>gi|26553494|ref|NP_757428.1| valyl-tRNA synthetase [Mycoplasma penetrans HF-2] >gi|26453500|dbj|BAC43832.1| valyl-tRNA synthetase [Mycoplasma penetrans HF-2] (872 aa)
Score = 4091, Expect = 0.0e+00, Identities = 872/872 (100%), Positives = 872/872 (100%)
  Q:     1 MVTMSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           MVTMSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK
  S:     1 MVTMSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
>gi|90101533|sp|Q8EX08|SYV_MYCPE Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (869 aa)
Score = 4074, Expect = 0.0e+00, Identities = 869/869 (100%), Positives = 869/869 (100%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK
  S:     1 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 869
>gi|42560851|ref|NP_975302.1| valyl-tRNA synthetase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81400731|sp|Q6MTU2|SYV_MYCMS Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|42492347|emb|CAE76944.1| valine-tRNA ligase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (872 aa)
Score = 1764, Expect = 0.0e+00, Identities = 394/856 (46%), Positives = 558/856 (65%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSK--DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE---SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLN---PKLFKIS-DEVINIL-NTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           L+ KYDH   E+    +   K L K ++ +NK  +SI+LPPPNVTG LH+GHA + ++QD +IRF  L G    ++ GMDH+GI+TQ K E  L++  I      R++ + + ++W +   N IR QW  +G  LDY  E FTL++  N++V ++FVK YND +IY+ K +VNWD + ++AISN+EVI KE ++ +YY +Y L +S +YL VATTRPET+F D+CLVVNP D RY+ YINK  INP+  + I II+DEYVDI+FGTGVMKCTPAHD NDY LG K+ L +  C N DG+ N     ++ L    AR K ++   K +L  K E  I+ VGFSER+NA+VEP +S+QWFVK+ ++   VI+LQ S  KI F+P +F   L  WMT+ +DWCISRQLWWGHQIP WY K + E+YVG  PP + E + +D DVLDTWFSSGLW  +T      L+S+     FPT+VLVTG+DIIFFWV RM+F +L   K++PFK   I GL+RDE N KMSKSLGNG+DP DVI   G D+LRLFLL++S+PG+D+ Y  EK+ + W FINKLWN+ RYV +N   DF FD +    +LE  ++WIL + +K  +   ++ NKY F ++   + DF W+ +C+ YIE SK   +N +        L Y++K+ILI+ HP+ PFV+  +Y N     K+SILLE+      SN   S I+DV+++I  IR F     I N+  + +++   N    KLFK   D++ N L N     +V + IK+ K     + Y I I N   +    N+   I++++++  ++ +EI+R   +L+N+ FI+KA  EKI+ EK K + +  +L+ ++  L
  S:     5 LNPKYDHLQVEKDKYQYWLDKNLFKADINSNKPKFSIILPPPNVTGKLHIGHAWDTSLQDAIIRFKKLTGYDTLFLPGMDHSGISTQVKVEAKLKQQGIDKNKLGREKFLLEAWKWKEEYANIIRKQWAKLGLSLDYSTEKFTLDEDINQIVKEIFVKFYNDQIIYKDKQIVNWDPEQKTAISNVEVIYKETQSKMYYFKYILEDSNEYLTVATTRPETMFADQCLVVNPNDSRYQKYINKKVINPVNKQVIPIISDEYVDIEFGTGVMKCTPAHDLNDYHLGIKHNLKMPICLNIDGSVNQLGGKYQGLDRFVARKKIIKNAIKEDLFVKEEDIINQVGFSERSNAIVEPYLSDQWFVKMDKFKNMVIDLQNSDNKINFYPNRFSDVLNRWMTDAHDWCISRQLWWGHQIPCWYHKKTNEMYVGINPPSDIENWTQDQDVLDTWFSSGLWAFSTLLNNKGLESEYFKNYFPTSVLVTGYDIIFFWVARMIFQTLEYTKQIPFKDVLIHGLVRDESNRKMSKSLGNGIDPMDVINNNGCDSLRLFLLTNSTPGQDIRYSNEKILASWNFINKLWNASRYVFLNLDEDFKFDPNFYKTDLEITNQWILTQLSKTQTYVYEKMNKYEFSLAGNHLWDFVWNKYCSWYIEFSKVNLNNDKFTHQTKQTLFYVLKEILIMLHPLIPFVSEEIYLNMML--KESILLEQWTNLN-SNYDTSFIDDVIKMITSIREFRNTKNIKNDVCLSVNISNTNQNHTKLFKKHFDQIYNFLFNFCNTKLVDEAIKN-KTSLSIDEYFIEIANDSFI----NKNELIKELEQKQNYLNNEITRSQKILNNQEFIKKAKPEKIQSEKIKYQNYLDQLQAIKDKL 866
>gi|83319485|ref|YP_424244.1| valyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283371|gb|ABC01303.1| valyl-tRNA synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (872 aa)
Score = 1760, Expect = 0.0e+00, Identities = 400/860 (46%), Positives = 554/860 (64%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA-------LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD-FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE---SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVI--------DIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEF----VKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           L+ KY+H + E+    +   K+L K N  + K  +SI+LPPPNVTG LH+GHA + ++QD +IRF  L G    ++ GMDH+GI+TQ K E+ L++  I      R++ + + ++W +   + IR QW  +G  LDY  E FTL++  N++V ++FVK YND +IY+ K +VNWD + ++AISN+EVI KE ++ +YY +Y L NS  YL+VATTRPET+F D+CLVVNP D RY+ YINK  INP+ N+ I II+DEYVDI+FGTGVMKCTPAHD NDY L  K+ L +  C N DG+ N     ++ L    AR + ++   K +L  K E  I+ VGFSER+NA+VEP +S+QWFVK+ ++   VI+LQ S  KI FFP +F   L  WMTN +DWCISRQLWWGHQIP WY K + E+YVG  PP + E + +D DVLDTWFSSGLW  +T   L +KD         FPT+VLVTG+DIIFFWV RM+F +L   K++PFK   I GL+RDE N KMSKSLGNG+DP DVI   G D+LRLFLL++S+PG+D+ Y  EK+ + W FINKLWN+ RYV +N  D F FD +    +LE  ++WIL + +K  +   ++ NKY F ++   + DF W+ +C+ YIE SK   SN +        L Y++K+ILI+ HP+ PFV+  +Y N     K+SILLE+      SN   S I+DV+++I  IR F     I NN  +        D H  +      +I+  + N  NT   N +K    S K     + Y I I        SN+   N +++ KE+E     + +EI R   +L+N  FI+KA  EKIE EKSK + ++ +L+ + K ++  K
  S:     5 LNPKYNHILVEKTKYQYWLDKKLFKANPNSKKPKFSIILPPPNVTGKLHIGHAWDTSLQDAIIRFKKLTGYDTLFLPGMDHSGISTQVKVEQKLKKQGIDKNKLGREKFLLEAWKWKEEYASIIREQWAKLGLSLDYSTEKFTLDEDINQIVKEIFVKFYNDKIIYKDKQIVNWDPEQKTAISNVEVIYKETQSKMYYFKYMLENSDKYLIVATTRPETMFADQCLVVNPNDSRYQEYINKKVINPVNNQVIPIISDEYVDIEFGTGVMKCTPAHDLNDYHLAIKHNLKMPICLNTDGSVNQLGGKYQGLDRFVARKEIIKDAIKEDLFVKEEDIINQVGFSERSNAIVEPYLSDQWFVKMDKFKNMVIDLQNSDNKINFFPNRFSDVLNRWMTNAHDWCISRQLWWGHQIPCWYHKKTNEMYVGINPPSDIENWTQDQDVLDTWFSSGLWAFSTL--LNNKDLESEYFKNYFPTSVLVTGYDIIFFWVARMIFQTLEYTKQIPFKDVLIHGLVRDELNRKMSKSLGNGIDPMDVINNNGCDSLRLFLLTNSTPGQDIRYSNEKILASWNFINKLWNASRYVFLNLDDHFEFDPNFYKTDLEITNQWILTQLSKTQAYVYEKMNKYEFSLAGNHLWDFVWNKYCSWYIEFSKVNLSNDKFNYQTKQTLFYVLKEILIMLHPLIPFVSEEIYLNMML--KESILLEQWTNLN-SNYDTSFIDDVIKMITSIREFRNTKNIKNNICLLANISNTNDKHSYIFEKHFLQINSFLKNFCNTKLDNSIK---ISNKTSLSIDEYFIEI--------SNDSFTNKDELIKELEAKQIQLTNEILRSQKILNNSEFIKKAKIEKIEQEKSKYQTYKEQLEAINKKINDLK 871
>gi|188159629|ref|ZP_02998784.1| valyl-tRNA synthetase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (872 aa)
Score = 1747, Expect = 0.0e+00, Identities = 396/860 (46%), Positives = 559/860 (65%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSK--DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLN---PKLFK-----ISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           L+ KYDH   E+    +   K L K ++ +NK  +SI+LPPPNVTG LH+GHA + ++QD +IRF  L G    ++ GMDH+GI+TQ K E  L++  I      R++ + + ++W +   N IR QW  +G  LDY  E FTL++  N++V ++FVK YND +IY+ K +VNWD + ++AISN+EVI KE ++ +YY +Y L +S +YL VATTRPET+FVD+CLVVNP D RY+ YINK  INP+  + I II+DEYVDI+FGTGVMKCTPAHD NDY L  K+ L +  C N DG+ N     ++ L    AR + ++     +L  K E  I+ VGFSER+NA+VEP +S+QWFVK+ ++   VI+LQ S  KI F+P +F   L  WMTN +DWCISRQLWWGHQIP WY K + E+YVG  PP + E + +D DVLDTWFSSGLW  +T      L+S+     FPT+VLVTG+DIIFFWV RM+F +L   K++PFK   I GL+RDE N KMSKSLGNG+DP DVI   G D+LRLFLL++S+PG+D+ Y  EK+ +   FINKLWN+ RYV +N   DF FD++    +LE  ++WIL + +K  +   ++ NKY F ++   + DF W+ +C+ YIE SK    N   N ++K   L Y++K+ILI+ HP+ PFV+  +Y N     K+SILLE+      SN   S I+DV+++I  IR F     I N+  + +++   N    KLFK     I   +IN  NT  ++ V ++  SL  D     Y I I N   +    N+   I++++++   + +EI+R   +L+N+ FI+KA  EKI+ EK K + +  +L+ ++  L   K
  S:     5 LNPKYDHLQVEKDKYQYWLDKNLFKADINSNKPKFSIILPPPNVTGKLHIGHAWDTSLQDAIIRFKKLTGYDTLFLPGMDHSGISTQVKVEAKLKQQGIDKNKLGREKFLLEAWKWKEEYANIIRKQWAKLGLSLDYSTEKFTLDEDINQIVKEIFVKFYNDQIIYKDKQIVNWDPEQKTAISNVEVIYKETQSKMYYFKYMLEDSNEYLTVATTRPETMFVDQCLVVNPNDSRYQKYINKKVINPVNKQVIPIISDEYVDIEFGTGVMKCTPAHDLNDYHLAIKHNLKMPICLNIDGSVNQLGGKYQGLDRFVARKEIIKNAINEDLFVKEEDIINQVGFSERSNAIVEPYLSDQWFVKMDKFKNMVIDLQNSDNKINFYPNRFSDVLNRWMTNAHDWCISRQLWWGHQIPCWYHKKTNEMYVGINPPSDIENWTQDQDVLDTWFSSGLWAFSTLLNNKGLESEYFKNYFPTSVLVTGYDIIFFWVARMIFQTLEYTKQIPFKDVLIHGLVRDELNRKMSKSLGNGIDPMDVINNNGCDSLRLFLLTNSTPGQDIRYSNEKILASSNFINKLWNASRYVFLNLDKDFKFDQNFYKTDLEITNQWILTELSKTQAYVYEKMNKYEFSLAGNHLWDFVWNKYCSWYIEFSKVNLNNDKFNHQTK-QTLFYVLKEILIMIHPLIPFVSEEIYLNMML--KESILLEQWTNLN-SNYDTSFIDDVIKMITSIREFKNTKNIKNDVCLSVNVSNTNQNHTKLFKKHFDQIYSFLINFCNTKLVDYVIKNKTSLSID----EYFIEIANDSFI----NKNELIKELEQKQNHLNNEITRSQKILNNQEFIKKAKPEKIQSEKIKYQNYLDQLQAIKDKLKELK 870
>gi|167755851|ref|ZP_02427978.1| hypothetical protein CLORAM_01368 [Clostridium ramosum DSM 1402] >gi|167704790|gb|EDS19369.1| hypothetical protein CLORAM_01368 [Clostridium ramosum DSM 1402] (873 aa)
Score = 1743, Expect = 0.0e+00, Identities = 375/859 (43%), Positives = 535/859 (62%)
