DSM 4150] (207 aa)
Score = 242, Expect = 3.1e-19, Identities = 64/155 (41%), Positives = 90/155 (58%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNK 171
           +D  EI F+GRSNVGKSSLIN + N K +AK + TPGRT++ NFY+ D K   +DLPGYG+AKV K+       II  Y+  RK L  V  ++DI    T  D+ M E L      + +V  K DK  ++      + I + LK +D   I+  S++ +
  S:    27 NDLPEITFVGRSNVGKSSLINTMLNRKNLAKVAATPGRTRVINFYNIDDKLYFVDLPGYGFAKVPKTMKTGWKDIIETYLIERKQLKKVIMLVDIRHSPTSDDVLMHEWLKAMRKSYVVVATKLDKIPRTKIKERISDIRSILKLEDDVKIIPFSSETR 185
>gi|170790827|gb|EDT31871.1| GTP-binding protein [Oligotropha carboxidovorans OM5] (221 aa)
Score = 242, Expect = 3.2e-19, Identities = 61/138 (44%), Positives = 80/138 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY--------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           EI   GRSNVGKSSLINAL     +A+TS+TPGRTQ   F+           + RL+D+PGYGYA   K+K    + +I  Y+  R NL  V+ +ID      D D ++   L      + IVL K D+  KS  D   A +A KL+K
  S:    40 EIALAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFFKGPGPLDAQTPELRLVDMPGYGYASAPKTKIASWTTLIHRYLLGRANLARVYVLIDSRHGFKDADDEVLTTLDKSAVSYQIVLTKTDQVKKSALDETMAAMAEKLRK 187
>gi|167464640|ref|ZP_02329729.1| GTPase EngB [Paenibacillus larvae subsp. larvae BRL-230010] (204 aa)
Score = 242, Expect = 3.4e-19, Identities = 66/159 (41%), Positives = 89/159 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           F+ S    + + TD   EI   GRSNVGKSSLIN L N K +A+TS+ PG+TQ  N+Y  ++    +DLPGYGYAKVSK+K  E  K I  Y+  R+ L  V Q+ID+    T  D  M   L +      +V  KADK  K  +  +   I   L+ +K +
  S:     8 FVISAVGPSQYPTDALPEIALAGRSNVGKSSLINRLINRKNLARTSSQPGKTQTLNYYLINQDLYFVDLPGYGYAKVSKAKRAEWGKFIENYLLKREPLKLVLQLIDLRHPPTKDDQAMYAWLKHHKLPVCVVTTKADKIPKGKWQKHCKVIKETLEFEKSD 169
>gi|89891777|ref|ZP_01203279.1| GTP-binding cell division protein EngB [Flavobacteria bacterium BBFL7] >gi|89515932|gb|EAS18597.1| GTP-binding cell division protein EngB [Flavobacteria bacterium BBFL7] (200 aa)
Score = 242, Expect = 3.4e-19, Identities = 60/128 (46%), Positives = 77/128 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           E  FIGRSNVGKSSLIN L N K +AKTS  PG+TQL N +  +K + L+DLPGYGYA+VSKS   +  K I+ Y   R+ LV  F ++D+      +D +  E L        IV  KADK   +  + N
  S:    25 EYAFIGRSNVGKSSLINMLTNKKSLAKTSGRPGKTQLINHFLINKSWHLVDLPGYGYARVSKSSKAKFQKFITNYFQQRRQLVCAFVLVDVRHEPQPIDTEFMEWLGENGIPFGIVFTKADKLKPNALERN 155
>gi|126700919|ref|YP_001089816.1| GTP-binding protein [Clostridium difficile 630] >gi|115252356|emb|CAJ70197.1| probable GTP-binding protein [Clostridium difficile 630] (194 aa)
Score = 242, Expect = 3.6e-19, Identities = 61/157 (38%), Positives = 95/157 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNL 177
           EI   GRSNVGKSS+IN L N +  A+TS TPG+T+  NFY  + +F  +DLPGYGYAK++KS+  +   I+  Y+  R+ L ++F ++DI    T  D  M E + +      ++  KADK ++  +  + + I  KL+ +  E ++ VS+  KT +  L
  S:    16 EIALAGRSNVGKSSIINTLLNRRNFARTSQTPGKTRTINFYLINNEFYFVDLPGYGYAKIAKSEKEKWGGIMERYLESRQELCSIFLLVDIRHEPTADDKLMYEWIKHFGYNCVVIATKADKISRGQYQKHISIIRKKLQMESSEKVIPVSSLKKTGVEEL 176
>gi|170016866|ref|YP_001727785.1| GTPase [Leuconostoc citreum KM20] >gi|169803723|gb|ACA82341.1| Predicted GTPase [Leuconostoc citreum KM20] (194 aa)
Score = 242, Expect = 3.7e-19, Identities = 65/155 (41%), Positives = 88/155 (56%)
  Q:     5 IKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           + S  S+  + TD K EI  +GRSNVGKSSL N L   K  A+TS+ PG+TQ  NFYD + +   +D+PGYGYAKVSK +      +I EYI  RK L  V  ++D     ++ D+ M E L        +V  K+DK +KS F+     I  +L  D
  S:     9 VMSAVSAAQYPTDGKPEIALVGRSNVGKSSLTNTLIQRKNFARTSSQPGKTQTLNFYDVENQLYFVDVPGYGYAKVSKKQREAFGNMIEEYITSRKQLRGVISLVDARHDPSEDDVAMYEWLHYYNIPILVVATKSDKISKSKFNKYENNIKKQLGFD 166
>gi|163733768|ref|ZP_02141210.1| GTPase EngB [Roseobacter litoralis Och 149] >gi|161392879|gb|EDQ17206.1| GTPase EngB [Roseobacter litoralis Och 149] (216 aa)
Score = 242, Expect = 3.7e-19, Identities = 64/178 (35%), Positives = 96/178 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLI 181
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+   +   L+DLPGYGYA        +  +++ +Y+  R+ L   F +ID       +D ++  LL +      +VL KADK  +   +    ++   L K       +V  S++    IP L+ +I
  S:    29 FVKGVVAMSGLPDPDRMEVCFAGRSNVGKSSLINALTGRKGLARASNTPGRTQEINFFTAGESHYLVDLPGYGYANAPVPVVEKWQRLLKQYLSGRQTLRRAFVLIDARHGAKKVDEEILSLLDSAAVTFQVVLTKADKVKEKEREKVLDQVRNALSKHPAAFPELVVTSSEKGWGIPTLRSII 212
>gi|148270457|ref|YP_001244917.1| small GTP-binding protein [Thermotoga petrophila RKU-1] >gi|166232160|sp|A5IMB8|ENGB_THEP1 Probable GTP-binding protein engB >gi|147736001|gb|ABQ47341.1| small GTP-binding protein [Thermotoga petrophila RKU-1] (195 aa)
Score = 241, Expect = 3.9e-19, Identities = 59/136 (43%), Positives = 81/136 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
            +K   +  D+    K E+ F+GRSNVGKSSL+NAL N KIA  S TPG+T+  NFY  + K+  +DLPGYGYAKVSK +     +++ +Y   R +L  VF ++D  +   D D  M E + +      IVL K DK
  S:     8 LVKVARTPGDYPPPLKGEVAFVGRSNVGKSSLLNALFNKKIAFVSKTPGKTRSINFYLVNSKYYFVDLPGYGYAKVSKKERMLWKRLVEDYFKNRWSLQMVFLLVDGRIPPQDSDFMMIEWMKSLNIPFTIVLTKMDK 145
>gi|163752987|ref|ZP_02160111.1| GTP-binding protein [Kordia algicida OT-1] >gi|161326719|gb|EDP98044.1| GTP-binding protein [Kordia algicida OT-1] (202 aa)
Score = 241, Expect = 4.0e-19, Identities = 65/139 (46%), Positives = 80/139 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           E  FIGRSNVGKSSLIN L   K +AKTS  PG+TQL N +   D++ L+DLPGYGYA+VSKS      K I+EY   R  LV  F ++DI      +DL+  + L        IV  KADK   S  D +      KL +D
  S:    25 EYAFIGRSNVGKSSLINMLTQRKSLAKTSGRPGKTQLINHFKINDEWFLVDLPGYGYARVSKSAKKVFQKFITEYFRKRTQLVCGFVLVDIRHEPQKVDLEFMQWLGENQIPFCIVFTKADKLRPSQIDKHVNAYREKLLED 166
>gi|124005837|ref|ZP_01690675.1| GTP-binding protein [Microscilla marina ATCC 23134] >gi|123988520|gb|EAY28161.1| GTP-binding protein [Microscilla marina ATCC 23134] (200 aa)
Score = 241, Expect = 4.1e-19, Identities = 62/136 (45%), Positives = 82/136 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           FIKS           + E  FIGRSNVGKSSLIN L N K +AKTS  PG+TQ  N F   D++ L+DLPGYGYAK SK++  +  K+I++YI  R+ L+ +F +ID       +DL+  E L        +V  K+DK
  S:     8 FIKSSTDYTQCPAVHQPEYAFIGRSNVGKSSLINKLTNRKSLAKTSQNPGKTQTINHFLINDRWHLVDLPGYGYAKASKTERKKWGKMINDYILKREVLLGIFVLIDARHEPQKIDLEFLEWLGEERVPFTMVFTKSDK 146
>gi|103485501|ref|YP_615062.1| GTPase EngB [Sphingopyxis alaskensis RB2256] >gi|119369262|sp|Q1GN74|ENGB_SPHAL Probable GTP-binding protein engB >gi|98975578|gb|ABF51729.1| GTP-binding [Sphingopyxis alaskensis RB2256] (219 aa)
Score = 241, Expect = 4.1e-19, Identities = 66/179 (36%), Positives = 99/179 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD---KENIVCVSAKNKTNIPNLKKLI 181
           +F+KS  +          EI F GRSNVGKSSL+NAL N   +A+TS TPGRTQ  N++D  +   FRL+D+PGYG+AK  K    +   +I++Y+  R+ L     +ID    I D+D  + E+L      + +VL KADK   S   +  A   A+ +K       ++  S++    I  L+  +
  S:    27 AFLKSAPALQHLPVPSVPEIAFAGRSNVGKSSLLNALTNRNGLARTSVTPGRTQELNYFDVGEPPVFRLVDMPGYGFAKAPKDVVRKWRFLINDYLRGRQVLKRTLVLIDSRHGIKDVDRDVLEMLDTAAVSYRLVLTKADKIKASALADVHAATEAEARKHPAAHPEVIATSSEKGMGIAELRTAV 213
>gi|169824742|ref|YP_001692353.1| EngB family GTP-binding protein [Finegoldia magna ATCC 29328] >gi|167831547|dbj|BAG08463.1| GTP-binding protein EngB family [Finegoldia magna ATCC 29328] (201 aa)
Score = 241, Expect = 4.2e-19, Identities = 64/153 (41%), Positives = 97/153 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVC-VSAKNKTN 173
           EI F GRSNVGKSS IN++ + K +A+TS+ PG+T+  NFY+ + +FRL+DLPGYGYA+ SKS+  + +++I  Y+  R+NL  VF I+DI    T  D +M   +       +++  K DK  K+    N   I  +L  D +N++   S+ +KTN
  S:    25 EIAFCGRSNVGKSSFINSILDRKNLARTSSKPGKTRTVNFYNANNEFRLVDLPGYGYAQTSKSEKKKWAQVIETYLNNRRNLYEVFLIVDIRHKPTVQDKEMYNWIIQSGFCGFVIATKLDKIGKTMIKKNLNIIKKELNIDDDNLIYEYSSTSKTN 181
>gi|146337895|ref|YP_001202943.1| GTPase EngB [Bradyrhizobium sp. ORS278] >gi|146190701|emb|CAL74705.1| putative GTP-binding protein engB [Bradyrhizobium sp. ORS278] (219 aa)
Score = 241, Expect = 4.3e-19, Identities = 59/158 (37%), Positives = 95/158 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY---DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLK 178
           EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ   F+   D    RL+D+PGYGYA  +K+K    +++I +++  R +L  V+ +ID    + ++D ++ + L      + +VL KAD+   +   +  A+    L K       ++  S+++ T +P L+
  S:    42 EIAFAGRSNVGKSSLINALTGQNALARTSHTPGRTQELIFFQGPDSAPLRLVDMPGYGYAAAAKTKVASWTELIHQFLLGRASLARVYVLIDARHGLKEVDQEILKTLDRSAVSYQLVLTKADQIKPAELASRIAETETALAKHPAAFPQVLATSSRSGTGMPELR 207
>gi|153814162|ref|ZP_01966830.1| hypothetical protein RUMTOR_00371 [Ruminococcus torques ATCC 27756] >gi|145848558|gb|EDK25476.1| hypothetical protein RUMTOR_00371 [Ruminococcus torques ATCC 27756] (202 aa)
Score = 241, Expect = 4.5e-19, Identities = 51/93 (54%), Positives = 68/93 (73%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI 109
           +DK E+ F G+SNVGKSSLINAL N K  A+ S TPG+TQ  NFY+  D+  L+DLPGYGYA+VS+ +  +  ++I  Y++  K L AVF +IDI
  S:    21 NDKPEVAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYNINDEMYLVDLPGYGYARVSEKEKEQWGRMIERYLHSSKQLKAVFLLIDI 115
>gi|182417604|ref|ZP_02948926.1| GTP-binding protein [Clostridium butyricum 5521] >gi|182378559|gb|EDT76088.1| GTP-binding protein [Clostridium butyricum 5521] (198 aa)
Score = 241, Expect = 4.6e-19, Identities = 71/174 (40%), Positives = 98/174 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNL 177
           FI S      +  D++ E+ F+GRSNVGKSS+IN+L N  K+AK S TPG+T+L NF+  +  F L+DLPGYGYAKVSKS+     K I  Y+  R+ L  +  ++D     T  D+ M E   +      +V  K+DK   S F  N   I   LK K+++     S+ NK  I  L
  S:     8 FIISAVKREQYPLDNRNEVAFVGRSNVGKSSIINSLTNRKKLAKVSGTPGKTRLVNFFLINNDFYLVDLPGYGYAKVSKSEKDSWGKTIEMYLTEREQLKRIVLLVDSRHKPTGDDILMYEWAKHFGYDVVVVATKSDKLKNSEFKKNEKIIKETLKLKEEDKFYFFSSLNKRGIETL 185
>gi|168697583|ref|ZP_02729860.1| probable GTP-binding protein [Clostridium difficile QCD-37x79] >gi|168708064|ref|ZP_02740341.1| probable GTP-binding protein [Clostridium difficile QCD-63q42] >gi|168724259|ref|ZP_02756536.1| probable GTP-binding protein [Clostridium difficile QCD-76w55] >gi|168731599|ref|ZP_02763876.1| probable GTP-binding protein [Clostridium difficile QCD-97b34] >gi|196124849|ref|ZP_03116598.1| GTP-binding protein [Clostridium difficile ATCC 43255] >gi|196160491|ref|ZP_03121052.1| GTP-binding protein [Clostridium difficile CIP 107932] >gi|196165115|ref|ZP_03125646.1| GTP-binding protein [Clostridium difficile QCD-23m63] >gi|119369184|sp|Q180E5|ENGB_CLOD6 Probable GTP-binding protein engB (203 aa)
Score = 241, Expect = 4.7e-19, Identities = 61/157 (38%), Positives = 95/157 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNL 177
           EI   GRSNVGKSS+IN L N +  A+TS TPG+T+  NFY  + +F  +DLPGYGYAK++KS+  +   I+  Y+  R+ L ++F ++DI    T  D  M E + +      ++  KADK ++  +  + + I  KL+ +  E ++ VS+  KT +  L
  S:    25 EIALAGRSNVGKSSIINTLLNRRNFARTSQTPGKTRTINFYLINNEFYFVDLPGYGYAKIAKSEKEKWGGIMERYLESRQELCSIFLLVDIRHEPTADDKLMYEWIKHFGYNCVVIATKADKISRGQYQKHISIIRKKLQMESSEKVIPVSSLKKTGVEEL 185
>gi|161505499|ref|YP_001572611.1| hypothetical protein SARI_03659 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160866846|gb|ABX23469.1| hypothetical protein SARI_03659 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (198 aa)
Score = 241, Expect = 4.8e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM +       Q  ++L KADK A
  S:    11 SDSGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVDGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIQWAVESNIQVLVLLTKADKLA 139
>gi|194430709|ref|ZP_03063138.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli B171] >gi|194411246|gb|EDX27639.1| ribosome biogenesis GTP-binding protein YsxC [Escherichia coli B171] (197 aa)
Score = 240, Expect = 5.0e-19, Identities = 67/175 (38%), Positives = 93/175 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITD-LDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNKTNIPNLK 178
           F+KS F   D    +  EI F+GRSNVGKSSLINA  N  K+AK S+TPG T+  NF+  D KF L+DLPGYG+AKV          ++  Y+   ++   +  I DI    D  D+Q+ E + +    H IVLNK D  +    +   +      K + E  +  +S K    IP L+
  S:     7 FVKSVFKLEDLPPPEFPEIAFLGRSNVGKSSLINAFLNRKKVAKVSSTPGFTKALNFFRIDFKFYLVDLPGYGFAKVPVEVKKHWQYLVEGYLKAVRDFRNLVLIFDIRRNPDEADIQLVEFVKHLKKPHCIVLNKIDTLSFREVERQASVYQKTFKPNPETPLFLISCKESKGIPQLR 185
>gi|85374953|ref|YP_459015.1| GTPase EngB [Erythrobacter litoralis HTCC2594] >gi|84788036|gb|ABC64218.1| probable GTPase [Erythrobacter litoralis HTCC2594] (213 aa)
Score = 240, Expect = 5.0e-19, Identities = 57/138 (41%), Positives = 82/138 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF---DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           EI F GRSNVGKSSL+NAL   + IA+TS TPGRTQ  NF++     +FRL+D+PGYG+AK           ++  Y+  R+ L     ++D    + D+D +M  +L      + +VL KADK   S  +   AK+A + +K
  S:    40 EIAFCGRSNVGKSSLLNALTGRRSIARTSVTPGRTQELNFFEVGEPTQFRLVDMPGYGFAKAPVKVVERWKNLVRTYLKGRQVLARTLVLVDARHGLKDVDREMMTMLDETAVSYRVVLTKADKIKASELEATAAKVAEEARK 182
>gi|145953819|ref|ZP_01802827.1| hypothetical protein CdifQ_04003834 [Clostridium difficile QCD-32g58] (206 aa)
Score = 240, Expect = 5.1e-19, Identities = 61/157 (38%), Positives = 95/157 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNL 177
           EI   GRSNVGKSS+IN L N +  A+TS TPG+T+  NFY  + +F  +DLPGYGYAK++KS+  +   I+  Y+  R+ L ++F ++DI    T  D  M E + +      ++  KADK ++  +  + + I  KL+ +  E ++ VS+  KT +  L
  S:    28 EIALAGRSNVGKSSIINTLLNRRNFARTSQTPGKTRTINFYLINNEFYFVDLPGYGYAKIAKSEKEKWGGIMERYLESRQELCSIFLLVDIRHEPTADDKLMYEWIKHFGYNCVVIATKADKISRGQYQKHISIIRKKLQMESSEKVIPVSSLKKTGVEEL 188
>gi|56964398|ref|YP_176129.1| GTPase EngB [Bacillus clausii KSM-K16] >gi|81822069|sp|Q5WEP2|ENGB_BACSK Probable GTP-binding protein engB >gi|56910641|dbj|BAD65168.1| GTP-binding protein [Bacillus clausii KSM-K16] (197 aa)
Score = 240, Expect = 5.1e-19, Identities = 60/142 (42%), Positives = 83/142 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           E+   GRSNVGKSS IN + N K +A+TS  PG+TQ  NFY+  ++   +D+PGYGYAKVSK++     K+I  Y+  R+ L AV Q++DI      D Q    L   + +HY     +V  KADK  K  +      IA  L K+  +
  S:    25 ELALAGRSNVGKSSFINKMLNRKGLARTSGQPGKTQTLNFYEINERLYFVDVPGYGYAKVSKTERAAWGKMIETYLSEREELKAVLQLVDIRHRPSEDDQ----LMYNWMKHYGIPVILVATKADKIPKGKWQKQLTAIAKTLDKEASD 169
>gi|189501178|ref|YP_001960648.1| GTP-binding protein HSR1-related [Chlorobium phaeobacteroides BS1] >gi|189496619|gb|ACE05167.1| GTP-binding protein HSR1-related [Chlorobium phaeobacteroides BS1] (192 aa)
Score = 240, Expect = 5.3e-19, Identities = 65/154 (42%), Positives = 95/154 (61%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL--DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           +F KS  + +    +   EI F+GRSNVGKS+L+N+L   K +AKTS+TPG+TQL N++  ++    +DLPGYGYAKV K K +E  K++S Y+  R ++  V  +ID S   D+  D  M+E L +    + +VL K DK  +       AK AA+L
  S:     7 TFYKSVSAIDHLPKEQLPEIVFVGRSNVGKSTLLNSLTARKGLAKTSSTPGKTQLINYFVINESCYFVDLPGYGYAKVDKGKKYEWGKLLSHYVSTRDSITLVVLLID-SRHPDMESDHLMAEFLEHCGRPYGVVLTKYDKLKQQ------AKAAARL 157
>gi|86135822|ref|ZP_01054401.1| GTP-binding protein [Roseobacter sp. MED193] >gi|85826696|gb|EAQ46892.1| GTP-binding protein [Roseobacter sp. MED193] (216 aa)
Score = 240, Expect = 5.7e-19, Identities = 64/178 (35%), Positives = 95/178 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY-DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLI 181
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++    +  L+DLPGYGYA    +   +  K++  Y+  R+ L   F +ID    + D+D ++  LL +       V+ KADK      D    ++   L +       IV  S++    I  L+ +I
  S:    29 FVKGVVAMSGLPDADRMEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYFTQGPELYLVDLPGYGYANAPLAVVEKWQKLLKRYLSGRQTLRRAFVLIDSRHGVKDVDEEIMSLLDSSAVTFQCVMTKADKVKIKDRDRVIEQVRTALARHPAAYPEIVLTSSEKGDGIATLRSII 212
>gi|13474032|ref|NP_105600.1| GTPase EngB [Mesorhizobium loti MAFF303099] >gi|24418390|sp|Q98D85|ENGB_RHILO Probable GTP-binding protein engB >gi|14024784|dbj|BAB51386.1| GTP-binding protein [Mesorhizobium loti MAFF303099] (212 aa)
Score = 240, Expect = 5.8e-19, Identities = 68/166 (40%), Positives = 93/166 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR----------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           EI F GRSNVGKSSLINAL N K +A+TSNTPGRTQ  N++  D F           L+D+PGYGYA   K K  E +K++ +Y+  R  L  V+ +ID    I   D ++  LL      + IVL K DK   +       +   K+KK       V A +      L++L  +++L
  S:    30 EIAFAGRSNVGKSSLINALVNQKGLARTSNTPGRTQELNYFVPDGFSGEGADLPPMALVDMPGYGYATAPKEKVDEWTKLVFDYLKGRVTLKRVYVLIDARHGIKAKDDEVLSLLDKAAVSYQIVLTKTDKIKVAGVPRLIEETLQKIKKRPAAFPFVLATSSEKGEGLEELQAAIVL 207
>gi|163795446|ref|ZP_02189413.1| acetylglutamate kinase [alpha proteobacterium BAL199] >gi|159179432|gb|EDP63963.1| acetylglutamate kinase [alpha proteobacterium BAL199] (214 aa)
Score = 240, Expect = 5.9e-19, Identities = 61/138 (44%), Positives = 81/138 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           E+ F GRSNVGKSSL+NAL   K +A+TSNTPGRTQ   F+D   + +L+DLPGYGYAKVSK+K    +  +  Y+  R +L  V  +ID      D+D +  +L       + I+L KADK   S        + A L K
  S:    43 EVAFAGRSNVGKSSLVNALTGRKSLARTSNTPGRTQELIFFDLGSRLQLVDLPGYGYAKVSKTKVQLWTDTLFAYLRGRTSLHRVNLLIDSRHGPKDIDNEAMDLFDRAALSYQIILTKADKPKPSELAELIESLGAALAK 183
>gi|150016213|ref|YP_001308467.1| GTPase EngB [Clostridium beijerinckii NCIMB 8052] >gi|189037172|sp|A6LT31|ENGB_CLOB8 Probable GTP-binding protein engB >gi|149902678|gb|ABR33511.1| GTP-binding protein, HSR1-related [Clostridium beijerinckii NCIMB 8052] (198 aa)
Score = 240, Expect = 5.9e-19, Identities = 65/159 (40%), Positives = 93/159 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           FI S    N +  D++ E+ F+GRSNVGKSSLIN+L N  K+AK S TPG+T+L NF+   D F L+DLPGYGYAKVSK++     K +  Y+  R+ L  V  ++D     T  D+ M E + +      +V  K+DK  ++    N   I   LK + ++
  S:     8 FITSAVKKNQYPIDNRVEVAFVGRSNVGKSSLINSLTNRKKLAKVSQTPGKTRLVNFFLINDDFYLVDLPGYGYAKVSKAEKDSWGKTVEMYLTGREQLKRVVLLVDSRHKPTGDDIIMHEWIKHFGYDVIVVATKSDKLTRNELKKNEKVIKETLKLNSDD 169
>gi|154506027|ref|ZP_02042765.1| hypothetical protein RUMGNA_03569 [Ruminococcus gnavus ATCC 29149] >gi|153793526|gb|EDN75946.1| hypothetical protein RUMGNA_03569 [Ruminococcus gnavus ATCC 29149] (206 aa)
Score = 239, Expect = 6.4e-19, Identities = 59/127 (46%), Positives = 81/127 (63%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKS 143
           ++K EI F G+SNVGKSSLINAL N K  A+ S TPG+TQ  NFY+  ++  L+DLPGYGYAKVS+ +  +   +I  Y++  K L AVF +IDI       D  M + + ++  Q  I+  K DK  +S
  S:    21 NEKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYNINEELYLVDLPGYGYAKVSEKEKIQWGNLIERYLHTSKQLKAVFLLIDIRHDPSANDKMMYQWIVDQGFQPIIIATKLDKLKRS 150
>gi|115377933|ref|ZP_01465117.1| GTP-binding protein [Stigmatella aurantiaca DW4/3-1] >gi|115365038|gb|EAU64089.1| GTP-binding protein [Stigmatella aurantiaca DW4/3-1] (177 aa)
Score = 239, Expect = 6.8e-19, Identities = 59/150 (39%), Positives = 89/150 (59%)
  Q:    25 IGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFD--------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNI 174
           +GRSNVGKSS+IN L    K+ + SNTPGRT+  NF+D +        + RL DLPGYG+AK SK+   + +++I+ Y+  R  L AV  IID  +  T  DLQ  + L  +  +  +V  K D+ AK+        +A +L    E ++  S+ +K  +
  S:     1 MGRSNVGKSSMINTLTGRKKLVRVSNTPGRTRTLNFFDVELDRDGHRHQVRLADLPGYGFAKASKADRVQWNEMITTYLDKRHRLEAVVSIIDAEIGPTPDDLQTLDYLQEKDRRVLVVATKIDRLAKARRKPRIQALAQQLDLPLEAVIAFSSVDKIGV 160
>gi|88858645|ref|ZP_01133286.1| GTP-binding protein [Pseudoalteromonas tunicata D2] >gi|88818871|gb|EAR28685.1| GTP-binding protein [Pseudoalteromonas tunicata D2] (219 aa)
Score = 239, Expect = 7.0e-19, Identities = 62/156 (39%), Positives = 87/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +FI S    +    D   E+ F GRSN GKSS +N L + KIAKTS TPGRTQL N +D  D  RLIDLPGYGYAKV      +  + + EY+  RK+L  +  ++DI   + DLD  +     +      ++L KADK  +    +   ++  +LK+
  S:    12 TFITSAPDISKLPPDTGIEVAFAGRSNAGKSSSLNTLTDKKIAKTSKTPGRTQLINAFDLGDNMRLIDLPGYGYAKVPIEMKKKWQRSLGEYLEKRKSLKGLVILMDIRHPLKDLDKDLINWAVDSNISTLVLLTKADKFKQGKRKSEVLRVRRELKE 169
>gi|165975551|ref|YP_001651144.1| GTPase EngB [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165875652|gb|ABY68700.1| GTP-binding protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (206 aa)
Score = 239, Expect = 7.3e-19, Identities = 57/127 (44%), Positives = 80/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D+  EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  V  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    24 DNGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRECLRGVVILMDIRHPLKDLDQQMIEWAVSAQLPVLLLLTKADKLSQS 153
>gi|117620801|ref|YP_854796.1| GTP-binding protein YihA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166225937|sp|A0KEY0|ENGB_AERHH Probable GTP-binding protein engB >gi|117562208|gb|ABK39156.1| GTP-binding protein YihA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (216 aa)
Score = 239, Expect = 7.3e-19, Identities = 57/136 (41%), Positives = 82/136 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKI 152
           D   EI F GRSN GKSS +N L   K +A+TS TPGRTQL N ++ +   RL+DLPGYGYA+V      +  K ++EY+  R++L  +  ++DI   + D D+ M E  S+R     ++L KADK +    +N   K+
  S:    26 DGGVEIAFAGRSNAGKSSALNTLTKHKNLARTSKTPGRTQLINLFELEPGKRLVDLPGYGYAQVPLEMKLKWQKSLAEYLQRRESLKGLVILMDIRHPLKDTDMNMLEWSSHRKLPVMLLLTKADKLSPGPRNNQVIKV 164
>gi|26111058|gb|AAN83241.1|AE016770_41 Probable GTP-binding protein engB [Escherichia coli CFT073] >gi|147313|gb|AAA24403.1| unidentified protein >gi|304970|gb|AAB02999.1| matches PS00017: ATP_GTP_A [Escherichia coli] >gi|73857847|gb|AAZ90554.1| conserved hypothetical protein [Shigella sonnei Ss046] >gi|81243109|gb|ABB63819.1| conserved hypothetical protein [Shigella dysenteriae Sd197] >gi|91074985|gb|ABE09866.1| probable GTP-binding cell division protein [Escherichia coli UTI89] (199 aa)
Score = 239, Expect = 7.4e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    12 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 140
>gi|116494828|ref|YP_806562.1| GTPase [Lactobacillus casei ATCC 334] >gi|191638335|ref|YP_001987501.1| Probable GTP-binding protein engB [Lactobacillus casei] >gi|122263754|sp|Q039K2|ENGB_LACC3 Probable GTP-binding protein engB >gi|116104978|gb|ABJ70120.1| Predicted GTPase [Lactobacillus casei ATCC 334] >gi|190712637|emb|CAQ66643.1| Probable GTP-binding protein engB [Lactobacillus casei BL23] (198 aa)
Score = 239, Expect = 7.4e-19, Identities = 58/137 (42%), Positives = 80/137 (58%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           S  ++  +  D   EI F+GRSNVGKSSLIN L   K +A+TS  PG+TQ  NFYD D +   +D+PGYGYAKVSK+   + + +I  Y+  R+ L  V  ++D     T  D+ M + L     +  +V  K DK  KS
  S:    11 SAVAAAQYPEDGHPEIAFLGRSNVGKSSLINKLIQRKAMARTSGVPGKTQTLNFYDLDSRLFFVDVPGYGYAKVSKTARAKFAAMIETYLTTRQPLRGVVLLVDSRHEPTADDISMYQYLKYYQLRTLVVATKIDKTPKS 150
>gi|154686955|ref|YP_001422116.1| GTPase EngB [Bacillus amyloliquefaciens FZB42] >gi|166225941|sp|A7Z7A9|ENGB_BACA2 Probable GTP-binding protein engB >gi|154352806|gb|ABS74885.1| YsxC [Bacillus amyloliquefaciens FZB42] (195 aa)
Score = 239, Expect = 7.7e-19, Identities = 61/151 (40%), Positives = 89/151 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           EI   GRSNVGKSS IN+L N K +A+TS+ PG+TQ  NFY   D+   +D+PGYG+AKVSKS+     ++I  Y+  R+ L A  QI+D+    +  D+ M E L        ++  KADK  K  +D +   +   L  D E+ ++  S++ K
  S:    25 EIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDELHFVDVPGYGFAKVSKSEREAWGRMIETYMTTREELKACVQIVDLRHAPSAEDVNMYEFLKYYGIPVIVIATKADKIPKGKWDKHLKVVKQTLDMDPEDELILFSSETK 179
>gi|170743187|ref|YP_001771842.1| GTP-binding protein HSR1-related [Methylobacterium sp. 4-46] >gi|168197461|gb|ACA19408.1| GTP-binding protein HSR1-related [Methylobacterium sp. 4-46] (216 aa)
Score = 239, Expect = 7.9e-19, Identities = 50/88 (56%), Positives = 63/88 (71%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID 108
           EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ  NF+D   K  L+D+PGYGYA VSK+K    +++I  Y+  R NL  V+ +ID
  S:    42 EIAFAGRSNVGKSSLINALTGRNTLARTSHTPGRTQQLNFFDLGGKLTLVDMPGYGYAAVSKAKVASWTELIHAYLQGRANLARVYVLID 131
>gi|110807451|ref|YP_690971.1| GTPase EngB [Shigella flexneri 5 str. 8401] >gi|30043106|gb|AAP18828.1| hypothetical protein S3811 [Shigella flexneri 2a str. 2457T] >gi|56384010|gb|AAN45370.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] >gi|110616999|gb|ABF05666.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] (198 aa)
Score = 239, Expect = 7.9e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    11 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 139
>gi|89110163|ref|AP_003943.1| GTP-binding protein [Escherichia coli W3110] >gi|170083337|ref|YP_001732657.1| GTP-binding protein [Escherichia coli str. K12 substr. DH10B] >gi|85676194|dbj|BAE77444.1| GTP-binding protein [Escherichia coli W3110] >gi|169891172|gb|ACB04879.1| GTP-binding protein [Escherichia coli str. K12 substr. DH10B] (198 aa)
Score = 239, Expect = 7.9e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    11 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 139
>gi|168335351|ref|ZP_02693446.1| GTPase EngB [Epulopiscium sp. 'N.t. morphotype B'] (196 aa)
Score = 239, Expect = 8.0e-19, Identities = 68/168 (40%), Positives = 100/168 (59%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIGSV 184
           +++ EI F G+SNVGKSSLIN L N K +A+TS+TPG+TQ  NFY+  DKF  +DLPGYGYAKVSK+      K I +Y+  R +L  V  +IDI    ++ D  M   +S   +   +V  K DK  +S    + + I + L+ +  + I+  SA  K     + +L+ S+
  S:    21 NNQIEIAFAGKSNVGKSSLINVLINRKALARTSSTPGKTQTINFYNIQDKFNFVDLPGYGYAKVSKTLRESWGKFIEDYLGKRSSLKQVVLLIDIRHAPSENDKLMYNWISFFHDNVLVVATKVDKIKRSQIAKHISIIKSVLQLRTTDRIIPFSAATKVGKEEIWELLDSI 192
>gi|89068161|ref|ZP_01155578.1| GTP-binding protein [Oceanicola granulosus HTCC2516] >gi|89046400|gb|EAR52457.1| GTP-binding protein [Oceanicola granulosus HTCC2516] (218 aa)
Score = 239, Expect = 8.0e-19, Identities = 63/182 (34%), Positives = 97/182 (53%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           +F+K   + +     D+ E+CF GRSNVGKS+LINAL   K +A+ SNTPGRTQ  N++   D   L+DLPGYG+A    +   +   ++ +Y+  R+ L   F +ID       +D ++  LL +       VL KADK   S  D    ++ A L +       IV  S++    I  L+ ++  +
  S:    30 TFVKGVVAMSGLPGADRPEVCFAGRSNVGKSTLINALTGRKALARASNTPGRTQEINYFALADSHYLVDLPGYGFANAPVAVVAKWQALLKQYLQGRQTLRRAFVLIDARHGAKAVDEEIMALLDSAAVTFQCVLTKADKIKASERDRVLDQVRATLARHPAAYPEIVLTSSEKGDGIETLRAIVAGI 217
>gi|170289148|ref|YP_001739386.1| small GTP-binding protein [Thermotoga sp. RQ2] >gi|170176651|gb|ACB09703.1| small GTP-binding protein [Thermotoga sp. RQ2] (195 aa)
Score = 239, Expect = 8.1e-19, Identities = 58/136 (42%), Positives = 81/136 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
            +K   +  D+    K E+ F+GRSNVGKSSL+NAL N K+A  S TPG+T+  NFY  + K+  +DLPGYGYAKVSK +     +++ +Y   R +L  VF ++D  +   D D  M E + +      IVL K DK
  S:     8 LVKIARTPGDYPPPLKGEVAFVGRSNVGKSSLLNALFNRKVAFVSKTPGKTRSINFYLVNSKYYFVDLPGYGYAKVSKKERMLWKRLVEDYFKNRWSLQMVFLLVDGRIPPQDSDFMMIEWMKSLNIPFTIVLTKMDK 145
>gi|161617123|ref|YP_001591088.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|189037187|sp|A9MYC7|ENGB_SALPB Probable GTP-binding protein engB >gi|161366487|gb|ABX70255.1| hypothetical protein SPAB_04962 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (210 aa)
Score = 239, Expect = 8.1e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM +       Q  ++L KADK A
  S:    23 SDRGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVDGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIQWAVESNIQVLVLLTKADKLA 151
>gi|157373117|ref|YP_001481106.1| GTPase EngB [Serratia proteamaculans 568] >gi|166920114|sp|A8GLI8|ENGB_SERP5 Probable GTP-binding protein engB >gi|157324881|gb|ABV43978.1| GTP-binding protein HSR1-related [Serratia proteamaculans 568] (216 aa)
Score = 238, Expect = 8.4e-19, Identities = 54/125 (43%), Positives = 78/125 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++ ++  RL+DLPGYGYA+V +    +  + + EY+ +R  L  +  ++DI   + DLD QM +          ++L KADK A
  S:    26 DEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEVEEGIRLVDLPGYGYAEVPEEMKRKWQRALGEYLQMRNCLKGLVVLMDIRHPLKDLDQQMIQWAVEVGTPVLLLLTKADKLA 153
>gi|12518743|gb|AAG59053.1|AE005617_2 orf, hypothetical protein [Escherichia coli O157:H7 EDL933] (199 aa)
Score = 238, Expect = 8.4e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    12 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 140
>gi|117626138|ref|YP_859461.1| GTPase EngB [Escherichia coli APEC O1] >gi|115515262|gb|ABJ03337.1| putative GTP-binding protein [Escherichia coli APEC O1] (215 aa)
Score = 238, Expect = 8.4e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    28 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 156
>gi|163815262|ref|ZP_02206639.1| hypothetical protein COPEUT_01422 [Coprococcus eutactus ATCC 27759] >gi|158449457|gb|EDP26452.1| hypothetical protein COPEUT_01422 [Coprococcus eutactus ATCC 27759] (206 aa)
Score = 238, Expect = 8.7e-19, Identities = 61/136 (44%), Positives = 81/136 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           EI F G+SNVGKSSLIN L N K +A+TS  PG+TQ  NFY+ +K    +DLPGYGYAKVS     +  K+I  Y++    L  VF +IDI  V ++ D  M + + N   +  I+  K DK  +S    N  +I  KL
  S:    25 EIAFAGKSNVGKSSLINGLLNRKSLARTSAQPGKTQTINFYNINKELYFVDLPGYGYAKVSVEIRAKWGKMIENYLHTSAQLKKVFLLIDIRHVPSENDCLMYDWIVNNGYEPVIICTKLDKIKRSQVQKNLKQIKEKL 163
>gi|34499840|ref|NP_904055.1| GTPase EngB [Chromobacterium violaceum ATCC 12472] >gi|81654051|sp|Q7NPV7|ENGB_CHRVO Probable GTP-binding protein engB >gi|34105690|gb|AAQ62044.1| GTP-binding protein [Chromobacterium violaceum ATCC 12472] (206 aa)
Score = 238, Expect = 9.1e-19, Identities = 57/151 (37%), Positives = 94/151 (62%)
  Q:    19 KKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAK 169
           + E+ F+GRSN GKSS IN LAN  ++A  S TPGRTQ  NF++  D+  L+DLPGYGYA+V ++      +++  Y+  R++L+ +  I+D    + +LD +M E         +I+L+KADK ++   + N  K+ A++K++  +   VS +
  S:    23 RAEVAFVGRSNAGKSSAINTLANRTRLAYVSKTPGRTQHINFFELGDECFLVDLPGYGYAEVPEAVRAHWVELLGRYLQTRQSLIGLLLIMDARHPLKELDRRMLEFFRVAGRPVHILLSKADKLSRQ--EQN--KVLAEVKRELADYPSVSVQ 172
>gi|170769691|ref|ZP_02904144.1| putative GTP-binding protein EngB [Escherichia albertii TW07627] >gi|170121499|gb|EDS90430.1| putative GTP-binding protein EngB [Escherichia albertii TW07627] (210 aa)
Score = 238, Expect = 9.2e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    23 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 151
>gi|161485827|ref|NP_709663.3| GTPase EngB [Shigella flexneri 2a str. 301] >gi|161486407|ref|NP_839017.2| GTPase EngB [Shigella flexneri 2a str. 2457T] >gi|119369258|sp|Q83PF4|ENGB_SHIFL Probable GTP-binding protein engB (210 aa)
Score = 238, Expect = 9.7e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    23 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 151