  Q:    10 NNDLSKKYDH-KICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK---NRTSNQESK--LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKD---SILLERLDFKKISNLKE--SSIEDVLQIINKIRI-FNFENKIPNNKVIDIHLEVLN-------PKLFKISDEVINILN-TAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +  L  KY+H K+ E ++  W  +K     +   +K  YSI++PPPNVTG LHLGHA + T+QD +IR+  ++G  A W+ GMDHAGIATQ K E  +RE  IS  D  RD  +   + W +   + IR QW+ +G  LDY  E FTL+   +E V +VFVK+YN+GLIY+ K ++NWD   ++A+SNIEVI KE+E  +YY +Y + +S + L++ATTRPET+F D+ + V+P D+RY + + K AINP   + + I+AD Y+D+ FGT VMKCTPAHD ND+ L KKY L +  C N+DGT N  A  +  +     R   V   +   +++ +EK +  VG SER+NA+VEP +S+QWFVK+   +K  +E Q    K+ F P +FEK    WM N+ DWCISRQLWWGHQ+P WY K++ E+YVG  PP + E + +D DVLDTWFSS LWP +T     +   L    FPTN LVTG+DIIFFWV RM+F SL+  +E PF+H  I GLIRDE   KMSKSLGNGVDP DVI++YGAD LR FL ++S+PG DL Y+ EK+++ W FINK+WNS R+V MN  D    E+ +  NL   DKWILN+ N+   E     +K+ F+    ++  F WDDFC+ YIEL+K   N T++ E +  L  L Y++  I+ + HP  PFVT  ++       +    +I  E  D     ++ +  + + D+++ I +IR  +  +N I    VI+   + L        P + K+ + V +  N  A   +    IK         N L+  L   D +  + E    EK+  +++ ++ EI RC  ML+N+ F  KAPKEK+ELE++K   ++ K   +++ L
  S:     2 SKQLEPKYNHHKVEEGKYRHWIDKKYFEAGD--TSKKPYSIVIPPPNVTGKLHLGHAWDTTLQDMIIRYKRMQGYDALWLPGMDHAGIATQAKVEARMREEGISRYDLGRDGFLEKAWSWKEEYASIIRAQWEKLGLSLDYSKERFTLDDGLSEAVKEVFVKLYNEGLIYQGKRIINWDPVQRTALSNIEVIHKEIEGAMYYFKYQIVDSDEQLIIATTRPETMFADQAIFVHPDDERYTHLVGKKAINPANGEALPIMADSYIDMSFGTAVMKCTPAHDPNDFALAKKYNLEMPICMNDDGTMNELAHKYAGMDRFACREALVADFKAAGVVDHIEKHMHQVGHSERSNAIVEPYLSKQWFVKMEPLAKAALENQLKDSKVNFVPERFEKTFNQWMENIEDWCISRQLWWGHQVPAWYHKETGEVYVGKNPPADLENWKQDEDVLDTWFSSALWPFSTLGWPNTDSELFKRYFPTNTLVTGYDIIFFWVSRMIFQSLHFTEERPFEHVLIHGLIRDEQGRKMSKSLGNGVDPMDVIDEYGADTLRFFLTTNSAPGMDLRYIPEKLEASWNFINKIWNSARFVLMNIDDEMKFEELSFDNLNLCDKWILNRLNEVIREVDINMDKFEFVNVGSELYKFIWDDFCSWYIELTKVHLNSTNDTEKQASLNTLVYVLNAIVKMLHPFMPFVTEEIFQAIPHLEESICIAIWPEVNDHFTDESINDQFTYLIDIVKGIREIRTQYTIKNAIEVPYVINTKNDDLEGLLNKCLPYIKKLCNAVCSGYNLNAAGEVANITIKG-------GNSLLVELG--DYIDKDAEK---EKLANQLKKLEGEIKRCQNMLANEKFTSKAPKEKVELERNKLADYQSKYDAVKEKL 870
>gi|169350153|ref|ZP_02867091.1| hypothetical protein CLOSPI_00895 [Clostridium spiroforme DSM 1552] >gi|169292936|gb|EDS75069.1| hypothetical protein CLOSPI_00895 [Clostridium spiroforme DSM 1552] (878 aa)
Score = 1742, Expect = 0.0e+00, Identities = 374/858 (43%), Positives = 544/858 (63%)
  Q:    13 LSKKYDH-KICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQ-----ESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL-------ERLDFKKISNLKESSIEDVLQIINKIRI-FNFENKIPNNKVIDI---HLEVLN----PKLFKISDEVINILN-TAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           L  KY+H K+ E ++  W  +K     +   +K  YSI++PPPNVTG LHLGHA + T+QD +IR+  ++G  A W+ GMDHAGIATQ K E  ++E  +S  D  R+  +   + W +   + IR+QW+ +G  LDY  E FTL++  +E V +VFVK+YN+GLIY+ K ++NWD   ++A+SNIEVI KE+E  +YY +Y + +S + L++ATTRPET+F D+ + V+P D RY + + K AINP   + + I+AD Y+D+ FGT VMKCTPAHD ND+ L KKY L++  C N+DGT N  A  ++ +   + R   V   E N +++ +EK +  VG SER+NA+VEP +S+QWFVK+   +K  ++ Q    K+ F P +FEK    WM N+ DWCISRQLWWGHQ+P WY K++ E+YVG +PPK+ E + +D DVLDTWFSS LWP +T         L    FPTN LVTG+DIIFFWV RM+F SL+   + PF++  I GLIRDE   KMSKSLGNGVDP DVI++YGAD LR FL ++S+PG DL Y+ EK++S W FINK+WNS R+V MN  +    ED T  NL   DKWILN+ N+   E     +K+ F+    ++  F WDDFC+ YIEL+K   +++     ++ L  L Y++  I+ + HP  PFVT  ++       ++SI +       E  + ++I N + + + D+++ I +IR  +  +N I    +ID     LE L     P + K+ + + +  N  A   +    IK         N L+  L   D +  + E    EK++ ++  ++ EI RC  ML+N+ F+ KAPKEK+ELE+ K   ++ K   +++ L +
  S:    10 LEPKYNHHKVEEGKYRKWIEKKYFEAGD--TSKKPYSIVIPPPNVTGKLHLGHAWDTTLQDMIIRYKRMQGYDALWLPGMDHAGIATQAKVEARMQEEGVSRYDLGREGFLKKAWSWKEEYASIIRSQWEKLGLSLDYSKERFTLDEGLSEAVKEVFVKLYNEGLIYQGKRIINWDPMQRTALSNIEVIHKEIEGAMYYFKYKIVDSDEELVIATTRPETMFADQAIFVHPDDTRYTHLVGKKAINPANGEPLPIMADSYIDMSFGTAVMKCTPAHDPNDFALAKKYNLDMPICMNDDGTMNELANKYQGMDRFECRKALVADFEANGIVDHIEKHMHQVGHSERSNAIVEPYLSKQWFVKMKPLAKMALDNQLKDSKVNFVPERFEKTFNQWMENIEDWCISRQLWWGHQVPAWYHKETGEVYVGKQPPKDIENWKQDEDVLDTWFSSALWPFSTLGWPNEDSELFKRYFPTNTLVTGYDIIFFWVSRMIFQSLHFTDQRPFENVLIHGLIRDEQGRKMSKSLGNGVDPMDVIDEYGADTLRFFLTTNSAPGMDLRYIPEKLESSWNFINKIWNSARFVLMNIDESMKYEDLTFDNLNLCDKWILNRLNEVIREVDINMDKFEFVNVGTELYKFIWDDFCSWYIELTKVHLNSENEVEKQASLNTLVYVLNAIVKMLHPFMPFVTEEIFQAIP-HLEESICIASWPEVNEDFNDEQI-NDQFTYLIDIVKGIREIRSQYTIKNAIEVAYIIDTKDSQLESLMDQCLPYIKKLCNAICSGYNLKATGEVANITIKG-------GNSLLIELG--DYIDKDAEK---EKLQAQLSKLEGEIKRCQNMLANEKFVSKAPKEKVELERKKLADYQSKYDAVKEKLDT 877
>gi|194017123|ref|ZP_03055735.1| valyl-tRNA synthetase [Bacillus pumilus ATCC 7061] >gi|194010991|gb|EDW20561.1| valyl-tRNA synthetase [Bacillus pumilus ATCC 7061] (880 aa)
Score = 1723, Expect = 0.0e+00, Identities = 354/864 (40%), Positives = 540/864 (62%)
  Q:     9 NNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT---DALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFK-KISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEV----LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           NN ++  KYD    E+ +++ W   K    +N K  K+ Y++++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E  LRE  +S  D  R++ V   ++W +   + IR+QW  MG  LDY  E FTL++  N+ V QVFV++Y  GLIYR + ++NWD   ++A+S+IEVI K+V+   Y++RY LS+    + +ATTRPET+  D  + V+P D+RY++ I K  + P+T +EI I+AD+YVDI+FG+G +K TPAHD ND+ELG ++ L  I   NEDGT N  A+ ++ +   + R + V+ L++  +L K+E  + +VG SER+ AVVEP +S QWFVK+   + + I LQ    ++QF P +FEK  ++WM N+ DWCISRQLWWGH+IP WY K++KE+YVG + P++ E + +DNDVLDTWFSS LWP +T    DA  S+D    +PTN+LVTG+DIIFFWV RM+F  L    E PFK   I GLIRDE   KMSKSLGNG+DP +VI+KYGAD+LR FL + SSPG+DL +  EKV+S W F NK+WN+ R+  MN     +DE          D+WIL + N+      Q  +KY F    + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PF+T  ++ +   + +   +    + K ++SN + S+ ++ ++++I  +R    E   P +K ++++++     +  +L K    +    N + + I      S K      +    IL  E L+  + E   I +++KE++ +  E+ R    L N+ F++KAP+  +E E++K+  +  K + ++K +   K
  S:     4 NNQEMPTKYDPNAIEKDRYTYWLEGKFFEAQNDKT-KDPYTVVIPPPNVTGKLHLGHAWDSTLQDIVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREEGVSRYDLGREKFVEGTWKWKEEYADFIRSQWAKMGLGLDYSRERFTLDEGLNKAVRQVFVQLYEKGLIYRGEYIINWDPATKTALSDIEVIYKDVQGAFYHLRYPLSDGTGSIEIATTRPETMLGDTAVAVHPDDERYQHLIGKTVVLPITGREIPIVADDYVDIEFGSGAVKITPAHDPNDFELGNRHDLERILVMNEDGTMNANALQYKGMDRFECRKQLVKDLQEEGILFKIEDHMHSVGHSERSGAVVEPYLSTQWFVKMQPLADEAINLQNGDDQVQFVPDRFEKTYLHWMENIRDWCISRQLWWGHRIPAWYHKETKEVYVGLEAPEDIENWEQDNDVLDTWFSSALWPFSTMGWPDA-DSEDFKRYYPTNLLVTGYDIIFFWVSRMIFQGLEFTGEKPFKDVLIHGLIRDEQGRKMSKSLGNGIDPMEVIDKYGADSLRYFLATGSSPGQDLRFSFEKVESTWNFANKIWNASRFALMNMDGLTYDELDLTGEKSVADQWILTRLNETIESVTQLADKYEFGEVGRHLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFLTEEIWQHLPHEGESITVAAWPEVKPELSNEQASADMKLLVELIRSVRNIRSEVNTPMSKQVELYIKASTSDVQERLEKNRLYIERFTNPSVLEIGTDVPASDKAMTAVISGAELILPLEGLINLDEE---IARLQKELDKLTKEVERVQKKLGNEGFMKKAPESVVEEERAKERDYVAKREAVQKRIEELK 879
>gi|49478642|ref|YP_038508.1| valyl-tRNA synthetase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|81394711|sp|Q6HD68|SYV_BACHK Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|49330198|gb|AAT60844.1| valine--tRNA ligase (valyl-tRNA synthetase) [Bacillus thuringiensis serovar konkukian str. 97-27] (881 aa)
Score = 1720, Expect = 0.0e+00, Identities = 366/863 (42%), Positives = 530/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K IEL QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  F+E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L+Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAIELQQKEEEKVTFVPDRFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKFEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILSYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|157693210|ref|YP_001487672.1| valyl-tRNA synthetase [Bacillus pumilus SAFR-032] >gi|157681968|gb|ABV63112.1| valine--tRNA ligase [Bacillus pumilus SAFR-032] (880 aa)
Score = 1720, Expect = 0.0e+00, Identities = 353/864 (40%), Positives = 542/864 (62%)