>gi|145698334|ref|NP_418301.3| GTP-binding protein [Escherichia coli str. K-12 substr. MG1655] >gi|157156230|ref|YP_001465345.1| GTPase EngB [Escherichia coli E24377A] >gi|157163335|ref|YP_001460653.1| GTPase EngB [Escherichia coli HS] >gi|161486045|ref|NP_756667.2| GTPase EngB [Escherichia coli CFT073] >gi|161950010|ref|YP_405310.2| GTPase EngB [Shigella dysenteriae Sd197] >gi|161986408|ref|YP_312789.2| GTPase EngB [Shigella sonnei Ss046] >gi|162138322|ref|YP_543397.2| GTPase EngB [Escherichia coli UTI89] >gi|170022121|ref|YP_001727075.1| GTP-binding protein HSR1-related [Escherichia coli ATCC 8739] >gi|170683684|ref|YP_001746193.1| putative GTP-binding protein EngB [Escherichia coli SMS-3-5] >gi|187732245|ref|YP_001882562.1| putative GTP-binding protein EngB [Shigella boydii CDC 3083-94] >gi|188492392|ref|ZP_02999662.1| GTPase family protein [Escherichia coli 53638] >gi|191169445|ref|ZP_03031182.1| putative GTP-binding protein EngB [Escherichia coli B7A] >gi|191173902|ref|ZP_03035422.1| putative GTP-binding protein EngB [Escherichia coli F11] >gi|193063965|ref|ZP_03045051.1| putative GTP-binding protein EngB [Escherichia coli E22] >gi|193068077|ref|ZP_03049042.1| putative GTP-binding protein EngB [Escherichia coli E110019] >gi|67462332|sp|P0A6P7|ENGB_ECOLI Probable GTP-binding protein engB >gi|166920110|sp|A7ZU66|ENGB_ECO24 Probable GTP-binding protein engB >gi|166920111|sp|A8A6W6|ENGB_ECOHS Probable GTP-binding protein engB >gi|189037177|sp|B1IW48|ENGB_ECOLC Probable GTP-binding protein engB >gi|67462333|sp|P0A6P8|ENGB_ECOL6 Probable GTP-binding protein engB >gi|119369193|sp|Q1R448|ENGB_ECOUT Probable GTP-binding protein engB >gi|119369257|sp|Q32A36|ENGB_SHIDS Probable GTP-binding protein engB >gi|119369259|sp|Q3YVA8|ENGB_SHISS Probable GTP-binding protein engB >gi|33358154|pdb|1PUI|A Chain A, Structure Of Engb Gtpase >gi|33358155|pdb|1PUI|B Chain B, Structure Of Engb Gtpase >gi|145693205|gb|AAC76862.3| GTP-binding protein [Escherichia coli str. K-12 substr. MG1655] >gi|157069015|gb|ABV08270.1| putative GTP-binding protein EngB [Escherichia coli HS] >gi|157078260|gb|ABV17968.1| putative GTP-binding protein EngB [Escherichia coli E24377A] >gi|169757049|gb|ACA79748.1| GTP-binding protein HSR1-related [Escherichia coli ATCC 8739] >gi|170521402|gb|ACB19580.1| putative GTP-binding protein EngB [Escherichia coli SMS-3-5] >gi|187429237|gb|ACD08511.1| putative GTP-binding protein EngB [Shigella boydii CDC 3083-94] >gi|188487591|gb|EDU62694.1| GTPase family protein [Escherichia coli 53638] >gi|190900513|gb|EDV60325.1| putative GTP-binding protein EngB [Escherichia coli B7A] >gi|190905860|gb|EDV65479.1| putative GTP-binding protein EngB [Escherichia coli F11] >gi|192929430|gb|EDV83038.1| putative GTP-binding protein EngB [Escherichia coli E22] >gi|192958697|gb|EDV89135.1| putative GTP-binding protein EngB [Escherichia coli E110019] (210 aa)
Score = 238, Expect = 9.7e-19, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    23 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 151
>gi|32035822|ref|ZP_00135658.1| COG0218: Predicted GTPase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126207582|ref|YP_001052807.1| GTPase EngB [Actinobacillus pleuropneumoniae L20] >gi|126096374|gb|ABN73202.1| putative GTP-binding protein EngB [Actinobacillus pleuropneumoniae L20] (206 aa)
Score = 238, Expect = 1.0e-18, Identities = 57/127 (44%), Positives = 80/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D+  EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  V  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    24 DNGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKALGEYLQKRECLRGVVILMDIRHPLKDLDQQMIEWAVSAQLPVLLLLTKADKLSQS 153
>gi|15834041|ref|NP_312814.1| GTPase EngB [Escherichia coli O157:H7 str. Sakai] >gi|161367480|ref|NP_290489.2| GTPase EngB [Escherichia coli O157:H7 EDL933] >gi|168711654|ref|ZP_02743931.1| GTPase EngB [Escherichia coli O157:H7 str. EC4045] >gi|168716463|ref|ZP_02748740.1| GTPase EngB [Escherichia coli O157:H7 str. EC4206] >gi|168736862|ref|ZP_02769139.1| GTPase EngB [Escherichia coli O157:H7 str. EC4115] >gi|168755530|ref|ZP_02780537.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC4401] >gi|168768147|ref|ZP_02793154.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC4486] >gi|168780765|ref|ZP_02805772.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC4076] >gi|168786702|ref|ZP_02811709.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC869] >gi|168794981|ref|ZP_02819988.1| GTPase EngB [Escherichia coli O157:H7 str. EC4042] >gi|168799576|ref|ZP_02824583.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC508] >gi|195937501|ref|ZP_03082883.1| GTPase EngB [Escherichia coli O157:H7 str. EC4024] >gi|21362528|sp|Q8X8H0|ENGB_ECO57 Probable GTP-binding protein engB >gi|13364263|dbj|BAB38210.1| essential GTPase for cell cycle [Escherichia coli O157:H7 str. Sakai] >gi|189001573|gb|EDU70559.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC4076] >gi|189357180|gb|EDU75599.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC4401] >gi|189362605|gb|EDU81024.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC4486] >gi|189373339|gb|EDU91755.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC869] >gi|189378061|gb|EDU96477.1| putative GTP-binding protein EngB [Escherichia coli O157:H7 str. EC508] (210 aa)
Score = 238, Expect = 1.1e-18, Identities = 56/126 (44%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    23 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 151
>gi|16762431|ref|NP_458048.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|16767266|ref|NP_462881.1| GTPase EngB [Salmonella typhimurium LT2] >gi|29143919|ref|NP_807261.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|56415847|ref|YP_152922.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62182463|ref|YP_218880.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|167546420|ref|ZP_02341984.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167551521|ref|ZP_02345276.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|167995106|ref|ZP_02576196.1| GTPase EngB [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168222761|ref|ZP_02647993.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168227085|ref|ZP_02652316.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168232924|ref|ZP_02657982.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168237615|ref|ZP_02662673.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168244253|ref|ZP_02669185.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|168263108|ref|ZP_02685081.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168467330|ref|ZP_02701167.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168476933|ref|ZP_02705956.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|194447921|ref|YP_002048005.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194468507|ref|ZP_03074491.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736984|ref|YP_002116922.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|54037056|sp|P64069|ENGB_SALTI Probable GTP-binding protein engB >gi|54040979|sp|P64068|ENGB_SALTY Probable GTP-binding protein engB >gi|75479463|sp|Q57HL3|ENGB_SALCH Probable GTP-binding protein engB >gi|81599694|sp|Q5PKC6|ENGB_SALPA Probable GTP-binding protein engB >gi|25306632|pir||AG0950 ATP/GTP-binding protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16422563|gb|AAL22840.1| putative GTPase involved in coordination of cell cycle [Salmonella typhimurium LT2] >gi|16504736|emb|CAD03099.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139555|gb|AAO71121.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] >gi|56130104|gb|AAV79610.1| ATP/GTP-binding protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62130096|gb|AAX67799.1| putative GTPase, involved in coordination of cell cycle [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|194406225|gb|ACF66444.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194454871|gb|EDX43710.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194712486|gb|ACF91707.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|195630199|gb|EDX48839.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Newport str. SL317] (210 aa)
Score = 237, Expect = 1.1e-18, Identities = 55/121 (45%), Positives = 77/121 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM +       Q  ++L KADK A
  S:    28 EVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVDGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIQWAVESNIQVLVLLTKADKLA 151
>gi|116878627|ref|YP_358147.2| GTPase EngB [Pelobacter carbinolicus DSM 2380] >gi|119369227|sp|Q3A0Y0|ENGB_PELCD Probable GTP-binding protein engB >gi|114843263|gb|ABA89977.2| GTP-binding protein [Pelobacter carbinolicus DSM 2380] (207 aa)
Score = 237, Expect = 1.2e-18, Identities = 60/140 (42%), Positives = 82/140 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           FIKS      +   D  E+ F GRSNVGKSSLIN L N + + +TS+TPGRTQL NF++ ++ F L+DLPG+G+AKV  S      ++   Y+  R NL AV  + DI     D +LQ+ + L         V+ K DK  K+
  S:     8 FIKSAAKPVGYPPGDLPEVAFAGRSNVGKSSLINVLVNRRGLVRTSSTPGRTQLLNFFEVNQHFMLVDLPGFGFAKVPVSVKKAWGRMTRTYLEERTNLKAVVLLFDIRREPRDEELQLLDWLEELNIPTIPVITKVDKVTKN 150
>gi|182680231|ref|YP_001834377.1| GTP-binding protein HSR1-related [Beijerinckia indica subsp. indica ATCC 9039] >gi|182636114|gb|ACB96888.1| GTP-binding protein HSR1-related [Beijerinckia indica subsp. indica ATCC 9039] (244 aa)
Score = 237, Expect = 1.2e-18, Identities = 63/165 (38%), Positives = 97/165 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           EI F GRSNVGKSSL+NAL   K +A+TS+TPGRTQ  NF+      +  + RL+D+PGYGYA  SK K    + +  +++  R  L+ V+ +ID    +  +D +  +LL      + IVL K D+  KS      A + A L K      +++  S+++   I +L+  I  ++
  S:    57 EIAFAGRSNVGKSSLLNALTGRKTLARTSHTPGRTQELNFFALGPTIESARMRLVDMPGYGYAAASKEKIAAWTSLCRDFLRGRVPLLRVYVLIDGRHGLKPIDSETLDLLDQSAISYQIVLTKRDEVKKSEQAARIASVKAALAKRPAAYPDVIFTSSQSGEGIADLRAAIARLL 232
>gi|146320685|ref|YP_001200396.1| GTPase EngB [Streptococcus suis 98HAH33] >gi|145691491|gb|ABP91996.1| Predicted GTPase [Streptococcus suis 98HAH33] (206 aa)
Score = 237, Expect = 1.2e-18, Identities = 62/145 (42%), Positives = 86/145 (59%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           D  EI   GRSNVGKSS IN L   K +A+TS  PG+TQ  NFY+ D K R +D+PG GYAKVSK++  +  K+I EY+  R+NL  +  ++D+       D+QM + L        IV  KADK  +  ++ + + I  KL  DK +
  S:    35 DIPEIALAGRSNVGKSSFINTLLGRKNLARTSGKPGKTQQLNFYNIDDKIRFVDVPGNGYAKVSKTERAKWGKMIEEYLTTRENLRVLVSLVDMRHEPSADDVQMYDFLKYYEIPVIIVATKADKIPRGKWNKHESMIKKKLDFDKND 182
>gi|19705309|ref|NP_602804.1| GTP-binding protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|24418375|sp|Q8RHK1|ENGB_FUSNN Probable GTP-binding protein engB >gi|19713278|gb|AAL94103.1| GTP-binding protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|148322461|gb|EDK87711.1| GTP-binding protein [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (194 aa)
Score = 237, Expect = 1.2e-18, Identities = 65/160 (40%), Positives = 96/160 (60%)
  Q:     4 FIKSCFSSNDWITD-DKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           F+KS     D+    DK E  F+GRSNVGKSSLIN+L +  K+A+TS TPGRTQL N++   D+F ++DLPGYG+AKV K    +  + +  YI  ++  + VF ++DI  V +D D++M E L      + I+  K DK + +        I  +L  D E++
  S:     8 FVKSAVYEKDYPEQLDKMEFAFVGRSNVGKSSLINSLTSRLKLARTSKTPGRTQLINYFLINDEFYIVDLPGYGFAKVPKEMKKQWGQTMERYIASKRKKL-VFVLLDIRRVPSDEDIEMLEWLEYNEMDYKIIFTKIDKLSNNERAKQLKAIKTRLVFDNEDV 170
>gi|145350092|ref|XP_001419457.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144579688|gb|ABO97750.1| predicted protein [Ostreococcus lucimarinus CCE9901] (416 aa)
Score = 237, Expect = 1.2e-18, Identities = 55/124 (44%), Positives = 78/124 (62%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRF-NQHYIVLNKAD 138
           I DD  EI F GRSNVGKSSLINAL  + +A++S+ PG+TQ  NFY  D + RL+DLPGYG+A   + +    ++++ +Y+  R NL  V+ +ID    +   D +M   LS     Q  ++LNK D
  S:   102 IKDDVPEIAFAGRSNVGKSSLINALTLSSVARSSDVPGKTQSLNFYSMDERIRLVDLPGYGFAFAKQHRVESWNELMDKYLTSRPNLKRVYLVIDARHGMKASDREMLAFLSKYGETQCGVILNKCD 228
>gi|81247620|gb|ABB68328.1| conserved hypothetical protein [Shigella boydii Sb227] (199 aa)
Score = 237, Expect = 1.2e-18, Identities = 56/126 (44%), Positives = 78/126 (61%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R +L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    12 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRHSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 140
>gi|149376397|ref|ZP_01894159.1| predicted GTPase [Marinobacter algicola DG893] >gi|149359238|gb|EDM47700.1| predicted GTPase [Marinobacter algicola DG893] (212 aa)
Score = 237, Expect = 1.3e-18, Identities = 61/158 (38%), Positives = 90/158 (56%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK--ENIVCVSAKNKTNI 174
           D   E+ F GRSN GKSS IN +  N K+A+TS TPGRT+L NF+  ++   RL+DLPGYGYAKVS+    +  + +  Y+  R+ L  +  ++DI   +TD D  M E   +      I+  KADK            I+ KL+  +  E+++  SA +K  +
  S:    34 DHGSEVAFAGRSNAGKSSAINCITTNGKLARTSKTPGRTRLINFFSLNRENCRLVDLPGYGYAKVSRDMKDDWQQHLGHYLNDRRCLRGLVLVMDIRHPLTDFDQMMVEWCEHNNLPLMILATKADKLKFGQAKTAMMGISKKLEAFQCVEHLIMFSATSKRGV 197
>gi|195952762|ref|YP_002121052.1| small GTP-binding protein [Hydrogenobaculum sp. Y04AAS1] >gi|195932374|gb|ACG57074.1| small GTP-binding protein [Hydrogenobaculum sp. Y04AAS1] (184 aa)
Score = 237, Expect = 1.3e-18, Identities = 66/164 (40%), Positives = 94/164 (57%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLR-KNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           DK  I   GRSNVGKSSLINA+AN KIA+ S  PG T   NFY  +   ++D PGYGYAK SK +    + II+++I    +N++ VF +ID  V  T+LD  + + L ++     +VL K DK  +    N       +LK   +NI+  S+K+   I  LK ++
  S:    14 DKPCILLTGRSNVGKSSLINAIANTKIARVSKDPGLTATLNFYIEENIYIVDTPGYGYAKRSKEERNRWANIINDFIENHGENILCVFALIDSVVGPTELDTMLIDYLDSKSLNTMLVLTKIDKATQKELANTL----NRLKAFDKNIIQTSSKDGIGIKQLKAIM 175
>gi|159042882|ref|YP_001531676.1| GTPase EngB [Dinoroseobacter shibae DFL 12] >gi|157910642|gb|ABV92075.1| GTP-binding protein HSR1-related [Dinoroseobacter shibae DFL 12] (217 aa)
Score = 237, Expect = 1.4e-18, Identities = 59/156 (37%), Positives = 89/156 (57%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++   + R L+D+PGYG+A+   +   +   ++  Y+  R  L   F +ID    I  +D ++  LL        +VL KADK   +  D   A++  +L +
  S:    29 TFLKGVVAMSGLPPADRLEVCFAGRSNVGKSSLINALTGRKALARTSNTPGRTQEINYFCLGEDRYLVDVPGYGFAEAPVAVVQKWQALLKAYLTGRPTLRRAFVLIDARHGIKAVDHEIMSLLDTAAVTFQVVLTKADKIKTAEQDKTLAQVRKELAR 187
>gi|161984817|ref|YP_410156.2| GTPase EngB [Shigella boydii Sb227] >gi|119369256|sp|Q31UD0|ENGB_SHIBS Probable GTP-binding protein engB (210 aa)
Score = 236, Expect = 1.5e-18, Identities = 56/126 (44%), Positives = 78/126 (61%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R +L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    23 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRHSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLA 151
>gi|34762743|ref|ZP_00143732.1| GTP-binding protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887593|gb|EAA24673.1| GTP-binding protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (194 aa)
Score = 236, Expect = 1.6e-18, Identities = 65/160 (40%), Positives = 96/160 (60%)
  Q:     4 FIKSCFSSNDWITD-DKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           F+KS     D+    DK E  F+GRSNVGKSSLIN+L +  K+A+TS TPGRTQL N++   D+F ++DLPGYG+AKV K    +  + +  YI  ++  + VF ++DI  V +D D++M E L      + I+  K DK + +        I  +L  D E++
  S:     8 FVKSAVYEKDYPEQLDKMEFAFVGRSNVGKSSLINSLTSRLKLARTSKTPGRTQLINYFLINDEFYIVDLPGYGFAKVPKEMKKQWGQTMERYIASKRKKL-VFVLLDIRRVPSDEDIEMLEWLEYNDMDYKIIFTKIDKLSNNERAKQLKAIKTRLVFDNEDV 170
>gi|99080146|ref|YP_612300.1| GTPase EngB [Silicibacter sp. TM1040] >gi|119369260|sp|Q1GJX8|ENGB_SILST Probable GTP-binding protein engB >gi|99036426|gb|ABF63038.1| GTP-binding [Silicibacter sp. TM1040] (216 aa)
Score = 236, Expect = 1.6e-18, Identities = 63/179 (35%), Positives = 96/179 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY-DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIG 182
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+    +  L+DLPGYGYA    +   +  +++ +Y+  R+ L   F +ID    +  +D ++ +LL        +V+ KADK  +        ++   L K       IV  S++    I  L+ +I 
  S:    29 FLKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINFFTQGPELYLVDLPGYGYANAPLAVVEKWQRLLKQYLSGRQTLRRAFVLIDTRHGVKKVDEEIMKLLDTSAVTFQVVMTKADKVKEKDRAKILDQVRDALSKHPAAYPEIVLTSSEKGDGIATLRSIIA 213
>gi|153893791|ref|ZP_02014410.1| GTP-binding protein HSR1-related [Opitutaceae bacterium TAV2] >gi|151580136|gb|EDN44070.1| GTP-binding protein HSR1-related [Opitutaceae bacterium TAV2] (213 aa)
Score = 236, Expect = 1.7e-18, Identities = 57/166 (34%), Positives = 96/166 (57%)
  Q:    20 KEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN---FAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           +E  FIGRSNVGKSSL+N L   K +AK S TPG+T++ NF+  +  + L+DLPGYG+AKV++ K  + ++ ++ Y+  R NL  VF +ID  +    +DL   + L        ++  K DK++ +        F +  A+ + +   I+  S+K K+    + + I  ++
  S:    40 REFAFIGRSNVGKSSLLNLLTEQKDLAKVSATPGKTRMINFFKINNAWSLVDLPGYGFAKVAQHKRSDFNQAVARYLEKRDNLACVFVLIDSRLPPQQIDLDFIQWLEGTGRPFALIFTKTDKQSPTQTRAKISLFTEALAEWRTEPPPILTSSSKTKSGRREILEFIAGML 211
>gi|149186359|ref|ZP_01864672.1| GTP-binding protein [Erythrobacter sp. SD-21] >gi|148829948|gb|EDL48386.1| GTP-binding protein [Erythrobacter sp. SD-21] (217 aa)
Score = 236, Expect = 1.7e-18, Identities = 58/138 (42%), Positives = 82/138 (59%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDF---DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           EI F GRSNVGKSSL+NAL    KIA+ S TPGRTQ  NF++     +FRL+D+PGYG+AK       +   ++  Y+  R+ LV    ++D    + D+D +M ++L      + +VL KADK   S      A + A+ KK
  S:    43 EIAFAGRSNVGKSSLLNALTGRRKIARASVTPGRTQELNFFEVGEPTQFRLVDMPGYGFAKAPVKVVEKWKNLVKTYLRGRQVLVRNLVLVDSRHGLKDVDREMMKMLDEAAVGYRVVLTKADKIKASELAKTVAAVEAEAKK 185
>gi|116492901|ref|YP_804636.1| GTPase EngB [Pediococcus pentosaceus ATCC 25745] >gi|122265635|sp|Q03F28|ENGB_PEDPA Probable GTP-binding protein engB >gi|116103051|gb|ABJ68194.1| Predicted GTPase [Pediococcus pentosaceus ATCC 25745] (195 aa)
Score = 236, Expect = 1.7e-18, Identities = 60/139 (43%), Positives = 83/139 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           EI  +GRSNVGKSSL N L N K  A+TS+ PG+TQ  NFY   D+   +D+PGYGYAKVS+ +  +  K+I +YI  RK L  V  ++D     TD D+ M + L        +V  K+DK A+  ++ + +KI   L  D
  S:    25 EIALVGRSNVGKSSLTNTLINRKSYARTSSQPGKTQTLNFYRVEDQLFFVDVPGYGYAKVSQKEREKWGKMIEKYITSRKELKGVISLVDARHEPTDDDITMYQYLRYYDIPVLVVATKSDKIARGKWNQHESKIKKALDFD 166
>gi|190149362|ref|YP_001967887.1| putative GTP-binding protein EngB [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189914493|gb|ACE60745.1| putative GTP-binding protein EngB [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (180 aa)
Score = 236, Expect = 1.8e-18, Identities = 56/123 (45%), Positives = 78/123 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  V  ++DI   + DLD QM E   +      ++L KADK ++S
  S:     2 EIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRECLRGVVILMDIRHPLKDLDQQMIEWAVSAQLPVLLLLTKADKLSQS 127
>gi|145300976|ref|YP_001143817.1| GTP binding protein [Aeromonas salmonicida subsp. salmonicida A449] >gi|166225938|sp|A4ST47|ENGB_AERS4 Probable GTP-binding protein engB >gi|142853748|gb|ABO92069.1| GTP binding protein [Aeromonas salmonicida subsp. salmonicida A449] (217 aa)
Score = 236, Expect = 1.8e-18, Identities = 57/136 (41%), Positives = 82/136 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKI 152
           D   EI F GRSN GKSS +N L   K +A+TS TPGRTQL N ++ +   RL+DLPGYGYA+V      +  K ++EY+  R++L  +  ++DI   + D D+ M E  S+R     ++L KADK +    +N   K+
  S:    26 DGGVEIAFAGRSNAGKSSALNTLTKHKNLARTSKTPGRTQLINLFELEPGKRLVDLPGYGYAQVPLEMKLKWQKSLAEYLQRRESLKGLVILMDIRHPLKDTDMNMLEWSSHRELPVMLLLTKADKLSPGPRNNQVIKV 164
>gi|15838031|ref|NP_298719.1| GTPase EngB [Xylella fastidiosa 9a5c] >gi|9106445|gb|AAF84239.1|AE003973_7 GTP-binding protein [Xylella fastidiosa 9a5c] (229 aa)
Score = 236, Expect = 1.8e-18, Identities = 62/178 (34%), Positives = 91/178 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLI 181
           ++ S  +++    DD  E+ F GRSN GKSS++N L     +A+ S TPGRTQ   ++     R L+DLPGYGYAKV K         I  Y + R+ L  +  ++DI   + + DLQM      R      +L KADK  +        K+  +L K   D  NI   S+K++  +  L  +I
  S:    36 YLLSAHTTHQLPADDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVTPQRYLVDLPGYGYAKVPKELQIHWQTFIDSYFHQRQALRGLVVVMDIRHPLKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLHTVI 219
>gi|13124224|sp|Q9PDE9|ENGB_XYLFA Probable GTP-binding protein engB (203 aa)
Score = 236, Expect = 1.8e-18, Identities = 62/178 (34%), Positives = 91/178 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLI 181
           ++ S  +++    DD  E+ F GRSN GKSS++N L     +A+ S TPGRTQ   ++     R L+DLPGYGYAKV K         I  Y + R+ L  +  ++DI   + + DLQM      R      +L KADK  +        K+  +L K   D  NI   S+K++  +  L  +I
  S:    10 YLLSAHTTHQLPADDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVTPQRYLVDLPGYGYAKVPKELQIHWQTFIDSYFHQRQALRGLVVVMDIRHPLKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLHTVI 193
>gi|114049482|ref|YP_740032.1| GTPase EngB [Shewanella sp. MR-7] >gi|119369255|sp|Q0HPI0|ENGB_SHESR Probable GTP-binding protein engB >gi|113890924|gb|ABI44975.1| GTP-binding protein [Shewanella sp. MR-7] (219 aa)
Score = 236, Expect = 1.8e-18, Identities = 56/123 (45%), Positives = 77/123 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ D + RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E           +L K+DK A+S
  S:    34 EIAFAGRSNAGKSSALNALTEQKNLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAQVPLAMKLKWQQSLGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQS 159
>gi|113972233|ref|YP_736026.1| GTPase EngB [Shewanella sp. MR-4] >gi|117922541|ref|YP_871733.1| GTPase EngB [Shewanella sp. ANA-3] >gi|166225983|sp|A0L2Q8|ENGB_SHESA Probable GTP-binding protein engB >gi|119369254|sp|Q0HD98|ENGB_SHESM Probable GTP-binding protein engB >gi|113886917|gb|ABI40969.1| GTP-binding [Shewanella sp. MR-4] >gi|117614873|gb|ABK50327.1| GTP-binding [Shewanella sp. ANA-3] (219 aa)
Score = 236, Expect = 1.8e-18, Identities = 56/123 (45%), Positives = 77/123 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ D + RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E           +L K+DK A+S
  S:    34 EIAFAGRSNAGKSSALNALTEQKNLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAQVPLAMKLKWQQSLGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQS 159
>gi|182681243|ref|YP_001829403.1| GTP-binding protein HSR1-related [Xylella fastidiosa M23] >gi|182631353|gb|ACB92129.1| GTP-binding protein HSR1-related [Xylella fastidiosa M23] (219 aa)
Score = 235, Expect = 1.9e-18, Identities = 62/178 (34%), Positives = 92/178 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLI 181
           ++ S  + +   +DD  E+ F GRSN GKSS++N L     +A+ S TPGRTQ   ++     R L+DLPGYGYAKV K         I  Y + R++L  +  ++DI   + + DLQM      R      +L KADK  +        K+  +L K   D  NI   S+K++  +  L  +I
  S:    26 YLLSAHTPHQLPSDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVTPQRYLVDLPGYGYAKVPKELQIHWQAFIDTYFHHRQSLRGLVVVMDIRHPLKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLHTVI 209
>gi|28198564|ref|NP_778878.1| GTPase EngB [Xylella fastidiosa Temecula1] >gi|32129522|sp|Q87DM6|ENGB_XYLFT Probable GTP-binding protein engB >gi|28056648|gb|AAO28527.1| GTP-binding protein [Xylella fastidiosa Temecula1] (203 aa)
Score = 235, Expect = 1.9e-18, Identities = 62/178 (34%), Positives = 92/178 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLI 181
           ++ S  + +   +DD  E+ F GRSN GKSS++N L     +A+ S TPGRTQ   ++     R L+DLPGYGYAKV K         I  Y + R++L  +  ++DI   + + DLQM      R      +L KADK  +        K+  +L K   D  NI   S+K++  +  L  +I
  S:    10 YLLSAHTPHQLPSDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVTPQRYLVDLPGYGYAKVPKELQIHWQAFIDTYFHHRQSLRGLVVVMDIRHPLKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLHTVI 193
>gi|118444919|ref|YP_878859.1| GTPase EngB [Clostridium novyi NT] >gi|166225951|sp|A0Q2K7|ENGB_CLONN Probable GTP-binding protein engB >gi|118135375|gb|ABK62419.1| GTP-binding protein [Clostridium novyi NT] (200 aa)
Score = 235, Expect = 1.9e-18, Identities = 66/183 (36%), Positives = 106/183 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           FI S    + +  D++ E+ F+GRSN GKSSLIN + N  K+AKTS+TPG+T+  NF+  + +F  +DLPGYG+AKVSKS+  +   ++ +Y+  R  L  +  ++D     +  D+QM E +     +  IV  K+DK  K+ F  N   I   L  +D++  +  S+ NK+    L +++   I 
  S:     8 FIISAVRPSQYPVDNRVEMAFVGRSNAGKSSLINVITNRRKLAKTSSTPGKTRQINFFLINNEFYFVDLPGYGFAKVSKSEQQKWGSMMEQYLINRHQLKKIVLLVDSRHKPSKEDVQMYEWIKYYGYETIIVATKSDKLRKNDFQKNRKIIKETLNIRDEDKFMFFSSLNKSGKEELLEILSEGIF 194
>gi|116059441|emb|CAL55148.1| Predicted GTPase (ISS) [Ostreococcus tauri] (444 aa)
Score = 235, Expect = 1.9e-18, Identities = 53/124 (42%), Positives = 78/124 (62%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRF-NQHYIVLNKAD 138
           I DD  EI F GRSNVGKSSLINAL  + +A++S+ PG+TQ  NFY   ++ RL+DLPGYG+A   +++    ++++  Y+  R NL  V+ ++D    +   D +M   LS     Q  ++LNK D
  S:   158 IKDDVPEIAFAGRSNVGKSSLINALTLSSVARSSDVPGKTQSLNFYSLGERIRLVDLPGYGFAFAKQARVETWNELMDRYLTSRPNLKRVYIVVDARHGLKASDREMLAFLSKYGETQCAVILNKCD 284
>gi|126646524|ref|ZP_01719041.1| GTP-binding protein [Algoriphagus sp. PR1] >gi|126578156|gb|EAZ82376.1| GTP-binding protein [Algoriphagus sp. PR1] (203 aa)
Score = 235, Expect = 2.1e-18, Identities = 60/139 (43%), Positives = 83/139 (59%)
  Q:    18 DKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           D+ EI FIGRSNVGKSSLIN L   + +AKTS  PG+TQL N F   +K+ L+DLPGYG+AK++         +IS Y+  R+NL  VF +ID  +    +DL+             +V  KADK++K+  + N  K   K+
  S:    21 DRAEIAFIGRSNVGKSSLINMLTGKSGLAKTSQKPGKTQLINHFMINEKWYLVDLPGYGFAKINVKVKQGWESMISTYLTKRENLCGVFVLIDSRLEPQKIDLEFLYWCGTEGVPAVLVFTKADKQSKNKTNQNIQKFLKKM 162
>gi|157147356|ref|YP_001454675.1| hypothetical protein CKO_03149 [Citrobacter koseri ATCC BAA-895] >gi|157084561|gb|ABV14239.1| hypothetical protein CKO_03149 [Citrobacter koseri ATCC BAA-895] (198 aa)
Score = 235, Expect = 2.1e-18, Identities = 55/126 (43%), Positives = 79/126 (62%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  +  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM +       Q  ++L KADK A
  S:    11 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVEGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIQWAVESNIQVLVLLTKADKLA 139
>gi|15606865|ref|NP_214245.1| hypothetical protein aq_1815 [Aquifex aeolicus VF5] >gi|6226469|sp|O67679|ENGB_AQUAE Probable GTP-binding protein engB >gi|2984110|gb|AAC07648.1| hypothetical protein aq_1815 [Aquifex aeolicus VF5] (183 aa)
Score = 235, Expect = 2.1e-18, Identities = 59/146 (40%), Positives = 87/146 (59%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRK-NLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           D  E+ F+GRSNVGKSSL+N +  +K+AK S TPGRT+  N++  D K  L+D+PGYGYAKV + +  +  K++  Y   RK N+   F +ID ++ +  LD QM E          +V+ K DK ++S       +IA  LK+ K  +
  S:    17 DYPEVVFVGRSNVGKSSLLNMVVGSKVAKVSKTPGRTRAVNYFLLDKKLYLVDVPGYGYAKVGREEMEKWRKMMERYFKERKDNIKMAFLLIDAVAGVQPLDEQMIEWFEYYGIPFTVVITKIDKASQS-------EIAKTLKQVKRYV 158
>gi|116490352|ref|YP_809896.1| GTPase [Oenococcus oeni PSU-1] >gi|122277459|sp|Q04H41|ENGB_OENOB Probable GTP-binding protein engB >gi|116091077|gb|ABJ56231.1| Predicted GTPase [Oenococcus oeni PSU-1] (198 aa)
Score = 235, Expect = 2.1e-18, Identities = 65/156 (41%), Positives = 84/156 (53%)
  Q:     2 PSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK 157
           P  I S  S   +   +  EI F+GRSNVGKSSLIN L     +A TS  PG+TQ  NFY+ D K   +D+PGYGYAKVSK++  +   ++ EY+  R  L  V  +ID     T+ D  M   L        IV  KADK A   F+   ++I   LK
  S:     6 PKLIISAVSKKQYPAGNLSEIAFVGRSNVGKSSLINTLIERNGLAHTSGQPGKTQTLNFYNLDEKLFFVDVPGYGYAKVSKAQREQFGSMVEEYLSSRDQLKGVISLIDARHEPTEDDKLMYNWLEYYQVPILIVATKADKVASGKFNAVESQIKKTLK 164
>gi|119899112|ref|YP_934325.1| GTPase EngB [Azoarcus sp. BH72] >gi|166225940|sp|A1K9D3|ENGB_AZOSB Probable GTP-binding protein engB >gi|119671525|emb|CAL95438.1| conserved hypothetical GTP-binding protein [Azoarcus sp. BH72] (209 aa)
Score = 235, Expect = 2.1e-18, Identities = 58/162 (35%), Positives = 95/162 (58%)
  Q:    21 EICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIG 182
           EI F GRSN GKSS IN LA + ++A  S TPGRTQL NF+  +    L+DLPGYGYA V +    +   +I  Y+  R++L+ +  ++D    +TDLD QM +  +      +++L K+DK ++   +     + A+L     D+ ++   S+  KT +  ++K++ 
  S:    26 EIAFAGRSNAGKSSAINTLAGHVRLAYVSKTPGRTQLINFFRLNCGALLVDLPGYGYAAVPEKIRRQWQGLIETYLRTRESLIGLVLMMDSRHPMTDLDRQMIDWFAPSGKPIHVLLTKSDKLSRGPANATLLAVRAELTARYGDQVSVQLFSSLKKTGVEEVEKVVA 193
>gi|77976789|ref|ZP_00832260.1| COG0218: Predicted GTPase [Yersinia intermedia ATCC 29909] (207 aa)
Score = 235, Expect = 2.2e-18, Identities = 55/125 (44%), Positives = 75/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM            ++L KADK A
  S:    17 DEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVDGIRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLA 144
>gi|167644607|ref|YP_001682270.1| GTPase EngB [Caulobacter sp. K31] >gi|167347037|gb|ABZ69772.1| GTP-binding protein HSR1-related [Caulobacter sp. K31] (214 aa)
Score = 235, Expect = 2.2e-18, Identities = 65/171 (38%), Positives = 94/171 (54%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFA---KIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           T D  E+ F GRSNVGKSSLIN L     +A+ SN+PGRT+  NF+   +K RL+DLPGYG+A+VSK+   +   +   Y+  R NL  V+ +ID    +  +D +  + L      + IVL KADK   +  +   A   K  AK       ++  S++    +P L+  I  V L
  S:    37 TADFPEVAFAGRSNVGKSSLINGLVGQNHLARASNSPGRTREVNFFVLAEKLRLVDLPGYGFARVSKTVADKFQDLGRAYLRGRVNLKRVYLLIDARHGLKSVDTEALDALDVAAVSYQIVLTKADKIKPAEVEAVVAATQKAIAKRPAAFPKVLATSSEKGDGLPELRAEIARVCL 213
>gi|15677644|ref|NP_274803.1| GTPase EngB [Neisseria meningitidis MC58] >gi|7227060|gb|AAF42143.1| conserved hypothetical protein [Neisseria meningitidis MC58] (211 aa)
Score = 235, Expect = 2.2e-18, Identities = 61/169 (36%), Positives = 97/169 (57%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVC--VSAKNKTNIPNLKKLIGS 183
           + D   EI F+GRSN GKSS IN L N  ++A  S TPGRTQ  NF++      ++DLPGYGYA+V ++       ++ +Y+  RK L+ +  I+D    + +LD++M +         +I+L+KADK +K+      +++   LK   D++NI     S+  K  I    + +GS
  S:    21 LPDTPLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGS 196
>gi|194684140|emb|CAR45568.1| probable GTP-binding protein [Proteus mirabilis HI4320] (207 aa)
Score = 235, Expect = 2.3e-18, Identities = 62/165 (37%), Positives = 90/165 (54%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI--VCVSAKNKTNIPNLKKLI 181
           D   EI F GRSN GKSS +NAL     +A+TS TPGRTQL N +  ++  RL+DLPGYGYA+V +    +  + + EY+  R+ L  V  ++DI   + DLD+QM +   +      ++L KADK A          +   L +   +I   C S+  K  I  L+  +
  S:    24 DTGIEIAFAGRSNAGKSSALNALTQQNGLARTSKTPGRTQLINLFQIEEGRRLVDLPGYGYAQVPEEMKRKWQRSLGEYLQKRECLKGVVILMDIRHPLKDLDMQMIDWAVDSELPTLVLLTKADKLASGARKKQLMAVQNALSEKSGDIRVECFSSLKKIGIDKLRNTL 193
>gi|24376139|ref|NP_720182.1| GTPase EngB [Shewanella oneidensis MR-1] >gi|81588968|sp|Q8E8J7|ENGB_SHEON Probable GTP-binding protein engB >gi|24351179|gb|AAN57626.1|AE015898_9 GTP-binding protein EngB [Shewanella oneidensis MR-1] (219 aa)
Score = 235, Expect = 2.3e-18, Identities = 56/123 (45%), Positives = 78/123 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ D + RL+DLPGYG+A+V  +   +  + ++EY+  R  L  V  ++DI   + DLD+QM E           +L K+DK A+S
  S:    34 EIAFAGRSNAGKSSALNALTEQKNLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAQVPLAMKMKWQQSLAEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQS 159
>gi|78484393|ref|YP_390318.1| GTP-binding protein, HSR1-related [Thiomicrospira crunogena XCL-2] >gi|119369276|sp|Q31JM9|ENGB_THICR Probable GTP-binding protein engB >gi|78362679|gb|ABB40644.1| cell division checkpoint GTPase YihA [Thiomicrospira crunogena XCL-2] (212 aa)
Score = 235, Expect = 2.3e-18, Identities = 58/150 (38%), Positives = 91/150 (60%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKI 152
           +++KS    +    D   E+ F GRSN GKSS +N + + + +AKTS TPGRTQL NF++ D+ R L+DLPGYGYAKV+ +      + +S+YI +R +L  +  ++D  +  T++DL M +         +I+L K+DK  K    N+  K+
  S:    10 TYLKSAPDLSHCPEDFGYEVAFAGRSNAGKSSALNVITSQRGLAKTSKTPGRTQLINFFECDEQRKLVDLPGYGYAKVNVNTKRAWERSLSQYIEVRSSLKGLIMMVDSRMPPTEIDLMMLDWTLTLNLPVHILLTKSDKLKKGPAQNSLLKM 162
>gi|71897603|ref|ZP_00679848.1| GTP-binding protein [Xylella fastidiosa Ann-1] >gi|71732506|gb|EAO34559.1| GTP-binding protein [Xylella fastidiosa Ann-1] (219 aa)