  Q:     9 NNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT---DALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFK-KISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEV----LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           NN ++  KYD    E+ +++ W   K    +N K  K+ Y++++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E  LRE  +S  D  R++ V + ++W +   + IR+QW  MG  LDY  E FTL++  N+ V QVFV++Y  GLIYR + ++NWD   ++A+S+IEVI K+V+   Y++RY LS+    + +ATTRPET+  D  + V+P D+RY++ I K  + P+T +EI I+AD+YVD++FG+G +K TPAHD ND+ELG ++ L  I   NEDGT N  A+ ++ +   + R + V+ L++  +L K+E  + +VG SER+ AVVEP +S QWFVK+   + + I LQ    ++QF P +FEK  ++WM N+ DWCISRQLWWGH+IP WY K++KE+YVG + P++ E + +DNDVLDTWFSS LWP +T    DA +S+D    +PTN+LVTG+DIIFFWV RM+F  L    E PFK   I GLIRDE   KMSKSLGNG+DP +VI+KYGAD+LR FL + SSPG+DL +  EKV+S W F NK+WN+ R+  MN     +DE          D+WIL + N+      Q  +KY F    + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PF+T  ++ +   + +   +    + K ++SN + S+ ++ ++++I  +R    E   P +K ++++++     +  +L K    +    N + + I      S K      +    IL  E L+  + E   I +++KE++ +  E+ R    L N+ F++KAP+  +E E++K+  +  K + ++K +   K
  S:     4 NNQEMPTKYDPNAIEKDRYTYWLEGKFFEAQNDKT-KDPYTVVIPPPNVTGKLHLGHAWDSTLQDIVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREEGVSRYDLGREKFVEETWKWKEEYADFIRSQWAKMGLGLDYSRERFTLDEGLNKAVRQVFVQLYEKGLIYRGEYIINWDPATKTALSDIEVIYKDVQGAFYHLRYPLSDGTGSIEIATTRPETMLGDTAVAVHPDDERYQHLIGKTVVLPITGREIPIVADDYVDMEFGSGAVKITPAHDPNDFELGNRHDLERILVMNEDGTMNANALQYKEMDRFECRKQLVKDLQEEGILFKIEDHMHSVGHSERSGAVVEPYLSTQWFVKMQPLADEAINLQNGDDQVQFVPDRFEKTYLHWMENIRDWCISRQLWWGHRIPAWYHKETKEVYVGLEAPEDIENWEQDNDVLDTWFSSALWPFSTMGWPDA-ESEDFKRYYPTNLLVTGYDIIFFWVSRMIFQGLEFTGEKPFKDVLIHGLIRDEQGRKMSKSLGNGIDPMEVIDKYGADSLRYFLATGSSPGQDLRFSFEKVESTWNFANKIWNASRFALMNMDGLTYDELDLIGEKSVADQWILTRLNETIESVTQLADKYEFGEVGRHLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFLTEEIWQHLPHEGESITVAAWPEVKPELSNEQASADMKLLVELIRSVRNIRSEVNTPMSKQVELYIKASTSDVQERLEKNRSYIERFTNPSVLEIGTDVPASDKAMTAVISGAELILPLEGLINLDEE---IARLQKELDKLTKEVERVQKKLGNEGFMKKAPESVVEEERAKERDYVAKREAVQKRIEELK 879
>gi|160915954|ref|ZP_02078162.1| hypothetical protein EUBDOL_01979 [Eubacterium dolichum DSM 3991] >gi|158432430|gb|EDP10719.1| hypothetical protein EUBDOL_01979 [Eubacterium dolichum DSM 3991] (874 aa)
Score = 1718, Expect = 0.0e+00, Identities = 359/861 (41%), Positives = 524/861 (60%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQ-KSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFK---KISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +L++KYDH + E++ +  W  +      +   +K+ + +++PPPNVTG LHLGHA + T+QD + R+  ++G    W+ GMDHAGIATQ K ++ L+   IS  D  R+  +   +EW +   + IR QW  MG  LDY  E FTL++  ++ V +VFV +YN+GLIY+ + ++NWD + ++A+SNIEVI KEVE  +YY +Y +  +   L++ATTRPET+F D+ + V+P D+RYK+ +   AINP   +E+ I+AD+Y+D+ FGT VMKCTPAHD ND+ L KKY L +  C + DGT N     +E +     R   V   EK  +++ +E  +  VG SERT  +VEP +S+QWFVK+   + +V++ Q    ++I F+P +FEK    W+ N+ DWCISRQLWWGH+IP WY KDS EIYVG + PK+ E +V+D DVLDTWFSS LWP +T    +     +  FP +VLVTG+DIIFFWV RM F + Y  K  PFK   I GL+RD    KMSKSLGNGVDP DVI K G D+LR FL ++S+PG+DL Y EEKV++   FINK+WN+ R+V M++ +     D    +    DKWIL +FN+          KY + +   ++  F WDDFC+ YIELSK     +  + + + +  L  ++  IL + HP  PFVT  +Y        +SI LE    K    +S+ + +SI  +L +I  +R    + ++  +  ID+ ++    K+ + +  +  IL      +      S+  D  E      ILN      L    N    IEK+ KE+E ++ EI+R  GMLSN+ F+ KAP+ K+  EK K E ++ +    EK L ++K
  S:     4 ELNQKYDHALVEKEHYQTWLEKGYFTAGD--KSKDPFCVVIPPPNVTGKLHLGHAWDTTLQDIVARYKRMRGFDMLWLPGMDHAGIATQAKVDERLKNEGISRYDIGRENFLKRAWEWKEEYASTIRKQWAKMGLSLDYSRERFTLDEGLSQAVRKVFVDLYNEGLIYQGERIINWDPQAKTALSNIEVIHKEVEGAMYYFKYKIVENGAELVIATTRPETMFADQAIFVHPDDERYKDIVGMHAINPANGEELPIMADDYIDMSFGTAVMKCTPAHDPNDFMLAKKYNLPMPICMHPDGTMNEMCHKYEGMDRFACRKALVADFEKAGVVDHIETHLHQVGHSERTGVIVEPYLSKQWFVKMKPLADEVLQAQGNEEERINFYPKRFEKTFQQWLENIEDWCISRQLWWGHRIPAWYHKDSNEIYVGMEEPKDIENWVQDEDVLDTWFSSALWPFSTLGWPEQTADLERYFPNDVLVTGYDIIFFWVARMAFQTRYCMKSRPFKDVLIHGLVRDSQGRKMSKSLGNGVDPMDVIAKSGVDSLRFFLTTNSTPGQDLRYSEEKVEASANFINKIWNAARFVLMHTKEDMCMSDVDLTHASMIDKWILRRFNEVLENVTANMEKYEYALVGNELYSFVWDDFCSWYIELSKAGLFSDDETTRHASVSTLVTVLSGILRMLHPFMPFVTEEIYLAIPHDY-ESINLEVWPSKVEVAMSDAEMTSIRQLLTMIEAVRGIKADYQLKPSFEIDVIIKDDKGKIVEGNVAIQAIL----AKMCHATWVSMDSD--EEMLTRTILNGTLSVPLASIVNVEEEIEKLTKELERLRKEIARGEGMLSNEKFVAKAPQAKVAAEKEKLEAYKAQYALSEKQLEAYK 871
>gi|118479624|ref|YP_896775.1| valyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam] >gi|196044847|ref|ZP_03112081.1| valyl-tRNA synthetase [Bacillus cereus 03BB108] >gi|118418849|gb|ABK87268.1| valyl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam] >gi|196024335|gb|EDX63008.1| valyl-tRNA synthetase [Bacillus cereus 03BB108] (881 aa)
Score = 1717, Expect = 0.0e+00, Identities = 366/863 (42%), Positives = 529/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K IEL QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  F+E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKVLVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAIELQQKEEEKVTFVPDRFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKFEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|69246247|ref|ZP_00603860.1| Valyl-tRNA synthetase, class Ia [Enterococcus faecium DO] >gi|68195348|gb|EAN09797.1| Valyl-tRNA synthetase, class Ia [Enterococcus faecium DO] (881 aa)
Score = 1716, Expect = 0.0e+00, Identities = 359/860 (41%), Positives = 541/860 (62%)
  Q:    11 NDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK----LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYL----IFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           N+LS KY+ +  E  ++  W  Q +L K +       YSI++PPPNVTG LHLGHA + T+QD LIR   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +  ++EW +   ++IR QW  MG  LDY  E FTL+   +E V +VFV +Y  GLIYR + ++NWD + ++A+S+IEVI K++E   Y++ Y L++    + +ATTRPET+  D  + V+P+D+RY+  I K  I PL NK+I IIADEYVD++FGTGV+K TPAHD ND+E+G ++ L  ++  ++DGT N  A  +  ++   AR   V+ L++   L K++  I +VG SERT  VVEP +S QWFVK++  +KK I+ Q++ + ++FFP +F +  + WM N++DW ISRQLWWGHQIP WY K++ E+YVG + P + E +V+D DVLDTWFSS LWP +T      +S+D    FPT+ LVTG+DIIFFWV RM+F SL    E PF++  I GLIRDE   KMSKSLGNG+DP +VIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN+ R+V MN      +E          D+WIL + N+      + F+++ F  + +++ +F WDDFC+ YIE+SK     +   ++++   +L + + +IL L HP+ PFVT  ++++   +    ++ E    R +F   +  K   +E + ++I  +R    E   P +K I + ++  + K    L + +  +    N  ++ I  +      PD   +  L    IF+     L G  N    I++++KE+E   SE+ R  G LSN+ F+  AP+E +E E++K++ +  K   +++ + S
  S:     5 NNLSTKYNPQEVEAGRYQHWLEQ-DLFKPSGDKKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDMLIRQKRMQGYDTLWLPGMDHAGIATQAKVEAKLREQGISRYDLGREKFIDQVWEWKEEYASHIREQWAKMGLSLDYSRERFTLDDGLSEAVRKVFVTLYEKGLIYRGEYIINWDPQARTALSDIEVIHKDIEGAFYHMSYELADGSGVVEIATTRPETMLGDTAIAVHPEDERYQALIGKKVILPLVNKQIPIIADEYVDMEFGTGVVKITPAHDPNDFEVGNRHDLPRVNVMDDDGTMNELAGKYAGMERFAARKAIVQDLKEIGRLIKIDTMIHSVGHSERTGVVVEPRLSTQWFVKMAPLAKKAIDNQETDQAVEFFPPRFNQTFLRWMENVHDWVISRQLWWGHQIPAWYHKETGEMYVGMEAPADSENWVQDPDVLDTWFSSALWPFSTMGWPDTESEDYKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGERPFENVLIHGLIRDEQGRKMSKSLGNGIDPMEVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNASRFVIMNIEGMTVEEIDLSGEKSVADRWILTRLNETIERVTELFDRFEFGEAGRQLYNFIWDDFCDWYIEMSKEVLYGDDAVSKQTTRSILVHTLDQILRLLHPIMPFVTEEIWEHIPHQGNSLVVAEYPVVRPEFDDETASK--GMEVLKELIRAVRNIRSEVNTPLSKPITLLIKTNDAKIDQFLVENTSYIERFCNPEELTISSE---ITAPDLAMSAVLTGAEIFL----PLAGLINIEEEIKRLEKELEKWTSEVKRVQGKLSNERFVSNAPEEVVEAERAKEKDYLEKQTAVKERIES 876