Score = 235, Expect = 2.3e-18, Identities = 61/166 (36%), Positives = 87/166 (52%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLI 181
           +DD  E+ F GRSN GKSS++N L     +A+ S TPGRTQ   ++     R L+DLPGYGYAKV K         I  Y + R++L  +  ++DI   + + DLQM      R      +L KADK  +        K+  +L K   D  NI   S+K++  +  L  +I
  S:    38 SDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVTPQRYLVDLPGYGYAKVPKELQIHWQAFIDTYFHHRQSLRGLVVVMDIRHPLKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHINIQTFSSKSRQGVEQLHTVI 209
>gi|167854567|ref|ZP_02477348.1| putative GTP-binding protein EngB [Haemophilus parasuis 29755] >gi|167854322|gb|EDS25555.1| putative GTP-binding protein EngB [Haemophilus parasuis 29755] (209 aa)
Score = 235, Expect = 2.3e-18, Identities = 56/127 (44%), Positives = 79/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  + + EY+  R+ L  V  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DSGVEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQVKLQWQRSLGEYLQKRECLRGVVILMDIRHPLKDLDQQMIEWAVSAKLPVLLLLTKADKLSQS 155
>gi|37524399|ref|NP_927743.1| GTPase EngB [Photorhabdus luminescens subsp. laumondii TTO1] >gi|81572743|sp|Q7N9E9|ENGB_PHOLL Probable GTP-binding protein engB >gi|36783823|emb|CAE12685.1| Probable GTP-binding protein engB [Photorhabdus luminescens subsp. laumondii TTO1] (210 aa)
Score = 235, Expect = 2.4e-18, Identities = 60/152 (39%), Positives = 85/152 (55%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKI 152
           M  FI S         D   E+ F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ ++  RL+DLPGYGYA+V +    +  K + EY+  R+ L+ +  ++DI   + DLD QM +          ++L KADK A     +   K+
  S:    10 MTRFITSAPDIRHLPQDMGIEVAFAGRSNAGKSSALNALTKQKSLARTSKTPGRTQLINLFEVEEGIRLVDLPGYGYAEVPEEMKRKWQKALGEYLQKRECLIGLVVLMDIRHPLKDLDQQMIQWAVAMQVPVMVLLTKADKLASGARKSQLNKV 164
>gi|149278824|ref|ZP_01884959.1| GTPase EngB [Pedobacter sp. BAL39] >gi|149230443|gb|EDM35827.1| GTPase EngB [Pedobacter sp. BAL39] (209 aa)
Score = 234, Expect = 2.6e-18, Identities = 62/136 (45%), Positives = 81/136 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           E  FIGRSNVGKSSLIN L N   +AKTS  PG+TQL N F   +K+ ++DLPGYGYAKVSK+   +  K I  YI  R++L  VF +ID  +    +DL+    +        ++  KADK++K   D N A     L
  S:    25 EYAFIGRSNVGKSSLINMLVNQHGLAKTSQRPGKTQLINHFLINEKWYIVDLPGYGYAKVSKNSREKWEKFIRNYITKRESLQCVFVLIDSRLEPQKIDLEFCCWMGEIQIPFALIFTKADKQSKVKTDQNVAAFKKAL 163
>gi|162420510|ref|YP_001604665.1| GTPase EngB [Yersinia pestis Angola] >gi|162353325|gb|ABX87273.1| putative GTP-binding protein EngB [Yersinia pestis Angola] (216 aa)
Score = 234, Expect = 2.7e-18, Identities = 55/125 (44%), Positives = 75/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM            ++L KADK A
  S:    26 DEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLA 153
>gi|16120372|ref|NP_403685.1| GTPase EngB [Yersinia pestis CO92] >gi|22127680|ref|NP_671103.1| GTPase EngB [Yersinia pestis KIM] >gi|45439885|ref|NP_991424.1| GTPase EngB [Yersinia pestis biovar Microtus str. 91001] >gi|51594377|ref|YP_068568.1| GTPase EngB [Yersinia pseudotuberculosis IP 32953] >gi|108809514|ref|YP_653430.1| GTPase EngB [Yersinia pestis Antiqua] >gi|108810412|ref|YP_646179.1| GTPase EngB [Yersinia pestis Nepal516] >gi|145601125|ref|YP_001165201.1| GTPase EngB [Yersinia pestis Pestoides F] >gi|150260917|ref|ZP_01917645.1| GTP-binding protein [Yersinia pestis CA88-4125] >gi|153948718|ref|YP_001399023.1| GTPase EngB [Yersinia pseudotuberculosis IP 31758] >gi|165926064|ref|ZP_02221896.1| putative GTP-binding protein EngB [Yersinia pestis biovar Orientalis str. F1991016] >gi|165940208|ref|ZP_02228738.1| putative GTP-binding protein EngB [Yersinia pestis biovar Orientalis str. IP275] >gi|166011511|ref|ZP_02232409.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213756|ref|ZP_02239791.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402124|ref|ZP_02307601.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167418997|ref|ZP_02310750.1| putative GTP-binding protein EngB [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167427046|ref|ZP_02318799.1| putative GTP-binding protein EngB [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170026401|ref|YP_001722906.1| GTP-binding protein HSR1-related [Yersinia pseudotuberculosis YPIII] >gi|186893364|ref|YP_001870476.1| GTP-binding protein HSR1-related [Yersinia pseudotuberculosis PB1/+] >gi|166232163|sp|A4TSG6|ENGB_YERPP Probable GTP-binding protein engB >gi|166920115|sp|A7FCP5|ENGB_YERP3 Probable GTP-binding protein engB >gi|24418384|sp|Q8ZJS0|ENGB_YERPE Probable GTP-binding protein engB >gi|81640846|sp|Q66GG3|ENGB_YERPS Probable GTP-binding protein engB >gi|119369282|sp|Q1C237|ENGB_YERPA Probable GTP-binding protein engB >gi|119369283|sp|Q1CN51|ENGB_YERPN Probable GTP-binding protein engB >gi|21960796|gb|AAM87354.1|AE013983_7 hypothetical protein y3809 [Yersinia pestis KIM] >gi|45434740|gb|AAS60301.1| Predicted GTPases [Yersinia pestis biovar Microtus str. 91001] >gi|51587659|emb|CAH19259.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] >gi|108774060|gb|ABG16579.1| cell division checkpoint GTPase YihA [Yersinia pestis Nepal516] >gi|108781427|gb|ABG15485.1| cell division checkpoint GTPase YihA [Yersinia pestis Antiqua] >gi|115345851|emb|CAL18709.1| conserved hypothetical protein [Yersinia pestis CO92] >gi|145212821|gb|ABP42228.1| cell division checkpoint GTPase YihA [Yersinia pestis Pestoides F] >gi|149290325|gb|EDM40402.1| GTP-binding protein [Yersinia pestis CA88-4125] >gi|152960213|gb|ABS47674.1| putative GTP-binding protein EngB [Yersinia pseudotuberculosis IP 31758] >gi|165911840|gb|EDR30487.1| putative GTP-binding protein EngB [Yersinia pestis biovar Orientalis str. IP275] >gi|165921924|gb|EDR39101.1| putative GTP-binding protein EngB [Yersinia pestis biovar Orientalis str. F1991016] >gi|165989657|gb|EDR41958.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205158|gb|EDR49638.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962991|gb|EDR59012.1| putative GTP-binding protein EngB [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048499|gb|EDR59907.1| putative GTP-binding protein EngB [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167053973|gb|EDR63804.1| putative GTP-binding protein EngB [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752935|gb|ACA70453.1| GTP-binding protein HSR1-related [Yersinia pseudotuberculosis YPIII] >gi|186696390|gb|ACC87019.1| GTP-binding protein HSR1-related [Yersinia pseudotuberculosis PB1/+] (216 aa)
Score = 234, Expect = 2.7e-18, Identities = 55/125 (44%), Positives = 75/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM            ++L KADK A
  S:    26 DEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLA 153
>gi|77956892|ref|ZP_00820966.1| COG0218: Predicted GTPase [Yersinia bercovieri ATCC 43970] (208 aa)
Score = 234, Expect = 2.7e-18, Identities = 55/125 (44%), Positives = 75/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM            ++L KADK A
  S:    17 DEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLA 144
>gi|148377409|ref|YP_001256285.1| GTPase EngB [Mycoplasma agalactiae PG2] >gi|148291455|emb|CAL58840.1| GTP-binding protein engB [Mycoplasma agalactiae PG2] (194 aa)
Score = 234, Expect = 2.7e-18, Identities = 66/177 (37%), Positives = 98/177 (55%)
  Q:     1 MPSFIKSCFSSNDWIT-DDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKAD----KEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNL 177
           M  F+KS      W+  +D  +ICF GRSNVGKSSL+NAL N KI+  S  PGRTQ  N++  +   ++DLPGYGYA++SK K  E++  IS ++   K    +F +ID    IT +DL+    L       +++  K D    KE  +    +   + + L  +  N   VS+ NK  + +L
  S:     1 MWKFVKSALKKETWVKCEDCIQICFWGRSNVGKSSLLNALVNQKISYVSKQPGRTQFINYFQEENRFIVDLPGYGYAQLSKEKIEEMNYWISAFLKDDKCTKVMFLLIDSRTGITKIDLEKLAFLKAINLPIHLIYTKIDKLNQKEKSALVKKHNEYLDSNLLNESTNSFLVSSTNKIGLDDL 183
>gi|33151575|ref|NP_872928.1| GTPase EngB [Haemophilus ducreyi 35000HP] >gi|71151867|sp|Q7VNY0|ENGB_HAEDU Probable GTP-binding protein engB >gi|33147795|gb|AAP95317.1| conserved possible cell division GTP-binding protein [Haemophilus ducreyi 35000HP] (210 aa)
Score = 234, Expect = 2.7e-18, Identities = 55/123 (44%), Positives = 77/123 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D+  EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ + + +L+DLPGYGYA V +    +  K + EY+  R  L  +  ++DI   + DLD QM E   +      ++L KADK
  S:    28 DNGIEIAFAGRSNAGKSTALNALTNQKSLARTSKTPGRTQLINLFEVEPQCKLVDLPGYGYAAVPEQMKLQWQKALGEYLQKRDCLAGIVILMDIRHPLKDLDQQMIEWAVSAQLPVLLLLTKADK 153
>gi|59800561|ref|YP_207273.1| GTPase EngB [Neisseria gonorrhoeae FA 1090] >gi|59717456|gb|AAW88861.1| putative GTPase [Neisseria gonorrhoeae FA 1090] (211 aa)
Score = 234, Expect = 2.8e-18, Identities = 61/169 (36%), Positives = 97/169 (57%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVC--VSAKNKTNIPNLKKLIGS 183
           + D   EI F+GRSN GKSS IN L N  ++A  S TPGRTQ  NF++      ++DLPGYGYA+V ++       ++ +Y+  RK L+ +  I+D    + +LD++M +         +I+L+KADK +K+      +++   LK   D++NI     S+  K  I    + +GS
  S:    21 LPDTPLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKQLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGS 196
>gi|167751031|ref|ZP_02423158.1| hypothetical protein EUBSIR_02016 [Eubacterium siraeum DSM 15702] >gi|167655949|gb|EDS00079.1| hypothetical protein EUBSIR_02016 [Eubacterium siraeum DSM 15702] (206 aa)
Score = 234, Expect = 2.8e-18, Identities = 58/125 (46%), Positives = 76/125 (60%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           +K EI F GRSNVGKSSLIN + N K +A+ S+ PG+T   NFY  D     DLPGYGYAKVSKS+    + ++  Y+   +NL  VFQ++D     T  D+ M   L +      +VL KADK +K
  S:    22 EKAEIAFSGRSNVGKSSLINKILNRKSLARVSSMPGKTVTINFYSVDNIYFADLPGYGYAKVSKSEKQRWAGLVEGYLADDRNLTLVFQLVDFRHPPTADDVMMINFLIDNGIPFVVVLTKADKLSK 148
>gi|126737053|ref|ZP_01752788.1| GTP-binding protein [Roseobacter sp. SK209-2-6] >gi|126721638|gb|EBA18341.1| GTP-binding protein [Roseobacter sp. SK209-2-6] (216 aa)
Score = 234, Expect = 2.8e-18, Identities = 66/181 (36%), Positives = 97/181 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK---EAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++    D F L+DLPGYGYA        +  K++  Y+  R+ L   F +ID    + ++D ++ +LL +       V+ KADK   + +        K  A+       IV  S++    I  L+ LI  +
  S:    29 FVKGVVAMSGLPEADRMEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYFTQGPDLF-LVDLPGYGYANAPLPVVEKWQKLLKRYLSGRQTLRRAFVLIDSRHGVKEVDEEIMKLLDSAAVTFQCVMTKADKVKVKDREKVLEQVRKALARHPAAYPEIVLTSSEKGDGIATLRALIAGI 215
>gi|89053125|ref|YP_508576.1| GTPase EngB [Jannaschia sp. CCS1] >gi|119369206|sp|Q28UR1|ENGB_JANSC Probable GTP-binding protein engB >gi|88862674|gb|ABD53551.1| GTP-binding [Jannaschia sp. CCS1] (218 aa)
Score = 234, Expect = 2.8e-18, Identities = 63/181 (34%), Positives = 94/181 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYD-FDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKS+LINAL   K +A+ SNTPGRTQ  N++   D   L+DLPGYGYA+       +   ++  Y+  R  L   F +ID    +  +D ++ +LL         VL K+DK      D + A+    L         I+  S++    IP L+  I ++
  S:    30 FLKGVVAMDGLPPADRIEVCFAGRSNVGKSTLINALTGRKGLARASNTPGRTQEINYFTLLDSHYLVDLPGYGYAEAPLHVVQQWQALLKSYLQGRATLRRAFVLIDARHGVKAVDEEIMKLLDIAAVPFQTVLTKSDKVKGRDRDASLARTRKALANHPAAYPEIILTSSEKGDGIPTLRATIATI 216
>gi|71906265|ref|YP_283852.1| cell division checkpoint GTPase YihA [Dechloromonas aromatica RCB] >gi|119369189|sp|Q47IE9|ENGB_DECAR Probable GTP-binding protein engB >gi|71845886|gb|AAZ45382.1| cell division checkpoint GTPase YihA [Dechloromonas aromatica RCB] (220 aa)
Score = 234, Expect = 2.9e-18, Identities = 57/142 (40%), Positives = 85/142 (59%)
  Q:     1 MPSFIKSCFSSN-----DWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           MP F K+ F +      D   D  +E+ F GRSN GKSS IN LA   ++A  S TPGRTQ  N++  D+ +  +DLPGYGYAK  ++   +   +I  Y+  R  L  +  I+DI   +TDLDL++ +         +I+L+K+DK ++
  S:     1 MPLFQKAVFLTTVANLRDLPQDSVREVAFAGRSNAGKSSAINTLAGRVRLAFVSKTPGRTQHLNYFTLDEGKYFVDLPGYGYAKAPEAIRSQWEGLIGPYLSKRDQLAGLVVIMDIRRPMTDLDLRLIDWFRPTGRPIHILLSKSDKLSR 150
>gi|114569008|ref|YP_755688.1| GTPase EngB [Maricaulis maris MCS10] >gi|119369211|sp|Q0ASI7|ENGB_MARMM Probable GTP-binding protein engB >gi|114339470|gb|ABI64750.1| GTP-binding [Maricaulis maris MCS10] (191 aa)
Score = 234, Expect = 2.9e-18, Identities = 52/122 (42%), Positives = 78/122 (63%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD--KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D+ E+ F GRSNVGKSSLINAL N K +A+ S  PGRT+  NF++ +    R++DLPGYGYAK  K    + +++   ++  R NL  V+ +ID    + D+DL++ ++       + +VL K DK
  S:    13 DRLEVAFAGRSNVGKSSLINALTNQKGLARASGEPGRTRELNFFNVEGGDLRIVDLPGYGYAKAPKPVVEKWTRLTKAFLRGRVNLKRVYLLIDSRHGLKDVDLKIMDVFDEAAVSYQVVLTKTDK 138
>gi|139438420|ref|ZP_01771936.1| Hypothetical protein COLAER_00926 [Collinsella aerofaciens ATCC 25986] >gi|133775959|gb|EBA39779.1| Hypothetical protein COLAER_00926 [Collinsella aerofaciens ATCC 25986] (196 aa)
Score = 234, Expect = 3.0e-18, Identities = 61/166 (36%), Positives = 95/166 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLS-NRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           E+ F+GRSNVGKSS++N L   K + K S+TPG+T   NF++ D    +DLPGYG+A+ SK++    +++I ++    ++   V  ++DI    + LD  M + L  N FN   + L KADK +++      A I  +L    EN++  S++  T I  LKK I    L
  S:    29 EVSFVGRSNVGKSSIMNKLFGRKNLVKVSSTPGKTSNINFFEADDVHFVDLPGYGFARRSKAERDRWAELIGDFFDSERSFNLVVSLVDIRHDPSKLDHDMIDYLQGNEFN-FIVCLTKADKLSRTQQARQAAAIKKQLNVPAENVIITSSQTGTGIDELKKRIAEACL 196
>gi|1914833|gb|AAB52537.1| hypothetical GTPase [Neisseria gonorrhoeae] (211 aa)
Score = 234, Expect = 3.0e-18, Identities = 61/169 (36%), Positives = 97/169 (57%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVC--VSAKNKTNIPNLKKLIGS 183
           + D   EI F+GRSN GKSS IN L N  ++A  S TPGRTQ  NF++      ++DLPGYGYA+V ++       ++ +Y+  RK L+ +  I+D    + +LD++M +         +I+L+KADK +K+      +++   LK   D++NI     S+  K  I    + +GS
  S:    21 LPDTPLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKELIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGS 196
>gi|196185384|gb|EDX80360.1| GTPase, putative [Brevundimonas sp. BAL3] (217 aa)
Score = 234, Expect = 3.1e-18, Identities = 57/125 (45%), Positives = 76/125 (60%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           D  EI F GRSNVGKSSLIN L    K+A+ SN PGRT+  NF+D D + RL+DLPGYG+AK SK+   +   +  +Y+  R  L  V+ +ID    +  +D +  + L      + IVL KADK  K
  S:    39 DLPEIAFAGRSNVGKSSLINGLVGMHKLARASNEPGRTREVNFFDLDGRMRLVDLPGYGWAKASKTTVRKFQDLGRDYLRGRVTLKRVYLLIDSRHGLKSVDKEALDALDLAAVSYQIVLTKADKLKK 166
>gi|188590593|ref|YP_001921995.1| GTP-binding protein [Clostridium botulinum E3 str. Alaska E43] >gi|188500874|gb|ACD54010.1| GTP-binding protein [Clostridium botulinum E3 str. Alaska E43] (198 aa)
Score = 234, Expect = 3.1e-18, Identities = 66/159 (41%), Positives = 92/159 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           FI S    + +  D++ E+ F+GRSNVGKSSLIN+L N  K+AK S TPG+T+L NF+  +  F L+DLPGYGYAKVSKS+     K I  Y+  R+ L  +  ++D     T  D+ M E   +      IV  K+DK   + F  +   I   LK  K++
  S:     8 FIISAVKPHQYPIDNRNEVAFVGRSNVGKSSLINSLTNRKKLAKVSGTPGKTRLINFFLINNDFYLVDLPGYGYAKVSKSEKDTWGKTIETYLSHREELKRIVCLVDSRHKPTGDDIMMYEWAKHFGYDVVIVATKSDKLKNAEFKKSEKLIRDTLKLTKDD 169
>gi|119369192|sp|Q0TAJ6|ENGB_ECOL5 Probable GTP-binding protein engB (210 aa)
Score = 234, Expect = 3.1e-18, Identities = 55/126 (43%), Positives = 78/126 (61%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM E   +      ++L K DK A
  S:    23 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKTDKLA 151
>gi|83859292|ref|ZP_00952813.1| GTP-binding protein [Oceanicaulis alexandrii HTCC2633] >gi|83852739|gb|EAP90592.1| GTP-binding protein [Oceanicaulis alexandrii HTCC2633] (192 aa)
Score = 234, Expect = 3.1e-18, Identities = 61/164 (37%), Positives = 87/164 (53%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSV 184
           E+ F GRSNVGKSSLINAL   K +A+ S  PGRT+  NF+D   + R++DLPGYG+AK  K      +++   Y+  R NL  VF +ID    I   D  + ++L +    + IVL K DK   S       +  AK+ +       +SA +      L +L G +
  S:    17 EVAFAGRSNVGKSSLINALTGRKQLARASTEPGRTRELNFFDMHGRLRIVDLPGYGFAKAPKEVAARWTRLTQNYLRGRVNLKRVFLLIDSRHGIKPSDEAIMKVLDSAAVVYQIVLTKTDKLKPSEAQKRLEETQAKVARRPAAFPVISATSSAKRDGLDELRGEI 183
>gi|77960491|ref|ZP_00824360.1| COG0218: Predicted GTPase [Yersinia mollaretii ATCC 43969] (207 aa)
Score = 234, Expect = 3.1e-18, Identities = 55/125 (44%), Positives = 75/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM            ++L KADK A
  S:    17 DEGIEVAFAGRSNAGKSSALNTLTNQKGLARTSKTPGRTQLINLFEVVDGVRLVDLPGYGYAEVPEEMKIKWQRALGEYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLA 144
>gi|163757862|ref|ZP_02164951.1| GTPase EngB [Hoeflea phototrophica DFL-43] >gi|162285364|gb|EDQ35646.1| GTPase EngB [Hoeflea phototrophica DFL-43] (225 aa)
Score = 233, Expect = 3.2e-18, Identities = 64/165 (38%), Positives = 94/165 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           EI F GRSNVGKSSLINAL  AK +A+TSNTPGRTQ  N++          D     L+D+PGYGYAK  K +    +K++ +Y+  R  L  V+ +ID    I   D ++ +LL      + +VL K DK  ++       +   KLK+       ++  S++    + +L+  I   I
  S:    44 EIAFAGRSNVGKSSLINALVGAKGLARTSNTPGRTQELNYFVPGGYSGAEDDLPPMALVDMPGYGYAKAPKEQVDLWTKLVFDYMRGRSTLKRVYLLIDSRHGIKKNDEEVMDLLDKAAMSYQVVLTKTDKIKEAGVPRLIGETLNKLKRRPAAYPEVLATSSEKANGVDDLRIAIALAI 223
>gi|167560329|ref|ZP_02353332.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|168821667|ref|ZP_02833667.1| GTPase EngB [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] >gi|194443397|ref|YP_002043224.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194402060|gb|ACF62282.1| putative GTP-binding protein EngB [Salmonella enterica subsp. enterica serovar Newport str. SL254] (210 aa)
Score = 233, Expect = 3.3e-18, Identities = 54/121 (44%), Positives = 77/121 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  +  RL+DLPGYGYA+V +    +  + + EY+  R++L  +  ++DI   + DLD QM +       Q  ++L KADK A
  S:    28 EVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVEGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIQWAVESNIQVLVLLTKADKLA 151
>gi|90019724|ref|YP_525551.1| cell division checkpoint GTPase YihA [Saccharophagus degradans 2-40] >gi|119369251|sp|Q21PP0|ENGB_SACD2 Probable GTP-binding protein engB >gi|89949324|gb|ABD79339.1| cell division checkpoint GTPase YihA [Saccharophagus degradans 2-40] (213 aa)
Score = 233, Expect = 3.3e-18, Identities = 58/136 (42%), Positives = 79/136 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDKF---RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           F+ S  S     T++  E+ F GRSN GKSS IN L  N K+A+TS TPGRTQL NF++F      R++DLPGYGYAKV  +   +    +SEY+  R  L  +  ++DI   + D D  M           +++L KADK
  S:    11 FLISAPSIRQCPTEEGTEVAFAGRSNAGKSSAINTLTGNGKLARTSKTPGRTQLINFFNFPAAPDQRIVDLPGYGYAKVPMAVKKKWQADLSEYLQQRDALRGLVIVMDIRHPLQDFDTMMINWAVEGEMPVHLLLTKADK 151
>gi|12644641|sp|Q9JY03|ENGB_NEIMB Probable GTP-binding protein engB (209 aa)
Score = 233, Expect = 3.4e-18, Identities = 61/169 (36%), Positives = 97/169 (57%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVC--VSAKNKTNIPNLKKLIGS 183
           + D   EI F+GRSN GKSS IN L N  ++A  S TPGRTQ  NF++      ++DLPGYGYA+V ++       ++ +Y+  RK L+ +  I+D    + +LD++M +         +I+L+KADK +K+      +++   LK   D++NI     S+  K  I    + +GS
  S:    19 LPDTPLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGS 194
>gi|194097727|ref|YP_002000768.1| GTP-binding protein [Neisseria gonorrhoeae NCCP11945] >gi|119369221|sp|Q5FAC6|ENGB_NEIG1 Probable GTP-binding protein engB >gi|193933017|gb|ACF28841.1| GTP-binding protein [Neisseria gonorrhoeae NCCP11945] (209 aa)
Score = 233, Expect = 3.4e-18, Identities = 61/169 (36%), Positives = 97/169 (57%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVC--VSAKNKTNIPNLKKLIGS 183
           + D   EI F+GRSN GKSS IN L N  ++A  S TPGRTQ  NF++      ++DLPGYGYA+V ++       ++ +Y+  RK L+ +  I+D    + +LD++M +         +I+L+KADK +K+      +++   LK   D++NI     S+  K  I    + +GS
  S:    19 LPDTPLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKQLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGS 194
>gi|83594669|ref|YP_428421.1| GTPase EngB [Rhodospirillum rubrum ATCC 11170] >gi|119369247|sp|Q2RP11|ENGB_RHORT Probable GTP-binding protein engB >gi|83577583|gb|ABC24134.1| GTP-binding [Rhodospirillum rubrum ATCC 11170] (231 aa)
Score = 233, Expect = 3.4e-18, Identities = 61/156 (39%), Positives = 86/156 (55%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           SF+  C S +     D  EI F GRSNVGKSSL+NAL   K +A+TSNTPGRTQ  N++            ++DLPGYG+A+  K      +++I  Y+  R  L  V  +ID    I + D  +  +L      + IVL KADK   +   +  A++ A+  K
  S:    36 SFVMGCVSLDTLPDHDLSEIAFAGRSNVGKSSLVNALTGRKTLARTSNTPGRTQELNYFRLGPEAQDPALMMVDLPGYGFAEAPKDAVKRWTRLIMAYLRGRPALRRVCLLIDSRHGIKENDRDVMRMLDEAAVSYQIVLTKADKLKAAEITDVLARVVAETAK 199
>gi|78221686|ref|YP_383433.1| GTPase EngB [Geobacter metallireducens GS-15] >gi|119369199|sp|Q39YG6|ENGB_GEOMG Probable GTP-binding protein engB >gi|78192941|gb|ABB30708.1| GTP-binding protein [Geobacter metallireducens GS-15] (204 aa)
Score = 233, Expect = 3.4e-18, Identities = 62/151 (41%), Positives = 85/151 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           E+ F GRSNVGKSSLIN L N K + +TS+TPGRTQL NF+  +    L+DLPGYG+AKV  +   E   ++  Y+  R NL  V  I+DI    T+ D  M + L        +V+ K DK +K+      A I   L   ++ +   SA +K
  S:    25 EVAFAGRSNVGKSSLINVLVNRKGLVRTSSTPGRTQLINFFRVNGSLMLVDLPGYGFAKVPLAVKKEWGPMVETYLSTRPNLSCVVLIVDIRREPTEEDQLMLQWLRAYNVAVLVVVTKCDKVSKNERAKQAAIITRTLGLARDEMAFFSALSK 178
>gi|88806834|ref|ZP_01122350.1| putative GTP-binding cell division protein [Robiginitalea biformata HTCC2501] >gi|88783168|gb|EAR14341.1| putative GTP-binding cell division protein [Robiginitalea biformata HTCC2501] (208 aa)
Score = 233, Expect = 3.4e-18, Identities = 54/119 (45%), Positives = 72/119 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           E  FIGRSNVGKSSLIN L + K +AK S  PG+TQL N +   D + L+DLPGYGYA+ SK       K+I  Y   R+ L++ F ++DI      +DL+  E L+       ++  KADK
  S:    25 EYAFIGRSNVGKSSLINMLTDRKHLAKISGRPGKTQLINHFRINDNWFLVDLPGYGYARTSKKDKAAFQKLIHRYFRERRQLLSAFLLVDIRHEPQPIDLEFMEWLTGEGIPFALIFTKADK 146
>gi|34396175|gb|AAP55641.1| GTP binding protein [Spiroplasma citri] >gi|110004356|emb|CAK98694.1| probable gtp binding protein [Spiroplasma citri] (199 aa)
Score = 233, Expect = 3.6e-18, Identities = 62/169 (36%), Positives = 99/169 (58%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD--KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNK 171
           ++I S  +   WI DD  EI F+G+SNVGKSS +N L N + +AK S  PG+T++ NF+  +  +FR++D PGYG+AKV      + +K++ EY+  R+NL  V  ++D+    T  D +M + L +      ++  K DK  K+    +   I AKL   D +  +  S++NK
  S:     8 NYITSAVNKAGWINDDLFEIAFLGKSNVGKSSFLNMLTNQRQLAKVSQIPGKTRMLNFFSINNNQFRIVDAPGYGFAKVGNQYKMDFAKMMEEYLTQRENLKFVCLLVDLRHPPTQDDYEMYQYLKHFNILTVLIGTKLDKVKKNDIQKHEKMIKAKLNFADSDYFIKTSSRNK 181
>gi|13124166|sp|O05132|ENGB_NEIGO Probable GTP-binding protein engB (209 aa)
Score = 233, Expect = 3.6e-18, Identities = 61/169 (36%), Positives = 97/169 (57%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVC--VSAKNKTNIPNLKKLIGS 183
           + D   EI F+GRSN GKSS IN L N  ++A  S TPGRTQ  NF++      ++DLPGYGYA+V ++       ++ +Y+  RK L+ +  I+D    + +LD++M +         +I+L+KADK +K+      +++   LK   D++NI     S+  K  I    + +GS
  S:    19 LPDTPLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLRHRKELIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGS 194
>gi|46201109|ref|ZP_00055731.2| COG0218: Predicted GTPase [Magnetospirillum magnetotacticum MS-1] (228 aa)
Score = 233, Expect = 3.7e-18, Identities = 59/164 (35%), Positives = 95/164 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD---KENIVCVSAKNKTNIPNLKKLIGSV 184
           E+ F GRSNVGKSSLINAL     +A+TSNTPGRTQ  NF++   +  L+D+PGYG+A+  K    + +++++ ++  R  L     ++D    + D D  M ++L      + +VL KADK   S  D   A+   ++K       +++  S++  T IP L+  + S+
  S:    58 EVAFAGRSNVGKSSLINALTGRNTLARTSNTPGRTQELNFFNLGGRLVLVDMPGYGFAQAPKGLVEKWTRLVNGFLKGRSVLRRAVVLVDSRHGLKDSDRDMMKMLDKAAVVYQVVLTKADKLKASELDAVQARTLEEIKSRVAAHPSLIVTSSEKGTGIPELRAELASL 227
>gi|46129021|ref|ZP_00155618.2| COG0218: Predicted GTPase [Haemophilus influenzae R2846] >gi|148826267|ref|YP_001291020.1| GTPase EngB [Haemophilus influenzae PittEE] >gi|166225958|sp|A5UCY6|ENGB_HAEIE Probable GTP-binding protein engB >gi|148716427|gb|ABQ98637.1| GTP-binding protein [Haemophilus influenzae PittEE] (205 aa)
Score = 233, Expect = 3.8e-18, Identities = 56/127 (44%), Positives = 80/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +  ++L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNYKLVDLPGYGYAAVPEQMKIQWQKSLGEYLQKRECLSGLVVLMDIRHPLKDLDQQMIEWAVSADLPILLLLTKADKLSQS 155
>gi|182704778|ref|ZP_02957178.1| GTP-binding protein HSR1-related [Methylocella silvestris BL2] >gi|172066102|gb|EDT52236.1| GTP-binding protein HSR1-related [Methylocella silvestris BL2] (226 aa)
Score = 233, Expect = 4.0e-18, Identities = 58/123 (47%), Positives = 81/123 (65%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKAD--KEAKS 143
           EI F GRSNVGKSSL+NAL N K +A+TS+TPGRT+  NF+      D  + RL+D+PGYGYA  SK +    ++++ +Y+  R  L+  F +ID    +   D +M +LL      + IVL K D  KEA +
  S:    46 EIAFAGRSNVGKSSLLNALTNRKSLARTSHTPGRTRELNFFGLGGGIDDARLRLVDMPGYGYAAASKEQIASWTQLMQDYLRGRAPLLRAFVLIDGRHGLKPPDYEMMDLLDRCALSYQIVLTKQDEVKEADA 178
>gi|113869399|ref|YP_727888.1| GTPase EngB [Ralstonia eutropha H16] >gi|123133546|sp|Q0K651|ENGB_RALEH Probable GTP-binding protein engB >gi|113528175|emb|CAJ94520.1| Predicted GTPase [Ralstonia eutropha H16] (233 aa)
Score = 233, Expect = 4.0e-18, Identities = 61/164 (37%), Positives = 93/164 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSV 184
           E+ F GRSN GKS+ IN L N K +A +S TPGRTQ  N++     +       L+DLPGYGYA+VS S  +    ++S+Y+  R+ L  +  ++D     TDLD QM E         +++L KADK   S  DN     A  L++ ++ +   + + +T +P   +L  S+
  S:    26 EVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINYFSVAPVKAPDPLAFLVDLPGYGYAEVSGSAKYHWQGLLSDYVQTRQQLSGLILMMDARRPFTDLDCQMVEWFLPTGRPIHVLLTKADKLTNS--DN-----AKALRETRKMLQGYAEQMETPVPMTAQLFSSL 191
>gi|114565094|ref|YP_752608.1| GTPase EngB [Shewanella frigidimarina NCIMB 400] >gi|119369253|sp|Q07W45|ENGB_SHEFN Probable GTP-binding protein engB >gi|114336387|gb|ABI73769.1| GTP-binding [Shewanella frigidimarina NCIMB 400] (224 aa)
Score = 233, Expect = 4.1e-18, Identities = 66/161 (40%), Positives = 94/161 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSE--LLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK--DKENIVCVSAKNKTNIPNLKKLI 181
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N +  D   RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E  +LSN       +L K+DK  +S        + A LK+  DK  +  +S+   T  P +  ++
  S:    34 EIAFAGRSNAGKSSALNALTEQKSLARTSKTPGRTQLINVFQLDDDRRLVDLPGYGFAQVPLALKHKWQEALGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVLSNI--PVLALLTKSDKLTQSVKMKTVNDVRAALKEFGDKVQVETLSSLKGTGKPKVLSIL 199
>gi|188532190|ref|YP_001905987.1| Probable GTP-binding protein EngB [Erwinia tasmaniensis] >gi|188027232|emb|CAO95071.1| Probable GTP-binding protein EngB [Erwinia tasmaniensis] (218 aa)
Score = 232, Expect = 4.2e-18, Identities = 53/125 (42%), Positives = 77/125 (61%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N +   + +RL+DLPGYGYA+V +    +  + ++EY++ R  L  +  ++DI   + +LD QM         +  ++L KADK A
  S:    33 DTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFQVAEGYRLVDLPGYGYAEVPEETKLKWQRSLAEYLHDRHCLKGLVVLMDIRHPLKELDRQMILWAVQSGREVLVLLTKADKLA 160
>gi|15793641|ref|NP_283463.1| GTPase EngB [Neisseria meningitidis Z2491] >gi|121634279|ref|YP_974524.1| GTPase EngB [Neisseria meningitidis FAM18] >gi|161869414|ref|YP_001598581.1| GTPase EngB [Neisseria meningitidis 053442] >gi|166225965|sp|A1KS92|ENGB_NEIMF Probable GTP-binding protein engB >gi|189037181|sp|A9M1V2|ENGB_NEIM0 Probable GTP-binding protein engB >gi|12644640|sp|Q9JVW1|ENGB_NEIMA Probable GTP-binding protein engB >gi|120865985|emb|CAM09722.1| putative GTP-binding protein [Neisseria meningitidis FAM18] >gi|121051619|emb|CAM07919.1| putative GTP-binding protein [Neisseria meningitidis Z2491] >gi|161594967|gb|ABX72627.1| GTP-binding protein [Neisseria meningitidis 053442] (209 aa)
Score = 232, Expect = 4.3e-18, Identities = 61/169 (36%), Positives = 97/169 (57%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK--KDKENIVC--VSAKNKTNIPNLKKLIGS 183
           + D   EI F+GRSN GKSS IN L N  ++A  S TPGRTQ  NF++      ++DLPGYGYA+V ++       ++ +Y+  RK L+ +  I+D    + +LD++M +         +I+L+KADK +K+      +++   LK   D++NI     S+  K  I    + +GS
  S:    19 LPDTPLEIAFVGRSNAGKSSAINTLTNHVRLAYVSKTPGRTQHINFFELQNGNFMVDLPGYGYAQVPEAVRAHWVNLLGDYLQQRKQLIGLVLIMDARHPLKELDIRMLDFFHTTGRPVHILLSKADKLSKNEQIKTLSQVKKLLKPYSDRQNISVQLFSSLKKQGIDEANRTVGS 194
>gi|152972673|ref|YP_001337819.1| GTP-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166225962|sp|A6TG68|ENGB_KLEP7 Probable GTP-binding protein engB >gi|150957522|gb|ABR79552.1| GTP-binding protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (210 aa)
Score = 232, Expect = 4.5e-18, Identities = 56/125 (44%), Positives = 76/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  +  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM E       Q  ++L KADK A
  S:    24 DTGIEVAFAGRSNAGKSSALNTLTNQKNLARTSKTPGRTQLINLFEVAEGKRLVDLPGYGYAQVPEEMKIKWQRALGEYLEKRLCLKGLVVLMDIRHPLKDLDQQMIEWAVESDIQVLVLLTKADKLA 151
>gi|124549729|ref|ZP_01707814.1| GTP-binding [Shewanella putrefaciens 200] >gi|146294988|ref|YP_001185412.1| GTPase EngB [Shewanella putrefaciens CN-32] >gi|166225982|sp|A4YCD0|ENGB_SHEPC Probable GTP-binding protein engB >gi|124507719|gb|EAY51839.1| GTP-binding [Shewanella putrefaciens 200] >gi|145566678|gb|ABP77613.1| GTP-binding protein, HSR1-related [Shewanella putrefaciens CN-32] (219 aa)
Score = 232, Expect = 4.5e-18, Identities = 56/123 (45%), Positives = 77/123 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ D + RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E           +L K+DK A+S
  S:    34 EIAFAGRSNAGKSSALNALTEQKSLARTSKTPGRTQLINVFELDSQRRLVDLPGYGFAQVPLAMKNKWQQALGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQS 159
>gi|114330261|ref|YP_746483.1| GTPase EngB [Nitrosomonas eutropha C91] >gi|122314688|sp|Q0AJF3|ENGB_NITEC Probable GTP-binding protein engB >gi|114307275|gb|ABI58518.1| cell division checkpoint GTPase YihA [Nitrosomonas eutropha C91] (223 aa)
Score = 232, Expect = 4.5e-18, Identities = 55/123 (44%), Positives = 75/123 (60%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS IN L    + A TS TPGRTQ  NF+   + R ++DLPGYGYA+V  +       ++S Y+  R+ L  +  I+DI   +T LDLQM E  +      +++L KADK ++S
  S:    28 EIAFAGRSNAGKSSAINTLVGRGRFAFTSKTPGRTQHINFFQLGEERFMVDLPGYGYAQVPLAIRQHWVHLLSTYLQTRQALYGMILIMDIRHPLTKLDLQMLEWFAQTGKLVHVLLTKADKLSRS 153
>gi|144899246|emb|CAM76110.1| GTP-binding protein [Magnetospirillum gryphiswaldense MSR-1] (193 aa)
Score = 232, Expect = 4.6e-18, Identities = 60/161 (37%), Positives = 94/161 (58%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK----EAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           E+ F GRSNVGKSSLINAL   + +A+TSNTPGRTQ  NF+D + +  L+D+PGYG+A   K K    +++I  ++  R  L     ++D    + D D +M ++L      + +VL K DK    E K+  +   A+I+ ++      ++  S++    IP L+  I
  S:    17 ELAFAGRSNVGKSSLINALCGRSTVARTSNTPGRTQELNFFDVNGRLILVDMPGYGFASAPKDKVDAWTRLIKGFLRGRPTLRRCILLVDSRHGLKDNDREMMDMLDKAAVVYQVVLTKIDKLNAAEVKAVQERTQAEISKRVAA-YPTLILTSSEKGIGIPELRAEI 183
>gi|183597074|ref|ZP_02958567.1| hypothetical protein PROSTU_00314 [Providencia stuartii ATCC 25827] >gi|188023736|gb|EDU61776.1| hypothetical protein PROSTU_00314 [Providencia stuartii ATCC 25827] (203 aa)