>gi|30264526|ref|NP_846903.1| valyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47529989|ref|YP_021338.1| valyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187350|ref|YP_030602.1| valyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|65321827|ref|ZP_00394786.1| COG0525: Valyl-tRNA synthetase [Bacillus anthracis str. A2012] >gi|165872012|ref|ZP_02216653.1| valyl-tRNA synthetase [Bacillus anthracis str. A0488] >gi|166996110|ref|ZP_02262570.1| valyl-tRNA synthetase [Bacillus cereus AH820] >gi|167640706|ref|ZP_02398966.1| valyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|170708361|ref|ZP_02898805.1| valyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|177653987|ref|ZP_02936028.1| valyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|190567025|ref|ZP_03019941.1| valyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] >gi|81581271|sp|Q81LD3|SYV_BACAN Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|30259184|gb|AAP28389.1| valyl-tRNA synthetase [Bacillus anthracis str. Ames] >gi|47505137|gb|AAT33813.1| valyl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181277|gb|AAT56653.1| valyl-tRNA synthetase [Bacillus anthracis str. Sterne] >gi|164712302|gb|EDR17838.1| valyl-tRNA synthetase [Bacillus anthracis str. A0488] >gi|167511278|gb|EDR86664.1| valyl-tRNA synthetase [Bacillus anthracis str. A0193] >gi|170126736|gb|EDS95619.1| valyl-tRNA synthetase [Bacillus anthracis str. A0389] >gi|172081042|gb|EDT66120.1| valyl-tRNA synthetase [Bacillus anthracis str. A0174] >gi|190562016|gb|EDV15985.1| valyl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I] (881 aa)
Score = 1716, Expect = 0.0e+00, Identities = 365/863 (42%), Positives = 529/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K IEL QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAIELQQKEEEKVTFVPDRFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|167636213|ref|ZP_02394517.1| valyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|170688689|ref|ZP_02879894.1| valyl-tRNA synthetase [Bacillus anthracis str. A0465] >gi|167528434|gb|EDR91202.1| valyl-tRNA synthetase [Bacillus anthracis str. A0442] >gi|170667375|gb|EDT18133.1| valyl-tRNA synthetase [Bacillus anthracis str. A0465] (881 aa)
Score = 1716, Expect = 0.0e+00, Identities = 364/863 (42%), Positives = 529/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K IEL QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKS GNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + ++L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAIELQQKEEEKVTFVPDRFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSFGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMLLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|163942206|ref|YP_001647090.1| valyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] >gi|163864403|gb|ABY45462.1| valyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4] (881 aa)
Score = 1714, Expect = 0.0e+00, Identities = 366/863 (42%), Positives = 533/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED--VLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN +NN  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL++  +  VN+VFV++Y   LIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  +   + R + V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K +EL QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      ++    KE++ E   ++ II  +R    E   P +K + + +    EV+  +L K S  +    N +++ I K D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP E I+ E++K+    EK E    +L +LEK
  S:     1 MSNTENN--LPTKYDHMSVEEGLYKWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDEGLSNAVNKVFVQLYEKDLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGTMNEKAGKYNGMDRFECRKELVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVELQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADFENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFKK-FYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRYFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDKEAAAEMHLLVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEVVLAQLTKNSSYIERFCNPSELTI-KIDLQA--PEKAMTAIVSGAELFLPLADLINLDEEKARLE---KELEKFGKEVERVQKKLSNQGFVAKAPAEVIDGERAKEQDYLEKREAVRQRLADLEK 881
>gi|167936650|ref|ZP_02523725.1| valyl-tRNA synthetase [Bacillus cereus AH1134] >gi|168135601|ref|ZP_02578830.1| valyl-tRNA synthetase [Bacillus cereus B4264] (881 aa)
Score = 1711, Expect = 0.0e+00, Identities = 363/863 (42%), Positives = 527/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  +   + R + V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T        A F     T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGTMNEKAGKYNGMDRFECRKELVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDSADFKRYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVSGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|196034490|ref|ZP_03101899.1| valyl-tRNA synthetase [Bacillus cereus W] >gi|195993032|gb|EDX56991.1| valyl-tRNA synthetase [Bacillus cereus W] (881 aa)
Score = 1710, Expect = 0.0e+00, Identities = 364/863 (42%), Positives = 529/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K IEL QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  +  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAIELQQKEEEKVTFVPDRFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDNMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|196039248|ref|ZP_03106554.1| valyl-tRNA synthetase [Bacillus cereus NVH0597-99] >gi|196029875|gb|EDX68476.1| valyl-tRNA synthetase [Bacillus cereus NVH0597-99] (881 aa)
Score = 1710, Expect = 0.0e+00, Identities = 363/863 (42%), Positives = 528/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|50365171|ref|YP_053596.1| valyl-tRNA synthetase [Mesoplasma florum L1] >gi|81827303|sp|Q6F1B1|SYV_MESFL Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|50363727|gb|AAT75712.1| valyl tRNA synthetase [Mesoplasma florum L1] (873 aa)
Score = 1709, Expect = 0.0e+00, Identities = 379/831 (45%), Positives = 528/831 (63%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNY-AVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWY-KKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT---DALKSK--DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKN---LEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK---NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLF-KISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILN--KEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKA 842
           +L  KY ++I E+    W  Q E  K N  + K  +SI+LPPPNVTG LH+GHA +G++QD +IRF  L G    ++ GMDHAGI+TQ K E  LRE  IS  +  R++ +   ++W       IR QW  +G   DY  E FTL+   N++V ++FV  YN GLIY+ K +VNWD   ++AISN+EVI KEVE  +Y+ +Y +  + ++L VATTRPET+F D+CLVVNPKD+RY ++I K AINP+ N+ I IIAD+YV++ FGTGVMKCTPAHD ND+E+  ++ L    C NEDGT N      ++ L   +AR K +E L K     K E  I  VGFSER+NA+VEP +S+QWFVK+  ++  +++LQ+S+ KI+FFP +F++ L  WM N++DW ISRQLWWGH+IP WY K+D  +IYVG + PK+ E +++D DVLDTWFSSGLWP  T    +  +SK      P  VLVTG DIIF WV RM+F ++    ++PFK   I GL+RDEH  KMSKSLGNG+DP DVI   G+D+LR  LL++S+PG+D+ Y + KVK+ W FINKLWN+ RYV MN   DF   E++   N   L + DKW+L +F+K   +     +KY F ++ K + DF W+ +C+ YIE +K   N    +E+    + YL+K ILI+ HP  PFVT ++Y     K     +LE   F K    +   I  V+++IN IR F   N I NN +++ +    N ++  K + E+ N LN   +N      +SL  +    + L F +    +D +        +   KKE+E   +EISR   MLSN++FI KA
  S:     4 ELEAKYSYEIVEENRYEWWIQNEYFKANPDSKKPKFSIVLPPPNVTGKLHIGHAWDGSLQDAIIRFKKLNGFDVLYLPGMDHAGISTQVKVEAKLREQGISRFELGREKFLEQAWKWKHEYAAIIRQQWSKLGLAFDYSMEKFTLDDDINKIVTEIFVDFYNKGLIYKGKRIVNWDPMQKTAISNVEVIYKEVEGFMYHFKYMIQGTNEFLNVATTRPETMFADQCLVVNPKDERYTSFIGKKAINPVNNQAIPIIADDYVELDFGTGVMKCTPAHDLNDFEIAVRHNLEKPICMNEDGTINEMGGEEYQGLDRFEARNKIIENLTKEKTFIKAEPMIHQVGFSERSNAIVEPYLSDQWFVKMDSFADMILKLQESNDKIKFFPERFDQVLKKWMENIHDWTISRQLWWGHRIPAWYNKEDKTKIYVGMEAPKDAENWIQDEDVLDTWFSSGLWPFATLMRGEGFESKYFKEYLPNGVLVTGHDIIFSWVSRMIFQTIEYTGQIPFKDVLIHGLVRDEHGAKMSKSLGNGIDPMDVIVNNGSDSLRFSLLTNSTPGQDIRYSDSKVKAAWNFINKLWNASRYVLMNLEEDFKPWEEQAILNSNSLNETDKWVLTEFSKVSKQVNYLIDKYEFAIAGKMLYDFVWNTYCSWYIEFAKVNLNNPKTKEATQQTIVYLLKNILIMLHPYLPFVTEHIYKTLDMKNS---ILEESWFDKEFVFETDYINVVIELINSIREFRATNNIKNNVLLNWNATNGNLEIITKYNLEINNFLNEF-VNANLSINESLVSETTSLSVLDFFIEIPNDDFIDKEKMLEELATKKKELE---NEISRSERMLSNENFISKA 844
>gi|30022546|ref|NP_834177.1| valyl-tRNA synthetase [Bacillus cereus ATCC 14579] >gi|81433513|sp|Q817R6|SYV_BACCR Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|29898104|gb|AAP11378.1| Valyl-tRNA synthetase [Bacillus cereus ATCC 14579] (881 aa)
Score = 1708, Expect = 0.0e+00, Identities = 362/863 (41%), Positives = 527/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R + V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T        A F     T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKELVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDSADFKRYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVSGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|42783595|ref|NP_980842.1| valyl-tRNA synthetase [Bacillus cereus ATCC 10987] >gi|81409029|sp|Q72ZW8|SYV_BACC1 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|42739524|gb|AAS43450.1| valyl-tRNA synthetase [Bacillus cereus ATCC 10987] (881 aa)