Score = 232, Expect = 5.1e-18, Identities = 58/141 (41%), Positives = 82/141 (58%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           M  F+ S         D   E+ F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ ++  RL+DLPGYGYA+V +    +  K + EY+  R+ +  +  ++DI   + DLD+QM E          ++L KADK A
  S:    10 MTKFVISAPDIRHLPKDTGIEVAFAGRSNAGKSSALNALTQQKSLARTSKTPGRTQLINLFEVEEGIRLVDLPGYGYAEVPEEMKRKWQKALGEYLQKRECIKGLVVLMDIRHPLKDLDMQMIEWSIAMEIPVLVLLTKADKLA 153
>gi|126663224|ref|ZP_01734222.1| GTPase EngB [Flavobacteria bacterium BAL38] >gi|126624882|gb|EAZ95572.1| GTPase EngB [Flavobacteria bacterium BAL38] (206 aa)
Score = 232, Expect = 5.2e-18, Identities = 59/128 (46%), Positives = 79/128 (61%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           E  FIGRSNVGKSSLIN L N K +AKTS+ PG+TQL N +  +  + L+DLPGYGYA+VSK       + I +Y   R+ LV  F +IDI +    +DL+  E L        I+  K+DK  K+  +N+
  S:    25 EYAFIGRSNVGKSSLINMLTNHKNLAKTSSKPGKTQLINHFKINNNWFLVDLPGYGYARVSKKTKAVFQQFIMDYFEQREQLVCAFVLIDIRLEAQKIDLEFMEYLGESEIPFAIIFTKSDKLGKNKVNNH 155
>gi|154250754|ref|YP_001411578.1| GTPase EngB [Parvibaculum lavamentivorans DS-1] >gi|154154704|gb|ABS61921.1| GTP-binding protein HSR1-related [Parvibaculum lavamentivorans DS-1] (235 aa)
Score = 232, Expect = 5.4e-18, Identities = 63/164 (38%), Positives = 92/164 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-----FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD---KENIVCVSAKNKTNIPNLKKLIGSV 184
           E+ F GRSNVGKSSLINAL   K +A+TSNTPGRT+  NF+           L+DLPGYGYA+ ++++  + + +I  Y+  R  L  V  +ID    + D D  +  LL      + IVL K DK      +    ++ A +++       IV  S++  T I  L+  I S+
  S:    50 EVAFAGRSNVGKSSLINALTGRKTLARTSNTPGRTKELNFFALGTSGNPAIMLVDLPGYGYARETRTRVDQWTDLIMAYLRGRVPLRRVLVLIDARHGLKDNDHSVMTLLDEAAVSYQIVLTKIDKLKAGELETRLDEVRAGIRRHVAAHPRIVATSSEKGTGIAELRAEIASL 223
>gi|85060212|ref|YP_455914.1| GTPase EngB [Sodalis glossinidius str. 'morsitans'] >gi|119369261|sp|Q2NQR6|ENGB_SODGM Probable GTP-binding protein engB >gi|84780732|dbj|BAE75509.1| conserved hypothetical protein [Sodalis glossinidius str. 'morsitans'] (211 aa)
Score = 231, Expect = 5.4e-18, Identities = 54/125 (43%), Positives = 78/125 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D   EI F GRSN GKSS +N L N K +A+TS TPGRT+L N ++ +   RL+DLPGYGYA+V +    +  + + EY+ +R +L  +  ++DI   + DLD QM +   +      ++L KADK A
  S:    25 DSGIEIAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTRLINLFEVESGIRLVDLPGYGYAEVPEELKRKWQRALGEYLQMRDSLKGLVVLMDIRHPMKDLDQQMVQWAVDVNIPVLVLLTKADKLA 152
>gi|126643102|ref|YP_001086086.1| GTPase EngB [Acinetobacter baumannii ATCC 17978] >gi|166225936|sp|A3M990|ENGB_ACIBT Probable GTP-binding protein engB (211 aa)
Score = 231, Expect = 5.4e-18, Identities = 64/168 (38%), Positives = 92/168 (54%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN--IVCVSAKNKTNIPNLKKLIG 182
           + D   EI F GRSN GKSS INAL N K +A+ S  PGRTQ+ NF+       RL+DLPGYGYA V +       K +  Y+  RK+L  +  ++DI   +   D+ M E   +R    +I+L KADK  +   +    ++  +LKK K +  I   S+ NK  +  L  ++ 
  S:    10 VEDSGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFSLGNPDQRLVDLPGYGYAAVPEDMKRVWQKELENYLIHRKSLQGLVLLMDIRHPLQHFDMMMLEWAYSRHLFVHILLTKADKLNRGPANKVLLEVKQQLKKMKLDFSIQLFSSLNKLGLEELASVMA 183
>gi|163781961|ref|ZP_02176961.1| hypothetical protein HG1285_03723 [Hydrogenivirga sp. 128-5-R1-1] >gi|159883181|gb|EDP76685.1| hypothetical protein HG1285_03723 [Hydrogenivirga sp. 128-5-R1-1] (184 aa)
Score = 231, Expect = 5.5e-18, Identities = 57/149 (38%), Positives = 86/149 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRK-NLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKI 152
           F+KS  ++ D+   DK E+ F+GRSNVGKSSLIN +    IA+ S  PGRT+  N++   D   L+D+PGYG+A+V K +  +  +++  Y   RK N+  VF +ID ++ +  LD QM E L        +VL K DK  +        ++
  S:     5 FLKS--TTADFPPPDKPEVVFVGRSNVGKSSLINMVTGRNIARVSKEPGRTRTINYFLLNDSVYLVDVPGYGFARVPKEEQDKWKRMMENYFKGRKENIRVVFLLIDAVAGVQKLDRQMIEWLQFVGLPFVVVLTKTDKAKQKELSRTLKQV 154
>gi|157329057|emb|CAO23922.1| unnamed protein product [Vitis vinifera] (316 aa)
Score = 231, Expect = 5.6e-18, Identities = 59/136 (43%), Positives = 75/136 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           F+KS     D   DD+ E   +GRSNVGKSSLINAL   K +A TS  PG+TQL N +  +K + ++DLPGYG+AK  +S   + S     Y   R  LVAV  +ID SV    +DL  +  L         V  K DK
  S:   121 FVKSSSRPKDCPKDDRPEFAILGRSNVGKSSLINALVRKKEVALTSKKPGKTQLINHFLVNKSWYIVDLPGYGFAKAPESARMDWSAFTKGYFLNRATLVAVLLLIDASVPPQKIDLDCANWLGRNNIPMTFVFTKCDK 259
>gi|121534152|ref|ZP_01665977.1| GTP-binding protein, HSR1-related [Thermosinus carboxydivorans Nor1] >gi|121307255|gb|EAX48172.1| GTP-binding protein, HSR1-related [Thermosinus carboxydivorans Nor1] (207 aa)
Score = 231, Expect = 5.7e-18, Identities = 60/183 (32%), Positives = 99/183 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFD---------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVIL 186
           ++ S    + +  ++  EI FIGRSNVGKSSLIN+L  +  +A+ S +PG+TQ  N+Y            ++ L+DLPGYGYA+  +++  + ++ + EY      L  V Q++D+       D+ M   L        +V  K DK  +++   + A I   LK +   I+  SA N     +L  +IG ++L
  S:    13 YVASAVRPDQYPPEELPEIAFIGRSNVGKSSLINSLCRHHGLARVSASPGKTQTINYYVVTAKLPNERRLEWYLVDLPGYGYARAGQTQRRQWTRFVEEYFLRSPRLKLVCQLVDLRHPPQASDVAMYGWLKTHNLPVQVVATKTDKIGRTHVARHLAAIKNGLKLETGGIIAYSALNGQGRDDLLDVIGQILL 206
>gi|119369240|sp|Q1LI69|ENGB_RALME Probable GTP-binding protein engB (227 aa)
Score = 231, Expect = 6.0e-18, Identities = 63/157 (40%), Positives = 85/157 (54%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNL 177
           E+ F GRSN GKS+ IN L N K +A +S TPGRTQ  NF+     +       L+DLPGYGYA+VS S  F    ++S+Y+  R  L  +  ++D     TDLD QM E         +++L KADK   S  DN      AK  ++   ++   A    N P L
  S:    26 EVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINFFTVAPVKAPDPVGFLVDLPGYGYAEVSGSAKFHWQGLLSDYVQARTQLSGLILMMDARRPFTDLDCQMVEWFLPTGKPIHVLLTKADKLTTS--DN------AKALRETRKVLADYAAQMENPPAL 183
>gi|94312216|ref|YP_585426.1| GTPase EngB [Ralstonia metallidurans CH34] >gi|93356068|gb|ABF10157.1| cell division checkpoint GTPase YihA [Ralstonia metallidurans CH34] (250 aa)
Score = 231, Expect = 6.0e-18, Identities = 63/157 (40%), Positives = 85/157 (54%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNL 177
           E+ F GRSN GKS+ IN L N K +A +S TPGRTQ  NF+     +       L+DLPGYGYA+VS S  F    ++S+Y+  R  L  +  ++D     TDLD QM E         +++L KADK   S  DN      AK  ++   ++   A    N P L
  S:    49 EVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINFFTVAPVKAPDPVGFLVDLPGYGYAEVSGSAKFHWQGLLSDYVQARTQLSGLILMMDARRPFTDLDCQMVEWFLPTGKPIHVLLTKADKLTTS--DN------AKALRETRKVLADYAAQMENPPAL 206
>gi|145633154|ref|ZP_01788886.1| GTP-binding protein [Haemophilus influenzae 3655] >gi|145635886|ref|ZP_01791575.1| GTP-binding protein [Haemophilus influenzae PittAA] >gi|144986380|gb|EDJ92959.1| GTP-binding protein [Haemophilus influenzae 3655] >gi|145266869|gb|EDK06884.1| GTP-binding protein [Haemophilus influenzae PittAA] (205 aa)
Score = 231, Expect = 6.0e-18, Identities = 56/127 (44%), Positives = 79/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKSLGEYLQKRECLAGLVVLMDIRHPLKDLDQQMIEWAVSANLPVLLLLTKADKLSQS 155
>gi|16273043|ref|NP_439275.1| GTPase EngB [Haemophilus influenzae Rd KW20] >gi|145630217|ref|ZP_01785999.1| GTP-binding protein [Haemophilus influenzae 22.4-21] >gi|148828278|ref|YP_001293031.1| GTPase EngB [Haemophilus influenzae PittGG] >gi|166225959|sp|A5UIP2|ENGB_HAEIG Probable GTP-binding protein engB >gi|1176322|sp|P46453|ENGB_HAEIN Probable GTP-binding protein engB >gi|1574673|gb|AAC22772.1| conserved hypothetical GTP-binding protein [Haemophilus influenzae Rd KW20] >gi|144984498|gb|EDJ91921.1| GTP-binding protein [Haemophilus influenzae R3021] >gi|148719520|gb|ABR00648.1| GTP-binding protein [Haemophilus influenzae PittGG] (205 aa)
Score = 231, Expect = 6.0e-18, Identities = 56/127 (44%), Positives = 79/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKSLGEYLQKRECLAGLVVLMDIRHPLKDLDQQMIEWAVSANLPVLLLLTKADKLSQS 155
>gi|167751930|ref|ZP_02424057.1| hypothetical protein ALIPUT_00172 [Alistipes putredinis DSM 17216] >gi|167660171|gb|EDS04301.1| hypothetical protein ALIPUT_00172 [Alistipes putredinis DSM 17216] (198 aa)
Score = 231, Expect = 6.1e-18, Identities = 53/123 (43%), Positives = 77/123 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D   E  FIGRSNVGKSSL+N L   + +AK S TPG+T+L N +   D + L+DLPGYGYA+ SK++  E +KII++Y+   + +  +F ++D  +    +DL+  E+L        IV  K DK
  S:    21 DSLPEFAFIGRSNVGKSSLVNMLTGRSGLAKVSGTPGKTRLINHFRINDSWYLVDLPGYGYARTSKTQRDEFAKIITDYVLRCERMHFLFVLVDSRLEPQKIDLRFIEMLGREGIPFGIVFTKTDK 146
>gi|126172308|ref|YP_001048457.1| GTP-binding protein HSR1-related [Shewanella baltica OS155] >gi|149115041|ref|ZP_01841788.1| GTP-binding protein, HSR1-related [Shewanella baltica OS223] >gi|153002842|ref|YP_001368523.1| GTPase EngB [Shewanella baltica OS185] >gi|160877587|ref|YP_001556903.1| GTPase EngB [Shewanella baltica OS195] >gi|166225979|sp|A3CYM5|ENGB_SHEB5 Probable GTP-binding protein engB >gi|166225980|sp|A6WUH1|ENGB_SHEB8 Probable GTP-binding protein engB >gi|189037188|sp|A9KWY5|ENGB_SHEB9 Probable GTP-binding protein engB >gi|125995513|gb|ABN59588.1| GTP-binding protein, HSR1-related [Shewanella baltica OS155] >gi|146865056|gb|EDK50404.1| GTP-binding protein, HSR1-related [Shewanella baltica OS223] >gi|151367460|gb|ABS10460.1| GTP-binding protein HSR1-related [Shewanella baltica OS185] >gi|160863109|gb|ABX51643.1| GTP-binding protein HSR1-related [Shewanella baltica OS195] (219 aa)
Score = 231, Expect = 6.1e-18, Identities = 56/123 (45%), Positives = 77/123 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ D + RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E           +L K+DK A+S
  S:    34 EIAFAGRSNAGKSSALNALTEQKSLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAQVPLALKNKWQQALGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQS 159
>gi|50118987|ref|YP_048154.1| GTPase EngB [Pectobacterium atrosepticum SCRI1043] >gi|81646696|sp|Q6DB76|ENGB_ERWCT Probable GTP-binding protein engB >gi|49609513|emb|CAG72946.1| probable GTP-binding protein [Erwinia carotovora subsp. atroseptica SCRI1043] (211 aa)
Score = 231, Expect = 6.4e-18, Identities = 59/141 (41%), Positives = 81/141 (57%)
  Q:     1 MPSFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           M  FI S        TD+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N +   +  RL+DLPGYGYA+V +    +  + + EY+  R +L  +  ++DI   + DLD QM     +      ++L KADK A
  S:     9 MTRFIISAPDIRHLETDNGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFQVAEGVRLVDLPGYGYAEVPEQMKIKWQRALGEYLQKRNSLKGLVVLMDIRHPLKDLDQQMILWAVDVKLPVLVLLTKADKLA 152
>gi|110632739|ref|YP_672947.1| GTPase EngB [Mesorhizobium sp. BNC1] >gi|119369212|sp|Q11LE3|ENGB_MESSB Probable GTP-binding protein engB >gi|110283723|gb|ABG61782.1| GTP-binding [Mesorhizobium sp. BNC1] (225 aa)
Score = 231, Expect = 6.4e-18, Identities = 55/119 (46%), Positives = 78/119 (65%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           E+ F GRSNVGKSSLIN L   K +A+TSNTPGRTQ  N++          D     L+D+PGYG+AK  K++    +K++ +Y+  R  L  V+ +ID    I  +D ++ +LL +    + IVL KADK
  S:    43 EVAFAGRSNVGKSSLINGLVGRKGLARTSNTPGRTQELNYFVPEGYSGEAGDLPPMALVDMPGYGFAKAPKAQVDAWTKLVFDYLRGRVTLKRVYLLIDARHGIKKIDEEVMDLLDSAAVSYQIVLTKADK 173
>gi|149203000|ref|ZP_01879971.1| GTP-binding protein [Roseovarius sp. TM1035] >gi|149143546|gb|EDM31582.1| GTP-binding protein [Roseovarius sp. TM1035] (216 aa)
Score = 231, Expect = 6.5e-18, Identities = 62/181 (34%), Positives = 95/181 (52%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+   +   L+DLPGYGYA    +   +   ++ +Y+  R+ L   F ++D    I  +D ++  LL         VL K DK   +  D    ++ AKL         ++  S++    +  L+  I ++
  S:    29 FVKGVVAMSGLPPADRLEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINFFALGESHYLVDLPGYGYANAPLAVVQKWQALLKQYLSGRQTLRRAFVLVDARHGIKTVDEEIMSLLDASAVTFQCVLTKTDKINAADRDRVLDQVRAKLAPHPAAYPELILTSSEKSEGLATLRATIATL 215
>gi|171462910|ref|YP_001797023.1| GTP-binding protein HSR1-related [Polynucleobacter necessarius STIR1] >gi|171192448|gb|ACB43409.1| GTP-binding protein HSR1-related [Polynucleobacter necessarius STIR1] (221 aa)
Score = 231, Expect = 6.5e-18, Identities = 59/139 (42%), Positives = 83/139 (59%)
  Q:    20 KEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYD-FDK----FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +E+ F GRSN GKSS IN L N K +A  S TPGRTQ  N++  F K      L+DLPGYGYA V+    +  + ++S+Y+  R+ LV V  I+D    ITDLD QM E         +++L+K DK  KS   +    +  +L++
  S:    25 REVAFAGRSNAGKSSAINVLCNQKRLAFASKTPGRTQHINYFGLFAKDDLLAYLVDLPGYGYAAVNHETKYHWNTLLSDYLQEREQLVGVVLIVDSRRGITDLDEQMIEWFVPTGKPTHVLLSKCDKLNKSECKHTLEAVRKQLQQ 170
>gi|146329655|ref|YP_001209308.1| GTPase [Dichelobacter nodosus VCS1703A] >gi|146233125|gb|ABQ14103.1| GTPase [Dichelobacter nodosus VCS1703A] (199 aa)
Score = 231, Expect = 6.7e-18, Identities = 58/141 (41%), Positives = 85/141 (60%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFY---DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           +F  S  +++    D   E+ F GRSN GKSS +NAL N A +A+ S TPGRTQL N++   D  K+ L+DLPGYGYA+V  +       ++ +Y+  R+ L  V  I+DI   +  LD Q+ +    R    +++L KADK +KS
  S:     9 TFSCSVHAAHQLPKDAVVEVAFAGRSNAGKSSALNALTNQATLARVSKTPGRTQLINYFALPDAGKY-LVDLPGYGYAQVPDAVRQHWEHLLGDYLLTRQALKGVVLIMDIRHPLKPLDQQLLDCCQARALPVHVLLTKADKLSKS 153
>gi|34540179|ref|NP_904658.1| GTPase EngB [Porphyromonas gingivalis W83] >gi|188995479|ref|YP_001929731.1| putative GTP-binding protein [Porphyromonas gingivalis ATCC 33277] >gi|81572162|sp|Q7MX68|ENGB_PORGI Probable GTP-binding protein engB >gi|34396491|gb|AAQ65557.1| GTP-binding protein [Porphyromonas gingivalis W83] >gi|188595159|dbj|BAG34134.1| putative GTP-binding protein [Porphyromonas gingivalis ATCC 33277] (201 aa)
Score = 231, Expect = 6.8e-18, Identities = 67/164 (40%), Positives = 88/164 (53%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN---IVCVSAKNKTNIPNLKKLIGSV 184
           E  FIGRSNVGKSSLIN L   K +A TS  PG+TQL N +  D  + L+DLPGYGYA++  S    L +II  YI  R+ L ++F +ID       +DL+  + L        IV  KADK + S    N      KL +  E    +   S++ KT    L   I S+
  S:    25 EYAFIGRSNVGKSSLINMLTGQKGLAMTSQKPGKTQLINHFIIDDSWYLVDLPGYGYARLGASNRESLRRIIETYILCREQLSSLFVLIDCRHEPQKIDLEFLQWLGENGIPFSIVFTKADKLSFSRLKENTEAYKQKLLETWEELPPVFITSSEKKTGKEELLDYIDSI 194
>gi|156936144|ref|YP_001440060.1| hypothetical protein ESA_04042 [Enterobacter sakazakii ATCC BAA-894] >gi|156534398|gb|ABU79224.1| hypothetical protein ESA_04042 [Enterobacter sakazakii ATCC BAA-894] (222 aa)
Score = 230, Expect = 7.2e-18, Identities = 56/126 (44%), Positives = 77/126 (61%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           +D   E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  D  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM E   +      ++L KADK A
  S:    34 SDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRLCLKGLVVLMDIRHPLKDLDQQMIEWAVDSGIPVLVLLTKADKLA 162
>gi|148556520|ref|YP_001264102.1| GTPase EngB [Sphingomonas wittichii RW1] >gi|148501710|gb|ABQ69964.1| GTP-binding protein, HSR1-related [Sphingomonas wittichii RW1] (220 aa)
Score = 230, Expect = 7.5e-18, Identities = 54/119 (45%), Positives = 76/119 (63%)
  Q:    21 EICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFD--------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           E+ F GRSNVGKSSL+N L N   +A+TSNTPGRTQ  NF+D            RL+D+PGYG+AK  K    +   ++++Y+  R  L     +ID    I D+D ++ E+L      +++VL KADK
  S:    41 EVAFAGRSNVGKSSLLNRLTNRVGLARTSNTPGRTQELNFFDVGADEEGGVPALRLVDMPGYGFAKAPKDIVRKWRHVVNDYLRGRVVLRRALVLIDSRHGIKDVDREIMEMLDKAAVTYHLVLTKADK 169
>gi|145636430|ref|ZP_01792098.1| GTP-binding protein [Haemophilus influenzae PittHH] >gi|145270255|gb|EDK10190.1| GTP-binding protein [Haemophilus influenzae PittHH] (205 aa)
Score = 230, Expect = 7.5e-18, Identities = 56/127 (44%), Positives = 79/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKSLGEYLQKRECLAGLVVLMDIRHPLKDLDQQMIEWAVSADLPVLLLLTKADKLSQS 155
>gi|20807122|ref|NP_622293.1| GTPase [Thermoanaerobacter tengcongensis MB4] >gi|24418374|sp|Q8RC22|ENGB_THETN Probable GTP-binding protein engB >gi|20515616|gb|AAM23897.1| predicted GTPases [Thermoanaerobacter tengcongensis MB4] (194 aa)
Score = 230, Expect = 7.5e-18, Identities = 66/182 (36%), Positives = 97/182 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINA-LANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           F+ S F+ + +  D   +I  +G+SNVGKS+LIN  L    +AK S+TPG+T+  NFY  ++ F ++DLPGYGYAKVSK    + +  I  ++   KNL     +IDI    T+ D  M    S +     +VL KADK  KS  +     I        + ++  SA  KT I  + ++   VI
  S:     8 FVGSAFNESQYPKDKIPQIAIVGKSNVGKSTLINTVLGRKNLAKVSSTPGKTRGINFYLVNRAFYIVDLPGYGYAKVSKEMKKQWAYNIETFLNTSKNLKHALLLIDIRREPTEDDFMMVNWFSFKNLPFSVVLTKADKVNKSEANKAIENICRSFNISSDRVIVFSAVEKTGISEILRIFEEVI 192
>gi|85860199|ref|YP_462401.1| GTPase EngB [Syntrophus aciditrophicus SB] >gi|119369274|sp|Q2LVW9|ENGB_SYNAS Probable GTP-binding protein engB >gi|85723290|gb|ABC78233.1| GTP-binding protein [Syntrophus aciditrophicus SB] (196 aa)
Score = 230, Expect = 7.9e-18, Identities = 57/139 (41%), Positives = 83/139 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           F+KS    + +      E+ F+GRSNVGKSSLIN L   K +A+TSNTPGRTQL NF++ ++    +DLPGYG+A+V ++   E   +I  Y+  R+ L  V  I+DI    +  DL +   L     +   VL K+DK ++
  S:     8 FVKSATLPSGYPPGSLPEVAFVGRSNVGKSSLINTLLRRKQLARTSNTPGRTQLINFFNVNQELLFVDLPGYGFARVPEAVKREWGPMIETYLRDRECLRMVVFILDIRRDPSQEDLALKGWLDYYGRRTLFVLTKSDKLSR 149
>gi|153094133|gb|EDN75032.1| possible GTP-binding protein [Mannheimia haemolytica PHL213] (203 aa)
Score = 230, Expect = 8.0e-18, Identities = 57/127 (44%), Positives = 78/127 (61%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N +  +   +L+DLPGYGYA V +    +  K + EY+  R+ L  V  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    23 DTGVEIAFAGRSNAGKSTALNALTNQKSLARTSKTPGRTQLINLFKVETNCKLVDLPGYGYAAVPEQMKIQWQKALGEYLQKRECLGGVVILMDIRHPLKDLDQQMIEWAVSANLPVLLLLTKADKLSQS 152
>gi|157328213|emb|CAO17686.1| unnamed protein product [Vitis vinifera] (219 aa)
Score = 230, Expect = 8.1e-18, Identities = 59/136 (43%), Positives = 75/136 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           F+KS     D   DD+ E   +GRSNVGKSSLINAL   K +A TS  PG+TQL N +  +K + ++DLPGYG+AK  +S   + S     Y   R  LVAV  +ID SV    +DL  +  L         V  K DK
  S:    24 FVKSSSRPKDCPKDDRPEFAILGRSNVGKSSLINALVRKKEVALTSKKPGKTQLINHFLVNKSWYIVDLPGYGFAKAPESARMDWSAFTKGYFLNRATLVAVLLLIDASVPPQKIDLDCANWLGRNNIPMTFVFTKCDK 162
>gi|73662400|ref|YP_301181.1| GTPase EngB [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|119369267|sp|Q49YA5|ENGB_STAS1 Probable GTP-binding protein engB >gi|72494915|dbj|BAE18236.1| putative GTP-binding protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (195 aa)
Score = 230, Expect = 8.1e-18, Identities = 60/153 (39%), Positives = 88/153 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTN 173
           E+   GRSNVGKS+ IN++   K +A+TS  PG+TQ  NFY+ D +   +D+PGYGYAKVSK +     K+I +YI  R+ L  V Q++D+    T+ D+ M   L       ++V  K DK AK     + A I  KL+ + E+ +   +  K N
  S:    27 EVGLSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDNQLVFVDVPGYGYAKVSKKQREAFGKMIEKYISQREELKLVIQLVDLRHNPTEDDILMYNYLKYYEIPTFVVATKEDKIAKGKVQKHLANIQQKLEMEPEDEIISYSSVKNN 182
>gi|148543886|ref|YP_001271256.1| small GTP-binding protein [Lactobacillus reuteri F275] >gi|184153286|ref|YP_001841627.1| GTP-binding protein [Lactobacillus reuteri F275] >gi|166920113|sp|A5VJ95|ENGB_LACRF Probable GTP-binding protein engB >gi|148530920|gb|ABQ82919.1| small GTP-binding protein [Lactobacillus reuteri F275] >gi|183224630|dbj|BAG25147.1| GTP-binding protein [Lactobacillus reuteri F275] (196 aa)
Score = 230, Expect = 8.3e-18, Identities = 65/165 (39%), Positives = 87/165 (52%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           S  S   +   +  EI  +GRSNVGKSSL N L N +  A TS+ PG+TQ  NFYD  DK   +D+PGYGYAKVSK +     K+I +Y+  R+ L  V Q++D     T  D+ M   L        IV  K DK  +S ++   + I   L  +    I+  SA  K
  S:    11 SAVSDEQYPKTNIPEIALVGRSNVGKSSLTNVLINRRNFAHTSSQPGKTQTLNFYDVEDKVYFVDVPGYGYAKVSKKERERFGKMIEQYLTQREQLRGVIQLVDARHEPTPDDVNMYNWLQYYNIPTLIVGTKIDKVKRSAWNRQLSLIKKTLDVESSTPIILFSATEK 179
>gi|194468441|ref|ZP_03074427.1| small GTP-binding protein [Lactobacillus reuteri 100-23] >gi|194453294|gb|EDX42192.1| small GTP-binding protein [Lactobacillus reuteri 100-23] (196 aa)
Score = 230, Expect = 8.4e-18, Identities = 65/165 (39%), Positives = 87/165 (52%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           S  S   +   +  EI  +GRSNVGKSSL N L N +  A TS+ PG+TQ  NFYD  DK   +D+PGYGYAKVSK +     K+I +Y+  R+ L  V Q++D     T  D+ M   L        IV  K DK  +S ++   + I   L  +    I+  SA  K
  S:    11 SAVSDEQYPKTNIPEIALVGRSNVGKSSLTNVLINRRNFAHTSSQPGKTQTLNFYDVEDKVYFVDVPGYGYAKVSKKERERFGKMIEQYLTQREQLRGVIQLVDARHEPTPDDVNMYNWLQYYNIPTLIVGTKIDKVKRSAWNRQLSLIKKALDVESSTPIILFSATEK 179
>gi|77361668|ref|YP_341243.1| GTPase EngB [Pseudoalteromonas haloplanktis TAC125] >gi|119369234|sp|Q3IJG3|ENGB_PSEHT Probable GTP-binding protein engB >gi|76876579|emb|CAI87801.1| putative GTPase with nucleoside triP hydrolase domain, involved in coordination of cell cycle [Pseudoalteromonas haloplanktis TAC125] (222 aa)
Score = 230, Expect = 8.5e-18, Identities = 65/177 (36%), Positives = 94/177 (53%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFY---DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIV--CVSAKNKTNIPNLKK 179
           SF+ S         D   E+ F GRSN GKSS +NAL + K+A+TS TPGRTQL N +   D D  RLIDLPGYG+AKV      +  K + EY+  R++L  +  ++DI   + DLD  +     +       +L KADK  +    +   K+  +L     +I     S+   T +P++ K
  S:    12 SFVTSAPDITKLPADTGIEVAFAGRSNAGKSSALNALTDQKLARTSKTPGRTQLINTFELADVDDMRLIDLPGYGFAKVPIEMKKKWQKSLGEYLQKRQSLKGIVILMDIRHPLKDLDRDLINWAISSEIPVLALLTKADKFKQGPRQSQVLKVRRELSALDGDITVHAFSSLKGTGLPDVAK 194
>gi|68249669|ref|YP_248781.1| GTPase EngB [Haemophilus influenzae 86-028NP] >gi|81335901|sp|Q4QLH6|ENGB_HAEI8 Probable GTP-binding protein engB >gi|68057868|gb|AAX88121.1| probable GTP-binding protein EngB [Haemophilus influenzae 86-028NP] (205 aa)
Score = 230, Expect = 8.6e-18, Identities = 56/127 (44%), Positives = 79/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKSLGEYLQKRECLAGLVVLMDIRHPLKDLDQQMIEWAVSANLPVLLLLTKADKLSQS 155
>gi|15615611|ref|NP_243915.1| GTPase EngB [Bacillus halodurans C-125] >gi|13124217|sp|Q9K8F7|ENGB_BACHD Probable GTP-binding protein engB >gi|10175671|dbj|BAB06768.1| GTP-binding protein [Bacillus halodurans C-125] (194 aa)
Score = 230, Expect = 8.6e-18, Identities = 59/139 (42%), Positives = 78/139 (56%)
  Q:    21 EICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVL-NKADKEAKSYFDNNFAKIAAKLKKD 159
           E+   GRSNVGKSS IN + N  K+A+TS  PG+TQ  NFY+  D    +D+PGYG+AKVSK       ++I  Y+  R  L AV QIIDI      D Q+       F    I++  K DK  K  +  +   IA+ L+KD
  S:    25 EVALAGRSNVGKSSFINKMINRKKLARTSQRPGKTQTLNFYNINDILHFVDVPGYGFAKVSKKDREAWGRMIETYLQQRGQLKAVLQIIDIRHDPTKDDQLMYDWLKHFEIPVIIIATKCDKIPKGKWPKHVKNIASVLEKD 166
>gi|46133299|ref|ZP_00156960.2| COG0218: Predicted GTPase [Haemophilus influenzae R2866] (205 aa)
Score = 230, Expect = 8.7e-18, Identities = 56/127 (44%), Positives = 79/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKSLGEYLQKRECLAGLVVLMDIRHPLKDLDQQMIEWAVSANLPILLLLTKADKLSQS 155
>gi|77972098|ref|ZP_00827677.1| COG0218: Predicted GTPase [Yersinia frederiksenii ATCC 33641] (207 aa)
Score = 229, Expect = 9.2e-18, Identities = 54/125 (43%), Positives = 75/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L N K +A+TS TPGRTQL N ++  +  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM            ++L KADK A
  S:    17 DEGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVVEGVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVLLLLTKADKLA 144
>gi|74316206|ref|YP_313946.1| cell division checkpoint GTPase YihA [Thiobacillus denitrificans ATCC 25259] >gi|119369277|sp|Q3SMA6|ENGB_THIDA Probable GTP-binding protein engB >gi|74055701|gb|AAZ96141.1| GTP-binding [Thiobacillus denitrificans ATCC 25259] (206 aa)
Score = 229, Expect = 9.3e-18, Identities = 60/145 (41%), Positives = 85/145 (58%)
  Q:    19 KKEICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           + E+ F GRSN GKSS IN L    ++A TS TPGRTQL NF++   D + L+DLPGYGYAKV      +   ++S Y+  R+ L  +  I+D    +T LD QM E  +      +I+L+KADK + S       K+  +L  D+E +
  S:    26 RAEVAFAGRSNAGKSSAINLLTRKNRLAFTSKTPGRTQLINFFELTADTY-LVDLPGYGYAKVPPEVKAKWEGLLSRYLQEREALAGMVLIMDARHPLTPLDRQMLEWFAPTGKPVHILLSKADKLSNSEKALTLRKVKQEL-ADRETV 172
>gi|56552523|ref|YP_163362.1| GTPase EngB [Zymomonas mobilis subsp. mobilis ZM4] >gi|13124231|sp|Q9RNL6|ENGB_ZYMMO GTP-binding protein engB (GTP-binding protein cgpA) >gi|5932358|gb|AAD56911.1|AF180145_3 GTP-binding protein CgpA [Zymomonas mobilis] >gi|56544097|gb|AAV90251.1| probable GTPase [Zymomonas mobilis subsp. mobilis ZM4] (212 aa)
Score = 229, Expect = 9.5e-18, Identities = 61/166 (36%), Positives = 92/166 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD---KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVIL 186
           E+ F GRSNVGKSSLINAL N   +A+ S TPGRTQ  NF+D     + RL+D+PGYG+AK  K        +I++Y+  R  L     +ID    I D+D  + ++L +    + +VL K+DK      +     I  +++K       I+  S++  T I  L+  +   I+
  S:    39 EVAFAGRSNVGKSSLINALTNRNSLARASTTPGRTQELNFFDVGEPLQMRLVDMPGYGFAKAPKDVVKRWKWLINDYLRGRAVLRRSLILIDSRHGIKDVDRDLMKMLDDAAISYRVVLTKSDKIKAVELEKTVKAITEEMRKHPAAFPEIIATSSEKGTGIAELRAAVYDAII 212
>gi|71274790|ref|ZP_00651078.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Dixon] >gi|71901070|ref|ZP_00683179.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Ann-1] >gi|170729963|ref|YP_001775396.1| GTP-binding protein [Xylella fastidiosa M12] >gi|71164522|gb|EAO14236.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Dixon] >gi|71729152|gb|EAO31274.1| GTP-binding protein, HSR1-related [Xylella fastidiosa Ann-1] >gi|167964756|gb|ACA11766.1| GTP-binding protein [Xylella fastidiosa M12] (219 aa)
Score = 229, Expect = 1.0e-17, Identities = 60/166 (36%), Positives = 86/166 (51%)
  Q:    16 TDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLI 181
           +DD  E+ F GRSN GKSS++N L     +A+ S TPGRTQ   ++     R L+DLPGYGYAKV K         I  Y + R+ L  +  ++DI   + + DLQM      R      +L KADK  +        K+  +L K   D  +I   S+K++  +  L  +I
  S:    38 SDDGSEVAFAGRSNAGKSSVLNTLTRQNALARVSKTPGRTQQLVYFTVTPQRYLVDLPGYGYAKVPKELQIHWQTFIDSYFHQRQALRGLVVVMDIRHPLKEYDLQMLAYARQRGLPAQALLTKADKLGRGQQAQTLQKVRNELTKHFADHIDIQTFSSKSRQGVEQLHTVI 209
>gi|170724428|ref|YP_001758454.1| GTP-binding protein HSR1-related [Shewanella woodyi ATCC 51908] >gi|169809775|gb|ACA84359.1| GTP-binding protein HSR1-related [Shewanella woodyi ATCC 51908] (219 aa)
Score = 229, Expect = 1.1e-17, Identities = 56/127 (44%), Positives = 77/127 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKSS +N L + K +A+TS TPGRTQL N ++ D+ R L+DLPGYG+A+V  +   +    + EY+  R+ L  V  ++DI   + DLD+QM E           +L KADK  +S
  S:    25 DAGVEIAFAGRSNAGKSSALNMLTDQKGLARTSKTPGRTQLINVFELDEHRRLVDLPGYGFAQVPLALKKKWQYALGEYLQERQCLTGVVVLMDIRHPLKDLDMQMIEWAVESEIPVLALLTKADKMKQS 154
>gi|120596877|ref|YP_961451.1| GTPase EngB [Shewanella sp. W3-18-1] >gi|166225984|sp|A1RE02|ENGB_SHESW Probable GTP-binding protein engB >gi|120556970|gb|ABM22897.1| GTP-binding protein, HSR1-related [Shewanella sp. W3-18-1] (219 aa)
Score = 229, Expect = 1.1e-17, Identities = 55/123 (44%), Positives = 77/123 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ D + RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM +           +L K+DK A+S
  S:    34 EIAFAGRSNAGKSSALNALTEQKSLARTSKTPGRTQLINVFELDSQRRLVDLPGYGFAQVPLAMKNKWQQALGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIQWAVASEIPVLALLTKSDKLAQS 159
>gi|118602244|ref|YP_903459.1| cell division checkpoint GTPase YihA [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|166225977|sp|A1AVN1|ENGB_RUTMC Probable GTP-binding protein engB >gi|118567183|gb|ABL01988.1| cell division checkpoint GTPase YihA [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (199 aa)
Score = 229, Expect = 1.1e-17, Identities = 65/155 (41%), Positives = 85/155 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFN-QHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           F+ SC S      D+  E+ F GRSN GKSS+IN L    K+AK S TPG+TQ   F++ DK  RL+DLPGYGYAKV K    +  K I+EY   R  L     ++DI     L  QM     +  N    I+L K+DK  K    N + K+  ++KK
  S:    10 FLLSCPSLKGCPPDEGYEVIFAGRSNAGKSSVINTLTLQNKLAKVSRTPGKTQHFVFFELDKDRRLVDLPGYGYAKVPKRVKTKWHKDINEYFNKRDCLRGTVLVMDIRHPFKLFDQMVLNWCHSINLSTQIILTKSDKLKKGAASNTYLKVHNQIKK 167
>gi|119773234|ref|YP_925974.1| GTPase EngB [Shewanella amazonensis SB2B] >gi|166225978|sp|A1S1P8|ENGB_SHEAM Probable GTP-binding protein engB >gi|119765734|gb|ABL98304.1| GTP-binding protein EngB [Shewanella amazonensis SB2B] (217 aa)
Score = 229, Expect = 1.1e-17, Identities = 57/123 (46%), Positives = 73/123 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N ++ D + RL+DLPGYG+AKV      +    + EY+  R  L  V  ++DI   + DLD QM E           +L KADK  +S
  S:    34 EIAFAGRSNAGKSSALNALTEQKSLARTSKTPGRTQLINVFELDAQRRLVDLPGYGFAKVPLEMKHKWQNALGEYLQKRACLSGVVVLMDIRHPLKDLDRQMIEWSVASEIPVLALLTKADKLGQS 159
>gi|184159605|ref|YP_001847944.1| GTPase [Acinetobacter baumannii ACICU] >gi|183211199|gb|ACC58597.1| predicted GTPase [Acinetobacter baumannii ACICU] (258 aa)
Score = 229, Expect = 1.1e-17, Identities = 64/168 (38%), Positives = 92/168 (54%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN--IVCVSAKNKTNIPNLKKLIG 182
           + D   EI F GRSN GKSS INAL N K +A+ S  PGRTQ+ NF+       RL+DLPGYGYA V +       K +  Y+  RK+L  +  ++DI   +   D+ M E   +R    +I+L KADK  +   +    ++  +LKK K +  I   S+ NK  +  L  ++ 
  S:    57 VEDSGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFSLGNPDQRLVDLPGYGYAAVPEDMKRVWQKELENYLIHRKSLQGLVLLMDIRHPLQHFDMMMLEWAYSRHLFVHILLTKADKLNRGPANKVLLEVKQQLKKMKLDFSIQLFSSLNKLGLEELASVMA 230
>gi|169632344|ref|YP_001706080.1| putative GTPase, involved in coordination of cell cycle (EngB) [Acinetobacter baumannii SDF] >gi|169151136|emb|CAO99805.1| putative GTPase, involved in coordination of cell cycle (EngB) [Acinetobacter baumannii] >gi|193078482|gb|ABO13484.2| putative cell cycle coordination GTPase (EngB) [Acinetobacter baumannii ATCC 17978] (258 aa)
Score = 229, Expect = 1.1e-17, Identities = 64/168 (38%), Positives = 92/168 (54%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN--IVCVSAKNKTNIPNLKKLIG 182
           + D   EI F GRSN GKSS INAL N K +A+ S  PGRTQ+ NF+       RL+DLPGYGYA V +       K +  Y+  RK+L  +  ++DI   +   D+ M E   +R    +I+L KADK  +   +    ++  +LKK K +  I   S+ NK  +  L  ++ 
  S:    57 VEDSGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFSLGNPDQRLVDLPGYGYAAVPEDMKRVWQKELENYLIHRKSLQGLVLLMDIRHPLQHFDMMMLEWAYSRHLFVHILLTKADKLNRGPANKVLLEVKQQLKKMKLDFSIQLFSSLNKLGLEELASVMA 230
>gi|27468266|ref|NP_764903.1| GTPase EngB [Staphylococcus epidermidis ATCC 12228] >gi|57867148|ref|YP_188811.1| GTPase EngB [Staphylococcus epidermidis RP62A] >gi|38257583|sp|Q8CS80|ENGB_STAES Probable GTP-binding protein engB >gi|71151869|sp|Q5HNN0|ENGB_STAEQ Probable GTP-binding protein engB >gi|27315812|gb|AAO04947.1|AE016748_181 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] >gi|57637806|gb|AAW54594.1| GTP-binding protein, EngB family [Staphylococcus epidermidis RP62A] (195 aa)
Score = 229, Expect = 1.1e-17, Identities = 60/148 (40%), Positives = 90/148 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSA 168
           E+   GRSNVGKS+ IN++   K +A+TS  PG+TQ  NFY+ D +   +D+PGYGYAKVSK +  +  K+I EYI  R+NL  V Q++D+    T+ D+ M   L +      ++  K DK AK     +  +I  KL+ +  +NI+  S+
  S:    27 EVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKVQREKFGKMIEEYITQRENLKLVIQLVDLRHQPTEDDVLMYNYLKHFDIPTLVICTKEDKIAKGKVQKHIKRIKDKLELESGDNIISYSS 178
>gi|169334576|ref|ZP_02861769.1| hypothetical protein ANASTE_00979 [Anaerofustis stercorihominis DSM 17244] >gi|169259293|gb|EDS73259.1| hypothetical protein ANASTE_00979 [Anaerofustis stercorihominis DSM 17244] (193 aa)
Score = 229, Expect = 1.1e-17, Identities = 66/150 (44%), Positives = 98/150 (65%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQM-SELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           +DK EI  IG+SNVGKSS IN L N K +A+TS+ PG+T+ AN+Y  + +F ++D+PGYGYAKVSKS+    S II++Y+  R     VF ++DI    ++ D++M +E+L N      +VL KADK +K+    N   I   L  D+++ V +
  S:    21 EDKLEIVLIGKSNVGKSSFINNLLNRKSLARTSSVPGKTRTANYYIINNEFYIVDMPGYGYAKVSKSEKATFSNIITDYLKKRNADFIVFFLVDIRHKPSENDIKMYNEILDNDIYP-VVVLTKADKISKNKRKQNIDLIKKTLGLDEDDKVII 173
>gi|194290991|ref|YP_002006898.1| GTPase binding protein, involved in coordination of cell cycle [Cupriavidus taiwanensis] >gi|193224826|emb|CAQ70837.1| GTPase binding protein, involved in coordination of cell cycle [Cupriavidus taiwanensis] (237 aa)
Score = 229, Expect = 1.1e-17, Identities = 59/164 (35%), Positives = 92/164 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSV 184
           E+ F GRSN GKS+ IN L N K +A +S TPGRTQ  N++     +       L+DLPGYGYA+VS S  +    ++S+Y+  R+ L  +  ++D     TDLD QM E         +++L KADK   S       + A  L++ ++ +   + + +T +P   +L  S+
  S:    26 EVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINYFSVAPVKAPDPLAFLVDLPGYGYAEVSGSAKYHWQGLLSDYVQTRQQLAGLILMMDARRPFTDLDCQMVEWFLPTGRPIHVLLTKADKLTNS-------ENAKALRETRKMLQGYAEQLETPVPMTAQLFSSL 191
>gi|187935182|ref|YP_001887073.1| GTP-binding protein [Clostridium botulinum B str. Eklund 17B] >gi|187723335|gb|ACD24556.1| GTP-binding protein [Clostridium botulinum B str. Eklund 17B] (198 aa)
Score = 229, Expect = 1.1e-17, Identities = 64/159 (40%), Positives = 90/159 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           FI S    + +  D + E+ F+GRSNVGKSSLIN+L N  K+AK S TPG+T+L NF+  +  F L+DLPGYGYAKVSKS+     K I  Y+  R+ L  +  ++D     T  D+ M E   +      +V  K+DK   + F  +   I   L   K++
  S:     8 FIISAVKPHQYPIDHRNEVAFVGRSNVGKSSLINSLTNRKKLAKVSGTPGKTRLINFFLINNDFYLVDLPGYGYAKVSKSEKDTWGKTIETYLSHREELKRIVCLVDSRHKPTGDDIMMYEWAKHFGYDVVVVATKSDKLKNAEFKKSEKLIRETLNLTKDD 169
>gi|166031006|ref|ZP_02233835.1| hypothetical protein DORFOR_00687 [Dorea formicigenerans ATCC 27755] >gi|166029273|gb|EDR48030.1| hypothetical protein DORFOR_00687 [Dorea formicigenerans ATCC 27755] (196 aa)
Score = 229, Expect = 1.1e-17, Identities = 59/141 (41%), Positives = 82/141 (58%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK 157
           + K EI F G+SNVGKSSLINAL N K  A+ S TPG+TQ  N+Y   D+  L+DLPGYGYAKVS+ +  +  ++I  Y++    L AVF +IDI    ++ D  M + +  +     I+  K DK  +S        +   LK
  S:    21 NTKPEIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINYYSINDEMYLVDLPGYGYAKVSEQEKIKWGQLIERYLHSSAQLKAVFLLIDIRHAPSENDRIMYQWIVEQGFHPIIIATKLDKIKRSQVQKQMKVLREGLK 164
>gi|163860137|gb|ABY41232.1| putative GTP-binding protein [Pseudomonas fluorescens] (146 aa)
Score = 229, Expect = 1.2e-17, Identities = 51/117 (43%), Positives = 72/117 (61%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQM 119
           +F+ S    +    D+  E+ F GRSN GKSS +N L +A +A+TS TPGRTQL NF+   D+ RL+DLPGYGYAKV         + +  Y+  R++L  +  ++DI   +TD DL M
  S:    15 TFMLSAAKVDQCPDDEGFEVAFAGRSNAGKSSALNTLTHASLARTSKTPGRTQLLNFFKLDDERRLVDLPGYGYAKVPIPLKQHWQRHLEAYLGSRESLKGLILMMDIRHPMTDFDLLM 133
>gi|162319777|ref|YP_423720.2| GTPase EngB [Magnetospirillum magneticum AMB-1] (187 aa)
Score = 229, Expect = 1.2e-17, Identities = 58/164 (35%), Positives = 95/164 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK---KDKENIVCVSAKNKTNIPNLKKLIGSV 184
           E+ F GRSNVGKSSLINAL     +A+TSNTPGRTQ  NF++   +  L+D+PGYG+A+  K    + +++++ ++  R  L     ++D    + D D  M ++L      + +VL KADK   +  D   A+   ++K       +++  S++  T IP L+  + S+
  S:    17 EVAFAGRSNVGKSSLINALTGRNTLARTSNTPGRTQELNFFNLGGRLILVDMPGYGFAQAPKGLVEKWTRLVNGFLKGRSVLRRAVVLVDSRHGLKDSDRDMMKMLDKAAVVYQVVLTKADKLKAAELDAVQARTLEEIKGRVAAHPHLIVTSSEKGTGIPELRAELASL 186
>gi|150005485|ref|YP_001300229.1| GTPase EngB [Bacteroides vulgatus ATCC 8482] >gi|166225943|sp|A6L4J3|ENGB_BACV8 Probable GTP-binding protein engB >gi|149933909|gb|ABR40607.1| putative GTP-binding protein [Bacteroides vulgatus ATCC 8482] (200 aa)
Score = 228, Expect = 1.2e-17, Identities = 61/147 (41%), Positives = 85/147 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           D+  E  FIGRSNVGKSSLIN LA   K+A TS+TPG+T L N +  +K + L+DLPGYGYA   K +  ++ +II +YI  R+ +  +F +ID  +    +DL+  E L        I+  KADK       +N  K   KL +  E +
  S:    21 DNLPEYAFIGRSNVGKSSLINMLAKRPKLAMTSSTPGKTLLINHFLINKEWYLVDLPGYGYASRGKKQVEKIQQIIEDYILEREQMTNLFVLIDCRLEPQKIDLEFMEWLGENGVPFSIIFTKADKLTNGKVKDNVNKYLKKLTEQWEEL 170
>gi|83643889|ref|YP_432324.1| GTPase [Hahella chejuensis KCTC 2396] >gi|119369202|sp|Q2SN75|ENGB_HAHCH Probable GTP-binding protein engB >gi|83631932|gb|ABC27899.1| predicted GTPase [Hahella chejuensis KCTC 2396] (222 aa)
Score = 228, Expect = 1.2e-17, Identities = 56/138 (40%), Positives = 79/138 (57%)
  Q:    21 EICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           E+ F GRSN GKSS +NA+  N K+AKTS TPGRTQL NF+  +    RL+DLPGYGYAKV K+   +    +  Y+  R  L A+  ++DI   ++  D  M +    R     ++L KADK           ++  +LK+
  S:    33 EVAFAGRSNAGKSSALNAITQNGKLAKTSKTPGRTQLINFFTLNSEGCRLVDLPGYGYAKVPKAMLEKWRSNLQRYLEHRLTLNALILVMDIRHPLSPFDCSMLDWCEARDLPTLVLLTKADKLKYGPAKTTLQEVKKELKQ 174
>gi|169188024|ref|ZP_02848181.1| small GTP-binding protein [Paenibacillus sp. JDR-2] >gi|169005048|gb|EDS51902.1| small GTP-binding protein [Paenibacillus sp. JDR-2] (201 aa)
Score = 228, Expect = 1.2e-17, Identities = 69/182 (37%), Positives = 98/182 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKSYFDNNFAKIAAKLKKD-KENIVCVSAKNKTNIPNLKKLIGSVI 185
           FI S    + +  D   EI   GRSNVGKSSLIN L   K +A+TS+ PG+TQ  N+Y   D    +D PGYGYAKVSK++     ++I  YI  RK L     +ID+      D    ++L   + +HY     IV  KADK  K  +D +   I   L+ D ++++V  S++       L ++I   I
  S:     8 FIISAVRPSQYPVDALPEIALAGRSNVGKSSLINKLILRKNLARTSSQPGKTQQLNYYRVNDMVYFVDFPGYGYAKVSKTQRELFGQMIETYIRDRKELKLQLLVIDMRHAPSKD----DVLMYHWLKHYNVPTCIVCTKADKIPKGKWDKHVKVIKETLEADPRDSLVMFSSETGLGREKLWEVINGAI 193
>gi|119470392|ref|ZP_01613120.1| GTP-binding protein [Alteromonadales bacterium TW-7] >gi|119446317|gb|EAW27593.1| GTP-binding protein [Alteromonadales bacterium TW-7] (225 aa)
Score = 228, Expect = 1.3e-17, Identities = 58/137 (42%), Positives = 77/137 (56%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAKIAKTSNTPGRTQLANFY---DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           SF+ S         D   E+ F GRSN GKSS +NAL + K+A+TS TPGRTQL N +   D D  RLIDLPGYG+AKV      +  K + EY+  R++L  +  ++DI   + DLD  +             +L KADK
  S:    12 SFVTSAPDITKLPADTGIEVAFAGRSNAGKSSALNALTDQKLARTSKTPGRTQLINTFELADVDNMRLIDLPGYGFAKVPIEMKKKWQKSLGEYLQKRQSLKGIVVLMDIRHPLKDLDRDLINWAIGSEIPVLALLTKADK 152
>gi|192813783|ref|ZP_03042440.1| small GTP-binding protein [Geobacillus sp. Y412MC10] >gi|192797372|gb|EDV73895.1| small GTP-binding protein [Geobacillus sp. Y412MC10] (214 aa)
Score = 228, Expect = 1.3e-17, Identities = 61/140 (43%), Positives = 82/140 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKS 143
           F+ S      +  D   EI   GRSNVGKSSLIN + + K +A+TS TPG+TQ  N+Y   D   L+D PGYGYAKVSK++     ++I  Y+  R+ L  V  I+D+    +  D+ M E L     QHY     +V  KADK  K+
  S:     8 FVISAVVPAQYPEDALPEIALAGRSNVGKSSLINRMISRKNLARTSATPGKTQQLNYYRVNDDLYLVDFPGYGYAKVSKTQRAAFGEMIERYLLSREELKLVLLIVDMRHPPSKDDISMYEWL-----QHYNRPVCVVATKADKIPKT 150
>gi|150026105|ref|YP_001296931.1| GTPase EngB [Flavobacterium psychrophilum JIP02/86] >gi|166225953|sp|A6H1A5|ENGB_FLAPJ Probable GTP-binding protein engB >gi|149772646|emb|CAL44129.1| Probable GTP-binding protein EngB [Flavobacterium psychrophilum JIP02/86] (205 aa)
Score = 228, Expect = 1.3e-17, Identities = 63/139 (45%), Positives = 79/139 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           E  FIGRSNVGKSSLIN L N K +AKTS  PG+TQL N +  +  + L+DLPGYGYAKVSK       + I++Y   R+ LV  F +IDI      +DL+    L        IV  KADK +K     + A     L K+
  S:    25 EYAFIGRSNVGKSSLINMLTNHKSLAKTSGRPGKTQLINHFKINNNWFLVDLPGYGYAKVSKKTKEVFQQFITDYFEKREQLVCAFVLIDIRHEAQKIDLEFITYLGEIELPFCIVFTKADKISKGKVAQHVAAYRTALLKN 166
>gi|84704992|ref|ZP_01018492.1| GTP-binding protein [Parvularcula bermudensis HTCC2503] >gi|84689828|gb|EAQ15670.1| GTP-binding protein [Parvularcula bermudensis HTCC2503] (213 aa)
Score = 228, Expect = 1.4e-17, Identities = 55/122 (45%), Positives = 74/122 (60%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D  E  F GRSNVGKSSLIN L   K +A+TSNTPGRT+  NF+D   + RL+DLPGYGYAK S+S     + +  +++  R NL  V  ++D    +  +D +   LL      + +VL K DK
  S:    38 DLPEFAFAGRSNVGKSSLINRLTGRKALARTSNTPGRTRELNFFDLGGRLRLVDLPGYGYAKASRSAVESWTGLTRDFLRGRPNLRRVHILVDSRHGLKPVDEETMSLLDESAVPYQLVLTKIDK 162
>gi|163791245|ref|ZP_02185661.1| GTP-binding protein [Carnobacterium sp. AT7] >gi|159873515|gb|EDP67603.1| GTP-binding protein [Carnobacterium sp. AT7] (195 aa)
Score = 228, Expect = 1.5e-17, Identities = 58/143 (40%), Positives = 83/143 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           EI   GRSNVGKSS IN + N K +A+TS  PG+TQ  N+Y   D F  +D+PGYGYAKVSK++  +  +++  Y   R+ L     ++D+    T+ D+QM E L        +V  KADK  +  ++ +      K+ KDK NI
  S:    25 EIALAGRSNVGKSSFINTMINRKGLARTSGKPGKTQTLNYYIIEDSFYFVDVPGYGYAKVSKTERAKWGQMLEVYFTQRETLKVALSVVDLRHPPTEDDVQMYEFLKYHSIPVIVVATKADKIPRGKWNKHI-----KIVKDKLNI 165
>gi|163724633|ref|ZP_02132162.1| small GTP-binding protein [Desulfatibacillum alkenivorans AK-01] >gi|161402137|gb|EDQ26376.1| small GTP-binding protein [Desulfatibacillum alkenivorans AK-01] (197 aa)
Score = 228, Expect = 1.5e-17, Identities = 50/92 (54%), Positives = 64/92 (69%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVI 112
           EI F GRSNVGKSSLIN+L    K+ KTS+TPGRTQL NF++ ++    +DLPGYGYAKVSK    +  ++I  +I  RK L  V  I+D+  I
  S:    17 EIAFAGRSNVGKSSLINSLLKRKKLVKTSSTPGRTQLLNFFEVNESLVFVDLPGYGYAKVSKEMRKKWGQMIETFITTRKTLHGVVLILDLRRI 110
>gi|85705861|ref|ZP_01036957.1| GTP-binding protein [Roseovarius sp. 217] >gi|85669449|gb|EAQ24314.1| GTP-binding protein [Roseovarius sp. 217] (216 aa)
Score = 227, Expect = 1.6e-17, Identities = 61/181 (33%), Positives = 95/181 (52%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  NF+   +   L+DLPGYGYA    +   +   ++ +Y+  R+ L   F ++D    I  +D ++  LL         VL K DK   +  D    ++ +KL         ++  S++    +  L+  I ++
  S:    29 FVKGVVAMSGLPPADRLEVCFAGRSNVGKSSLINALTGRKALARASNTPGRTQEINFFALGESHYLVDLPGYGYANAPLAVVQKWQALLKQYLSGRQTLRRAFVLVDARHGIKTVDEEIMTLLDGAAVTFQCVLTKTDKINAADRDRVLDQVRSKLAPHPAAFPELILTSSEKSEGLATLRATIATL 215
>gi|167038047|ref|YP_001665625.1| small GTP-binding protein [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040912|ref|YP_001663897.1| small GTP-binding protein [Thermoanaerobacter sp. X514] >gi|166855152|gb|ABY93561.1| small GTP-binding protein [Thermoanaerobacter sp. X514] >gi|166856881|gb|ABY95289.1| small GTP-binding protein [Thermoanaerobacter pseudethanolicus ATCC 33223] (192 aa)
Score = 227, Expect = 1.6e-17, Identities = 66/171 (38%), Positives = 95/171 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNI 174
           F +S F+   +  D+  +I  +GRSNVGKS+LIN + N K +AKTS+ PG+T+  NFY  + KF L+DLPGYGYAKVSK    + +  I  ++   +NL     +IDI    T+ D  M     ++     +VL KADK  KS        I    K ++E ++  SA  K  +
  S:     8 FARSAFNEEQYPKDNLPQIVIVGRSNVGKSTLINTVLNRKNLAKTSSRPGKTRGINFYLINNKFYLVDLPGYGYAKVSKEMKKQWAHNIETFLNTSQNLRHGLFLIDIRRNPTEDDFLMINWFKHKNLPFTVVLTKADKVNKSESRKAVEDICKIFKINREEVIIFSALEKMGV 181
>gi|52081302|ref|YP_080093.1| GTPase EngB [Bacillus licheniformis ATCC 14580] >gi|52786681|ref|YP_092510.1| GTPase EngB [Bacillus licheniformis ATCC 14580] >gi|81825232|sp|Q65GJ7|ENGB_BACLD Probable GTP-binding protein engB >gi|52004513|gb|AAU24455.1| GTP-binding domain,Small GTP-binding protein domain [Bacillus licheniformis ATCC 14580] >gi|52349183|gb|AAU41817.1| YsxC [Bacillus licheniformis DSM 13] (195 aa)
Score = 227, Expect = 1.6e-17, Identities = 59/151 (39%), Positives = 91/151 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           EI   GRSNVGKSS IN + N K +A+TS+ PG+TQ  NFY   D    +D+PGYG+AKVSK++     ++I  Y+  R+ L AV QI+D+      D    +++   F +HY     ++  KADK  K  ++ +   +   L  +KE+ ++  S++ K
  S:    25 EIALAGRSNVGKSSFINTMINRKNLARTSSKPGKTQTLNFYIINDVLHFVDVPGYGFAKVSKTEREAWGRMIETYLTSREELKAVVQIVDLRHAPSQD----DVMMYDFLKHYEIPVIVIATKADKIPKGKWEKHAKVVKETLNIEKEDRLILFSSETK 179
>gi|169794587|ref|YP_001712380.1| putative GTPase, involved in coordination of cell cycle (EngB) [Acinetobacter baumannii AYE] >gi|169147514|emb|CAM85375.1| putative GTPase, involved in coordination of cell cycle (EngB) [Acinetobacter baumannii] (258 aa)
Score = 227, Expect = 1.7e-17, Identities = 64/168 (38%), Positives = 92/168 (54%)
  Q:    15 ITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN--IVCVSAKNKTNIPNLKKLIG 182
           + D   EI F GRSN GKSS INAL N K +A+ S  PGRTQ+ NF+       RL+DLPGYGYA V +       K +  Y+  RK+L  +  ++DI   +   D+ M E   +R    +I+L KADK  +   +    ++  +LKK K +  I   S+ NK  +  L  ++ 
  S:    57 VEDSGYEIAFAGRSNAGKSSAINALTNQKQLARASKKPGRTQMINFFSLGNPDQRLVDLPGYGYAAVPEDMKRVWQKELENYLIHRKSLQGLVLLMDIRHPLQHFDMMMLEWAYSRHLFVHILLTKADKLNRGPANKVLLEVKQQLKKMKLDFSIQLFSSLNKLGLEELASVMA 230
>gi|118586682|ref|ZP_01544120.1| GTP-binding protein [Oenococcus oeni ATCC BAA-1163] >gi|118432867|gb|EAV39595.1| GTP-binding protein [Oenococcus oeni ATCC BAA-1163] (198 aa)
Score = 227, Expect = 1.8e-17, Identities = 64/154 (41%), Positives = 83/154 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK 157
            I S  S   +   +  EI F+GRSNVGKSSLIN L     +A TS  PG+TQ  NFY+ D K   +D+PGYGYAKVSK++  +   ++ EY+  R  L  V  +ID     T+ D  M   L        IV  KADK A   F+   ++I   LK
  S:     8 LIISAVSKKQYPAGNLSEIAFVGRSNVGKSSLINTLIERNGLAHTSGQPGKTQTLNFYNLDEKLFFVDVPGYGYAKVSKAQREQFGSMVEEYLSSRDQLKGVISLIDARHEPTEDDKLMYNWLEYYQVPILIVATKADKVASGKFNAVESQIKKTLK 164
>gi|18310371|ref|NP_562305.1| GTPase EngB [Clostridium perfringens str. 13] >gi|110800363|ref|YP_696084.1| GTPase EngB [Clostridium perfringens ATCC 13124] >gi|168207810|ref|ZP_02633815.1| GTP-binding protein [Clostridium perfringens E str. JGS1987] >gi|168215329|ref|ZP_02640954.1| GTP-binding protein [Clostridium perfringens CPE str. F4969] >gi|168217820|ref|ZP_02643445.1| GTP-binding protein [Clostridium perfringens NCTC 8239] >gi|169342290|ref|ZP_02863368.1| GTP-binding protein [Clostridium perfringens C str. JGS1495] >gi|24418379|sp|Q8XKK5|ENGB_CLOPE Probable GTP-binding protein engB >gi|119369185|sp|Q0TQK6|ENGB_CLOP1 Probable GTP-binding protein engB >gi|18145051|dbj|BAB81095.1| probable GTP binding protein [Clostridium perfringens str. 13] >gi|110675010|gb|ABG83997.1| ribosome biogenesis GTP-binding protein YsxC [Clostridium perfringens ATCC 13124] >gi|169299617|gb|EDS81676.1| GTP-binding protein [Clostridium perfringens C str. JGS1495] >gi|170660856|gb|EDT13539.1| GTP-binding protein [Clostridium perfringens E str. JGS1987] >gi|170713286|gb|EDT25468.1| GTP-binding protein [Clostridium perfringens CPE str. F4969] >gi|182380168|gb|EDT77647.1| GTP-binding protein [Clostridium perfringens NCTC 8239] (197 aa)
Score = 227, Expect = 1.9e-17, Identities = 59/136 (43%), Positives = 82/136 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           FI S      +  D+  EI F+GRSNVGKSS+IN+L N + +AK S TPG+T+L NF+  +K F L+DLPGYGYAKVSK +       I  Y+  R  L  V  ++D     T  D+QM E + +   +  ++  K+DK
  S:     8 FIISAVKREQYPDDNLPEIAFVGRSNVGKSSIINSLTNRRGLAKVSQTPGKTRLINFFLLNKDFYLVDLPGYGYAKVSKKEKASWGATIERYLLNRGPLKKVVLLVDCRHKPTADDVQMYEWIKHYGYEVVVIATKSDK 146
>gi|30250379|ref|NP_842449.1| GTPase EngB [Nitrosomonas europaea ATCC 19718] >gi|81584537|sp|Q82S94|ENGB_NITEU Probable GTP-binding protein engB >gi|30181174|emb|CAD86370.1| putative GTP-binding protein [Nitrosomonas europaea ATCC 19718] (222 aa)
Score = 227, Expect = 1.9e-17, Identities = 53/123 (43%), Positives = 74/123 (60%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           E+ F GRSN GKSS IN L    + A  S TPGRTQ  NF+   + R ++DLPGYGYA+V  +       ++S Y+  R++L  +  I+DI   +T LDLQM +         +++L KADK +KS
  S:    28 EVAFAGRSNAGKSSAINTLVGRERFAFVSKTPGRTQHINFFQLGEERFMVDLPGYGYAQVPLAIRQHWGHLLSSYLQTRQSLYGMILIMDIRHPLTKLDLQMLDWFRQTKKPVHVLLTKADKLSKS 153
>gi|88713181|ref|ZP_01107265.1| putative GTP-binding protein [Flavobacteriales bacterium HTCC2170] >gi|88708562|gb|EAR00798.1| putative GTP-binding protein [Flavobacteriales bacterium HTCC2170] (203 aa)
Score = 227, Expect = 2.0e-17, Identities = 57/119 (47%), Positives = 73/119 (61%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           E  FIGRSNVGKSSLIN L   K +AKTS  PG+TQL N +  +  + L+DLPGYGYA+VSK       K I++Y   RK LV+ F ++DI      +D++  E L        I+  KADK
  S:    25 EYAFIGRSNVGKSSLINMLTERKSLAKTSGRPGKTQLINHFKINGNWFLVDLPGYGYARVSKKDKRTFQKYITDYFIKRKQLVSAFVLVDIRHEPQKVDMEFMEYLGENMIPFSIIFTKADK 146
>gi|110802133|ref|YP_698700.1| GTPase EngB [Clostridium perfringens SM101] >gi|119369186|sp|Q0ST57|ENGB_CLOPS Probable GTP-binding protein engB >gi|110682634|gb|ABG86004.1| Predicted GTPase, YSXC [Clostridium perfringens SM101] (197 aa)
Score = 226, Expect = 2.1e-17, Identities = 59/136 (43%), Positives = 82/136 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           FI S      +  D+  EI F+GRSNVGKSS+IN+L N + +AK S TPG+T+L NF+  +K F L+DLPGYGYAKVSK +       I  Y+  R  L  V  ++D     T  D+QM E + +   +  ++  K+DK
  S:     8 FIISAVKREQYPDDNLPEIAFVGRSNVGKSSIINSLTNRRGLAKVSQTPGKTRLINFFLLNKDFYLVDLPGYGYAKVSKKEKASWGATIERYLLNRGPLKKVVLLVDCRHKPTADDVQMYEWIKHYGYEVVVIATKSDK 146
>gi|163764311|ref|ZP_02171369.1| phosphate binding protein [Bacillus selenitireducens MLS10] >gi|160355392|gb|EDP82047.1| phosphate binding protein [Bacillus selenitireducens MLS10] (212 aa)
Score = 226, Expect = 2.1e-17, Identities = 55/142 (38%), Positives = 83/142 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           E+   GRSNVGKSS IN L N K +A+TS  PG+TQ  NFY   D+F  +D+PGYGYAKVSK++     K +  Y   R+ L  V Q+ID     ++ D+ M + L +  ++  ++  K DK  +  +  +  +I+  L +D  +
  S:    25 EVALSGRSNVGKSSFINTLINRKGLARTSQRPGKTQTLNFYIINDRFHFVDVPGYGYAKVSKAERAAWGKTLELYFSSREQLNGVVQLIDSRHKPSEDDILMYDWLKHHGHKVVLIATKCDKIPRGKWAKSKKQISGDLNRDPSD 169
>gi|167748794|ref|ZP_02420921.1| hypothetical protein ANACAC_03568 [Anaerostipes caccae DSM 14662] >gi|167651764|gb|EDR95893.1| hypothetical protein ANACAC_03568 [Anaerostipes caccae DSM 14662] (204 aa)
Score = 226, Expect = 2.2e-17, Identities = 57/144 (39%), Positives = 86/144 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIV 164
           E+ F G+SNVGKSSLINAL N K  A+ S  PG+TQ  N+Y+  ++   +DLPGYGYAKV++S   +   +I  Y++  K L  VF +IDI    +  D+ M + + +      I+  K+DK  +S    +  +I  +L+ +KE  V
  S:    25 EVAFAGKSNVGKSSLINALMNRKSYARVSAQPGKTQTINYYNINEELYYVDLPGYGYAKVTESVKEQWGAMIERYLHTSKQLKLVFLLIDIRHKPSKNDVMMYDWIVHNGYHPVIIATKSDKLKRSQLPKHVKEIRQELRLNKETPV 171
>gi|153008691|ref|YP_001369906.1| GTPase EngB [Ochrobactrum anthropi ATCC 49188] >gi|151560579|gb|ABS14077.1| GTP-binding protein HSR1-related [Ochrobactrum anthropi ATCC 49188] (241 aa)
Score = 226, Expect = 2.2e-17, Identities = 55/119 (46%), Positives = 77/119 (64%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSNVGKSSLINAL N K +A+TSNTPGRTQ  N++          D     L+D+PGYG+A+  K++    ++++ +Y+  R  L  V+ +ID    I   D ++ +LL      + IVL K DK
  S:    59 EIAFAGRSNVGKSSLINALVNKKGLARTSNTPGRTQELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVYVLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDK 189
>gi|49483916|ref|YP_041140.1| GTPase EngB [Staphylococcus aureus subsp. aureus MRSA252] >gi|56749018|sp|Q6GG32|ENGB_STAAR Probable GTP-binding protein engB >gi|49242045|emb|CAG40744.1| putative GTP-binding protein [Staphylococcus aureus subsp. aureus MRSA252] (196 aa)
Score = 226, Expect = 2.3e-17, Identities = 58/170 (34%), Positives = 94/170 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTN 173
            I S    + +   +  E+   GRSNVGKS+ IN++   K +A+TS  PG+TQ  NFY+ D +   +D+PGYGYAKVSK++  +  K+I EYI  R+NL  V Q++D+      D    ++L   + +H+     ++  K DK  K     +   I  +L  D ++ +   +  + N
  S:    10 LIISAVKEDQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLR----HDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNN 182
>gi|167761300|ref|ZP_02433427.1| hypothetical protein CLOSCI_03705 [Clostridium scindens ATCC 35704] >gi|167660966|gb|EDS05096.1| hypothetical protein CLOSCI_03705 [Clostridium scindens ATCC 35704] (200 aa)
Score = 226, Expect = 2.3e-17, Identities = 59/136 (43%), Positives = 80/136 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           EI F G+SNVGKSSLINAL N K  A+ S TPG+TQ  NFY+  ++  L+DLPGYGYAKVS+ +  +  K+I  Y++    L AVF +IDI       D  M + +  +     I+  K DK  +S  D +   +   L
  S:    25 EIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYNINEELYLVDLPGYGYAKVSEQEKAKWGKLIERYLHGSAQLKAVFLLIDIRHDPSANDKMMYDWIVAQGYNPIIIATKLDKIKRSQVDKHLKAVRQGL 163
>gi|21674964|ref|NP_663029.1| GTPase EngB [Chlorobium tepidum TLS] >gi|25452938|sp|Q8KAK5|ENGB_CHLTE Probable GTP-binding protein engB >gi|21648196|gb|AAM73371.1| GTP-binding protein [Chlorobium tepidum TLS] (192 aa)
Score = 226, Expect = 2.3e-17, Identities = 59/136 (43%), Positives = 80/136 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVI-TDLDLQMSELLSNRFNQHYIVLNKADK 139
           F  S  S N   +D + EI F+GRSNVGKSSL+N+L A   +AKTS+TPG+T+L N++   D    +DLPGYGYAKV + +     K+++ YI  R  +  V  ++D        DL+M E L        IVL K DK
  S:     8 FFCSYSSLNGLPSDGRPEIVFVGRSNVGKSSLLNSLCARKGLAKTSSTPGKTRLINYFIINDNLYFVDLPGYGYAKVGQGERESWGKLLTGYIQKRGEIALVVLLVDSRHPGMASDLEMMEFLDYCGRPFGIVLTKWDK 146
>gi|154707542|ref|YP_001423657.1| GTP-binding protein [Coxiella burnetii Dugway 5J108-111] >gi|165919241|ref|ZP_02219327.1| GTP-binding protein [Coxiella burnetii RSA 334] >gi|189037175|sp|A9KBW2|ENGB_COXBN Probable GTP-binding protein engB >gi|154356828|gb|ABS78290.1| GTP-binding protein [Coxiella burnetii Dugway 5J108-111] >gi|165917035|gb|EDR35639.1| GTP-binding protein [Coxiella burnetii RSA 334] (205 aa)
Score = 226, Expect = 2.3e-17, Identities = 55/165 (33%), Positives = 95/165 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK--DKENIVCVSAKNKTNIPNLKKLI 181
           D   EI FIGRSN GKSS +N +   K +A+TS TPGRTQ+ NF+  ++  RL+DLPGYGYAKV +       +++  Y+  R+ L  +  ++DI   + ++D  + E   N     +I+L K+DK +++       ++   +    +K  +   S+ ++T +  +K ++
  S:    28 DQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFALNEHERLVDLPGYGYAKVPRMVQKRWEELVDSYLKKRRCLKGLVVVMDIRHPLKEMDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAYGEKLTLQLFSSHDRTGLDEVKAVL 197
>gi|153854550|ref|ZP_01995820.1| hypothetical protein DORLON_01815 [Dorea longicatena DSM 13814] >gi|149752859|gb|EDM62790.1| hypothetical protein DORLON_01815 [Dorea longicatena DSM 13814] (196 aa)
Score = 226, Expect = 2.5e-17, Identities = 58/126 (46%), Positives = 79/126 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFD 146
           EI F G+SNVGKSSLINAL N K  A+ S TPG+TQ  NFY+  ++  L+DLPGYGYAKVS+ +  +  ++I  Y++  K L  VF +IDI    +  D  M E + ++     I+  K DK  +S  D
  S:    25 EIAFAGKSNVGKSSLINALMNRKSYARISATPGKTQTINFYNINEELYLVDLPGYGYAKVSEQEKIKWGQLIERYLHGSKQLKVVFLLIDIRHKPSGNDKMMYEWIVSQGFNPVIIATKLDKIKRSQKD 153
>gi|94270231|ref|ZP_01291683.1| GTP-binding [delta proteobacterium MLMS-1] >gi|93450888|gb|EAT01901.1| GTP-binding [delta proteobacterium MLMS-1] (199 aa)
Score = 226, Expect = 2.5e-17, Identities = 63/174 (36%), Positives = 89/174 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNL 177
           F+ S F        +  EI F GRSNVGKSSLIN L   K + K S  PG+T+  NFY  D +  L+DLPGYGYAKV K    +  +++  Y+  R NL  V  IID+   + +LD  +++ L +      +V  K DK +++        +   L    E  +  SAK+    P L
  S:    12 FVDSVFDLAKLPAGELPEIAFAGRSNVGKSSLINCLLGRKNLVKVSAKPGKTRSLNFYLVDERLHLVDLPGYGYAKVDKRMQEQWRQLVGGYLEKRDNLRCVVVIIDLRHELKELDRLLAQWLRDIGVAFLLVYTKMDKLSRNQQQRQARLLDGGLGISPEQRLLFSAKSGEGRPEL 188
>gi|114706825|ref|ZP_01439725.1| GTP-binding protein [Fulvimarina pelagi HTCC2506] >gi|114537773|gb|EAU40897.1| GTP-binding protein [Fulvimarina pelagi HTCC2506] (217 aa)
Score = 226, Expect = 2.6e-17, Identities = 63/162 (38%), Positives = 93/162 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKF----------RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIG 182
           E+ F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  NF+  D F           ++D+PGYGYA+  K K    ++++ +Y+  R  L  VF +ID    I   D ++ +LL      + IVL K DK   +      A     ++K       I+  S++ ++ +  L+  +G
  S:    37 EVAFAGRSNVGKSSLINALLGQKGLARTSNTPGRTQELNFFVPDGFGGETTELPPIAIVDMPGYGYAQAPKEKVDAWTELVFDYLRGRPTLKRVFVLIDARHGIKANDEEVLKLLDKAAMSYQIVLTKIDKIKPTGVPKLIAATEEAIRKRPAAYPGILATSSEKRSGLDELQAALG 213
>gi|118589751|ref|ZP_01547156.1| GTP-binding protein [Stappia aggregata IAM 12614] >gi|118437837|gb|EAV44473.1| GTP-binding protein [Stappia aggregata IAM 12614] (215 aa)
Score = 226, Expect = 2.6e-17, Identities = 56/119 (47%), Positives = 74/119 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSNVGKSSLINAL   K +A+TS TPGRTQ+ NF+   +    ++D+PGYGYA+  K      +K++  Y+  R NL  V  +ID    I   DL+  ELL      + +VL K+DK
  S:    42 EIAFAGRSNVGKSSLINALTGRKDLARTSATPGRTQMLNFFIAPETPLTIVDMPGYGYAQAPKELVEAWTKLVFSYLRGRPNLRRVILLIDSRHGIKKNDLEAMELLDKAAVVYQVVLTKSDK 164
>gi|150395306|ref|YP_001325773.1| GTPase EngB [Sinorhizobium medicae WSM419] >gi|166225985|sp|A6U5K8|ENGB_SINMW Probable GTP-binding protein engB >gi|150026821|gb|ABR58938.1| GTP-binding protein HSR1-related [Sinorhizobium medicae WSM419] (217 aa)
Score = 225, Expect = 2.7e-17, Identities = 59/138 (42%), Positives = 81/138 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           EI F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     L+D+PGYGYA+  K +    +K++ +Y+  R  L  V+ +ID    I   D ++  LL      + IVL K DK   +      A+   K++K
  S:    36 EIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYFVPDGYSGEADDLPPMALVDMPGYGYAQAPKEQVDAWTKLVFDYLRGRSTLKRVYVLIDARHGIKKNDEEVLALLDKAAVSYQIVLTKTDKIKAAGVPRLLAETLEKIRK 185
>gi|163748903|ref|ZP_02156155.1| GTP-binding protein [Shewanella benthica KT99] >gi|161331677|gb|EDQ02482.1| GTP-binding protein [Shewanella benthica KT99] (239 aa)
Score = 225, Expect = 2.8e-17, Identities = 57/132 (43%), Positives = 82/132 (62%)
  Q:    12 NDWITDDKK-EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           N+++  D   EI F GRSN GKSS +N L + K +A+TS TPGRTQL N ++ D+ R L+DLPGYG+A+V  +   +  K + EY+  R+ L  +  ++DI   + DLD+QM E           +L KADK  +S
  S:    34 NEYLPGDAGIEIAFAGRSNAGKSSALNLLTDQKSLARTSKTPGRTQLINVFELDEHRRLVDLPGYGFAQVPLALKNKWQKSLGEYLQERQCLGGMVVLMDIRHPLKDLDMQMIEWAVESDIPVLALLTKADKMKQS 169
>gi|145639362|ref|ZP_01794968.1| GTPase EngB [Haemophilus influenzae PittII] >gi|145271665|gb|EDK11576.1| GTPase EngB [Haemophilus influenzae PittII] (205 aa)
Score = 225, Expect = 2.8e-17, Identities = 55/127 (43%), Positives = 79/127 (62%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + +Y+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DTGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKIQWQKSLGKYLQKRECLAGLVVLMDIRHPLKDLDQQMIEWAVSANLPILLLLTKADKLSQS 155
>gi|15924663|ref|NP_372197.1| GTPase EngB [Staphylococcus aureus subsp. aureus Mu50] >gi|15927252|ref|NP_374785.1| GTPase EngB [Staphylococcus aureus subsp. aureus N315] >gi|49486500|ref|YP_043721.1| GTPase EngB [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650545|ref|YP_186558.1| GTPase EngB [Staphylococcus aureus subsp. aureus COL] >gi|82751262|ref|YP_417003.1| GTPase EngB [Staphylococcus aureus RF122] >gi|87160096|ref|YP_494315.1| GTPase EngB [Staphylococcus aureus subsp. aureus USA300] >gi|88195478|ref|YP_500282.1| GTPase EngB [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268154|ref|YP_001247097.1| GTPase EngB [Staphylococcus aureus subsp. aureus JH9] >gi|150394221|ref|YP_001316896.1| GTPase EngB [Staphylococcus aureus subsp. aureus JH1] >gi|151221779|ref|YP_001332601.1| GTPase EngB [Staphylococcus aureus subsp. aureus str. Newman] >gi|156979991|ref|YP_001442250.1| GTPase EngB [Staphylococcus aureus subsp. aureus Mu3] >gi|161509892|ref|YP_001575551.1| GTPase EngB [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728848|ref|ZP_02761125.1| possible GTP-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|166225986|sp|A7X395|ENGB_STAA1 Probable GTP-binding protein engB >gi|172048935|sp|A6QHK7|ENGB_STAAE Probable GTP-binding protein engB >gi|189037192|sp|A6U2E1|ENGB_STAA2 Probable GTP-binding protein engB >gi|189037193|sp|A5ITJ8|ENGB_STAA9 Probable GTP-binding protein engB >gi|189037194|sp|A8Z2J4|ENGB_STAAT Probable GTP-binding protein engB >gi|54037057|sp|P64071|ENGB_STAAN Probable GTP-binding protein engB >gi|54040980|sp|P64070|ENGB_STAAM Probable GTP-binding protein engB >gi|56748964|sp|Q6G8Q2|ENGB_STAAS Probable GTP-binding protein engB >gi|71151868|sp|Q5HF99|ENGB_STAAC Probable GTP-binding protein engB >gi|119369263|sp|Q2FG63|ENGB_STAA3 Probable GTP-binding protein engB >gi|119369264|sp|Q2FXQ8|ENGB_STAA8 Probable GTP-binding protein engB >gi|119369265|sp|Q2YTB6|ENGB_STAAB Probable GTP-binding protein engB >gi|13701470|dbj|BAB42764.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] >gi|14247445|dbj|BAB57835.1| probable GTP-binding protein engB [Staphylococcus aureus subsp. aureus Mu50] >gi|49244943|emb|CAG43404.1| putative GTP-binding protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284731|gb|AAW36825.1| GTP-binding protein, putative [Staphylococcus aureus subsp. aureus COL] >gi|82656793|emb|CAI81222.1| probable GTP-binding protein [Staphylococcus aureus RF122] >gi|87126070|gb|ABD20584.1| probable GTP-binding protein engB [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203036|gb|ABD30846.1| GTP-binding protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741223|gb|ABQ49521.1| GTP-binding protein, HSR1-related [Staphylococcus aureus subsp. aureus JH9] >gi|149946673|gb|ABR52609.1| GTP-binding protein HSR1-related [Staphylococcus aureus subsp. aureus JH1] >gi|150374579|dbj|BAF67839.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722126|dbj|BAF78543.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] >gi|160368701|gb|ABX29672.1| possible GTP-binding protein [Staphylococcus aureus subsp. aureus USA300_TCH1516] (196 aa)
Score = 225, Expect = 2.8e-17, Identities = 56/153 (36%), Positives = 89/153 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTN 173
           E+   GRSNVGKS+ IN++   K +A+TS  PG+TQ  NFY+ D +   +D+PGYGYAKVSK++  +  K+I EYI  R+NL  V Q++D+      D    ++L   + +H+     ++  K DK  K     +   I  +L  D ++ +   +  + N
  S:    27 EVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLR----HDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNN 182
>gi|157693221|ref|YP_001487683.1| GTPase EngB [Bacillus pumilus SAFR-032] >gi|166920109|sp|A8FFV6|ENGB_BACP2 Probable GTP-binding protein engB >gi|157681979|gb|ABV63123.1| possible GTPase [Bacillus pumilus SAFR-032] (195 aa)
Score = 225, Expect = 3.0e-17, Identities = 56/128 (43%), Positives = 79/128 (61%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           EI   GRSNVGKSS IN+L N K +A+TS+ PG+TQ  NFY   D    +D+PGYG+AKVSK++     ++I  YI +R+ L AV QI+D+     + D+ M E L        ++  KADK  K  ++ +
  S:    25 EIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDMLHFVDVPGYGFAKVSKTEREAWGRMIETYITMREELKAVVQIVDLRHKPSVDDVNMYEFLKYYGVPVIVIATKADKIPKGKWEKH 155
>gi|194017131|ref|ZP_03055743.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus pumilus ATCC 7061] >gi|194010999|gb|EDW20569.1| ribosome biogenesis GTP-binding protein YsxC [Bacillus pumilus ATCC 7061] (195 aa)
Score = 225, Expect = 3.1e-17, Identities = 56/128 (43%), Positives = 79/128 (61%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDL-DLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           EI   GRSNVGKSS IN+L N K +A+TS+ PG+TQ  NFY   D    +D+PGYG+AKVSK++     ++I  YI +R+ L AV QI+D+     + D+ M E L        ++  KADK  K  ++ +
  S:    25 EIALAGRSNVGKSSFINSLINRKNLARTSSKPGKTQTLNFYIINDMLHFVDVPGYGFAKVSKTEREAWGRMIETYITMREELKAVVQIVDLRHKPSVDDVNMYEFLKYYGVPVIVIATKADKIPKGKWEKH 155