Score = 1705, Expect = 0.0e+00, Identities = 362/863 (41%), Positives = 528/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL++  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP +VIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDEGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGTMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMEVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDAEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|75759956|ref|ZP_00740025.1| Valyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168140449|ref|ZP_02583678.1| valyl-tRNA synthetase [Bacillus cereus G9842] >gi|74492553|gb|EAO55700.1| Valyl-tRNA synthetase [Bacillus thuringiensis serovar israelensis ATCC 35646] (881 aa)
Score = 1705, Expect = 0.0e+00, Identities = 362/863 (41%), Positives = 526/863 (60%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL+K  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T        A F     T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDKGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPDEDSADFKRYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIEKYGADAMRYFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVSGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLVDLEK 881
>gi|166982215|ref|ZP_02253657.1| valyl-tRNA synthetase [Bacillus cereus AH187] >gi|168161235|ref|ZP_02596468.1| valyl-tRNA synthetase [Bacillus cereus H3081.97] (881 aa)
Score = 1704, Expect = 0.0e+00, Identities = 362/863 (41%), Positives = 528/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL++  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP +VIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDEGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGTMNEKAGKYNGMDRFECRKALVKDLQEVGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMEVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|47566648|ref|ZP_00237470.1| valyl-tRNA synthetase [Bacillus cereus G9241] >gi|47556678|gb|EAL15010.1| valyl-tRNA synthetase [Bacillus cereus G9241] (881 aa)
Score = 1702, Expect = 0.0e+00, Identities = 361/863 (41%), Positives = 528/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL++  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP +VIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDEGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMEVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|52141048|ref|YP_085781.1| valyl-tRNA synthetase [Bacillus cereus E33L] >gi|81824177|sp|Q633Y6|SYV_BACCZ Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|51974517|gb|AAU16067.1| valine--tRNA ligase (valyl-tRNA synthetase) [Bacillus cereus E33L] (881 aa)
Score = 1702, Expect = 0.0e+00, Identities = 361/863 (41%), Positives = 528/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDH   E+    W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL++  ++ VN+VFV++Y  GLIYR + ++NWD   ++A+S+IEVI KEV+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  +EI IIADEYV+  FGTGV+K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK++  ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T      DA   K   + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP +VIEKYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PFVT  ++ +   + +   +      R D +      E  +  ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I + D+++  P+      +      L   DL+  + E   +E   KE+E    E+ R    LSN+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHMSVEEGLYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEGKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDEGLSDAVNKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKEVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDDRYKHLIGKTVTLPIVGREIPIIADEYVEKDFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGVLVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAVALQQKDEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWNQDNDVLDTWFSSALWPFSTLGWPNEDAADFK-RYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMEVIEKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEEIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVAAWPTVREDLQDTEAAAEMHL--LVDIIRSVRNIRAEVNTPMSKKVQMQIKAKDEAVLAQLTKNSSYIERFCNPSELTI-QTDLQA--PEKAMTAIVTGAELFLPLADLINLDEERARLE---KELEKFDKEVERVQKKLSNQGFVAKAPAAVIEGERAKEQDYLEKREAVRQRLADLEK 881
>gi|154686944|ref|YP_001422105.1| valyl-tRNA synthetase [Bacillus amyloliquefaciens FZB42] >gi|154352795|gb|ABS74874.1| ValS [Bacillus amyloliquefaciens FZB42] (880 aa)
Score = 1700, Expect = 0.0e+00, Identities = 348/864 (40%), Positives = 523/864 (60%)
  Q:     9 NNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT----DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           N   +  KYD    E+ ++  W   K          K  YS+++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E  LRE   S  D  R++ + + ++W +   + IR+QW  MG  LDY  E FTL++  N+ V +VFVK+Y  GLIYR + ++NWD   ++A+S+IEVI K+V+   Y++RY L++    + +ATTRPET+  D  + V+P+D+RYK+ I K  I P+TN+EI I+ D+YVD++FG+G +K TPAHD ND+ELG ++ L  I   NEDGT N  A+ +  +   + R K V+ L+++ +L K+E  + +VG SER+ AVVEP +S QWFVK+   +   ++LQ   +K+ F P +FEK  ++WM N+ DWCISRQLWWGH+IP WY K++KE+YVG + P++ E + +D+DVLDTWFSS LWP +T     +  +     + T+VLVTG+DIIFFWV RM+F  L    E PFK   I GLIRDE   KMSKSLGNGVDP DVI+KYGAD+LR FL + SSPG+DL +  EKV+S W F NK+WN+ R+  MN     +DE          DKWIL + N+   +  Q  ++Y F    + + +F WDD C+ YIE++K        + +++   VL Y++ + + L HP  PF+T  ++ +   +  +SI +         +  + +  D   ++++I  +R    E   P +K +++++    E +  +L K    V    N + + I      + K           IL  E L+  + E   I +++KE + +  E+ R    L N+ FI+KAP+  IE E+ K++ +  K + + + ++  K
  S:     4 NEQTMPTKYDPSAIEKGRYDFWLKGKYFEAGG-DQTKQPYSVVIPPPNVTGRLHLGHAWDTTLQDIVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREQGTSRYDLGREKFLEETWKWKEEYADFIRSQWAKMGLGLDYSRERFTLDEGLNKAVREVFVKLYKKGLIYRGEYIINWDPATKTALSDIEVIYKDVQGAFYHLRYPLADGSGSIEIATTRPETMLGDTAVAVHPEDERYKHLIGKTVILPITNREIPIVGDDYVDMEFGSGAVKITPAHDPNDFELGNRHNLERILVMNEDGTMNEKALQYNGMDRFECRKKLVKDLQESGVLFKIEDHMHSVGHSERSGAVVEPYLSTQWFVKMQPLADAAVDLQSKEEKVHFVPDRFEKTYLHWMENIRDWCISRQLWWGHRIPAWYHKETKEVYVGLEAPEDSENWEQDSDVLDTWFSSALWPFSTMGWPDENAEDFKRYYSTDVLVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLIRDEQGRKMSKSLGNGVDPMDVIDKYGADSLRYFLATGSSPGQDLRFSYEKVESTWNFANKIWNASRFALMNMDGMTYDELDLSGEKSVADKWILTRLNETIEDVTQLADRYEFGEVGRHLYNFIWDDVCDWYIEMAKLPLYGEDEAAKKTTRSVLAYVLDQTMRLLHPFMPFLTEEIWQHLPHE-GESITISSWPVPVPEHTDKEAAADMKLLVELIRSVRNIRSEVNTPMSKQVELYIKTSTEDIAGRLEKNRSYVERFTNPSTLKIGTDITAADKAMTAVVTGAEVILPLEGLINIDEE---IARLQKEFDKLTKEVERVQKKLGNEGFIKKAPEHVIEEERGKEKDYTAKREAVRQRIAELK 879
>gi|169829404|ref|YP_001699562.1| valyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] >gi|168993892|gb|ACA41432.1| Valyl-tRNA synthetase [Lysinibacillus sphaericus C3-41] (881 aa)
Score = 1700, Expect = 0.0e+00, Identities = 348/861 (40%), Positives = 516/861 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSK-KIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT----DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +  N  +  KYD +  E     W  Q +  +   ++ K  YSI++PPPNVTG LHLGHA + T+QD LIR   ++G  A W+ GMDHAGIATQ K E  LRE+ I+  D  R++ +   +EW +    +IR+QW  +G  LDY  E FTL+K  +E VN VFV++Y  GLIYR + ++NWD   ++A+S+IEVI ++V+   Y+++Y L++   Y+ VATTRPET+  D  + V+PKD+RY++ I K  I P+  +EI I+AD+YVD++FGTGV+K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  +   + R + V  L++  +L ++E+ + +VG SER+ AVVEP +S QWFVK+   +   +ELQK  + K+ F P +FE     WM N+ DWCISRQLWWGHQIP WY  ++ EIYVG + P + E + +D DVLDTWFSS LWP +T     +A +     +PTN LVTG+DIIFFWV RM+F  L   ++ PFK   I GL+RD    KMSKSLGNGVDP DVIE+YGAD+LR FL + SSPG+DL Y  EKV++ W F NK+WN+ R+  MN     +DE          DKWIL + N+          +Y F    +++ +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PF+T  ++ +     +   +      +   +  + S  ++ ++ II  +R    E   P +K + + +   +     + +     +    N   + I +  +        V     +F+     L+G  N    I +++KE+E    E+    G LSN+ F+ KAP+  + +E+ K    + KH + LK LE+L