>gi|15964196|ref|NP_384549.1| GTPase EngB [Sinorhizobium meliloti 1021] >gi|24418387|sp|Q92SF6|ENGB_RHIME Probable GTP-binding protein engB >gi|15073372|emb|CAC41880.1| Hypothetical GTP-binding protein [Sinorhizobium meliloti 1021] (217 aa)
Score = 225, Expect = 3.1e-17, Identities = 64/161 (39%), Positives = 90/161 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLI 181
           EI F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     L+D+PGYGYA+  K +    +K++ +Y+  R  L  V+ +ID    I   D  +  LL      + IVL K DK   +      A+   K+KK       ++  S++    I +L+  I
  S:    36 EIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYFVPDGYSGEAGDLPPMALVDMPGYGYAQAPKEQVDAWTKLVFDYLRGRSTLKRVYVLIDARHGIKKNDEDVLALLDKAAVSYQIVLTKTDKIKAAGVPRLVAETLEKIKKRPAAFPEVLSTSSEKGEGIEDLRAAI 211
>gi|184155097|ref|YP_001843437.1| GTP-binding protein [Lactobacillus fermentum IFO 3956] >gi|183226441|dbj|BAG26957.1| GTP-binding protein [Lactobacillus fermentum IFO 3956] (197 aa)
Score = 225, Expect = 3.2e-17, Identities = 55/133 (41%), Positives = 74/133 (55%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADK 139
           S    N +      E+  +GRSNVGKSSL N L N K  A TS  PG+TQ  NFY+ + K   +D+PGYGYAKVSK +  +  K+I  Y+  R+ L  V Q++D     T+ D  M + L+       +V  K DK
  S:    11 SAVEENQYPATALPELALVGRSNVGKSSLTNVLINRKNYAHTSGQPGKTQTLNFYEVEHKLYFVDVPGYGYAKVSKKQREKFGKMIENYLTTREQLRGVVQLVDGRHAPTEDDRMMFQWLAYYHIPTLVVATKVDK 146
>gi|194700920|gb|ACF84544.1| unknown [Zea mays] (308 aa)
Score = 225, Expect = 3.2e-17, Identities = 58/139 (41%), Positives = 74/139 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           F+KS   + D   DD+ E   +GRSNVGKSSLINAL   K  A TS  PG+TQ  N +  +K + L+DLPGYG+A  S+S   + S     Y   R  LV V  +ID S+    +DL  +  L         V  K DK  K
  S:   110 FVKSSARARDCPNDDRPEFAVLGRSNVGKSSLINALTRRKEAALTSKKPGKTQTINHFLVNKSWYLVDLPGYGFAAASQSARMDWSSFTKGYFLNRDTLVGVLLLIDASIPPQKIDLDCANWLGRNNIGLTFVFTKCDKVKK 251
>gi|159477681|ref|XP_001696937.1| hypothetical protein CHLREDRAFT_105231 [Chlamydomonas reinhardtii] >gi|158274849|gb|EDP00629.1| predicted protein [Chlamydomonas reinhardtii] (214 aa)
Score = 225, Expect = 3.2e-17, Identities = 53/109 (48%), Positives = 67/109 (61%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV 111
           +FIKS     D   D   E  FIGRSNVGKSSLIN+L N  ++AK S  PG T+L N Y   D + L+DLPGYG+AK  KS   E  +   +Y   R NLV+V  ++D S+
  S:     8 AFIKSSTRVADCPPDRIPEFAFIGRSNVGKSSLINSLTNNDRLAKVSKEPGMTKLINHYLINDSWYLVDLPGYGFAKAGKSNREEWLRFTKDYFITRDNLVSVMLLVDSSL 118
>gi|161830201|ref|YP_001597597.1| GTP-binding protein [Coxiella burnetii RSA 331] >gi|189037176|sp|A9NAD8|ENGB_COXBR Probable GTP-binding protein engB >gi|161762068|gb|ABX77710.1| GTP-binding protein [Coxiella burnetii RSA 331] (205 aa)
Score = 225, Expect = 3.2e-17, Identities = 55/165 (33%), Positives = 95/165 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK--DKENIVCVSAKNKTNIPNLKKLI 181
           D   EI FIGRSN GKSS +N +   K +A+TS TPGRTQ+ NF+  ++  RL+DLPGYGYAKV +       +++  Y+  R+ L  +  ++DI   + ++D  + E   N     +I+L K+DK +++       ++   +    +K  +   S+ ++T +  +K ++
  S:    28 DQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFALNEHERLVDLPGYGYAKVPRMVQKRWEELVDSYLKNRRCLKGLVVVMDIRHPLKEMDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAYGEKLTLQLFSSHDRTGLDEVKAVL 197
>gi|18400109|ref|NP_565543.1| EMB2001 (EMBRYO DEFECTIVE 2001); GTP binding [Arabidopsis thaliana] >gi|21903474|sp|O81004|Y2287_ARATH GTP-binding protein At2g22870 (Protein EMBRYO DEFECTIVE 2001) >gi|20197273|gb|AAC32434.2| putative nucleotide-binding protein [Arabidopsis thaliana] >gi|21592880|gb|AAM64830.1| putative nucleotide-binding protein [Arabidopsis thaliana] >gi|52354269|gb|AAU44455.1| hypothetical protein AT2G22870 [Arabidopsis thaliana] >gi|55740571|gb|AAV63878.1| hypothetical protein At2g22870 [Arabidopsis thaliana] (300 aa)
Score = 225, Expect = 3.3e-17, Identities = 59/136 (43%), Positives = 77/136 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           F+KS   + D   DD+ EI  +GRSNVGKSSLIN L   K +A TS  PG+TQL N +  +K + ++DLPGYG+AKVS +   + S     Y   R +LV V  +ID SV    +DL  +  L         V  K DK
  S:   105 FVKSSARARDCPKDDRPEIAILGRSNVGKSSLINCLVRKKEVALTSKKPGKTQLINHFLVNKSWYIVDLPGYGFAKVSDAAKTDWSAFTKGYFLNRDSLVCVLLLIDASVPPQKIDLDCANWLGRNNVPMTFVFTKCDK 243
>gi|154244318|ref|YP_001415276.1| GTPase EngB [Xanthobacter autotrophicus Py2] >gi|154158403|gb|ABS65619.1| small GTP-binding protein [Xanthobacter autotrophicus Py2] (217 aa)
Score = 225, Expect = 3.4e-17, Identities = 61/165 (36%), Positives = 90/165 (54%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV---SAKNKTNIPNLKKLIGSVI 185
           EI   GRSNVGKSSL+NAL   K +A+TS TPGRTQ   F+    +  L+D+PGYG+AK  K K    +  I  Y+  R NL  VF +ID    I  +D ++ +LL      + I+L K+D+   S   +  A +  K+K+       V   S++     P L+  +  ++
  S:    43 EIALAGRSNVGKSSLVNALTGRKALARTSVTPGRTQELIFFRVGPELSLVDMPGYGFAKAPKEKVEAWTHTIKAYLRGRVNLARVFVLIDSRHGIKPVDEEILDLLDKAAVSYAIILTKSDQVKPSALPHVIASVQEKIKRRPAAYPVVFPTSSQTGAGFPELRAAVARLL 213
>gi|21283346|ref|NP_646434.1| GTPase EngB [Staphylococcus aureus subsp. aureus MW2] >gi|24418368|sp|Q8NW73|ENGB_STAAW Probable GTP-binding protein engB >gi|21204786|dbj|BAB95482.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] (196 aa)
Score = 224, Expect = 3.5e-17, Identities = 56/153 (36%), Positives = 89/153 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-----IVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTN 173
           E+   GRSNVGKS+ IN++   K +A+TS  PG+TQ  NFY+ D +   +D+PGYGYAKVSK++  +  K+I EYI  R+NL  V Q++D+      D    ++L   + +H+     ++  K DK  K     +   I  +L  D ++ +   +  + N
  S:    27 EVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLR----HDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNN 182
>gi|91794968|ref|YP_564619.1| GTPase EngB [Shewanella denitrificans OS217] >gi|119369252|sp|Q12I30|ENGB_SHEDO Probable GTP-binding protein engB >gi|91716970|gb|ABE56896.1| GTP-binding [Shewanella denitrificans OS217] (219 aa)
Score = 224, Expect = 3.6e-17, Identities = 56/123 (45%), Positives = 75/123 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +NAL   K +A+TS TPGRTQL N +  D   RL+DLPGYG+A+V  +   +  + + EY+  R  L  V  ++DI   + DLD+QM E           +L K+DK A+S
  S:    34 EIAFAGRSNAGKSSALNALTEQKSLARTSKTPGRTQLINVFALDDDRRLVDLPGYGFAQVPLALKNKWQQALGEYLQKRACLSGVVVLMDIRHPLKDLDMQMIEWAVASEIPVLALLTKSDKLAQS 159
>gi|160893845|ref|ZP_02074628.1| hypothetical protein CLOL250_01399 [Clostridium sp. L2-50] >gi|156864497|gb|EDO57928.1| hypothetical protein CLOL250_01399 [Clostridium sp. L2-50] (201 aa)
Score = 224, Expect = 3.8e-17, Identities = 61/161 (37%), Positives = 91/161 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVC-VSAKNKTNIPNLKKLI 181
           EI F G+SNVGKSSLIN L N K +A+TS+ PG+TQ  N+Y+ +     +DLPGYGYA+VS     +  K++  Y++  K L  VF +IDI    ++ D  M + +     +  I+  K DK  +S    N   I  K++  +  I+   SA+ K     + +LI
  S:    25 EIAFAGKSNVGKSSLINGLLNRKSLARTSSQPGKTQTINYYNINHDLYFVDLPGYGYAQVSVEIRAKWGKMVERYLHTSKQLRLVFLLIDIRHEPSENDCIMYDWIVKNGYEPVIIATKLDKIKRSQIQKNLKIIRQKIQPVEGTIIIPFSAQTKQGKEEILQLI 189
>gi|114567167|ref|YP_754321.1| GTP-binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338102|gb|ABI68950.1| GTP-binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (219 aa)
Score = 224, Expect = 4.0e-17, Identities = 60/165 (36%), Positives = 96/165 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           EI   GRSNVGKSSLIN + N K +AK+S+TPG+T+  N+Y   D++ ++DLPGYGYA+VS+ +     K++  Y+  R+ L  V Q++DI     + D+ M + L +      +V  KADK ++     + A I   L   +  +V  SA++   +  LK  +  ++
  S:    53 EIALAGRSNVGKSSLINKICNRKNLAKSSSTPGKTRTINYYLINDQWFMVDLPGYGYARVSREEKARWKKMVEAYLSQREQLRGVIQLLDIRHEPGENDILMKDWLLHLQIPVLVVATKADKLSRGARMKHIAIIRKTLDLPEMPLV-FSAQSGDGVEELKAALAELL 219
>gi|153206108|ref|ZP_01945371.1| GTP-binding protein [Coxiella burnetii 'MSU Goat Q177'] >gi|120577238|gb|EAX33862.1| GTP-binding protein [Coxiella burnetii 'MSU Goat Q177'] (205 aa)
Score = 224, Expect = 4.2e-17, Identities = 55/165 (33%), Positives = 95/165 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK--DKENIVCVSAKNKTNIPNLKKLI 181
           D   EI FIGRSN GKSS +N +   K +A+TS TPGRTQ+ NF+  ++  RL+DLPGYGYAKV +       +++  Y+  R+ L  +  ++DI   + ++D  + E   N     +I+L K+DK +++       ++   +    +K  +   S+ ++T +  +K ++
  S:    28 DQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFALNEHERLVDLPGYGYAKVPRMVQKRWEELVDSYLKKRRCLKGLVVVMDIRHPLKEVDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAYGEKLTLQLFSSHDRTGLDEVKAVL 197
>gi|126653685|ref|ZP_01725604.1| GTP-binding protein [Bacillus sp. B14905] >gi|126589722|gb|EAZ83857.1| GTP-binding protein [Bacillus sp. B14905] (193 aa)
Score = 224, Expect = 4.2e-17, Identities = 61/160 (38%), Positives = 86/160 (53%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVL-NKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S    + +  D   E    GRSNVGKSS IN +   K +A+ S+ PG+TQ  NFY  + +   +D+PGYGYAKVSKS+     K+I  Y   R+ L AV QIID+      D +M       +N   IV+  KADK  K  +D +   +   L+ +K + + V
  S:    11 SAVRPDQYPEDGLPEFALAGRSNVGKSSFINRMIGRKALARISSKPGKTQTLNFYKIEEQLFFVDVPGYGYAKVSKSEREAWGKMIERYFTGRQELKAVVQIIDLRHPPTADDRMMYDFLKHYNIPCIVIATKADKIPKGKWDKHKKIVKETLEMEKNDPLIV 173
>gi|29655060|ref|NP_820752.1| small GTP-binding protein domain-containing protein [Coxiella burnetii RSA 493] >gi|81628492|sp|Q83AV6|ENGB_COXBU Probable GTP-binding protein engB >gi|29542329|gb|AAO91266.1| small GTP-binding protein domain protein, putative [Coxiella burnetii RSA 493] (205 aa)
Score = 224, Expect = 4.4e-17, Identities = 55/165 (33%), Positives = 95/165 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKF-RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK--DKENIVCVSAKNKTNIPNLKKLI 181
           D   EI FIGRSN GKSS +N +   K +A+TS TPGRTQ+ NF+  ++  RL+DLPGYGYAKV +       +++  Y+  R+ L  +  ++DI   + ++D  + E   N     +I+L K+DK +++       ++   +    +K  +   S+ ++T +  +K ++
  S:    28 DQGAEIAFIGRSNAGKSSALNIITGIKGLARTSKTPGRTQMINFFALNEHERLVDLPGYGYAKVPRMVQKRWEELVDSYLKNRRCLKGLVVVMDIRHPLKEMDEDVIEWAVNYDIPIHILLTKSDKLSQNAAKKTLGEVQTAISAYGEKLTLQLFSSHDRTGLDEVKAVL 197
>gi|56476001|ref|YP_157590.1| GTPase EngB [Azoarcus sp. EbN1] >gi|81598986|sp|Q5P7M2|ENGB_AZOSE Probable GTP-binding protein engB >gi|56312044|emb|CAI06689.1| GTP-binding protein [Azoarcus sp. EbN1] (216 aa)
Score = 223, Expect = 4.6e-17, Identities = 56/139 (40%), Positives = 82/139 (58%)
  Q:    21 EICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           EI F GRSN GKSS IN LA+  ++A  S TPGRTQL NF+  D    L+DLPGYGYAKV ++   +   ++  Y+  R+NL+ +  I+D    +T LD QM +         +++L K DK ++    N  A   A ++++
  S:    26 EIAFAGRSNAGKSSAINTLADHTRLAFVSKTPGRTQLINFFRLDCGAVLVDLPGYGYAKVPENIRRQWQGLLEHYLRKRENLIGLVLIMDSRHPLTPLDRQMIDWFVPGGRPIHVLLTKCDKLSR----NEAAATLASVRRE 163
>gi|90422336|ref|YP_530706.1| GTPase EngB [Rhodopseudomonas palustris BisB18] >gi|119369245|sp|Q21B49|ENGB_RHOPB Probable GTP-binding protein engB >gi|90104350|gb|ABD86387.1| GTP-binding [Rhodopseudomonas palustris BisB18] (216 aa)
Score = 223, Expect = 4.7e-17, Identities = 57/158 (36%), Positives = 89/158 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLK 178
           E+ F GRSNVGKSSLINAL     +A+TS+TPGRTQ   F++  +   FRL+D+PGYGYA   K+K    + +I  ++  R  L  V+ +ID    + ++D  +   L      + +VL KAD+   +        + A L+K       ++  S++    +P L+
  S:    40 EVAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFFEGPENANFRLVDMPGYGYASAPKAKIASWTSLIHNFLQGRSTLARVYVLIDARHGLKEVDQDVLNTLDKSAVSYQVVLTKADQVKPAELAQCRIDVEAGLRKHPAAYPELLVTSSRTGAGMPELR 205
>gi|167765941|ref|ZP_02437994.1| hypothetical protein CLOSS21_00432 [Clostridium sp. SS2/1] >gi|167712439|gb|EDS23018.1| hypothetical protein CLOSS21_00432 [Clostridium sp. SS2/1] (213 aa)
Score = 223, Expect = 5.1e-17, Identities = 63/166 (37%), Positives = 95/166 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNKTNIPNLKKLIGSVIL 186
           E+ F G+SNVGKSSLINAL N K  A+ S  PG+TQ  N+Y+  ++   +DLPGYG+AKV++S   +   +I  Y+   K L  VF +IDI    +  D+ M + + +   +  I+  K DK  +S    +  +I  +L+ DKE  I   SA +K     +   I S++L
  S:    38 EVAFAGKSNVGKSSLINALMNRKSYARISAQPGKTQTINYYNINEELYYVDLPGYGFAKVTQSVKEKWGHMIENYLQTSKQLKMVFLLIDIRHKPSKNDVMMYDWILHNGYRPVIIATKLDKLKRSQVPKHLKEIRTELQMDKETPIFPFSALSKQGRDEIWDFIESMVL 207
>gi|163702959|ref|ZP_02121795.1| GTP-binding [Methylobacterium nodulans ORS 2060] >gi|162430827|gb|EDQ41435.1| GTP-binding [Methylobacterium nodulans ORS 2060] (216 aa)
Score = 223, Expect = 5.1e-17, Identities = 65/165 (39%), Positives = 92/165 (55%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           EI F GRSNVGKSSLIN+L     +A+TS+TPGRTQ  NF+D   K  L+D+PGYGYA VSK+K    +++I  Y+  R NL  V+ +ID    I   D ++ + L      + IVL K D   KS         +A L +       I+  S++    I  L+  +  ++
  S:    42 EIAFAGRSNVGKSSLINSLTGRTTLARTSHTPGRTQQLNFFDLGGKLTLVDMPGYGYAAVSKAKVAAWTELIHAYLQGRANLARVYVLIDARHGIKPNDGEVLDELDAAAVSYQIVLTKGDALKKSEIQARLDATSAALARRPAAYPEIILTSSRTGEGIAELRASVARLL 212
>gi|86132597|ref|ZP_01051190.1| GTP-binding protein [Cellulophaga sp. MED134] >gi|85816839|gb|EAQ38024.1| GTP-binding protein [Dokdonia donghaensis MED134] (201 aa)
Score = 223, Expect = 5.1e-17, Identities = 55/128 (42%), Positives = 76/128 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           E  FIGRSNVGKSSLIN L N K +AKTS  PG+TQL N F   + + L+DLPGYGYA+VSK       K I++Y   R+ +++ F ++D       +D++  E +  +     I+  KADK      + N
  S:    25 EYAFIGRSNVGKSSLINMLTNRKSLAKTSGRPGKTQLINHFLINENWHLVDLPGYGYARVSKKDKKYFQKFITDYFEQREQMISAFVLVDCRHEPQKIDMEFMEYMGEKEIPFSIIFTKADKLRPQALERN 155
>gi|123440425|ref|YP_001004419.1| GTPase EngB [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166232162|sp|A1JHT4|ENGB_YERE8 Probable GTP-binding protein engB >gi|122087386|emb|CAL10167.1| conserved hypothetical protein [Yersinia enterocolitica subsp. enterocolitica 8081] (217 aa)
Score = 223, Expect = 5.3e-17, Identities = 53/125 (42%), Positives = 74/125 (59%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D+  E+ F GRSN GKSS +N L   K +A+TS TPGRTQL N ++  +  RL+DLPGYGYA+V +    +  + + EY+  R  L  +  ++DI   + DLD QM            ++L KADK A
  S:    26 DEGIEVAFAGRSNAGKSSALNTLTGQKSLARTSKTPGRTQLINLFEVVEGVRLVDLPGYGYAEVPEEMKLKWQRALGEYLQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVMLLLTKADKLA 153
>gi|169829417|ref|YP_001699575.1| GTP-binding protein [Lysinibacillus sphaericus C3-41] >gi|168993905|gb|ACA41445.1| Probable GTP-binding protein [Lysinibacillus sphaericus C3-41] (186 aa)
Score = 223, Expect = 5.5e-17, Identities = 60/160 (37%), Positives = 86/160 (53%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHYIVL-NKADKEAKSYFDNNFAKIAAKLKKDKENIVCV 166
           S    + +  D   E    GRSNVGKSS IN +   K +A+ S+ PG+TQ  NFY  + +   +D+PGYGYAKVSKS+     K+I  Y   R+ L AV QI+D+      D +M       +N   IV+  KADK  K  +D +   +   L+ +K + + V
  S:     4 SAVRPDQYPEDGLPEFALAGRSNVGKSSFINRMIGRKALARISSKPGKTQTLNFYKIEEQLFFVDVPGYGYAKVSKSEREAWGKMIERYFTGRQELKAVVQIVDLRHPPTADDRMMYDFLKHYNIPCIVIATKADKIPKGKWDKHKKIVKETLEMEKNDPLIV 166
>gi|126664648|ref|ZP_01735632.1| predicted GTPase [Marinobacter sp. ELB17] >gi|126630974|gb|EBA01588.1| predicted GTPase [Marinobacter sp. ELB17] (213 aa)
Score = 223, Expect = 5.5e-17, Identities = 59/178 (33%), Positives = 96/178 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK--ENIVCVSAKNKTNIPNLKKLI 181
           F+ S    N+   D   E+ F GRSN GKSS +N +  N K+A+TS TPGRT+L NF+  ++   RL+DLPGYGYA+VS+    +    +  Y+  R+ L  +  ++DI   +T+ D  M +   +      I+  K+DK            I  KL +    ++++  S+ NKT +   ++ +
  S:    17 FMVSASKLNECPADIGAEVAFAGRSNAGKSSALNTITVNGKLARTSKTPGRTRLINFFSLNRENARLVDLPGYGYARVSRDMKDDWQTHLGHYLNDRRCLRGLVLVMDIRHPLTEFDQTMVQWCQHNTMPLMILATKSDKLKFGQAKTAMLGIRQKLNEFSCVQHLIMFSSSNKTGLDECRQAL 200
>gi|73542832|ref|YP_297352.1| GTPase EngB [Ralstonia eutropha JMP134] >gi|119369239|sp|Q46WH5|ENGB_RALEJ Probable GTP-binding protein engB >gi|72120245|gb|AAZ62508.1| cell division checkpoint GTPase YihA [Ralstonia eutropha JMP134] (228 aa)
Score = 223, Expect = 5.6e-17, Identities = 53/123 (43%), Positives = 73/123 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           E+ F GRSN GKS+ IN L N K +A +S TPGRTQ  N++     +       L+DLPGYGYA+VS S  +    ++S+Y+  R  L  +  ++D     TDLD QM E         +++L KADK   S
  S:    26 EVAFAGRSNAGKSTAINILCNQKRLAFSSRTPGRTQHINYFTVAPVKAPDPIAFLVDLPGYGYAEVSGSAKYHWQGLLSDYVQTRSQLSGLILMMDARRPFTDLDCQMVEWFLPTGKPVHVLLTKADKLTNS 157
>gi|87120351|ref|ZP_01076246.1| putative GTPase, involved in coordination of cell cycle (EngB) [Marinomonas sp. MED121] >gi|86164454|gb|EAQ65724.1| putative GTPase, involved in coordination of cell cycle (EngB) [Marinomonas sp. MED121] (211 aa)
Score = 223, Expect = 5.7e-17, Identities = 56/154 (36%), Positives = 88/154 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFY--DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK 157
           FIKS    +    D   E+ F GRSN GKS+ +N L +  K+A+TS TPGRTQL N +  + +  RLIDLPGYG+AKV  +   +    + +Y+  R++L  V  ++DI   + + D  M +   +   Q +++L K+DK  +    +   ++A  LK
  S:    13 FIKSAEKLSQCPVDQGLEVAFAGRSNAGKSTALNTLTDQKKLARTSKTPGRTQLINCFGLNVEDRRLIDLPGYGFAKVPVAMKMKWQAHMQDYLMNRRSLAGVVLVMDIRHPLKEFDHMMLDWAKSNKMQVHVILTKSDKLKRGPAKSTKLQVAKALK 170
>gi|154173698|ref|YP_001407908.1| GTPase EngB [Campylobacter curvus 525.92] >gi|112803367|gb|EAU00711.1| GTP-binding protein [Campylobacter curvus 525.92] (205 aa)
Score = 223, Expect = 5.8e-17, Identities = 73/178 (41%), Positives = 105/178 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-------------DKFRL--IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVIT-DLDLQMSELLSNRFNQHYIVLN---KADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           FI S  S  D       E+ F+GRSNVGKSSLINAL N K +AK+S+TPG+TQL NF++              DKF++  +DLPG+GYAKV+KSKH E  + + E++  R ++     +ID      D+D+ ++  ++        +LN   KADK  +S          + + K   N   VS  NK  I   ++LI
  S:     9 FISSSPSIKDAAEFALSEVVFLGRSNVGKSSLINALVNQKALAKSSSTPGKTQLINFFEVEFDERDDQSGEKTDKFKIMFVDLPGFGYAKVAKSKHEEWRRNLDEFLKFRSSIKLFVHLIDARHFDLDIDVNVNNYINEFLRPDQKILNFYTKADKLNQSS--------KSTVLKFDPNGTLVSTLNKVGIDKARELI 198
>gi|190890107|ref|YP_001976649.1| GTP-binding protein [Rhizobium etli CIAT 652] >gi|190695386|gb|ACE89471.1| GTP-binding protein [Rhizobium etli CIAT 652] (217 aa)
Score = 223, Expect = 5.9e-17, Identities = 60/165 (36%), Positives = 93/165 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           E+ F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     ++D+PGYGYA+  K +  + +K++ +Y+  R  L  V+ +ID    I   D  +  LL      + +VL K DK          A+ A K++K       ++  S++    + +L++ I   +
  S:    32 EVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDEDVLTLLDKAAVSYQLVLTKTDKIKAPAVPKLLAETADKIRKRPAAYPAVLSTSSEKGDGLDDLRQAIAQTV 211
>gi|70726255|ref|YP_253169.1| GTPase EngB [Staphylococcus haemolyticus JCSC1435] >gi|119369266|sp|Q4L712|ENGB_STAHJ Probable GTP-binding protein engB >gi|68446979|dbj|BAE04563.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (195 aa)
Score = 222, Expect = 6.3e-17, Identities = 57/144 (39%), Positives = 86/144 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIV 164
           E+   GRSNVGKSS IN++   K +A+TS  PG+TQ  NF++ D +   +D+PGYGYAKVSKS+  +  K+I EY+  R++L  V Q++D+    T+ D+ M   L +      ++  K DK AK     +   I  KL  D ++ +
  S:    27 EVALSGRSNVGKSSFINSMIGRKNMARTSQQPGKTQTLNFFNIDDQLIFVDVPGYGYAKVSKSQREKFGKMIEEYLTKRESLKLVIQLVDLRHNPTEDDVLMYNYLKHFDIPTLVICTKEDKIAKGKIQKHIKNIKEKLDLDPDDTI 173
>gi|116751466|ref|YP_848153.1| GTP-binding protein, HSR1-related [Syntrophobacter fumaroxidans MPOB] >gi|116700530|gb|ABK19718.1| GTP-binding protein, HSR1-related [Syntrophobacter fumaroxidans MPOB] (198 aa)
Score = 222, Expect = 6.4e-17, Identities = 58/168 (34%), Positives = 92/168 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNK 171
           F  +   S  +  D   E+ F GRSNVGKSSLIN L    K+ +TS TPG+TQ  NF+  +  F  +DLPGYG+A+V  +   +   ++  Y+  R NL  V QI+D     +  DL++   L +R      VL KADK  ++ +D   ++ +  L   ++ ++  S++ +
  S:    12 FKTAAVRSGQYPDDHLPEVAFAGRSNVGKSSLINCLLQRRKLVRTSRTPGQTQTINFFLINGLFYCVDLPGYGFARVPMAVRAQWGPMVESYLGGRPNLRGVVQILDARHPPSPDDLKLWNWLIDRKIPAVPVLTKADKVPRTKWDAAASRASLSLGIPRDRLLLFSSETR 182
>gi|69246839|ref|ZP_00604148.1| GTP-binding protein [Enterococcus faecium DO] >gi|68195072|gb|EAN09534.1| GTP-binding protein [Enterococcus faecium DO] (195 aa)
Score = 222, Expect = 6.5e-17, Identities = 56/142 (39%), Positives = 83/142 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN 162
           EI   GRSNVGKSS IN L + K +A+TS  PG+TQ  NFY  +     +D+PGYGYAKVSK++  +  K+I  Y+  R  L AV  ++D+    +  D+QM + L        +V  KADK  +  ++ + ++I   L  D+ +
  S:    25 EIALAGRSNVGKSSFINTLIDRKNLARTSGKPGKTQTLNFYLIENALHFVDVPGYGYAKVSKTERAKWGKMIETYLTTRDQLRAVVSLVDLRHKPSQEDIQMYQFLKYYDIPVIVVATKADKIPRGKWNKHESEIKKALDFDRND 169
>gi|145356924|ref|XP_001422673.1| predicted protein [Ostreococcus lucimarinus CCE9901] >gi|144582916|gb|ABP00990.1| predicted protein [Ostreococcus lucimarinus CCE9901] (253 aa)
Score = 222, Expect = 6.7e-17, Identities = 57/139 (41%), Positives = 76/139 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD----KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITD-LDLQMSELLSNRFNQHYIVLNKADKEAK 142
           F+++C            EI  IGRSNVGKSSL+N L N K +AKTS  PG+TQ  N Y       KF L+DLPGYGYA   +    + +    EY+  R++L+ V  +ID +V    LDL+  + L        +V  K DK  K
  S:    14 FVQACVDLAGCPKPTLPEIAVIGRSNVGKSSLVNMLTNRKSLAKTSKNPGKTQTINHYRMTTGDGKFYLVDLPGYGYANAPEDLREKWAAFTREYLIKRESLITVLLLIDSTVKPQRLDLECLDWLGEAGVPVTVVFTKVDKRKK 158
>gi|182627119|ref|ZP_02954837.1| hypothetical protein CJD_0168 [Clostridium perfringens D str. JGS1721] >gi|177907508|gb|EDT70166.1| hypothetical protein CJD_0168 [Clostridium perfringens D str. JGS1721] (197 aa)
Score = 222, Expect = 6.9e-17, Identities = 58/136 (42%), Positives = 82/136 (60%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           FI S      +  ++  EI F+GRSNVGKSS+IN+L N + +AK S TPG+T+L NF+  +K F L+DLPGYGYAKVSK +       I  Y+  R  L  V  ++D     T  D+QM E + +   +  ++  K+DK
  S:     8 FIISAVKREQYPDNNLPEIAFVGRSNVGKSSIINSLTNRRGLAKVSQTPGKTRLINFFLLNKDFYLVDLPGYGYAKVSKKEKASWGATIERYLLNRGPLKKVVLLVDCRHKPTADDVQMYEWIKHYGYEVVVIATKSDK 146
>gi|90419895|ref|ZP_01227804.1| GTP-binding protein [Aurantimonas sp. SI85-9A1] >gi|90335936|gb|EAS49684.1| GTP-binding protein [Aurantimonas sp. SI85-9A1] (226 aa)
Score = 222, Expect = 6.9e-17, Identities = 58/119 (48%), Positives = 74/119 (62%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDKF----------RLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSNVGKSSLINAL A   +A+TSNTPGRTQ  NF+  D +           ++D+PGYGYAK  K      +K++  Y+  R +L  VF +ID    I   D ++  LL      + IVL K DK
  S:    46 EIAFAGRSNVGKSSLINALLAQKGLARTSNTPGRTQELNFFVPDGYGGETAELPPIAVVDMPGYGYAKAPKDHVDAWTKLVFSYLRGRASLKRVFLLIDARHGIKKNDEEVMGLLDKAAVSYQIVLTKTDK 176
>gi|91216020|ref|ZP_01252989.1| GTP-binding protein [Psychroflexus torquis ATCC 700755] >gi|91185997|gb|EAS72371.1| GTP-binding protein [Psychroflexus torquis ATCC 700755] (199 aa)
Score = 222, Expect = 7.1e-17, Identities = 63/143 (44%), Positives = 76/143 (53%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           E  FIGRSNVGKSSLIN L     +AK S  PG+T+L N F   D + L+DLPGYGYAKVSK +     K I+ Y   R+ LV  F +ID       LDL+  E L        IV  K DK      +NN      KL +  E +
  S:    25 EYAFIGRSNVGKSSLINMLTERNSLAKVSGKPGKTRLINHFLINDSWHLVDLPGYGYAKVSKKEKKTFQKYITAYFEKRQQLVNTFVLIDSRHAPQPLDLEFLEWLGKNAIPLSIVFTKTDKLKPKVLENNIIDYKTKLMETWEEL 170
>gi|158321195|ref|YP_001513702.1| small GTP-binding protein [Alkaliphilus oremlandii OhILAs] >gi|166920107|sp|A8MIS4|ENGB_ALKOO Probable GTP-binding protein engB >gi|158141394|gb|ABW19706.1| small GTP-binding protein [Alkaliphilus oremlandii OhILAs] (208 aa)
Score = 222, Expect = 7.5e-17, Identities = 59/157 (37%), Positives = 90/157 (57%)
  Q:    21 EICFIGRSNVGKSSLINA-LANAKIAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNKTNIPNL 177
           EI   GRSNVGKSS +N  L   K+A+ S +PG+T+  NFY  + +F ++DLPGYGYAKVSK +     K++  Y+  RKNL  V  ++DI    T  D  M + + +      ++  K+DK ++  +  +F  I  KL    E+ I+ +S+  +  I  L
  S:    25 EIALAGRSNVGKSSTVNTILKRRKLARVSASPGKTRTINFYIVNNEFHIVDLPGYGYAKVSKGEKETWGKMMETYLSSRKNLYEVILLVDIRHEPTADDKMMYDWIKHYGYGSIVIATKSDKISRGAYQKHFKMIREKLGMSPEDKIIPISSLKREGIDKL 185
>gi|118728208|ref|ZP_01576774.1| GTP-binding [Clostridium cellulolyticum H10] >gi|118662398|gb|EAV69093.1| GTP-binding [Clostridium cellulolyticum H10] (204 aa)
Score = 221, Expect = 7.8e-17, Identities = 61/151 (40%), Positives = 88/151 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKN--LVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNK 171
           EI F+GRSNVGKSS+IN L N K +A+  +TPG+T+  NF+D + +F L+DLPGYG+A VSK        +I  Y+Y RK   L  V  ++DI    +  D+ M + L        I+ NK DK ++         I   L+  D E ++  SA+N+
  S:    25 EIAFVGRSNVGKSSIINTLVNRKSLARVGSTPGKTRQINFFDVNGEFYLVDLPGYGFANVSKEMKASWQNLIETYLYSRKENFLKMVVMLVDIRHSPSKDDIIMYQWLKGFGLDTLIIANKVDKISRGQIHVRINDIRKVLQLDDAEKVIPFSAENR 181
>gi|169196518|ref|ZP_02855872.1| GTP-binding protein HSR1-related [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169091261|gb|EDS69971.1| GTP-binding protein HSR1-related [Rhizobium leguminosarum bv. trifolii WSM2304] (217 aa)
Score = 221, Expect = 8.1e-17, Identities = 64/182 (35%), Positives = 99/182 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-IVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           FI+   S N    +   E+ F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     ++D+PGYGYA+  K +  + +K++ +Y+  R  L  V+ +ID       +      L ++    Y IVL K DK          A+ A K++K       ++  S++    + +L++ IG  +
  S:    15 FIRGVPSLNFLPPEGPLEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYFVPDGYSGESGDMPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKIKAPAVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDDLRQAIGETV 211
>gi|161621072|ref|YP_001594958.1| GTPase EngB [Brucella canis ATCC 23365] >gi|161337883|gb|ABX64187.1| GTP-binding conserved hypothetical protein [Brucella canis ATCC 23365] (267 aa)
Score = 221, Expect = 8.3e-17, Identities = 54/119 (45%), Positives = 76/119 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     L+D+PGYG+A+  K++    ++++ +Y+  R  L  V+ +ID    I   D ++ +LL      + IVL K DK
  S:    85 EIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRTQELNYFVPDGYSSENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVYVLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDK 215
>gi|17988618|ref|NP_541251.1| GTPase EngB [Brucella melitensis 16M] >gi|189023103|ref|YP_001932844.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19] >gi|54037055|sp|P64067|ENGB_BRUSU Probable GTP-binding protein engB >gi|54040978|sp|P64066|ENGB_BRUME Probable GTP-binding protein engB >gi|119368793|sp|Q2YJR1|ENGB_BRUA2 Probable GTP-binding protein engB >gi|119368794|sp|Q576T9|ENGB_BRUAB Probable GTP-binding protein engB >gi|17984421|gb|AAL53515.1| GTP-BINDING PROTEIN CGPA [Brucella melitensis 16M] >gi|189021677|gb|ACD74398.1| ATP/GTP-binding site motif A (P-loop) [Brucella abortus S19] (241 aa)
Score = 221, Expect = 8.3e-17, Identities = 54/119 (45%), Positives = 76/119 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     L+D+PGYG+A+  K++    ++++ +Y+  R  L  V+ +ID    I   D ++ +LL      + IVL K DK
  S:    59 EIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRTQELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVYVLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDK 189
>gi|23500747|ref|NP_700187.1| GTPase EngB [Brucella suis 1330] >gi|62317853|ref|YP_223706.1| GTPase EngB [Brucella abortus bv. 1 str. 9-941] >gi|83269832|ref|YP_419123.1| GTPase EngB [Brucella melitensis biovar Abortus 2308] >gi|148558302|ref|YP_001257935.1| GTPase EngB [Brucella ovis ATCC 25840] >gi|163845138|ref|YP_001622793.1| GTPase EngB [Brucella suis ATCC 23445] >gi|23464401|gb|AAN34192.1| GTP-binding protein, putative [Brucella suis 1330] >gi|62198046|gb|AAX76345.1| hypothetical GTP-binding protein [Brucella abortus biovar 1 str. 9-941] >gi|82940106|emb|CAJ13153.1| ATP/GTP-binding site motif A (P-loop):GTP-binding domain [Brucella melitensis biovar Abortus 2308] >gi|148369587|gb|ABQ62459.1| putative GTP-binding protein [Brucella ovis ATCC 25840] >gi|163675861|gb|ABY39971.1| GTP-binding conserved hypothetical protein [Brucella suis ATCC 23445] (267 aa)
Score = 221, Expect = 8.3e-17, Identities = 54/119 (45%), Positives = 76/119 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     L+D+PGYG+A+  K++    ++++ +Y+  R  L  V+ +ID    I   D ++ +LL      + IVL K DK
  S:    85 EIAFAGRSNVGKSSLINALVGKKGLARTSNTPGRTQELNYFVPDGYSGENGDLPPLALVDMPGYGFAEAPKAQVDAWTRLVFDYLRGRTTLKRVYVLIDARHGIKKNDAEVLDLLDKAAVSYQIVLTKIDK 215
>gi|86159103|ref|YP_465888.1| GTP-binding protein [Anaeromyxobacter dehalogenans 2CP-C] >gi|119368789|sp|Q2ILB9|ENGB_ANADE Probable GTP-binding protein engB >gi|85775614|gb|ABC82451.1| GTP-binding protein [Anaeromyxobacter dehalogenans 2CP-C] (216 aa)
Score = 221, Expect = 8.4e-17, Identities = 49/105 (46%), Positives = 67/105 (63%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD----------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID 108
           F K+     +W      EI F+GRSNVGKSS++NALA  K +A+ S+TPGRT+   F+D              R  DLPGYGYAKVS+++    + +I +Y+  R  L AV  I+D
  S:    10 FDKTATRPEEWPRGATPEIAFVGRSNVGKSSMLNALARRKGLARVSSTPGRTRALQFFDLSYRPTPAARPRAIRFCDLPGYGYAKVSRAERDRWTAMIEDYLRDRDVLRAVVLIVD 125
>gi|86140633|ref|ZP_01059192.1| GTP-binding protein [Flavobacterium sp. MED217] >gi|85832575|gb|EAQ51024.1| GTP-binding protein [Leeuwenhoekiella blandensis MED217] (202 aa)
Score = 221, Expect = 8.4e-17, Identities = 58/136 (42%), Positives = 79/136 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           E  FIGRSNVGKSSLIN L + K +AKTS  PG+TQL N +  ++ + L+DLPGYGYA+VSK    E  K I++Y   R+ LV+ F +ID       +D +  + L  +     I+  KADK      + N      +L
  S:    25 EYAFIGRSNVGKSSLINMLTDRKNLAKTSGRPGKTQLINHFVINQTWYLVDLPGYGYARVSKKVKKEFQKFITQYFEEREQLVSAFVLIDCRHEPQPIDREFMQYLGEKQIPFSIIFTKADKLKPKALERNIENYKQEL 163
>gi|149371567|ref|ZP_01890983.1| GTP-binding protein [unidentified eubacterium SCB49] >gi|149355194|gb|EDM43754.1| GTP-binding protein [unidentified eubacterium SCB49] (199 aa)
Score = 221, Expect = 8.6e-17, Identities = 57/147 (38%), Positives = 81/147 (55%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           D   E  FIGRSNVGKSSLIN L + K +AKTS  PG+TQL N +  +K + L+DLPGYGYA+VSK       + I++Y   R+ L+  F ++D       +D +  + L       +I+  KADK      + N      K+ +  E +
  S:    21 DRLPEYAFIGRSNVGKSSLINMLVDQKNMAKTSGRPGKTQLINHFLINKNWFLVDLPGYGYARVSKKAKKTFQRFITDYFEKREQLILAFVLVDCRHEPQPIDQEFMQYLGENGIPFHIIFTKADKLKPGALERNLKAYETKMLETWEEM 170
>gi|154482726|ref|ZP_02025174.1| hypothetical protein EUBVEN_00403 [Eubacterium ventriosum ATCC 27560] >gi|149736321|gb|EDM52207.1| hypothetical protein EUBVEN_00403 [Eubacterium ventriosum ATCC 27560] (195 aa)
Score = 221, Expect = 9.1e-17, Identities = 58/136 (42%), Positives = 81/136 (59%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKL 156
           EI F G+SNVGKSSLIN L N K +A+TS+ PG+TQ  NFY+ +K    +DLPGYGYA VS     +  K+I  Y++  + L AVF +IDI    +  D+ M + +     +  I+  KADK  +S    +   I  +L
  S:    25 EIAFAGKSNVGKSSLINGLVNRKALARTSSQPGKTQTINFYNVNKELYFVDLPGYGYANVSLKVKEQWGKMIERYLHESQVLKAVFLLIDIRHEPSANDVNMYQWILANGYEPIIIATKADKIKRSQLQKHIKMIKTEL 163
>gi|167762858|ref|ZP_02434985.1| hypothetical protein BACSTE_01221 [Bacteroides stercoris ATCC 43183] >gi|167699198|gb|EDS15777.1| hypothetical protein BACSTE_01221 [Bacteroides stercoris ATCC 43183] (202 aa)
Score = 221, Expect = 9.2e-17, Identities = 57/143 (39%), Positives = 79/143 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           E  FIGRSNVGKSSLIN L   K +A TS TPG+T L N +  +K + ++DLPGYGYAK  +    ++ +II  YI  R+ +  +F ++D       +DL   E L        IV  KADK      ++N      KL++  E +