  S:     1 MTENISMPTKYDPQSIEAGRYEWWLQGKFFEAQPESGKKPYSIVIPPPNVTGKLHLGHAWDTTLQDILIRMKRMQGYDALWLPGMDHAGIATQAKVEAKLREDNITRYDLGREKFLEKTWEWKEEYAGHIRDQWAKLGLGLDYTRERFTLDKGLSEAVNTVFVQLYEKGLIYRGERIINWDPAAKTALSDIEVIYQDVQGAFYHMKYPLADGSGYVEVATTRPETMLGDSGVAVHPKDERYQHLIGKTVILPIVGREIPIVADDYVDMEFGTGVVKMTPAHDPNDFEVGNRHNLERILVMNEDGTMNELAGKYNGMDRFECRKQIVADLQEAGVLIRIEEHMHSVGHSERSGAVVEPYLSAQWFVKMQPLADSSLELQKDQEGKVNFVPARFENTYSRWMENIRDWCISRQLWWGHQIPAWYHNETGEIYVGKEAPVDAENWTQDEDVLDTWFSSALWPFSTMGWPDEANEEYKRYYPTNTLVTGYDIIFFWVSRMIFQGLEFTEQRPFKDVLIHGLVRDGEGRKMSKSLGNGVDPMDVIEQYGADSLRYFLATGSSPGQDLRYTTEKVEAVWNFSNKIWNASRFALMNMDGMTYDEIDLTGEKSVADKWILTRLNETIERVTSLAERYEFGEVGRELYNFIWDDFCSWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFITEEIWQHLPHDGESITVAAWPTVRTDLHFADESDNMKLLMDIIRSVRNIRAEVNTPMSKKVPLFISAKDAATVAVLEANKAYLEKFCNPDTLTIGEGLEAPGQSMTAVITGAQVFL----PLVGLINLEEEIARLEKELEKWAKEVKLVTGKLSNEKFVSKAPEALVNVEREKLADYESKHAVVLKRLEEL 878
>gi|171324204|ref|ZP_02912720.1| valyl-tRNA synthetase [Geobacillus sp. WCH70] >gi|171089849|gb|EDT36167.1| valyl-tRNA synthetase [Geobacillus sp. WCH70] (880 aa)
Score = 1698, Expect = 0.0e+00, Identities = 349/851 (41%), Positives = 524/851 (61%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED--VLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL---GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKE 863
           +S KYDHK  E     W    +  +     +K  ++I++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E+ LR+  +S  D  R++ + + ++W +   ++IR QW  +G  LDY  E FTL++  ++ V +VFV +Y  GLIYR + ++NWD   ++A+S+IEVI KEV+  LY++RY L++   Y+ VATTRPET+  D  + V+P D+RYK+ I K  I P+  +EI IIAD+YVD++FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N  A+ ++ L   + R + V+ L++  +L K+E+ + +VG SER+ AVVEP +S QWFVK+   ++  I+LQK+  K+ F P +FEK  ++W+ N+ DWCISRQLWWGH+IP WY K++ EIYV  +PP + E + +D DVLDTWFSS LWP +T     T+A   K   +PT+VLVTG+DIIFFWV RM+F  L    E PFK   I GL+RD    KMSKSLGNGVDP DVI++YGAD+LR FL + SSPG+DL +  EKV++ W F NK+WN+ R+  MN     +D+          D WIL + N+      +   KY F    + + +F WDD C+ YIE++K     +  + +++   VL Y++   + L HP  PF+T  ++ +   + +   + +  + +   +  E++ E   ++ II  +R    E   P +K I +H+    E +   L K    +    N +++ ++  DI +      E      +   E +L   G  N    I++++KE+E +  E+ R    LSN+ F+ KAP   +E E+ KKEK  ++ +E
  S:     8 MSTKYDHKAVEANRYQWWLDGKFFEATGDPDKKPFTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRKQGLSRYDLGREKFLEETWKWKEEYASHIRQQWAKLGLGLDYTRERFTLDEGLSKAVREVFVSLYRKGLIYRGEYIINWDPVTKTALSDIEVIYKEVKGALYHMRYPLADGSGYIEVATTRPETMLGDTAVAVHPDDERYKHLIGKTVILPIVGREIPIIADKYVDMEFGSGAVKITPAHDPNDFEIGNRHNLPRILVMNEDGTMNENAMQYQGLDRFECRKQIVKDLQEQGVLFKIEEHVHSVGHSERSGAVVEPYLSTQWFVKMKPLAEAAIQLQKTEGKVHFVPERFEKTYLHWLENIRDWCISRQLWWGHRIPAWYHKETGEIYVDHEPPADIENWEQDPDVLDTWFSSALWPFSTMGWPDTEAPDYK-RYYPTDVLVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDAQGRKMSKSLGNGVDPMDVIDQYGADSLRFFLATGSSPGQDLRFSTEKVEATWNFANKIWNASRFALMNMGGMTYDQLDLSGEKTVADHWILTRLNETIETVTKLAEKYEFGEVGRVLYNFIWDDLCDWYIEMAKLPLYGDDEAAKKTTRSVLAYVLDNTMRLLHPFMPFITEEIWQHLPHEGESITVAKWPEVRPGLSNHEAAEEMRLLVDIIRAVRNIRAEVNTPLSKPIKLHIKAKDEHIQATLEKNRVYLERFCNPSEL-LIATDIPA-----AEKAMTAVVTGAELILPLEGLINIEEEIKRLEKELEKLNKEVERVQKKLSNEGFLTKAPAHVVE-EERKKEKDYLEKRE 869
>gi|152976875|ref|YP_001376392.1| valyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025627|gb|ABS23397.1| valyl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] (881 aa)
Score = 1695, Expect = 0.0e+00, Identities = 356/863 (41%), Positives = 531/863 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED--VLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIE----KIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHE---MKLKELEK 866
           MSN + N  L  KYDHK  E     W  + +  +      K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +   +EW +   ++IR QW  +G  LDY  E FTL++  ++ V +VFV++Y  GLIYR + ++NWD   ++A+S+IEVI K+V+   Y++ Y L++   ++ +ATTRPET+  D  + V+P+D+RYK+ I K    P+  +EI IIAD+YVD +FGTGV+K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  +   + R   V+ L++  +L ++E  + +VG SER+ AVVEP +S QWFVK+   ++K + L QK  +K+ F P +FE   + WM N++DWCISRQLWWGH+IP WY K++ E+YVGT+ P + E + +DNDVLDTWFSS LWP +T     +  K     + T+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNG+DP DVI+KYGADA+R FL + S+PG+DL +  EKV+S W FINK+WN+ R+V MN  D  +++          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   VL Y++ + + L HP  PFVT  ++ +   + +   +      ++    +E++ E   ++ II  +R    E   P +K + + +    E +  +L K S  +    N +++ I+K D+++          +  I++  +L     +  N+E    +++KE E    E+ R    L+N+ F+ KAP   IE E++K+    EK E    +L +LEK
  S:     1 MSNTEKN--LPTKYDHKSVEDGRYQWWLEGKYFEATGDEKKQPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRTKRMQGYDVLWLPGMDHAGIATQAKVEAKLREEGISRYDLGREKFLEKAWEWKEEYASHIRQQWGKVGLGLDYSRERFTLDEGLSDAVKKVFVQLYEKGLIYRGEYIINWDPATRTALSDIEVIHKDVQGAFYHMNYPLTDGSGHIRLATTRPETMLGDTAVAVHPEDERYKHLIGKTVTLPIVGREIPIIADDYVDPEFGTGVVKITPAHDPNDFEVGNRHDLPRILVMNEDGTMNEKAGKYNGMDRFECRKALVKDLQEAGVLIEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMGPLAEKAVALQQKEEEKVTFVPERFENTYLRWMENIHDWCISRQLWWGHRIPAWYHKETGEVYVGTEAPADIENWEQDNDVLDTWFSSALWPFSTLGWPNEDAKDFKRYYSTDALVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGIDPMDVIDKYGADAMRFFLSTGSAPGQDLRFSMEKVESTWNFINKIWNASRFVLMNMDDMKYEDIDLTGEKSVADKWILTRLNETIESVTRNMDKYEFGEAGRSLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSVLAYVLDQTMRLLHPFMPFVTEKIWQHLPHEGESITVSAWPTVREDLQDEEAAAEMHLLVDIIRSVRNIRSEVNTPMSKKVQLQIKAKDEAVLAQLTKNSSYIERFCNPSEL-IIKTDLQA------PEKAMTAIVSGAELFLPLADLINLEEEKARLQKEFEKFNKEVERVQKKLANEGFVAKAPAAVIEGERAKEKDYLEKREAVRQRLADLEK 881
>gi|126653698|ref|ZP_01725617.1| valyl-tRNA synthetase [Bacillus sp. B14905] >gi|126589735|gb|EAZ83870.1| valyl-tRNA synthetase [Bacillus sp. B14905] (881 aa)
Score = 1694, Expect = 0.0e+00, Identities = 351/861 (40%), Positives = 520/861 (60%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSK-KIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT----DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE-----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +  N  +  KYD +  E     W  Q +  +   ++ K  YSI++PPPNVTG LHLGHA + T+QD LIR   ++G  A W+ GMDHAGIATQ K E  LRE+ I+  D  R++ +   +EW +    +IR+QW  +G  LDY  E FTL+K  +E VN VFV++Y  GLIYR + ++NWD   ++A+S+IEVI ++V+   Y+++Y L++   Y+ VATTRPET+  D  + V+PKD+RY++ I K  I P+  +EI I+AD+YVD++FGTGV+K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  +   + R + V  L++  +L ++E+ + +VG SER+ AVVEP +S QWFVK+   +   +ELQK  + K+ F P +FE     WM N+ DWCISRQLWWGHQIP WY  ++ EIYVG + P + + + +D DVLDTWFSS LWP +T     +A +     +PTN LVTG+DIIFFWV RM+F  L   ++ PFK   I GL+RD    KMSKSLGNGVDP DVIE+YGAD+LR FL + SSPG+DL Y  EKV++ W F NK+WN+ R+  MN     +DE          DKWIL + N+          +Y F    +++ +F WDDFC+ YIE++K      + T+ + ++  +L Y++ + + L HP  PF+T  ++ +      +SI +      R D       +  +++ ++ II  +R    E   P +K + + +   +     + +     +    N   + I +  +        V     +F+     L+G  N    I +++KE+E    E+    G LSN+ F+ KAP+  + +E+ K    + KH + LK LE+L
  S:     1 MTENISMPTKYDPQSIEAGRYEWWLQGKFFEAQPESGKEPYSIVIPPPNVTGKLHLGHAWDTTLQDILIRMKRMQGYDALWLPGMDHAGIATQAKVEAKLREDNITRYDLGREKFLEKTWEWKEEYAGHIRDQWAKLGLGLDYTRERFTLDKGLSEAVNTVFVQLYEKGLIYRGERIINWDPAAKTALSDIEVIYQDVQGAFYHMKYPLADGSGYVEVATTRPETMLGDSGVAVHPKDERYQHLIGKTVILPIVGREIPIVADDYVDMEFGTGVVKMTPAHDPNDFEVGNRHNLERILVMNEDGTMNELAGKYNGMDRFECRKQIVADLQEVGVLIRIEEHMHSVGHSERSGAVVEPYLSAQWFVKMQPLADSSLELQKDQEGKVNFVPARFENTYSRWMENIRDWCISRQLWWGHQIPAWYHNETGEIYVGKEAPADADNWTQDEDVLDTWFSSALWPFSTMGWPDEANEEYKRYYPTNTLVTGYDIIFFWVSRMIFQGLEFTEQRPFKDVLIHGLVRDGEGRKMSKSLGNGVDPMDVIEQYGADSLRYFLATGSSPGQDLRYTTEKVEAVWNFSNKIWNASRFALMNMDGMTYDEIDLTGEKSVADKWILTRLNETIERVTSLAERYEFGEVGRELYNFIWDDFCSWYIEMAKLPLYGEDETAKKTTRS-ILAYVLDQTMRLLHPFMPFITEEIWQHLP-HDGESITVAAWPTVRTDLHFAD--EADNMKLLMDIIRSVRNIRAEVNTPMSKKVPLFISAKDAATVAVLEANKAYLEKFCNPDTLTIGEGLEAPGQSMTAVITGAQVFL----PLVGLINLEEEIARLEKELEKWAKEVKLVTGKLSNEKFVSKAPEALVNVEREKLADYENKHAVVLKRLEEL 878
>gi|52081291|ref|YP_080082.1| valyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52786670|ref|YP_092499.1| valyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|81825234|sp|Q65GK8|SYV_BACLD Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|52004502|gb|AAU24444.1| valyl-tRNA synthetase [Bacillus licheniformis ATCC 14580] >gi|52349172|gb|AAU41806.1| ValS [Bacillus licheniformis DSM 13] (880 aa)
Score = 1692, Expect = 0.0e+00, Identities = 349/860 (40%), Positives = 531/860 (61%)
  Q:    13 LSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVK--QDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +  KYD    E+ ++  W   K    KN    K  Y++++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E  LRE   +  D  R++ + + + W +   + IR+QW  +G  LDY  E FTL++  ++ V +VFVK+Y  GLIYR + ++NWD   ++A+S+IEVI K+V+   Y++RY L +    + +ATTRPET+  D  + V+P+D+RYK+ I K  I P+T +EI I+ D+YVD++FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N+ A+ ++ +   + R + V+ L++  +L K+E+   +VG SER+ AVVEP +S QWFV++   +   IELQKS  K+ F P +FEK  ++WM N+ DWCISRQLWWGH+IP WY K++ EIYVG + P++ E + +D DVLDTWFSS LWP +T     +  +D    +PTNVLVTG+DIIFFWV RM+F  +    E PFK   I GLIRD+   KMSKSLGNGVDP DVI+KYGAD+LR FL + SSPG+DL +  EKV+S W F NK+WN+ R+  MN     ++E          DKWIL + N+      Q  +KY F    + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PF+T  ++ +   + +   + +  +  K     E++  ++ ++++I  +R    E   P +K I+++++   P++ +  +E    V    N + + I    Q +       V    LI  L  E L+  + E   I +++KE++ +  E+ R    LSN+ F++KAP   IE E++K+  +  K + +EK ++  K
  S:     8 MPTKYDPSAVEKDRYDYWVNGKFFEAKN-DPEKEPYTVVIPPPNVTGKLHLGHAWDSTLQDIVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREEGKTRYDLGREKFLEETWNWKEEYADFIRSQWAKLGLGLDYSRERFTLDEGLSKAVREVFVKLYEKGLIYRGEYIINWDPATKTALSDIEVIYKDVQGAFYHMRYPLKDGSGSIEIATTRPETMLGDTAVAVHPEDERYKHLIGKTVILPITGREIPIVGDDYVDMEFGSGAVKITPAHDPNDFEIGNRHNLERILVMNEDGTMNDNALQYKGMDRFECRKQIVKDLQEEGVLFKIEEHTHSVGHSERSGAVVEPYLSTQWFVQMQPLADAAIELQKSEGKVNFVPDRFEKTYLHWMENIRDWCISRQLWWGHRIPAWYHKETGEIYVGVEAPEDAENWEQDKDVLDTWFSSALWPFSTMGWPDIDEEDFKRYYPTNVLVTGYDIIFFWVSRMIFQGIEFTGERPFKDVLIHGLIRDDQGRKMSKSLGNGVDPMDVIDKYGADSLRYFLATGSSPGQDLRFSFEKVESTWNFANKIWNASRFALMNMDGMTYEELDLSGEKSVADKWILTRLNETIETVTQLADKYEFGEVGRHLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFLTEEIWQHLPHEGESITVAKWPEAVKEYTDTEAAADMKLLVEVIRAVRNIRSEVNTPLSKQIELYIKTSTPEIAERLEENRSYVERFTNPSLLQIGTDIQAVDKAMTAVVSGAELILPL--EGLINIDEE---ISRLQKELDKLTKEVERVQKKLSNEGFMKKAPAHVIEEERAKEADYTAKREAVEKRIAELK 879
>gi|138896204|ref|YP_001126657.1| valyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2] >gi|196250160|ref|ZP_03148854.1| valyl-tRNA synthetase [Geobacillus sp. G11MC16] >gi|134267717|gb|ABO67912.1| Valyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2] >gi|196210344|gb|EDY05109.1| valyl-tRNA synthetase [Geobacillus sp. G11MC16] (880 aa)
Score = 1692, Expect = 0.0e+00, Identities = 346/860 (40%), Positives = 526/860 (61%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +  KYDH+  E     W  + +  +     +K  ++I++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E+ LR+  +S  D  R++ + + ++W +    +IR+QW  +G  LDY  E FTL++  ++ V +VFV +Y  GLIYR + ++NWD   ++A+S+IEVI KEV+  LY++RY L++   Y+ VATTRPET+  D  + V+P D+RYK+ I K    P+  +EI IIADEYVD++FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N  A+ ++ L   + R + V  L++  +L K+E+ + +VG SER+ AVVEP +S QWFVK+   ++  I++Q++  K+QF P +FEK  ++W+ N+ DWCISRQLWWGH+IP WY K++ EIYV  +PP + E + +D DVLDTWFSS LWP +T     T+A   K   +PT+VLVTG+DIIFFWV RM+F  L    + PFK   I GL+RD    KMSKSLGNGVDP DVI++YGADALR FL + SSPG+DL +  EKV++ W F NK+WN+ R+  MN     ++E          D WIL + N+      +  +KY F    + + +F WDD C+ YIE++K     +  + +++   VL Y++   + L HP  PF+T  ++ N      +SI +      +     E + E+   ++ II  +R    E   P +K I +++    E +   L K    +    N +++ I+  D+ +  P+      +     IL  E L+    E   I++++KE++    E+ R    L+N+ F+ KAP   +E E+ K++ +  K + ++  L+  K
  S:     8 MPPKYDHRAVEAGRYDWWLKGKFFETTGDPDKQPFTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRQQGLSRYDLGREKFLEETWKWKEEYAGHIRSQWAKLGLGLDYTRERFTLDEGLSKAVREVFVSLYRKGLIYRGEYIINWDPATKTALSDIEVIYKEVKGALYHLRYPLADGSGYIEVATTRPETMLGDTAVAVHPDDERYKHLIGKMVKLPIVGREIPIIADEYVDMEFGSGAVKITPAHDPNDFEVGNRHNLPRILVMNEDGTMNENALQYQGLDRFECRKQIVRDLQEQGVLFKIEEHVHSVGHSERSGAVVEPYLSTQWFVKMKPLAEAAIKMQQTEGKVQFVPERFEKTYLHWLENIRDWCISRQLWWGHRIPAWYHKETGEIYVDHEPPADIENWEQDPDVLDTWFSSALWPFSTMGWPDTEAPDYK-RYYPTDVLVTGYDIIFFWVSRMIFQGLEFTGKRPFKDVLIHGLVRDAQGRKMSKSLGNGVDPMDVIDQYGADALRYFLATGSSPGQDLRFSTEKVEATWNFANKIWNASRFALMNMGGMTYEELDLSGEKTVADHWILTRLNETIDTVTKLADKYEFGEVGRTLYNFIWDDLCDWYIEMAKLPLYGDDETAKKTTRSVLAYVLDNTMRLLHPFMPFITEEIWQNLP-HDGESITVASWPQVRPELSNEEAAEEMRMLVDIIRAVRNVRAEVNTPPSKPIALYIKTKDEQVRAALMKNRAYLERFCNPSEL-IIDTDVPA--PEKAMTAVVTGAELILPLEGLINIEEE---IKRLEKELDKWNKEVERVEKKLANEGFLAKAPAHVVEEERRKRQDYIEKREAVKARLAELK 879
>gi|29377395|ref|NP_816549.1| valyl-tRNA synthetase [Enterococcus faecalis V583] >gi|75541540|sp|Q82ZW6|SYV_ENTFA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|29344862|gb|AAO82619.1| valyl-tRNA synthetase [Enterococcus faecalis V583] (880 aa)
Score = 1689, Expect = 0.0e+00, Identities = 362/866 (41%), Positives = 539/866 (62%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-----SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKIN-----------IVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK----EKHEMKLKELEKLLS 869
           MS  KN   L  KY     E  ++  W  Q +L K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ L +  IS  D  R++ V  ++EW +   ++IR QW  MG  LDY  E FTL++  +E V +VFV +Y   LIYR + ++NWD K ++A+S+IEVI K++E   Y++ Y LS+    + +ATTRPET+  D  + V+P+D+RY+  I K  + PL +KEI IIAD+YVD++FGTGV+K TPAHD ND+E+G ++ L  ++  NEDGT N  A  +E +    AR   V  L++   L K+E    +VG SERT  VVEP +S QWFVK+   ++K ++ Q++   ++F+P +F +  + WM N++DW ISRQLWWGHQIP WY K++ E+YVG + P + E +V+D+DVLDTWFSS LWP +T     +A +     FPT+ LVTG+DIIFFWV RM+F SL    E PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN+ R+V MN     ++D +F  +KT       D+WIL + N+  +   + F+++ F  + +++ +F WDDFC+ YIE+SK      N  + Q ++  +L Y + +IL L HP+ PFVT  +++    + +  ++ E     +  N + ++  +E + ++I  +R    E   P +K I +        L K +D  +    TA  +           ++ ++I++  P+   +  L        L G  N    I +++KE++    E+ R  G LSN+ F+  AP E +E E++K+    EK E   + + +L S
  S:     1 MSEEKN---LPTKYQPTEIEAGRYQKWLDQ-DLFKPSGDKKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDMIIRQKRMQGFDTLWLPGMDHAGIATQAKVEEKLAQQGISRYDLGREKFVDQVWEWKEEYASHIREQWAKMGLSLDYSRERFTLDEGLSEAVRKVFVSLYEKDLIYRGEYIINWDPKAKTALSDIEVIHKDIEGAFYHMSYPLSDGSGVVEIATTRPETMLGDTAIAVHPEDERYQELIGKTVVLPLVDKEIPIIADDYVDMEFGTGVVKITPAHDPNDFEVGNRHDLPRVNVMNEDGTMNELAGKYEGMDRFAARKAIVSDLKELGRLIKIETMNHSVGHSERTGVVVEPRLSTQWFVKMGPLAEKAMKNQETEDAVEFYPPRFNQTFLRWMENVHDWVISRQLWWGHQIPAWYHKETGEMYVGMEEPADSENWVQDSDVLDTWFSSALWPFSTMGWPNEASEDYQRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGERPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNASRFVIMNVEGMTAADIDFSGEKTVA-----DRWILTRLNETVARVTELFDRFEFGEAGRQLYNFIWDDFCDWYIEMSKEILYGDNEAAKQTTRS-ILVYTLDQILRLLHPIMPFVTEEIWEKIPHQGESLVVAEYPVVHEEFNDEAAARGMEVLKEVIRSVRNIRAEVNTPLSKPITL--------LIKTNDTEVEEFLTANTSYLERFCNPEELVISREIEA--PELAMSAVLTGAELFLPLAGLINIEEEIARLEKELDKWTKEVKRVQGKLSNERFVSNAPDEVVEAERAKEKDYLEKQEAVKERIAQLRS 879
>gi|56421173|ref|YP_148491.1| valyl-tRNA synthetase [Geobacillus kaustophilus HTA426] >gi|81819656|sp|Q5KWL3|SYV_GEOKA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|56381015|dbj|BAD76923.1| valyl-tRNA synthetase [Geobacillus kaustophilus HTA426] (880 aa)
Score = 1687, Expect = 0.0e+00, Identities = 344/860 (40%), Positives = 523/860 (60%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK----LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +  KYDH+  E     W  + +  +     NK  ++I++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E+ LR+  +S  D  R++ + + ++W +    +IR+QW  +G  LDY  E FTL++  ++ V +VFV +Y  GLIYR + ++NWD   ++A+S+IEV+ KEV+  LY++RY L++    + VATTRPET+  D  + V+P D+RYK+ I K    P+  +EI IIADEYVD++FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N  A+ ++ L   + R + V  L++  +L K+E+ + +VG SER+ AVVEP +S QWFVK+   ++  I+LQ++ +K+QF P +FEK  ++W+ N+ DWCISRQLWWGH+IP WY K++ EIYV  +PPK+ E + +D DVLDTWFSS LWP +T     ++       +PT+VLVTG+DIIFFWV RM+F  L    + PFK   I GL+RD    KMSKSLGNGVDP DVI++YGADALR FL + SSPG+DL +  EKV++ W F NK+WN+ R+  MN     ++E          D WIL + N+      +   KY F    + + +F WDD C+ YIE++K        + +++   VL Y++   + L HP  PF+T  ++ N   +  +SI +      +     E + E+   ++ II  +R    E   P +K I ++++V + +    L K    +    N +++ I   D     PD      +     I+  E L+    E   I++++KE++    E+ R    L+N+ F+ KAP   +E E+ K++ +  K + ++  L+  K