  S:    25 EYAFIGRSNVGKSSLINMLTGRKGLAMTSATPGKTMLINHFLINKNWYIVDLPGYGYAKRGQKGQEQIQRIIETYILQREQMTCLFVLVDSRHEPQAIDLAFIEWLGENGVPFAIVFTKADKLKGGRINSNIRHYLEKLREQWEEL 170
>gi|81428670|ref|YP_395670.1| GTPase EngB [Lactobacillus sakei subsp. sakei 23K] >gi|119369209|sp|Q38WS0|ENGB_LACSS Probable GTP-binding protein engB >gi|78610312|emb|CAI55361.1| Putative GTP-binding protein [Lactobacillus sakei subsp. sakei 23K] (199 aa)
Score = 221, Expect = 9.4e-17, Identities = 49/104 (47%), Positives = 67/104 (64%)
  Q:     5 IKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID 108
           + S  +++ + TD   EI   GRSNVGKSSLIN L N K  A+TS+ PG+TQ  NFY  + +   +D+PGYGYAKVSK +  +  +II  Y+  R NL  +  +ID
  S:     9 VMSAVAASQYPTDQLPEIALSGRSNVGKSSLINKLINRKSYARTSSKPGKTQTLNFYRVENELYFVDVPGYGYAKVSKKQREKFGQIIEAYLTNRDNLRGLISLID 114
>gi|49475955|ref|YP_033996.1| GTPase EngB [Bartonella henselae str. Houston-1] >gi|81647688|sp|Q6G2G5|ENGB_BARHE Probable GTP-binding protein engB >gi|49238763|emb|CAF28024.1| GTP-binding protein cgpa [Bartonella henselae str. Houston-1] (215 aa)
Score = 221, Expect = 9.4e-17, Identities = 61/138 (44%), Positives = 79/138 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR----------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           EI F GRSNVGKSSLINAL   K +A+TSN PGRTQ  N++  D F           L+D+PGYG+AK  K+     + +I  Y+  R  L  V+ +ID    I   D ++ ELL      + IVL K+DK   S  +        KL K
  S:    34 EIAFAGRSNVGKSSLINALVRQKSLARTSNMPGRTQELNYFVPDGFSGRPEDLPPIALVDMPGYGFAKAPKNLVDAWTDLIYSYLRGRTTLKRVYVLIDSRHGIKKNDAEILELLDKAAVSYQIVLTKSDKIKSSVLEQRIITTKTKLLK 183
>gi|146299560|ref|YP_001194151.1| GTPase EngB [Flavobacterium johnsoniae UW101] >gi|189037178|sp|A5FIZ1|ENGB_FLAJO Probable GTP-binding protein engB >gi|146153978|gb|ABQ04832.1| GTP-binding protein, HSR1-related [Flavobacterium johnsoniae UW101] (210 aa)
Score = 221, Expect = 9.7e-17, Identities = 58/130 (44%), Positives = 78/130 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFA 150
           E  FIGRSNVGKSSLIN + N K +AKTS  PG+TQL N +  +  + L+DLPGYGYAKVSK       + I++Y   R+ LV  F +IDI      +D++    +        I+  KADK +K   D++ A
  S:    25 EYAFIGRSNVGKSSLINMITNHKNLAKTSGKPGKTQLINHFKINNNWFLVDLPGYGYAKVSKKTKSIFQQFITDYFENREQLVCAFVLIDIRHEAQKIDIEFMSYMGESEIPFCIIFTKADKISKGKIDSHIA 157
>gi|91974552|ref|YP_567211.1| GTPase EngB [Rhodopseudomonas palustris BisB5] >gi|119369246|sp|Q13F29|ENGB_RHOPS Probable GTP-binding protein engB >gi|91681008|gb|ABE37310.1| GTP-binding [Rhodopseudomonas palustris BisB5] (217 aa)
Score = 221, Expect = 9.8e-17, Identities = 61/158 (38%), Positives = 89/158 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLK 178
           E+ F GRSNVGKSSLINAL     +A+TSNTPGRTQ   F+D       RL+D+PGYGYA  SK+K    + +I +++  R  L  V+ +ID    + D+DL + + L      + IV  KAD+   +  +   A     L K       ++  S++    +P L+
  S:    40 EVAFAGRSNVGKSSLINALTGRNALARTSNTPGRTQELIFFDGPTDAGLRLVDMPGYGYAAASKAKVASWTSLIHKFLQGRATLARVYVLIDGRHGLKDVDLDILKTLDKSAVSYQIVFTKADQVKAAELEQRIAATKTVLAKHPAAFPELLMTSSRTGAGMPELR 205
>gi|146313732|ref|YP_001178806.1| cell division checkpoint GTPase YihA [Enterobacter sp. 638] >gi|166920112|sp|A4WGC5|ENGB_ENT38 Probable GTP-binding protein engB >gi|145320608|gb|ABP62755.1| cell division checkpoint GTPase YihA [Enterobacter sp. 638] (208 aa)
Score = 221, Expect = 9.9e-17, Identities = 53/125 (42%), Positives = 75/125 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEA 141
           D   E+ F GRSN GKSS +N L N + +A+TS TPGRTQL N ++  +  RL+DLPGYGYA+V +    +  K + EY+  R+ L  +  ++DI   + DLD QM            ++L K+DK A
  S:    24 DTGIEVAFAGRSNAGKSSALNTLTNQRSLARTSKTPGRTQLINLFEVAEGKRLVDLPGYGYAEVPEEVKLKWQKALGEYLEKRQCLKGLVVLMDIRHPLKDLDQQMIHWAVASEIPVLVLLTKSDKLA 151
>gi|170718325|ref|YP_001783554.1| GTP-binding protein HSR1-related [Haemophilus somnus 2336] >gi|168826454|gb|ACA31825.1| GTP-binding protein HSR1-related [Haemophilus somnus 2336] (231 aa)
Score = 221, Expect = 1.0e-16, Identities = 55/127 (43%), Positives = 77/127 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL   K +A+TS TPGRTQL N +  +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    53 DSGIEIAFAGRSNAGKSTALNALTQQKNLARTSKTPGRTQLINLFQVEPNCKLVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGLVILMDIRHPLKDLDQQMIEWAVSADLPVLLLLTKADKLSQS 182
>gi|168056123|ref|XP_001780071.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162668474|gb|EDQ55080.1| predicted protein [Physcomitrella patens subsp. patens] (305 aa)
Score = 220, Expect = 1.0e-16, Identities = 61/166 (36%), Positives = 90/166 (54%)
  Q:    21 EICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI---VCVSAKNKTNIPNLKKLIGSVIL 186
           EI F GRSNVGKSSLINAL     + +TS+ PG TQ  NF+    +  L+DLPGYG+A   +        ++ EY+  RK L  V  ++D    +   D ++ EL+ N   ++ IVL K D            +I   LK  K+ I   + VS++    IP+L+K + ++ L
  S:   128 EIAFAGRSNVGKSSLINALTRQWGVVRTSDKPGMTQSVNFFTLGSRLCLVDLPGYGFAYAKEEAKEAWEDLVKEYVTTRKILKRVCLLVDSKWGLKPRDEELIELMENAQTKYQIVLTKTDILPPLDLARRATQIQEALKHHKQLILPVLMVSSQTGGGIPHLRKALVNLAL 299
>gi|119369275|sp|Q0AWF4|ENGB_SYNWW Probable GTP-binding protein engB (193 aa)
Score = 220, Expect = 1.0e-16, Identities = 60/165 (36%), Positives = 96/165 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           EI   GRSNVGKSSLIN + N K +AK+S+TPG+T+  N+Y   D++ ++DLPGYGYA+VS+ +     K++  Y+  R+ L  V Q++DI     + D+ M + L +      +V  KADK ++     + A I   L   +  +V  SA++   +  LK  +  ++
  S:    27 EIALAGRSNVGKSSLINKICNRKNLAKSSSTPGKTRTINYYLINDQWFMVDLPGYGYARVSREEKARWKKMVEAYLSQREQLRGVIQLLDIRHEPGENDILMKDWLLHLQIPVLVVATKADKLSRGARMKHIAIIRKTLDLPEMPLV-FSAQSGDGVEELKAALAELL 193
>gi|75677252|ref|YP_319673.1| GTPase EngB [Nitrobacter winogradskyi Nb-255] >gi|119369225|sp|Q3SN20|ENGB_NITWN Probable GTP-binding protein engB >gi|74422122|gb|ABA06321.1| GTPase [Nitrobacter winogradskyi Nb-255] (217 aa)
Score = 220, Expect = 1.1e-16, Identities = 59/165 (35%), Positives = 93/165 (56%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK----EAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           E+ F GRSNVGKSSLINAL   + +A+TS TPGRTQ   F++  K    RL+D+PGYG+A   K++    + +I +++  R  L  V+ +ID    I D+D  +   L      + +VL KAD+    E     D    ++A+       +++  S++    IP L+  +  +I
  S:    40 EVAFAGRSNVGKSSLINALTGRSALARTSRTPGRTQELIFFEGPKGVDVRLVDMPGYGFASAPKARIASWTSLIHQFLLGRATLARVYVLIDARHGIKDIDKTVLGALDRSAVSYQVVLTKADEVKVTEMAERIDITRTQLASH-PAAFPDVLVTSSRTGNGIPELRAAMARLI 212
>gi|170758960|ref|YP_001788547.1| GTP-binding protein [Clostridium botulinum A3 str. Loch Maree] >gi|169405949|gb|ACA54360.1| GTP-binding protein [Clostridium botulinum A3 str. Loch Maree] (194 aa)
Score = 220, Expect = 1.1e-16, Identities = 63/168 (37%), Positives = 95/168 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           FI S      +  D + E+ F+GRSNVGKS+LIN L N  K+ K S+TPG+T+L NF+   D    +DLPGYGYAKVSK +      I+ +Y+  R  L  +  ++D     T  D+ M   + +   +  +V  K DK  ++  + N   I   LK DK++ I+ +S+ +K
  S:    10 FIISAVKKGQYPEDGRPEVAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFVINDNMYFVDLPGYGYAKVSKREKENWGYIMEQYLVERDQLKKIVLLVDSRHKPTSDDINMYNWIKHYNYEVLVVGTKLDKLKRNDINKNKKIIRDTLKMDKDDKILLISSLSK 181
>gi|169182514|ref|ZP_02843030.1| GTP-binding protein HSR1-related [Thauera sp. MZ1T] >gi|169010385|gb|EDS57151.1| GTP-binding protein HSR1-related [Thauera sp. MZ1T] (219 aa)
Score = 220, Expect = 1.1e-16, Identities = 56/162 (34%), Positives = 92/162 (56%)
  Q:    21 EICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK--DKENIVCVSAKNKTNIPNLKKLIG 182
           EI F GRSN GKSS IN LA + ++A  S TPGRTQL NF+  +    L+DLPGYGYA V +    + S +I  Y+  R++L+ +  I+D    +T LD  M +  +      +++L K+DK ++        ++   L+    +  +   S+  K+ +  ++++IG
  S:    26 EIAFAGRSNAGKSSAINTLAGHVRLAYVSKTPGRTQLINFFRLNNGALLVDLPGYGYAAVPEKIRRQWSGLIETYLRTRESLIGLVLIMDSRHPLTPLDRNMIDWFAPSGRPMHVLLTKSDKLSRGAAAATLQEVRRALEPLGPQVTVQLFSSLKKSGVEEVERVIG 192
>gi|163768554|ref|ZP_02175543.1| GTP-binding protein HSR1-related [Anaeromyxobacter sp. K] >gi|167457901|ref|ZP_02324110.1| GTP-binding protein HSR1-related [Anaeromyxobacter dehalogenans 2CP-1] >gi|167415818|gb|EDR82540.1| GTP-binding protein HSR1-related [Anaeromyxobacter dehalogenans 2CP-1] >gi|196173026|gb|ACG73999.1| GTP-binding protein HSR1-related [Anaeromyxobacter sp. K] (216 aa)
Score = 220, Expect = 1.1e-16, Identities = 48/105 (45%), Positives = 67/105 (63%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD----------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID 108
           F K+     +W      EI F+GRSNVGKSS++NALA  K +A+ S+TPGRT+   F+D              R  DLPGYGYAKV++++    + +I +Y+  R  L AV  I+D
  S:    10 FAKTATRPEEWPRGATPEIAFVGRSNVGKSSMLNALARRKGLARVSSTPGRTRALQFFDLSYRPTPAARPRAIRFCDLPGYGYAKVARAERDRWTAMIEDYLRDRDVLRAVVLIVD 125
>gi|92119159|ref|YP_578888.1| GTPase EngB [Nitrobacter hamburgensis X14] >gi|119369222|sp|Q1QH69|ENGB_NITHX Probable GTP-binding protein engB >gi|91802053|gb|ABE64428.1| GTP-binding [Nitrobacter hamburgensis X14] (217 aa)
Score = 220, Expect = 1.2e-16, Identities = 60/165 (36%), Positives = 94/165 (56%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK-EAKSYFDNNFA--KIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           E+ F GRSNVGKSSLINAL     +A+TS TPGRTQ   F++  K    RL+D+PGYG+A   K++    + +I +++  R +L  V+ +ID    I D+D  +   L      + IVL KAD+ +A    +   A   + AK      +++  S++    +P L+  +  +I
  S:    40 EVAFAGRSNVGKSSLINALTGRGTLARTSRTPGRTQELIFFEGPKDADVRLVDMPGYGFASAPKARIASWTSLIHKFLLGRASLARVYVLIDSRHGIKDIDQAILTTLDRSAVSYQIVLTKADEVKATEMAERTEATRTLLAKHPAAFPDVLVTSSRTGYGVPELRAAMARLI 212
>gi|168183544|ref|ZP_02618208.1| GTP-binding protein [Clostridium botulinum Bf] >gi|182673313|gb|EDT85274.1| GTP-binding protein [Clostridium botulinum Bf] (194 aa)
Score = 220, Expect = 1.2e-16, Identities = 63/168 (37%), Positives = 95/168 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           F+ S      +  D + EI F+GRSNVGKS+LIN L N  K+ K S+TPG+T+L NF+   D    +DLPGYGYAKVSK +      I+ +Y+  R  L  +  ++D     T  D+ M   + +   +  +V  K DK  ++  + N   I   LK DK++ I+ +S+ +K
  S:    10 FVISAVKRGQYPEDGRPEIAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFLINDNMYFVDLPGYGYAKVSKKEKENWGYIMEQYLVERNQLKKIVLLVDSRHKPTSDDINMYNWIKHYNYEVLVVGTKLDKLKRNDINKNKKIIRDTLKMDKDDKILLISSLSK 181
>gi|153005532|ref|YP_001379857.1| GTP-binding protein HSR1-related [Anaeromyxobacter sp. Fw109-5] >gi|166225939|sp|A7HDS7|ENGB_ANADF Probable GTP-binding protein engB >gi|152029105|gb|ABS26873.1| GTP-binding protein HSR1-related [Anaeromyxobacter sp. Fw109-5] (216 aa)
Score = 220, Expect = 1.3e-16, Identities = 63/180 (35%), Positives = 88/180 (48%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF----------DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGS 183
           F+K+     +W      E+ F+GRSNVGKSS++NAL   K +A+ S TPGRT+   F+D              R  DLPGYGYAKVS+ +    + +I +Y+  R  L AV  I+D     +D D+  +  L     +  +   K DK  K+        +   L   K   V  SA   T    L   I S
  S:    10 FVKTATRPPEWPRGQTPELAFVGRSNVGKSSMLNALTRKKGLARVSATPGRTRALQFFDVAYRPTPAARPRHVRFCDLPGYGYAKVSREERDRWAAMIEDYLRDRDVLRAVVLIVDARHAPSDSDVDAAAFLRATGRRVLVAATKMDKLPKTRRGAALRAVEGALALAKGEAVPFSAVEGTGTDALWARIAS 201
>gi|190575834|ref|YP_001973679.1| putative ATP/GTP binding protein [Stenotrophomonas maltophilia K279a] >gi|190013756|emb|CAQ47391.1| putative ATP/GTP binding protein [Stenotrophomonas maltophilia K279a] (200 aa)
Score = 220, Expect = 1.3e-16, Identities = 58/166 (34%), Positives = 88/166 (53%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIG 182
           D+  E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+    +  L+DLPGYGYAKV           I +Y   R+ L  +  ++DI   + D D QM      R    + +L KADK ++S    +  K+  +L+    D  ++   S +++T +   + +IG
  S:    23 DEGAEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQVTPEAHLVDLPGYGYAKVPLDLQAHWQAFIDKYFRTREALKGLVVVMDIRHPLKDYDRQMLSYAVQRGLPAHALLTKADKLSRSQQMQSLQKVRKELQSAYGDSVSVQVFSGEDRTGVDEARGVIG 194
>gi|145588273|ref|YP_001154870.1| GTP-binding protein, HSR1-related [Polynucleobacter sp. QLW-P1DMWA-1] >gi|189037184|sp|A4SUZ2|ENGB_POLSQ Probable GTP-binding protein engB >gi|145046679|gb|ABP33306.1| cell division checkpoint GTPase YihA [Polynucleobacter sp. QLW-P1DMWA-1] (221 aa)
Score = 219, Expect = 1.3e-16, Identities = 56/139 (40%), Positives = 83/139 (59%)
  Q:    20 KEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYD-FDK----FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           +E+ F GRSN GKSS +N L N K +A  S TPGRTQ  N++  F K      L+DLPGYGYA V+    +  + ++S+Y+  R+ LV +  I+D    IT+LD QM +         +I+L+K DK  KS   +    +  +L++
  S:    25 REVAFAGRSNAGKSSALNVLCNQKRLAFASKTPGRTQHINYFGIFAKDDLLAYLVDLPGYGYAAVNHETKYHWNALLSDYLQEREQLVGMVLIVDARRGITELDEQMIQWFVPTGKPIHILLSKCDKLNKSECKHALEDVRKQLQQ 170
>gi|152978187|ref|YP_001343816.1| GTPase EngB [Actinobacillus succinogenes 130Z] >gi|171704208|sp|A6VLN4|ENGB_ACTSZ Probable GTP-binding protein engB >gi|150839910|gb|ABR73881.1| GTP-binding protein HSR1-related [Actinobacillus succinogenes 130Z] (206 aa)
Score = 219, Expect = 1.4e-16, Identities = 58/140 (41%), Positives = 82/140 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           F+ S  +      D   EI F GRSN GKS+ +NAL N K +A+TS TPGRTQL N ++ +   +L+DLPGYGYA V +    +  K + EY+  R+ L  V  ++DI   +  LD QM E   +      ++L KADK ++S
  S:    13 FLTSAANIKQLPEDSGIEIAFAGRSNAGKSTALNALTNQKNLARTSKTPGRTQLINLFEVEPNCKLVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGVVILMDIRHPLKALDQQMIEWAVSADLPLLLLLTKADKLSQS 155
>gi|187776854|ref|ZP_02993327.1| hypothetical protein CLOSPO_00393 [Clostridium sporogenes ATCC 15579] >gi|187775513|gb|EDU39315.1| hypothetical protein CLOSPO_00393 [Clostridium sporogenes ATCC 15579] (199 aa)
Score = 219, Expect = 1.5e-16, Identities = 63/168 (37%), Positives = 96/168 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           F+ S      +  D + EI F+GRSNVGKS+LIN L N  K+ K S+TPG+T+L NF+  ++    +DLPGYGYAKVSK +      I+ +Y+  R  L  +  ++D     T  D+ M   + +   +  +V  K DK  ++  + N   I   LK DK++ I+ +S+ NK
  S:    15 FVISAVKKAQYPEDGRPEIAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFLINENMYFVDLPGYGYAKVSKKEKENWGYIMEQYLVERDQLKKIVLLVDSRHKPTSDDINMYNWIKHYNYEVLVVGTKLDKLKRNDINKNKKIIRDTLKMDKDDKILLISSLNK 186
>gi|109896346|ref|YP_659601.1| GTP-binding protein, HSR1-related [Pseudoalteromonas atlantica T6c] >gi|119369232|sp|Q160A3|ENGB_PSEA6 Probable GTP-binding protein engB >gi|109698627|gb|ABG38547.1| cell division checkpoint GTPase YihA [Pseudoalteromonas atlantica T6c] (206 aa)
Score = 219, Expect = 1.6e-16, Identities = 50/103 (48%), Positives = 67/103 (65%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQM 119
           D   E+ F GRSN GKSS +N L   K +A+TS TPGRTQL N +D D+  RLIDLPGYGYAKV  +   +  K + EY+  R++L  +  ++DI     DLD ++
  S:    22 DQGIEVAFAGRSNAGKSSALNRLTRQKSLARTSKTPGRTQLINVFDLDEDRRLIDLPGYGYAKVPMAIKLKWQKSLGEYLQKRESLKGLVVLMDIRHPFKDLDQEL 127
>gi|163787480|ref|ZP_02181927.1| GTP-binding protein [Flavobacteriales bacterium ALC-1] >gi|159877368|gb|EDP71425.1| GTP-binding protein [Flavobacteriales bacterium ALC-1] (204 aa)
Score = 219, Expect = 1.6e-16, Identities = 61/147 (41%), Positives = 84/147 (57%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           D   E  FIGRSNVGKSSLIN L + K +AKTS  PG+TQL N +  ++ + L+DLPGYGYA+VSKS   +  K I+ Y   R+ L++ F ++DI      +DL+  + L        I+  KADK      D +      +L K  E +
  S:    21 DSLPEYAFIGRSNVGKSSLINMLTDRKSLAKTSGRPGKTQLINHFIINESWYLVDLPGYGYARVSKSSKKKFQKFITNYFEKRQQLISAFVLVDIRHKPQPIDLEFMQYLGESGIPFGIIFTKADKLKPMAIDRHVNNYCEELLKTWEEV 170
>gi|163740283|ref|ZP_02147677.1| GTP-binding protein [Phaeobacter gallaeciensis 2.10] >gi|161386141|gb|EDQ10516.1| GTP-binding protein [Phaeobacter gallaeciensis 2.10] (216 aa)
Score = 219, Expect = 1.6e-16, Identities = 62/181 (34%), Positives = 94/181 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY-DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++    +  L+DLPGYGYA        +  +++ +Y+  R+ L   F +ID    I  +D ++   L +       V+ KADK           ++ + L K       IV  S++    I  L+ +I  +
  S:    29 FVKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYFTQGPELYLVDLPGYGYANAPLPVVEKWQRLLKQYLSGRQTLRRAFVLIDSRHGIKKVDDEIMTRLDSSAVTFQCVMTKADKVKDKDRAVVMEQVRSALSKHPAAYPEIVMTSSEKGDGIATLRSIIAGL 215
>gi|15887733|ref|NP_353414.1| GTPase EngB [Agrobacterium tumefaciens str. C58] >gi|24418376|sp|Q8UIB4|ENGB_AGRT5 Probable GTP-binding protein engB >gi|15155296|gb|AAK86199.1| GTP-binding protein [Agrobacterium tumefaciens str. C58] (217 aa)
Score = 219, Expect = 1.7e-16, Identities = 55/119 (46%), Positives = 73/119 (61%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     L+D+PGYGYA+  K      +K++ +Y+  R  L  V+ +ID    I   D ++  LL      + +VL K DK
  S:    36 EIAFAGRSNVGKSSLINALVGHKGLARTSNTPGRTQELNYFVPEGYSGEPGDLPPMALVDMPGYGYAQAPKDHVDAWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDEEVLSLLDKAAVSYQVVLTKTDK 166
>gi|157164919|ref|YP_001467169.1| GTPase EngB [Campylobacter concisus 13826] >gi|112801424|gb|EAT98768.1| GTP-binding protein [Campylobacter concisus 13826] (204 aa)
Score = 218, Expect = 1.8e-16, Identities = 71/178 (39%), Positives = 105/178 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD--------------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVIT-DLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           FI S  S  +  +    E+ F+GRSNVGKSSLINAL N K +AK+S+TPG+TQL NF++ +              K  L+DLPG+GYAKV+KSKH E  K + E++  R ++     +ID      D+D+ +   L +       +LN   K  K     N ++ +A +K D   I+ VS  +K+ I   ++ I
  S:     9 FITSSPSIKEAPSFVTSEVVFLGRSNVGKSSLINALVNQKNLAKSSSTPGKTQLINFFEAEFCEQKDEQEEKEKFKLILVDLPGFGYAKVAKSKHDEWRKNLDEFLKFRSDIRLFIHLIDARHFDLDIDVNVDSYLKSFLRADQKILNLYTKSDKL----NQSQKSAIMKFDPSGIL-VSTLSKSGIDKAREAI 197
>gi|149181759|ref|ZP_01860250.1| GTP-binding protein [Bacillus sp. SG-1] >gi|148850500|gb|EDL64659.1| GTP-binding protein [Bacillus sp. SG-1] (196 aa)
Score = 218, Expect = 2.0e-16, Identities = 52/122 (42%), Positives = 74/122 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           E    GRSNVGKSS IN +   K +A+ S+ PG+TQ  NFY  ++    +D+PGYG+AKVSK +     ++I  YI +R+ L AV QI+D+    T+ D+ M + L +      I+  KADK  K
  S:    28 EFALAGRSNVGKSSFINRMIGRKSMARISSRPGKTQTLNFYKIEESLYFVDVPGYGFAKVSKKEREAWGRMIETYITMREQLKAVIQIVDLRHPPTEDDIMMYDFLKHNGIPCVIIATKADKIPK 152
>gi|90961519|ref|YP_535435.1| GTP-binding protein [Lactobacillus salivarius UCC118] >gi|119369208|sp|Q1WUI3|ENGB_LACS1 Probable GTP-binding protein engB >gi|90820713|gb|ABD99352.1| GTP-binding protein [Lactobacillus salivarius UCC118] (196 aa)
Score = 218, Expect = 2.0e-16, Identities = 60/151 (39%), Positives = 89/151 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDK-ENIVCVSAKNK 171
           E+   GRSNVGKSSLIN L N +  A+TS+ PG+TQ  NFY+  D    +D+PGYGYAKVS+ +  + +++I  Y   R+ L     ++D     ++LD QM E L        +V  K DK  KS  + + ++I  KL+  K + ++  SA +K
  S:    25 EVALAGRSNVGKSSLINTLINRRNYARTSSQPGKTQTLNFYNIEDLLYFVDVPGYGYAKVSQKEREKWARMIETYFSTRQELKGAISLVDARHEPSELDCQMIEFLHYYNIPVLVVGTKIDKIPKSKRNKSESQIRKKLQLTKNDRLILFSAVDK 179
>gi|28378737|ref|NP_785629.1| GTPase EngB [Lactobacillus plantarum WCFS1] >gi|38257507|sp|Q88VE3|ENGB_LACPL Probable GTP-binding protein engB >gi|28271574|emb|CAD64479.1| GTP-binding protein [Lactobacillus plantarum WCFS1] (197 aa)
Score = 218, Expect = 2.0e-16, Identities = 60/168 (35%), Positives = 91/168 (54%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLK-KDKENIVCVSAKNK 171
            + S  + + + T    EI   GRSNVGKSSLIN L N    A+TS+ PG+TQ  NFY   D+   +D+PGYGYAKVSK +  +  ++I  Y+  R+ L  V  ++D     T  D+ M E +        +V  K+DK  +  ++   + I   L  + +++ +  SAK K
  S:     8 LVMSAVAPSQYPTTGFPEIGLAGRSNVGKSSLINVLINRNSYARTSSQPGKTQTLNFYKVEDQLYFVDVPGYGYAKVSKKEREKWGQMIETYLTSRETLRGVVILVDARHAPTKDDVAMYEWMRYYEMPLLVVATKSDKIPRGKWNKQESLIKKTLNFQAEDDFIAFSAKTK 179
>gi|150008077|ref|YP_001302820.1| GTPase EngB [Parabacteroides distasonis ATCC 8503] >gi|166225966|sp|A6LBY4|ENGB_PARD8 Probable GTP-binding protein engB >gi|149936501|gb|ABR43198.1| GTP-binding protein [Parabacteroides distasonis ATCC 8503] (200 aa)
Score = 218, Expect = 2.0e-16, Identities = 60/146 (41%), Positives = 81/146 (55%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           +K E  FIGRSNVGKSSLIN L N K +A TS TPG+T L N F   +++ L+DLPGYG+A+  K    +L +II  YI  R+ L  +F ++D       +DL+  E L        I+  K DK +K     N      KL +  E +
  S:    22 NKPEYAFIGRSNVGKSSLINMLTNKKGLAMTSQTPGKTLLINHFLINNEWYLVDLPGYGFAQRGKENREQLKRIIENYILDREQLTNLFVLLDCRHEAQKIDLEFMEWLGESGVPFSIIFTKIDKISKGRLKENLKVYTDKLLETWEEL 170
>gi|148381176|ref|YP_001255717.1| GTP-binding protein [Clostridium botulinum A str. ATCC 3502] >gi|153931772|ref|YP_001385551.1| GTPase EngB [Clostridium botulinum A str. ATCC 19397] >gi|153935229|ref|YP_001388957.1| GTPase EngB [Clostridium botulinum A str. Hall] >gi|153938105|ref|YP_001392578.1| GTPase EngB [Clostridium botulinum F str. Langeland] >gi|168179123|ref|ZP_02613787.1| GTP-binding protein [Clostridium botulinum NCTC 2916] >gi|170757263|ref|YP_001782866.1| GTP-binding protein [Clostridium botulinum B1 str. Okra] >gi|148290660|emb|CAL84789.1| probable GTP-binding protein Engb [Clostridium botulinum A str. ATCC 3502] >gi|152927816|gb|ABS33316.1| GTP-binding protein [Clostridium botulinum A str. ATCC 19397] >gi|152931143|gb|ABS36642.1| GTP-binding protein [Clostridium botulinum A str. Hall] >gi|152934001|gb|ABS39499.1| GTP-binding protein [Clostridium botulinum F str. Langeland] >gi|169122475|gb|ACA46311.1| GTP-binding protein [Clostridium botulinum B1 str. Okra] >gi|182669944|gb|EDT81920.1| GTP-binding protein [Clostridium botulinum NCTC 2916] (194 aa)
Score = 218, Expect = 2.0e-16, Identities = 62/168 (36%), Positives = 95/168 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN-IVCVSAKNK 171
           F+ S      +  D + E+ F+GRSNVGKS+LIN L N  K+ K S+TPG+T+L NF+   D    +DLPGYGYAKVSK +      I+ +Y+  R  L  +  ++D     T  D+ M   + +   +  +V  K DK  ++  + N   I   LK DK++ I+ +S+ +K
  S:    10 FVISAVKKTQYPEDGRPEVAFVGRSNVGKSTLINTLTNRRKLVKVSSTPGKTRLINFFVINDNMYFVDLPGYGYAKVSKKEKENWGYIMEQYLVERDQLKKIVLLVDSRHKPTSDDINMYNWIKHYNYEVLVVGTKLDKLKRNDINKNKKIIRDTLKMDKDDKILLISSLSK 181
>gi|193211890|ref|YP_001997843.1| small GTP-binding protein [Chlorobaculum parvum NCIB 8327] >gi|193085367|gb|ACF10643.1| small GTP-binding protein [Chlorobaculum parvum NCIB 8327] (192 aa)
Score = 218, Expect = 2.1e-16, Identities = 56/136 (41%), Positives = 80/136 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVI-TDLDLQMSELLSNRFNQHYIVLNKADK 139
           F  S  S N   +D + EI F+GRSNVGKSSL+N+L A   +AKTS+TPG+T+L N++  ++    +DLPGYGYAKV   +     K++++Y+  R  +  V  ++D        D +M E L        IVL K DK
  S:     8 FFCSYSSLNGLPSDGRPEIVFVGRSNVGKSSLLNSLCARKGLAKTSSTPGKTRLINYFLINENLYFVDLPGYGYAKVGHGERESWGKLLTDYVVKRDEIALVVLLVDARHPGMGSDREMMEFLDYCGRPFGIVLTKWDK 146
>gi|186455254|ref|ZP_02965569.1| GTP-binding protein HSR1-related [bacterium Ellin514] >gi|184208813|gb|EDU05857.1| GTP-binding protein HSR1-related [bacterium Ellin514] (196 aa)
Score = 218, Expect = 2.1e-16, Identities = 52/128 (40%), Positives = 74/128 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           E  FIGRSNVGKSSL+N LA  K +A+ S  PG T+L NF+  +K +RL+DLPGYGYA +++      +  +S Y+  R NL  VF +ID       +DL+  + L  +     ++  K DK   +    N
  S:    25 EFAFIGRSNVGKSSLVNLLAGRKDLARVSKVPGYTKLINFFTINKAWRLVDLPGYGYAHIARENSARFNDAVSNYLAKRSNLYCVFVLIDSRHKPQKIDLEFVQWLGEQSAPCALIFTKTDKVKAAQLQTN 155
>gi|39998104|ref|NP_954055.1| GTPase EngB [Geobacter sulfurreducens PCA] >gi|81831965|sp|Q748I9|ENGB_GEOSL Probable GTP-binding protein engB >gi|39985049|gb|AAR36405.1| GTP-binding protein [Geobacter sulfurreducens PCA] (206 aa)
Score = 218, Expect = 2.2e-16, Identities = 55/140 (39%), Positives = 78/140 (55%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           F+ S      +   D  EI F+GRSNVGKSSLIN L N K + +TS+TPGRTQL NF+  +    L+DLPGYG+A+V      +   ++  Y+  R  L  V  I+D+     + D  M + L        +V+ K DK +K+
  S:     9 FVTSGTRPEHYPPGDLLEIAFVGRSNVGKSSLINVLVNRKSLVRTSSTPGRTQLINFFRVNGSLMLVDLPGYGFARVPPEVKRQWGPMVETYLAGRSCLACVVLIVDVRRTPAEEDRLMLQWLRAYDIPVLVVITKCDKVSKN 151
>gi|115451735|ref|NP_001049468.1| Os03g0232500 [Oryza sativa (japonica cultivar-group)] >gi|108707011|gb|ABF94806.1| GTP-binding protein, putative, expressed [Oryza sativa (japonica cultivar-group)] >gi|113547939|dbj|BAF11382.1| Os03g0232500 [Oryza sativa (japonica cultivar-group)] (318 aa)
Score = 218, Expect = 2.2e-16, Identities = 56/139 (40%), Positives = 74/139 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAK 142
           F+KS   + D   DD+ E   +GRSNVGKSSLINAL   K  A TS  PG+TQ  N +  +K + L+DLPGYG+A  S+S   + S     Y   R  LV V  ++D S+    +D+  +  L         V  K DK  K
  S:   117 FVKSSARARDCPKDDRPEFAVLGRSNVGKSSLINALIRRKEAALTSKKPGKTQTINHFLVNKSWYLVDLPGYGFAAASQSARTDWSSFTKGYFLNRDTLVGVLLLVDASIPPQKIDIDCANWLGRNNIGLTYVFTKCDKSKK 258
>gi|87198603|ref|YP_495860.1| GTPase EngB [Novosphingobium aromaticivorans DSM 12444] >gi|119369226|sp|Q2GAU7|ENGB_NOVAD Probable GTP-binding protein engB >gi|87134284|gb|ABD25026.1| GTP-binding [Novosphingobium aromaticivorans DSM 12444] (217 aa)
Score = 218, Expect = 2.3e-16, Identities = 63/178 (35%), Positives = 95/178 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF---DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLI 181
           F+KS  +       D  EI F GRSNVGKSSL+NAL   K +A+TS TPGRTQ  N+++     + RL+D+PGYG+AK          +++ +++  R  L     +ID    +  +D  M ++L      + IVL KADK   S  +   A+  A  +K       I+  S++ K  I  L+  +
  S:    26 FLKSAPALKFLPDPDVPEIAFAGRSNVGKSSLLNALTGRKSLARTSVTPGRTQELNYFEVGEPTRLRLVDMPGYGFAKAPPKVVETWRRLVRDFLRGRVVLKRTLLLIDSRHGVKPVDDDMMQMLDEAGVGYRIVLTKADKIKASELEKVTAETIAAARKRTAAYPEIIVTSSEKKMGIEELRAAV 211
>gi|148244359|ref|YP_001219053.1| GTP-binding protein [Candidatus Vesicomyosocius okutanii HA] >gi|166232161|sp|A5CXJ4|ENGB_VESOH Probable GTP-binding protein engB >gi|146326186|dbj|BAF61329.1| GTP-binding protein [Candidatus Vesicomyosocius okutanii HA] (199 aa)
Score = 217, Expect = 2.3e-16, Identities = 61/155 (39%), Positives = 82/155 (52%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           F+ SC S      D   E+ F GRSN GKS  IN L    K+AK S TPGRTQ   F++ DK  RL DLPGYGYAKV +    +  K ++EY   R  L     ++D+   +   D  M +  +N      I+L K+DK  K    N + K+  ++KK
  S:    10 FLLSCPSLKGCPPDQGYEVIFAGRSNAGKSRAINTLTLQNKLAKVSRTPGRTQHLVFFELDKDRRLADLPGYGYAKVPEHIKVKWYKDMNEYFNQRDCLRGAVLVMDVRHPLKPFDQMMLDWCNNIHLPTQIILTKSDKLKKIAASNTYFKVLDQIKK 167
>gi|121602307|ref|YP_989324.1| GTPase EngB [Bartonella bacilliformis KC583] >gi|166225944|sp|A1UTM1|ENGB_BARBK Probable GTP-binding protein engB >gi|120614484|gb|ABM45085.1| GTP-binding protein [Bartonella bacilliformis KC583] (215 aa)
Score = 217, Expect = 2.4e-16, Identities = 55/127 (43%), Positives = 78/127 (61%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDN 147
           EI F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          DF    L+D+PGYG+A+  K+     + ++  Y+  R  L  V+ +ID    I   D ++ +LL      + I+L K+DK   +  +N
  S:    34 EIAFAGRSNVGKSSLINALVQQKGLARTSNTPGRTQELNYFVPDGFSGSKEDFPPMALVDMPGYGFAQAPKNLVDAWTHLVFNYLRGRTTLKRVYILIDSRHGIKKNDEEVLDLLDKAAVSYQIILTKSDKIKSNMLEN 172
>gi|88705359|ref|ZP_01103070.1| GTP-binding protein engB [gamma proteobacterium KT 71] >gi|88700449|gb|EAQ97557.1| GTP-binding protein engB [Congregibacter litoralis KT71] (230 aa)
Score = 217, Expect = 2.5e-16, Identities = 57/163 (34%), Positives = 87/163 (53%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVC 165
           +F+ S    +    D   E+ F GRSN GKSS IN+L  N K+A+TS TPGRTQL NF+   ++ R++DLPGYGYAKV +    + +K +  Y+  R++L  +  + D    +   D QM    +      +++L K DK +K        K+   +    E + C
  S:    26 AFLTSAAKVSQCPEDIGWEVAFAGRSNAGKSSAINSLTQNHKLARTSKTPGRTQLINFFTVGEQQRIVDLPGYGYAKVPQKLKQDWTKQMEAYLQERQSLRGLILLSDCRHPLQPFDQQMLTWAAEADMPVHMLLTKCDKLSKGAGKQTLLKVRNSVAPLGELVTC 191
>gi|78186100|ref|YP_374143.1| GTPase EngB [Pelodictyon luteolum DSM 273] >gi|119369228|sp|Q3B6D1|ENGB_PELLD Probable GTP-binding protein engB >gi|78166002|gb|ABB23100.1| GTP-binding [Pelodictyon luteolum DSM 273] (207 aa)
Score = 217, Expect = 2.6e-16, Identities = 54/137 (39%), Positives = 83/137 (60%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           +FI+S  +  D   +   EI F GRSNVGKSSL+N+L   K +AKTS+TPG+T+L N++   D    +D+PGYGYA VS ++     ++++ Y+  R+ +  V  ++D      + D +M E L+     + IVL K DK
  S:     7 AFIRSVSALQDLPDERVPEIVFAGRSNVGKSSLLNSLTGRKGLAKTSSTPGKTRLLNYFLINDDLYFVDIPGYGYAAVSHTEKDAWGRLLAGYVGGRQAIALVVLLLDSRHPAMESDREMMEFLAYHDRPYGIVLTKDDK 146
>gi|119358159|ref|YP_912803.1| GTPase EngB [Chlorobium phaeobacteroides DSM 266] >gi|166225950|sp|A1BJ02|ENGB_CHLPD Probable GTP-binding protein engB >gi|119355508|gb|ABL66379.1| GTP-binding protein, HSR1-related [Chlorobium phaeobacteroides DSM 266] (192 aa)
Score = 217, Expect = 2.7e-16, Identities = 54/123 (43%), Positives = 77/123 (62%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSNVGKS+L+N+LA  K +AKTS+TPG+T+L NF+  +K F  +DLPGYG+A V   +H    K+++ YI  R  +  V  ++D        D +M + L+     + IVL K DK  +S
  S:    25 EIVFAGRSNVGKSTLLNSLAGIKGLAKTSSTPGKTRLINFFLVNKAFFFVDLPGYGFAAVGHEQHEAWKKLLTTYIERRSAITLVVLLVDSRHPAMQSDREMIDYLTYLGKPYGIVLTKDDKLTQS 150
>gi|157339533|emb|CAO44074.1| unnamed protein product [Vitis vinifera] (307 aa)
Score = 217, Expect = 2.7e-16, Identities = 49/120 (40%), Positives = 71/120 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELL 123
           F+KS   + D  +D   E   +GRSNVGKSSL+N+L   K +A TS  PG+TQ  N +   D + L+DLPGYGYA   +    + +K   +Y   R  LV+VF ++D S+    +DL+ +  L
  S:   109 FVKSSVRTEDCPSDGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDSWYLVDLPGYGYAAAPQELRTDWNKFTKDYFQSRSTLVSVFLLVDASIPAKKIDLEYASWL 231
>gi|163739490|ref|ZP_02146900.1| GTP-binding protein [Phaeobacter gallaeciensis BS107] >gi|161387243|gb|EDQ11602.1| GTP-binding protein [Phaeobacter gallaeciensis BS107] (216 aa)
Score = 217, Expect = 2.8e-16, Identities = 62/181 (34%), Positives = 94/181 (51%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY-DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSV 184
           F+K   + +     D+ E+CF GRSNVGKSSLINAL   K +A+ SNTPGRTQ  N++    +  L+DLPGYGYA        +  +++ +Y+  R+ L   F +ID    I  +D ++   L +       V+ KADK           ++ + L K       IV  S++    I  L+ +I  +
  S:    29 FVKGVVAMSGLPPADRIEVCFAGRSNVGKSSLINALTGTKGLARASNTPGRTQEINYFTQGPELYLVDLPGYGYANAPLPIVEKWQRLLKQYLSGRQTLRRSFVLIDSRHGIKKVDDEIMTRLDSSAVTFQCVMTKADKVKDKDRAVVMEQVRSALSKHPAAYPEIVMTSSEKGDGIATLRSIIAGL 215
>gi|85709447|ref|ZP_01040512.1| GTP-binding protein [Erythrobacter sp. NAP1] >gi|85688157|gb|EAQ28161.1| GTP-binding protein [Erythrobacter sp. NAP1] (229 aa)
Score = 217, Expect = 2.8e-16, Identities = 56/138 (40%), Positives = 78/138 (56%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-------FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           E+ F GRSNVGKSSL+NAL   K IA+ S TPGRTQ  NF+D          FRL+D+PGYG+AK           ++  Y+  R  L     ++D    + D+D +M ++L      + IVL K DK   S  +    K+A + +K
  S:    44 EVAFCGRSNVGKSSLLNALTGRKAIARASVTPGRTQELNFFDVGGEPGGKPLFRLVDMPGYGFAKAPVKVVERWKNLVKSYLRGRPVLARNLVLVDSRHGLKDVDREMMKMLDEAAVGYRIVLTKTDKIKASELERVANKVADEARK 190
>gi|119369201|sp|Q0I1G1|ENGB_HAES1 Probable GTP-binding protein engB (204 aa)
Score = 217, Expect = 2.9e-16, Identities = 54/127 (42%), Positives = 76/127 (59%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL   K +A+TS  PGRTQL N +  +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    26 DSGIEIAFAGRSNAGKSTALNALTQQKNLARTSKIPGRTQLINLFQVEPNCKLVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGLVILMDIRHPLKDLDQQMIEWAVSADLPVLLLLTKADKLSQS 155
>gi|127514643|ref|YP_001095840.1| GTPase EngB [Shewanella loihica PV-4] >gi|166225981|sp|A3QJD3|ENGB_SHELP Probable GTP-binding protein engB >gi|126639938|gb|ABO25581.1| GTP-binding protein, HSR1-related [Shewanella loihica PV-4] (218 aa)
Score = 216, Expect = 3.0e-16, Identities = 53/123 (43%), Positives = 75/123 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           EI F GRSN GKSS +N L   K +A+TS TPGRTQL N +  D+ R L+DLPGYG+A+V  +   +  + + +Y+  R  L  +  ++DI   + DLD+QM E   +       +L K DK A+S
  S:    34 EIAFAGRSNAGKSSALNQLTEQKNLARTSKTPGRTQLINVFALDEHRRLVDLPGYGFAQVPLAMKKKWQQALGQYLQERACLSGLVVLMDIRHPLKDLDMQMIEWAVDCDIPVLALLTKCDKLAQS 159
>gi|152994783|ref|YP_001339618.1| GTP-binding protein HSR1-related [Marinomonas sp. MWYL1] >gi|150835707|gb|ABR69683.1| GTP-binding protein HSR1-related [Marinomonas sp. MWYL1] (214 aa)
Score = 216, Expect = 3.0e-16, Identities = 58/136 (42%), Positives = 81/136 (59%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFY--DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELL-SNRFNQHYIVLNKADK 139
           FIKS    +    D   E+ F GRSN GKS+ +N L N  K+A+TS TPGRTQL N +  + D  RLIDLPGYG+AKV  +        + +Y+  R++L  V  ++DI   + + D  M +   SNR   H ++L K+DK
  S:    13 FIKSAEKLSQCPLDQGVEVAFAGRSNAGKSTALNTLTNQKKLARTSKTPGRTQLINCFGLNVDDRRLIDLPGYGFAKVPIAMKKVWQAHMQDYLMNRRSLAGVVLVMDIRHPLKEFDEMMLDWAKSNRMKVH-VLLTKSDK 152
>gi|161507350|ref|YP_001577304.1| GTPase EngB [Lactobacillus helveticus DPC 4571] >gi|172048268|sp|A8YUS5|ENGB_LACH4 Probable GTP-binding protein engB >gi|160348339|gb|ABX27013.1| GTP-binding protein [Lactobacillus helveticus DPC 4571] (196 aa)
Score = 216, Expect = 3.1e-16, Identities = 63/153 (41%), Positives = 88/153 (57%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKD 159
           S    + +  D+  EI   GRSNVGKSSLIN L N K +A+TS+ PG+TQ  NFY   D+F L+D+PGYGYA+VS+ K  E  ++I +Y+  R NL  +  +ID     T  D+ M            +V  K DK  KS  +    K+ ++LKK+
  S:    11 SAVREDQYPKDNLPEIALSGRSNVGKSSLINTLLNRKNLARTSSQPGKTQTLNFYLINDEFYLVDVPGYGYARVSQKKRQEFGEMIQDYLETRPNLKGLVILIDSRHEPTKDDIAMYNYAQYLNLPILVVCTKIDKIKKSQVN----KVMSRLKKN 162
>gi|163859239|ref|YP_001633537.1| GTPase EngB [Bordetella petrii DSM 12804] >gi|163262967|emb|CAP45270.1| putative GTP-binding protein [Bordetella petrii] (257 aa)
Score = 216, Expect = 3.2e-16, Identities = 51/119 (42%), Positives = 76/119 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFR-------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           E+CF+GRSN GKSS IN L N + +A +S TPGRT+L N +   D          L+DLPGYGYA V+  +  + + ++  Y+  R +L  +  IIDI   IT+LD ++++ ++        +L KADK
  S:    76 EVCFVGRSNAGKSSAINVLCNQRRLAFSSKTPGRTRLINLFGLPDPLSPDQPLGFLVDLPGYGYASVAHREKEKWADVLGGYLRDRSSLAGIVLIIDIRRGITELDRRLADFIAPTGRPVLALLTKADK 204
>gi|189485033|ref|YP_001955974.1| putative GTP-binding protein EngB [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170286992|dbj|BAG13513.1| putative GTP-binding protein EngB [uncultured Termite group 1 bacterium phylotype Rs-D17] (193 aa)
Score = 216, Expect = 3.4e-16, Identities = 64/158 (40%), Positives = 92/158 (58%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAK-LKKDKENIVCVSAKNKTNIPNLK 178
           EI F GRSNVGKSS+INAL + K +A+ S TPGRT+  N Y     + ++DLPGYG+A+VS  +    +K++ E I  R +   V+ +ID  V  T+LD  M++ L        I+ NK DK  ++  ++     AA+    DK N+  VSAK +     LK
  S:    23 EIIFSGRSNVGKSSVINALCSQKNLARISKTPGRTRSINVYSVSLRKWIVDLPGYGFARVSLQEKKLWNKMMEECIIKRNSNKTVYIVIDAFVGPTELDFDMTKWLKEYNISFKIIANKCDKVPQTISEDEIQSKAAECFGTDKPNVFTVSAKKRNGFNKLK 184
>gi|119369279|sp|Q3BXK1|ENGB_XANC5 Probable GTP-binding protein engB (207 aa)
Score = 216, Expect = 3.6e-16, Identities = 57/167 (34%), Positives = 85/167 (50%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIGS 183
           D   E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+     R L+DLPGYGYAKV +         I  Y   R+ L  +  ++DI   + D DLQM    + R    + +L KADK  +        K+  ++     D   +   S +++  +  L+ ++G+
  S:    23 DGGYEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQIQPERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLGYAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGESRQGVDELRAIVGA 195
>gi|78046337|ref|YP_362512.1| GTPase EngB [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78034767|emb|CAJ22412.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] (221 aa)
Score = 216, Expect = 3.6e-16, Identities = 57/167 (34%), Positives = 85/167 (50%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIGS 183
           D   E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+     R L+DLPGYGYAKV +         I  Y   R+ L  +  ++DI   + D DLQM    + R    + +L KADK  +        K+  ++     D   +   S +++  +  L+ ++G+
  S:    37 DGGYEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQIQPERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLGYAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGESRQGVDELRAIVGA 209
>gi|194689944|gb|ACF79056.1| unknown [Zea mays] >gi|194693496|gb|ACF80832.1| unknown [Zea mays] (313 aa)
Score = 216, Expect = 3.6e-16, Identities = 47/108 (43%), Positives = 63/108 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV 111
           F+KS    +D   D   E   +GRSNVGKSSL+N+L   K +A TS  PG+TQ  N +   D + L+DLPGYGYA   +       +    Y   R+NLV+VF +ID S+
  S:   115 FVKSSVRPDDCPRDGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFKVNDSWYLVDLPGYGYASAPQEARTNWDEFTRNYFLSRENLVSVFLLIDASI 224
>gi|90581062|ref|ZP_01236862.1| GTP-binding protein [Vibrio angustum S14] >gi|90437758|gb|EAS62949.1| GTP-binding protein [Vibrio angustum S14] (224 aa)
Score = 216, Expect = 3.7e-16, Identities = 65/166 (39%), Positives = 85/166 (51%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSA 168
           SFI S         D   EI F GRSN GKSS +N L + K +A+TS TPGRTQL N ++      LIDLPGYG+A+V      +  K + EY+  R+ L  +  ++DI   + DLD QM            ++L KADK           KI  ++ KD E  V V A
  S:    11 SFITSAPDIRHLPQDAGVEIAFAGRSNAGKSSALNRLTDQKGLARTSKTPGRTQLINMFEVVQGCNLIDLPGYGFAQVPLEMKLKWQKSLGEYLQRRECLQGLVVLMDIRHPMKDLDQQMINWALESRLPVLVLLTKADKLKSGARKAQVLKI-RQMTKDLEGEVQVEA 178
>gi|158425674|ref|YP_001526966.1| GTPase EngB [Azorhizobium caulinodans ORS 571] >gi|158332563|dbj|BAF90048.1| GTP-binding protein [Azorhizobium caulinodans ORS 571] (223 aa)
Score = 216, Expect = 3.7e-16, Identities = 56/138 (40%), Positives = 79/138 (57%)
  Q:    21 EICFIGRSNVGKSSLINAL-ANAKIAKTSNTPGRTQ-LANFYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK 158
           EI  +GRSNVGKSSL+NAL     +A+TS TPGRTQ L  F    +  L+D+PGYG+AK  K K       I  Y+  R NL  VF +ID    I  +D ++ +LL      + IVL K+D+  ++  +   A    K+++
  S:    49 EIALVGRSNVGKSSLVNALTGRTALARTSVTPGRTQELIFFRCVPEMMLVDMPGYGFAKAPKDKVDAWVATIRAYLRGRVNLARVFVLIDARHGIKPVDAEILDLLDKAAVSYAIVLTKSDQVKRTDLEAVIADTKDKIRR 189
>gi|149192614|ref|ZP_01870766.1| GTPase EngB [Vibrio shilonii AK1] >gi|148833550|gb|EDL50635.1| GTPase EngB [Vibrio shilonii AK1] (244 aa)
Score = 216, Expect = 3.7e-16, Identities = 53/123 (43%), Positives = 74/123 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D+  EI F GRSN GKSS +N L N + +AKTS TPGRTQL N +  D+   ++DLPGYG+A+V      +  K + EY+  RK L  +  ++DI   + DLD Q+ +          ++L KADK
  S:    54 DEGIEIAFAGRSNAGKSSSLNRLTNQRALAKTSKTPGRTQLINLFKVDEGCHIVDLPGYGFAQVPLEMKKKWQKSLGEYLQKRKCLKGLVVLMDIRHPMKDLDQQLIQWAVESHIPVQVLLTKADK 179
>gi|57242609|ref|ZP_00370546.1| GTP-binding protein [Campylobacter upsaliensis RM3195] >gi|57016538|gb|EAL53322.1| GTP-binding protein [Campylobacter upsaliensis RM3195] (196 aa)
Score = 215, Expect = 4.4e-16, Identities = 68/161 (42%), Positives = 99/161 (61%)
  Q:    21 EICFIGRSNVGKSSLINALA-NAKIAKTSNTPGRTQLANFYDFD--------KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-----ISVITDLDLQMSELLSNRFNQHYI-VLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLI 181
           E+ F+GRSNVGKSSLIN L    K+AK+S+TPG+TQL NF++          K   IDLPG+GYAKVSK+     +K + E++ LR ++     +ID     + +  D+D+ +   L  R +Q  + V  KADK  +S           KLK D EN + +S  NK+ +  L+ +I
  S:    24 EVAFLGRSNVGKSSLINTLCKQKKLAKSSSTPGKTQLINFFEIKCKKNEEEFKIHFIDLPGFGYAKVSKNLKEIWNKNLDEFLKLRTSIKLFLHLIDARHTNLEIDLDVDVYLKSFL--RGDQQILKVFTKADKLNQSQ--------KTKLKNDFENSLLISNLNKSGLTLLENII 189
>gi|78777274|ref|YP_393589.1| GTPase EngB [Sulfurimonas denitrificans DSM 1251] >gi|78497814|gb|ABB44354.1| GTP-binding [Sulfurimonas denitrificans DSM 1251] (205 aa)
Score = 215, Expect = 4.5e-16, Identities = 64/168 (38%), Positives = 102/168 (60%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYD------------FDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELL---SNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCVSAKNKTNIPNLKKLIGSVI 185
           ++ EI F+ RSNVGKSSL+NAL N K +AK S+TPG+T+L N++D            F KF  +DLPG+GYAKV+KS  ++  + +++YI  RK +     ++D      D+D  +S+ L   +N     + +  K DK  +        K   +L++D  N + VS+  K  +  +  LI +V+
  S:    24 EQNEIVFMARSNVGKSSLLNALTNHKGLAKVSSTPGKTRLINYFDVTFINREDSLKSFAKF--VDLPGFGYAKVAKSIKYDWERNLTDYIASRKQIKIFIHLVDCRHPFLDIDKSVSDFLLECANPTQHIFQIFTKIDKLNQ--------KEQTELRRDFPNALMVSSSKKKGLAKIVTLIYNVL 198
>gi|82703200|ref|YP_412766.1| GTPase EngB [Nitrosospira multiformis ATCC 25196] >gi|119369223|sp|Q2Y797|ENGB_NITMU Probable GTP-binding protein engB >gi|82411265|gb|ABB75374.1| cell division checkpoint GTPase YihA [Nitrosospira multiformis ATCC 25196] (235 aa)
Score = 215, Expect = 4.5e-16, Identities = 53/119 (44%), Positives = 72/119 (60%)
  Q:    21 EICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSN GKSS IN LAN  ++A  S TPGRTQ  NF+    D+F L+DLPGYGYAKV         +++  Y+  R++L  +  I+D    +T LD QM    +      +++L K+DK
  S:    26 EIAFAGRSNAGKSSAINTLANRNRLAFVSKTPGRTQHLNFFRLGNDRF-LVDLPGYGYAKVPAEVRQHWERLLGTYLQTRQSLHGMVLIMDARHPLTPLDRQMLAWFAPTKKAVHVLLTKSDK 147
>gi|157373236|ref|YP_001471836.1| GTPase EngB [Shewanella sediminis HAW-EB3] >gi|189037191|sp|A8FPD5|ENGB_SHESH Probable GTP-binding protein engB >gi|157315610|gb|ABV34708.1| GTP-binding protein, HSR1-related [Shewanella sediminis HAW-EB3] (220 aa)
Score = 215, Expect = 4.6e-16, Identities = 54/127 (42%), Positives = 77/127 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKSS +N L + K +A+TS TPGRTQL N ++ D+  RL+DLPGYG+A+V  +   +  + + EY+  R+ L  +  ++DI   + DLD+QM             +L KADK  +S
  S:    30 DAGVEIAFAGRSNAGKSSALNLLTDQKSLARTSRTPGRTQLINIFELDENRRLVDLPGYGFAQVPLALKKKWQESLGEYLQERQCLGGMVVLMDIRHPLKDLDMQMIAWALESEIPVLALLTKADKLKQS 159
>gi|33594513|ref|NP_882157.1| GTPase EngB [Bordetella pertussis Tohama I] >gi|33594785|ref|NP_882428.1| GTPase EngB [Bordetella parapertussis 12822] >gi|33599057|ref|NP_886617.1| GTPase EngB [Bordetella bronchiseptica RB50] >gi|81578317|sp|Q7VTA1|ENGB_BORPE Probable GTP-binding protein engB >gi|81578960|sp|Q7W2C4|ENGB_BORPA Probable GTP-binding protein engB >gi|81580336|sp|Q7WR92|ENGB_BORBR Probable GTP-binding protein engB >gi|33564589|emb|CAE43906.1| putative GTP-binding protein [Bordetella pertussis Tohama I] >gi|33564861|emb|CAE39805.1| putative GTP-binding protein [Bordetella parapertussis] >gi|33575103|emb|CAE30566.1| putative GTP-binding protein [Bordetella bronchiseptica RB50] (207 aa)
Score = 215, Expect = 4.7e-16, Identities = 51/119 (42%), Positives = 75/119 (63%)
  Q:    21 EICFIGRSNVGKSSLINALANA-KIAKTSNTPGRTQLANFYDF-DKFR-------LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           E+CF+GRSN GKSS IN L N  ++A +S TPGRT+L N +   D          L+DLPGYGYA V+  +  + + I+  Y+  R +L  +  +IDI   +TDLD +++  ++        +L KADK
  S:    26 EVCFVGRSNAGKSSAINVLCNQRRLAFSSKTPGRTRLINMFGLPDPLAPGEQLGFLVDLPGYGYASVAHREKEKWADILGGYLRDRASLAGIVLLIDIRRGVTDLDRRLTNFIAPTGRPVLALLTKADK 154
>gi|53713337|ref|YP_099329.1| GTPase EngB [Bacteroides fragilis YCH46] >gi|81382646|sp|Q64UN4|ENGB_BACFR Probable GTP-binding protein engB >gi|52216202|dbj|BAD48795.1| putative GTP-binding protein [Bacteroides fragilis YCH46] (201 aa)
Score = 215, Expect = 4.8e-16, Identities = 57/143 (39%), Positives = 79/143 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           E  FIGRSNVGKSSLIN L   K +A TS TPG+T L N F   + + L+DLPGYGYA+  +    ++  II +YI  R+ +  +F +ID  +    +DL+  E L        I+  KADK        N +    +L+K  E +
  S:    25 EYAFIGRSNVGKSSLINMLTGRKGLAMTSATPGKTMLINHFLINNSWYLVDLPGYGYARRGQKGQEQIRTIIEDYILEREQMTNLFVLIDSRLEPQKIDLEFMEWLGENGIPFAIIFTKADKLKGGRLKINISAYLRELRKQWEEL 170
>gi|104773863|ref|YP_618843.1| GTPase EngB [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116513870|ref|YP_812776.1| GTPase EngB [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122275360|sp|Q04B34|ENGB_LACDB Probable GTP-binding protein engB >gi|119369207|sp|Q1GAP7|ENGB_LACDA Probable GTP-binding protein engB >gi|103422944|emb|CAI97606.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093185|gb|ABJ58338.1| Predicted GTPase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (200 aa)
Score = 215, Expect = 4.9e-16, Identities = 64/161 (39%), Positives = 90/161 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK----FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENIVCV--SAKNKTNIPNLKKLI 181
           EI   GRSNVGKSS IN L   K +A+TS++PG+TQ  NFY  D     F L+D+PGYGYAKVSK +  E  ++I +Y+  R  L  +  +ID     T  D+ M +          +V  K DK  K+ F+   A     L  +K+N+  +  S+  K N+  +K  I
  S:    25 EIALAGRSNVGKSSFINTLLQRKNLARTSSSPGKTQTLNFYRVDSDQADFYLVDVPGYGYAKVSKKQREEFGEMIQDYLETRAYLKGLILMIDGRHEPTVDDIAMYDYAQYLNLPILLVATKMDKIKKNAFNKTEAAFRKHLNLNKDNVTFLPFSSVTKLNVDQVKDWI 193
>gi|91774588|ref|YP_544344.1| GTPase EngB [Methylobacillus flagellatus KT] >gi|119369214|sp|Q1H4T4|ENGB_METFK Probable GTP-binding protein engB >gi|91708575|gb|ABE48503.1| cell division checkpoint GTPase YihA [Methylobacillus flagellatus KT] (207 aa)
Score = 214, Expect = 5.1e-16, Identities = 60/162 (37%), Positives = 94/162 (58%)
  Q:    21 EICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF--DKFRLIDLPGYGYAKVSKS--KHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKEN--IVCVSAKNKTNIPNLKKLIG 182
           E+ F GRSN GKSS +N LAN  ++A  S  PGRTQL NF+    D+F L+DLPGYGYAKV ++  KH++L+  ++ Y+  R  +  +  ++D    +T LD QM    S      + +L KADK ++   +    ++  +L+    N  +   S+  K  +   + +IG
  S:    26 EVVFAGRSNAGKSSALNTLANHNRLAFVSKQPGRTQLINFFSLGNDRF-LVDLPGYGYAKVPEAVRKHWQLT--LASYLSQRPCIGGLVLVMDCRHPLTPLDRQMLNWYSPSGKPIHALLTKADKLSRQAANQTLQQVRKELEASWGNCSVQLFSSLKKQGVEEAETVIG 192
>gi|113460478|ref|YP_718540.1| GTPase EngB [Haemophilus somnus 129PT] >gi|112822521|gb|ABI24610.1| cell division checkpoint GTPase YihA [Haemophilus somnus 129PT] (231 aa)
Score = 214, Expect = 5.1e-16, Identities = 54/127 (42%), Positives = 76/127 (59%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFD-KFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKS 143
           D   EI F GRSN GKS+ +NAL   K +A+TS  PGRTQL N +  +   +L+DLPGYGYA V +    +  K + EY+  R+ L  +  ++DI   + DLD QM E   +      ++L KADK ++S
  S:    53 DSGIEIAFAGRSNAGKSTALNALTQQKNLARTSKIPGRTQLINLFQVEPNCKLVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGLVILMDIRHPLKDLDQQMIEWAVSADLPVLLLLTKADKLSQS 182
>gi|189466062|ref|ZP_03014847.1| hypothetical protein BACINT_02427 [Bacteroides intestinalis DSM 17393] >gi|189434326|gb|EDV03311.1| hypothetical protein BACINT_02427 [Bacteroides intestinalis DSM 17393] (201 aa)
Score = 214, Expect = 5.4e-16, Identities = 59/164 (35%), Positives = 90/164 (54%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITD-LDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI---VCVSAKNKTNIPNLKKLIGSV 184
           E  FIGRSNVGKSSLIN +   K +A TS TPG+T L N +  +K + ++DLPGYGYA+  +    ++ +II +YI  R+ +  +F +ID  +    +D++    L        IV  K DK      ++N  +   KLK+  E +      S++N+     L   I S+
  S:    25 EYAFIGRSNVGKSSLINMMTGRKGLAMTSATPGKTMLINHFLINKSWYIVDLPGYGYARRGQKGKSQIQRIIEDYILEREQMTNLFVLIDSRLDPQVIDIEFMGWLGEHGIPFSIVFTKGDKLKGGRLNSNIQQYLKKLKEQWEELPPYFVTSSENRMGKKELLDYIESI 194
>gi|58583504|ref|YP_202520.1| GTPase EngB [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58428098|gb|AAW77135.1| GTP-binding protein [Xanthomonas oryzae pv. oryzae KACC10331] (258 aa)
Score = 214, Expect = 5.4e-16, Identities = 57/166 (34%), Positives = 84/166 (50%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIG 182
           D   E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+     R L+DLPGYGYAKV +         I  Y   R+ L  +  ++DI   + D DLQM    + R    + +L KADK  +        K+  ++     D   +   S +++  +  L+ ++G
  S:    74 DGGYEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQIQPERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLGYAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGQSRQGVDELRGIVG 245
>gi|84625320|ref|YP_452692.1| GTPase EngB [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|166710592|ref|ZP_02241799.1| GTPase EngB [Xanthomonas oryzae pv. oryzicola BLS256] >gi|188575232|ref|YP_001912161.1| GTP-binding protein [Xanthomonas oryzae pv. oryzae PXO99A] >gi|119369280|sp|Q2NZ59|ENGB_XANOM Probable GTP-binding protein engB >gi|119369281|sp|Q5GVY6|ENGB_XANOR Probable GTP-binding protein engB >gi|84369260|dbj|BAE70418.1| GTP-binding protein [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|188519684|gb|ACD57629.1| GTP-binding protein [Xanthomonas oryzae pv. oryzae PXO99A] (207 aa)
Score = 214, Expect = 5.4e-16, Identities = 57/166 (34%), Positives = 84/166 (50%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIG 182
           D   E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+     R L+DLPGYGYAKV +         I  Y   R+ L  +  ++DI   + D DLQM    + R    + +L KADK  +        K+  ++     D   +   S +++  +  L+ ++G
  S:    23 DGGYEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQIQPERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLGYAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGQSRQGVDELRGIVG 194
>gi|188990195|ref|YP_001902205.1| GTP-binding protein [Xanthomonas campestris pv. campestris] >gi|167731955|emb|CAP50141.1| GTP-binding protein [Xanthomonas campestris pv. campestris] (222 aa)
Score = 214, Expect = 5.4e-16, Identities = 57/166 (34%), Positives = 84/166 (50%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIG 182
           D   E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+     R L+DLPGYGYAKV +         I  Y   R+ L  +  ++DI   + D DLQM    + R    + +L KADK  +        K+  ++     D   +   S +++  +  L+ ++G
  S:    38 DGGYEVAFAGRSNAGKSSALNALTRQNSLARVSKTPGRTQQLVFFQIQPERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLGYAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVSSRFGDSVTVQTYSGESRQGVDELRGIVG 209
>gi|21232826|ref|NP_638743.1| GTPase EngB [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66767103|ref|YP_241865.1| GTPase EngB [Xanthomonas campestris pv. campestris str. 8004] >gi|24418370|sp|Q8P5E4|ENGB_XANCP Probable GTP-binding protein engB >gi|81306913|sp|Q4UYM8|ENGB_XANC8 Probable GTP-binding protein engB >gi|21114651|gb|AAM42667.1| GTP-binding protein [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66572435|gb|AAY47845.1| GTP-binding protein [Xanthomonas campestris pv. campestris str. 8004] (207 aa)
Score = 214, Expect = 5.4e-16, Identities = 57/166 (34%), Positives = 84/166 (50%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIG 182
           D   E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+     R L+DLPGYGYAKV +         I  Y   R+ L  +  ++DI   + D DLQM    + R    + +L KADK  +        K+  ++     D   +   S +++  +  L+ ++G
  S:    23 DGGYEVAFAGRSNAGKSSALNALTRQNSLARVSKTPGRTQQLVFFQIQPERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLGYAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVSSRFGDSVTVQTYSGESRQGVDELRGIVG 194
>gi|152981348|ref|YP_001355067.1| GTP-binding protein EngB [Janthinobacterium sp. Marseille] >gi|166225961|sp|A6T3H0|ENGB_JANMA Probable GTP-binding protein engB >gi|151281425|gb|ABR89835.1| GTP-binding protein EngB [Janthinobacterium sp. Marseille] (235 aa)
Score = 214, Expect = 5.6e-16, Identities = 54/119 (45%), Positives = 75/119 (63%)
  Q:    21 EICFIGRSNVGKSSLINALAN-AKIAKTSNTPGRTQLANFYDF---------------DKFR--LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDI-SVITDLDLQMSELLSNRFNQHYIVLNKADK 139
           EI F GRSN GKS+ IN L N  K+A  S TPGRTQ  N++                 D+ R  L+DLPGYGYA+VS S      +++ +Y+  R+ L A+  I+D     T+LD+QM E  +      + +L K+DK
  S:    26 EIAFAGRSNAGKSTAINILCNQKKLAFASKTPGRTQHINYFSIGGAHVGQHRKDETKVDEIRALLVDLPGYGYAEVSGSAKLHWQELLGDYVQRREQLAALVLIVDSRRPFTELDIQMLEWFAPTGKPIHCLLTKSDK 163
>gi|23099530|ref|NP_692996.1| GTPase EngB [Oceanobacillus iheyensis HTE831] >gi|81846051|sp|Q8EPM2|ENGB_OCEIH Probable GTP-binding protein engB >gi|22777760|dbj|BAC14031.1| GTP-binding protein (EngB family) [Oceanobacillus iheyensis HTE831] (195 aa)
Score = 214, Expect = 5.9e-16, Identities = 59/157 (37%), Positives = 86/157 (54%)
  Q:     7 SCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           S  S   +  D   EI   GRSNVGKSS IN L N K +A+TS+ PG+TQ  NFY  ++ F  +D+PGYGYAKVSK +  +  +++ EY   R  L AV  + D+    T  D+QM + +        I+  K DK  K+    +  +    L+ D+ ++
  S:    11 SAVSKKQYPEDQLPEIALAGRSNVGKSSFINRLINRKNLARTSSKPGKTQTLNFYRINESFYFVDVPGYGYAKVSKKEREKWGRMMEEYFQTRDTLRAVVLVTDLRHDPTQDDIQMYDFIKYFDLPVIIIGTKLDKITKNKRQKHINRAKQVLEMDETDL 170
>gi|21241496|ref|NP_641078.1| GTPase EngB [Xanthomonas axonopodis pv. citri str. 306] >gi|24418373|sp|Q8PPG1|ENGB_XANAC Probable GTP-binding protein engB >gi|21106841|gb|AAM35614.1| GTP-binding protein [Xanthomonas axonopodis pv. citri str. 306] (214 aa)
Score = 214, Expect = 6.2e-16, Identities = 57/166 (34%), Positives = 84/166 (50%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDKFR-LIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKK---DKENIVCVSAKNKTNIPNLKKLIG 182
           D   E+ F GRSN GKSS +NAL     +A+ S TPGRTQ   F+     R L+DLPGYGYAKV +         I  Y   R+ L  +  ++DI   + D DLQM    + R    + +L KADK  +        K+  ++     D   +   S +++  +  L+ ++G
  S:    23 DGGYEVAFAGRSNAGKSSALNALTRQNALARVSKTPGRTQQLVFFQIQPERYLVDLPGYGYAKVPQDLQAHWQAFIDRYFRTREALRGLVVVMDIRHPLKDYDLQMLGYAAERGLPAHGLLTKADKLGRGQQMQTLQKVKKEVTSRFGDSVTVQTYSGESRQGVDELRGIVG 194
>gi|117926943|ref|YP_867560.1| small GTP-binding protein [Magnetococcus sp. MC-1] >gi|117610699|gb|ABK46154.1| small GTP-binding protein [Magnetococcus sp. MC-1] (218 aa)
Score = 214, Expect = 6.3e-16, Identities = 53/136 (38%), Positives = 78/136 (57%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADK 139
           F+        +  D   E+ F GRSNVGKSSL+N L N + +A+ SNTPGRT+  NF+  ++ +  +DLPGYGYAKV + +     + I  Y   R++L AV  ++DI   +T+ D  M + +         VL K+DK
  S:    14 FVVGAVKPEQYPDDGLPEVAFAGRSNVGKSSLLNKLLNRRQLARVSNTPGRTRELNFFRINQAYYYVDLPGYGYAKVGRGQREVWDRGIGLYFNSRRDLRAVILLLDIRRGMTEQDQAMLDFIFKMGLPVLPVLTKSDK 152
>gi|60681583|ref|YP_211727.1| GTPase EngB [Bacteroides fragilis NCTC 9343] >gi|81315351|sp|Q5LDL2|ENGB_BACFN Probable GTP-binding protein engB >gi|60493017|emb|CAH07797.1| putative GTP-binding cell division protein [Bacteroides fragilis NCTC 9343] (201 aa)
Score = 213, Expect = 7.1e-16, Identities = 57/143 (39%), Positives = 79/143 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKENI 163
           E  FIGRSNVGKSSLIN L   K +A TS TPG+T L N F   + + L+DLPGYGYA+  +    ++  II +YI  R+ +  +F +ID  +    +DL+  E L        I+  KADK        N +    +L+K  E +
  S:    25 EYAFIGRSNVGKSSLINMLTGRKGLAMTSATPGKTMLINHFLINNSWYLVDLPGYGYARRGQKGQKQIRTIIEDYILEREQMTNLFVLIDSRLEPQKIDLEFMEWLGENGIPFAIIFTKADKLKGGRLKINISAYLRELRKQWEEL 170
>gi|167367663|ref|ZP_02301804.1| GTP-binding protein HSR1-related [Rhodopseudomonas palustris TIE-1] >gi|192289065|ref|YP_001989670.1| GTP-binding protein HSR1-related [Rhodopseudomonas palustris TIE-1] >gi|192282814|gb|ACE99194.1| GTP-binding protein HSR1-related [Rhodopseudomonas palustris TIE-1] (216 aa)
Score = 213, Expect = 7.2e-16, Identities = 61/158 (38%), Positives = 88/158 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLK 178
           EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ   F++       RL+D+PGYGYA  SK+K    + +I  ++  R  L  V+ +ID    + D+DL + + L      + IVL KAD+   +          A L K       ++  S++    +P L+
  S:    40 EIAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFFEGPPNAGLRLVDMPGYGYAAASKAKVASWTSLIHHFLQGRATLARVYVLIDGRHGLKDVDLDILKTLDKAAVSYQIVLTKADQVKAAELAERVTATVAALAKHPAAFPEVLTTSSRTGAGMPELR 205
>gi|39933708|ref|NP_945984.1| GTPase EngB [Rhodopseudomonas palustris CGA009] >gi|81564114|sp|Q6NC42|ENGB_RHOPA Probable GTP-binding protein engB >gi|39647554|emb|CAE26075.1| possible GTPases [Rhodopseudomonas palustris CGA009] (216 aa)
Score = 213, Expect = 7.2e-16, Identities = 61/158 (38%), Positives = 88/158 (55%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK---FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID-ISVITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLK 178
           EI F GRSNVGKSSLINAL     +A+TS+TPGRTQ   F++       RL+D+PGYGYA  SK+K    + +I  ++  R  L  V+ +ID    + D+DL + + L      + IVL KAD+   +          A L K       ++  S++    +P L+
  S:    40 EIAFAGRSNVGKSSLINALTGRNALARTSHTPGRTQELIFFEGPPNAGLRLVDMPGYGYAAASKAKVASWTSLIHHFLQGRATLARVYVLIDGRHGLKDVDLDILKTLDKAAVSYQIVLTKADQVKAAELAERVTATVAALAKHPAAFPEVLTTSSRTGAGMPELR 205
>gi|88811280|ref|ZP_01126536.1| GTP-binding protein [Nitrococcus mobilis Nb-231] >gi|88791819|gb|EAR22930.1| GTP-binding protein [Nitrococcus mobilis Nb-231] (254 aa)
Score = 213, Expect = 7.2e-16, Identities = 51/123 (41%), Positives = 74/123 (60%)
  Q:    17 DDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           D  +E+ F GRSN GKSS IN L   K +A+TS TPGRTQ  N +   D+  LIDLPGYG+AK+ ++      + + EY+  R++L  +  I+D+   +T LD Q+           +++L KADK
  S:    64 DTGREVAFAGRSNAGKSSAINTLTGQKALARTSKTPGRTQQINVFPVSDQRYLIDLPGYGFAKLPQAIRAHWQRTLPEYLQRRRSLRGLMLIMDVRHPLTALDQQLLAWCGAVGLPVHVLLTKADK 189
>gi|86356093|ref|YP_467985.1| GTPase EngB [Rhizobium etli CFN 42] >gi|119369241|sp|Q2KD28|ENGB_RHIEC Probable GTP-binding protein engB >gi|86280195|gb|ABC89258.1| GTP-binding protein [Rhizobium etli CFN 42] (217 aa)
Score = 213, Expect = 7.3e-16, Identities = 59/155 (38%), Positives = 87/155 (56%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-IVLNKADKEAKSYFDNNFAKIAAKLKK 158
           FI+   S N    +   E+ F GRSNVGKSSLINAL + K +A+TSNTPGRTQ  N++          D     ++D+PGYGYA+  K +  + +K++ +Y+  R  L  V+ +ID       +      L ++    Y +VL K DK          A+ A K++K
  S:    15 FIRGVPSLNFLPPEGPPEVAFAGRSNVGKSSLINALVSQKGLARTSNTPGRTQELNYFVPDGYSGEAGDLPPMAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQLVLTKTDKIKAPAVPKLLAETADKIRK 181
>gi|168013946|ref|XP_001759525.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162689455|gb|EDQ75827.1| predicted protein [Physcomitrella patens subsp. patens] (222 aa)
Score = 213, Expect = 7.4e-16, Identities = 48/108 (44%), Positives = 68/108 (62%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK-FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV 111
           FIKS    ++   +   E   +GRSNVGKSSLINAL + K +A+TS  PG+TQL N Y  +K + L+DLPGYGYAK   +   + ++    Y   R+ LV+V  ++D S+
  S:    25 FIKSSSKESECPHEGHPEFALVGRSNVGKSSLINALVHRKELAQTSKKPGKTQLINHYLINKTWYLVDLPGYGYAKAPTAIRTDWNEFTKGYFLKRQTLVSVLLLVDSSI 134
>gi|167357084|ref|ZP_02291754.1| GTP-binding protein HSR1-related [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167076052|gb|EDR79858.1| GTP-binding protein HSR1-related [Rhizobium leguminosarum bv. trifolii WSM1325] (217 aa)
Score = 213, Expect = 7.9e-16, Identities = 63/182 (34%), Positives = 98/182 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-IVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           FI+   S N    +   E+ F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     ++D+PGYGYA+  K +  + +K++ +Y+  R  L  V+ +ID       +      L ++    Y IVL K DK   +      A+ A K++K       ++  S++    +  L++ I   +
  S:    15 FIRGVPSLNFLPPEGPLEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGQDLPPTAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKIKAAGVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDELRQAIAETV 211
>gi|116250221|ref|YP_766059.1| GTPase EngB [Rhizobium leguminosarum bv. viciae 3841] >gi|119369242|sp|Q1MM59|ENGB_RHIL3 Probable GTP-binding protein engB >gi|115254869|emb|CAK05943.1| putative GTP-binding protein [Rhizobium leguminosarum bv. viciae 3841] (217 aa)
Score = 213, Expect = 8.3e-16, Identities = 63/182 (34%), Positives = 98/182 (53%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFY----------DFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISVITDLDLQMSELLSNRFNQHY-IVLNKADKEAKSYFDNNFAKIAAKLKKDKE---NIVCVSAKNKTNIPNLKKLIGSVI 185
           FI+   S N    +   E+ F GRSNVGKSSLINAL   K +A+TSNTPGRTQ  N++          D     ++D+PGYGYA+  K +  + +K++ +Y+  R  L  V+ +ID       +      L ++    Y IVL K DK   +      A+ A K++K       ++  S++    +  L++ I   +
  S:    15 FIRGVPSLNFLPPEGPLEVAFAGRSNVGKSSLINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGGDLPPTAIVDMPGYGYAQAPKEQVDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKIKAAGVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDELRQAIAETV 211
>gi|120602468|ref|YP_966868.1| GTPase EngB [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|166225952|sp|A1VDC5|ENGB_DESVV Probable GTP-binding protein engB >gi|120562697|gb|ABM28441.1| GTP-binding protein, HSR1-related [Desulfovibrio vulgaris subsp. vulgaris DP4] (216 aa)
Score = 212, Expect = 8.7e-16, Identities = 45/91 (49%), Positives = 65/91 (71%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID 108
           D  +I   GRSNVGKSSL+NALA  K +AKTS+TPG+T+  N+Y  +   F ++DLPGYGYA+ SK +  + +K+I +YI   K+L  +  ++D
  S:    21 DAPQIALAGRSNVGKSSLVNALARRKQLAKTSSTPGKTRSVNYYRVEPEGFYIVDLPGYGYAQCSKEERKKWAKLIEKYIVSCKSLRGLAVLLD 114
>gi|120437113|ref|YP_862799.1| GTPase EngB [Gramella forsetii KT0803] >gi|166225957|sp|A0M537|ENGB_GRAFK Probable GTP-binding protein engB >gi|117579263|emb|CAL67732.1| protein containing GTP binding domain [Gramella forsetii KT0803] (198 aa)
Score = 212, Expect = 8.8e-16, Identities = 57/128 (44%), Positives = 73/128 (57%)
  Q:    21 EICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLAN-FYDFDKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFDNN 148
           E  FIGRSNVGKSSLIN L   K +AKTS  PG+TQL N F   + + L+DLPGYGYA+VSKS      K I+ Y   R+ ++  F +ID       +D++  + L        I+  KADK      D N
  S:    25 EYAFIGRSNVGKSSLINMLTGRKSLAKTSAKPGKTQLINHFLINNNWHLVDLPGYGYAQVSKSTKKVFQKFITAYFKKREQMICAFVLIDSRHKPQPIDMEFMQWLGEHNIPFCIIFTKADKLKPKILDKN 155
>gi|89074465|ref|ZP_01160942.1| GTP-binding protein [Photobacterium sp. SKA34] >gi|89049753|gb|EAR55303.1| GTP-binding protein [Photobacterium sp. SKA34] (224 aa)
Score = 212, Expect = 8.9e-16, Identities = 57/137 (41%), Positives = 75/137 (54%)
  Q:     3 SFIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDIS-VITDLDLQMSELLSNRFNQHYIVLNKADK 139
           SFI S         D   EI F GRSN GKSS +N L + K +A+TS TPGRTQL N ++      LIDLPGYG+A+V      +  K + EY+  R+ L  +  ++DI   + DLD QM            ++L KADK
  S:    11 SFITSAPDIRHLPQDAGVEIAFAGRSNAGKSSALNRLTDQKGLARTSKTPGRTQLINMFEVVQGCNLIDLPGYGFAQVPLEMKLKWQKSLGEYLQRRECLQGLVVLMDIRHPMKDLDQQMINWALESRLPVMVLLTKADK 150
>gi|46580074|ref|YP_010882.1| GTPase EngB [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|81566751|sp|Q72BH2|ENGB_DESVH Probable GTP-binding protein engB >gi|46449490|gb|AAS96141.1| GTP-binding protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (216 aa)
Score = 212, Expect = 9.1e-16, Identities = 45/91 (49%), Positives = 65/91 (71%)
  Q:    18 DKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDFDK--FRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIID 108
           D  +I   GRSNVGKSSL+NALA  K +AKTS+TPG+T+  N+Y  +   F ++DLPGYGYA+ SK +  + +K+I +YI   K+L  +  ++D
  S:    21 DAPQIALAGRSNVGKSSLVNALARRKQLAKTSSTPGKTRSVNYYRVEPEGFYIVDLPGYGYAQCSKEERKKWAKLIEKYIVSCKSLRGLAVLLD 114
>gi|115439749|ref|NP_001044154.1| Os01g0732200 [Oryza sativa (japonica cultivar-group)] >gi|57899709|dbj|BAD87429.1| putative GTP-binding protein [Oryza sativa Japonica Group] >gi|113533685|dbj|BAF06068.1| Os01g0732200 [Oryza sativa (japonica cultivar-group)] (316 aa)
Score = 212, Expect = 9.2e-16, Identities = 46/108 (42%), Positives = 63/108 (58%)
  Q:     4 FIKSCFSSNDWITDDKKEICFIGRSNVGKSSLINALANAK-IAKTSNTPGRTQLANFYDF-DKFRLIDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV 111
           F+KS    +D   D   E   +GRSNVGKSSL+N+L   K +A TS  PG+TQ  N +   D + L+DLPGYGYA   +       +    Y   R+NLV+VF ++D S+
  S:   118 FVKSSVRPDDCPRDGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFKVNDSWYLVDLPGYGYAAAPQEARTNWDEFTRNYFLGRENLVSVFLLVDASI 227