  S:     8 MPPKYDHRAVEAGRYEWWLKGKFFEATGDPNKRPFTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRQQGLSRYDLGREKFLEETWKWKEEYAGHIRSQWAKLGLGLDYTRERFTLDEGLSKAVREVFVSLYRKGLIYRGEYIINWDPVTKTALSDIEVVYKEVKGALYHLRYPLADGSGCIEVATTRPETMLGDTAVAVHPDDERYKHLIGKMVKLPIVGREIPIIADEYVDMEFGSGAVKITPAHDPNDFEIGNRHNLPRILVMNEDGTMNENAMQYQGLDRFECRKQIVRDLQEQGVLFKIEEHVHSVGHSERSGAVVEPYLSTQWFVKMKPLAEAAIKLQQTDEKVQFVPDRFEKTYLHWLENIRDWCISRQLWWGHRIPAWYHKETGEIYVDHEPPKDIENWEQDPDVLDTWFSSALWPFSTMGWPDTESPDYKRYYPTDVLVTGYDIIFFWVSRMIFQGLEFTGKRPFKDVLIHGLVRDAQGRKMSKSLGNGVDPMDVIDQYGADALRYFLATGSSPGQDLRFSTEKVEATWNFANKIWNASRFALMNMGGMTYEELDLSGEKTVADHWILTRLNETIETVTKLAEKYEFGEVGRTLYNFIWDDLCDWYIEMAKLPLYGADEAAKKTTRSVLAYVLDNTMRLLHPFMPFITEEIWQNLPHE-GESITVAPWPQVRPELSNEEAAEEMRLLVDIIRAVRSVRAEVNTPPSKPIALYIKVKDEQVRAALMKNRAYLERFCNPSELLI---DTNVPAPDKAMTAVVTGAELIMPLEGLINIEEE---IKRLEKELDKWNKEVERVEKKLANEGFLAKAPAHVVEEERRKRQDYIEKREAVKARLAELK 879
>gi|135181|sp|P11931|SYV_BACST Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|143797|gb|AAA22879.1| valyl-tRNA synthetase (880 aa)
Score = 1685, Expect = 0.0e+00, Identities = 345/860 (40%), Positives = 523/860 (60%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +  KYDH+  E     W  + +  +     NK  ++I++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E+ LR+  +S  D  R++ + + ++W +    +IR+QW  +G  LDY  E FTL++  ++ V +VFV +Y  GLIYR + ++NWD   ++A+S+IEV+ KEV+  LY++RY L++   ++ VATTRPET+  D  + V+P D+RYK+ I K    P+  +EI IIADEYVD++FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N  A+ ++ L   + R + V  L++  +L K+E+ + +VG SER+ AV+EP +S QWFVK+   ++  I+LQ++  K+QF P +FEK  ++W+ N+  WCISRQLWWGH+IP WY K++ EIYV  +PPK+ E + +D DVLDTWFSS LWP +T     TD+   K   +PT+VLVTG+DIIFFWV RM+F  L    + PFK   I GL+RD    KMSKSLGNGVDP DVI++YGADALR FL + SSPG+DL +  EKV++ W F NK+WN+ R+  MN     ++E          D WIL + N+      +   KY F    + + +F WDD C+ YIE++K     +  + +++   VL Y++   + L HP  PF+T  ++ N   +  +SI +      +     E + E+   ++ II  +R    E   P +K I +++    E +   L K    +    N +++ I   D     PD      +     I+  E L+    E   I++++KE++    E+ R    L+N+ F+ KAP   +E E+ K++ +  K + ++  L+  K
  S:     8 MPPKYDHRAVEAGRYEWWLKGKFFEATGDPNKRPFTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRQQGLSRYDLGREKFLEETWKWKEEYAGHIRSQWAKLGLGLDYTRERFTLDEGLSKAVREVFVSLYRKGLIYRGEYIINWDPVTKTALSDIEVVYKEVKGALYHMRYPLADGSGFIEVATTRPETMLGDTAVAVHPDDERYKHLIGKMVKLPIVGREIPIIADEYVDMEFGSGAVKITPAHDPNDFEIGNRHNLPRILVMNEDGTMNENAMQYQGLDRFECRKQIVRDLQEQGVLFKIEEHVHSVGHSERSGAVIEPYLSTQWFVKMKPLAEAAIKLQQTDGKVQFVPERFEKTYLHWLENIRHWCISRQLWWGHRIPAWYHKETGEIYVDHEPPKDIENWEQDPDVLDTWFSSALWPFSTMGWPDTDSPDYK-RYYPTDVLVTGYDIIFFWVSRMIFQGLEFTGKRPFKDVLIHGLVRDAQGRKMSKSLGNGVDPMDVIDQYGADALRYFLATGSSPGQDLRFSTEKVEATWNFANKIWNASRFALMNMGGMTYEELDLSGEKTVADHWILTRLNETIETVTKLAEKYEFGERGRTLYNFIWDDLCDWYIEMAKLPLYGDDEAAKKTTRSVLAYVLDNTMRLLHPFMPFITEEIWQNLPHE-GESITVAPWPQVRPELSNEEAAEEMRMLVDIIRAVRNVRAEVNTPPSKPIALYIKTKDEHVRAALLKNRAYLERFCNPSELLI---DTNVPAPDKAMTAVVTGAELIMPLEGLINIEEE---IKRLEKELDKWNKEVERVEKKLANEGFLAKAPAHVVEEERRKRQDYIEKREAVKARLAELK 879
>gi|163791284|ref|ZP_02185698.1| valyl-tRNA synthetase [Carnobacterium sp. AT7] >gi|159873425|gb|EDP67515.1| valyl-tRNA synthetase [Carnobacterium sp. AT7] (877 aa)
Score = 1679, Expect = 0.0e+00, Identities = 354/841 (42%), Positives = 516/841 (61%)
  Q:    13 LSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT----DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-LDFKKISNLKESSIEDVL-QIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIK------SLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           +S KY     E  ++  W  +K L K +    K  YS+++PPPNVTG LHLGHA + T+QD ++R   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  +++W +   + IR QW  +G  +DY  E FTL+   +E V +VFV MYN  LIYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L++    + +ATTRPET+  D  + V+P+D+RYK+ + K  + PL N+EI IIADEYV++ FGTGV+K TPAHD ND+E+GK++ L  I+  N+DG+ N  A  +E +    AR   ++ LE    L K+EK + +VG SERT  VVEP +S QWFV ++  +K+ IE Q +  K+ F P +FE   + WM N++DW ISRQLWWGH+IP WY K S E+YVG + P++ E +++D DVLDTWFSS LWP +T     +  +     FPTN LVTG+DIIFFWV RMMF SL    + PF +  I GLIRD    KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  +K+ + W FINK+WN+ R+  MN  DF  D+          D+WIL K N+   +    F ++ F  + + +  F WDDFC+ YIE+SK      + T+ Q ++  +L Y++ + L L HP+ PFVT  +++N   + +  ++ E  +   ++S+   +   DVL ++I  +R    E   P +K I++        L K +D+ +     A  + +++         S + +  E      I   E    L G  N    I ++ KE++    E+ R  G L+NK F+E AP   +E EK+K
  S:     3 MSTKYQPNEVEAGRYDKWV-EKGLFKPSGDKTKEPYSVVIPPPNVTGKLHLGHAWDTTLQDIIVRQKRMQGYDTLWLPGMDHAGIATQAKVEAKLAEDGISRYDLGREKFIDTVWDWKEEYASVIREQWAKVGISVDYSRERFTLDDGLSEAVRKVFVTMYNKKLIYRGEYIINWDPKAKTALSDIEVIHKDVEGAFYHMSYPLTDGSGVVEIATTRPETMLGDTAIAVHPEDERYKHLVGKTVMLPLMNREIPIIADEYVEMDFGTGVVKITPAHDPNDFEVGKRHDLPQINVMNDDGSMNELAGKYETMDRFAARKAVIKDLEAEGRLIKIEKMVHSVGHSERTGVVVEPRLSTQWFVNMAPLAKEAIESQGTEDKVNFVPERFENTYMRWMENVHDWVISRQLWWGHRIPAWYHKTSGELYVGMEAPEDSENWMQDPDVLDTWFSSALWPFSTMGWPDEESEDFKRYFPTNTLVTGYDIIFFWVSRMMFQSLEFTGKRPFNNVLIHGLIRDTEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYDKMDAAWNFINKIWNASRFALMNMEDFTVDQIDLTGEKTVADRWILTKLNETVEKVTDLFERFEFGEAGRHLYHFIWDDFCDWYIEMSKEVLFGEDETAKQMTRS-ILAYVLDQTLRLLHPIMPFVTEEIWENIPHEGESLVVAEYPVVHPELSDEAATKGMDVLMELIRSVRNSRAEVNTPLSKKIEL--------LIKTNDQTVEQFLKANTSYIERFCNPETLTISSEIEAPETAMSAVITGAEIYLPLAGLINLEEEIARLNKELDKWSKEVKRVEGKLANKRFVESAPDAVVEAEKAK 855
>gi|16079861|ref|NP_390687.1| valyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] >gi|586069|sp|Q05873|SYV_BACSU Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|452309|emb|CAA54458.1| valyl-tRNA synthetase [Bacillus subtilis] >gi|2635274|emb|CAB14769.1| valyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str. 168] (880 aa)
Score = 1679, Expect = 0.0e+00, Identities = 340/864 (39%), Positives = 529/864 (61%)
  Q:     9 NNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKD-------SILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           N   +  KYD    E+ ++  W   K     +    K  YS+++PPPNVTG LHLGHA + T+QD + R   ++G    W+ GMDHAGIATQ K E  LRE   S  D  R++ + + ++W +   + IR+QW  +G  LDY  E FTL++  ++ V +VFVK+Y  GLIYR + ++NWD   ++A+S+IEVI K+V+   Y++ Y L++    + +ATTRPET+  D  + V+P+D+RYK+ I K  I P+ N+EI I+ D+YVD++FG+G +K TPAHD ND+ELG ++ L  I   NEDGT N  A+ ++ +   + R K V+ L++  +L K+E  + +VG SER+ AVVEP +S QWFV++   +   IEL+K  +K+ F P +FEK  ++WM N+ DWCISRQLWWGH+IP WY K++ E+YVG + P++ E + +D DVLDTWFSS LWP +T     + ++D    +PT+VLVTG+DIIFFWV RM+F  +    E PFK   I GLIRDE   KMSKSLGNGVDP DVI+KYGAD+LR FL + SSPG+DL +  EKV+S W F NK+WN+ R+  MN     +DE          DKWIL + N+      Q  ++Y F    + + +F WDDFC+ YIE++K        + +++   +L Y++ + + L HP  PF+T  ++ +   + +        +++ E  D +  +++K      ++++I  +R    E   P +K ++++++    ++    + +   +       +  +  DI+++ K      +    IL  E L+  + E   I +++KE + +  E+ R    L N+ F++KAP   I+ E+ K++ +  K   ++K ++  K
  S:     4 NEQTMPTKYDPAAVEKDRYDFWLKGKFFEAGS-DQTKEPYSVVIPPPNVTGRLHLGHAWDTTLQDIVTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREEGKSRYDLGREKFLEETWKWKEEYADFIRSQWAKLGLGLDYSRERFTLDEGLSKAVREVFVKLYEKGLIYRGEYIINWDPATKTALSDIEVIYKDVQGAFYHMSYPLADGSGSIEIATTRPETMLGDTAVAVHPEDERYKHLIGKTVILPIVNREIPIVGDDYVDMEFGSGAVKITPAHDPNDFELGNRHNLERILVMNEDGTMNENALQYQGMDRFECRKKLVKDLQEAGVLFKIEDHMHSVGHSERSGAVVEPYLSTQWFVRMQPLADAAIELEKKEEKVNFVPDRFEKTYLHWMENIRDWCISRQLWWGHRIPAWYHKETGELYVGLEAPEDSENWEQDTDVLDTWFSSALWPFSTMGWPDVTAEDFKRYYPTDVLVTGYDIIFFWVSRMIFQGIEFTGERPFKDVLIHGLIRDEQGRKMSKSLGNGVDPMDVIDKYGADSLRYFLATGSSPGQDLRFSYEKVESTWNFANKIWNASRFALMNMDGMTYDELDLSGEKSVADKWILTRLNETIEHVTQLADRYEFGEVGRHLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDQTMRLLHPFMPFLTEEIWQHLPHQGESITVSQWPAVVPEHTDTEAAADMKL-----LVELIRSVRNIRSEVNTPMSKQVELYIKTSTDEIASRLEANRSYVERFTNPSVLKIGTDIEAVDKAMTAVVSGAEVILPLEGLINIDEE---IARLQKEFDKLTKEVERVQKKLGNEGFMKKAPAHVIDEEREKEKDYVAKRDAVQKRMAELK 879
>gi|110004402|emb|CAK98740.1| probable valyl-trna synthetase protein [Spiroplasma citri] (888 aa)
Score = 1672, Expect = 0.0e+00, Identities = 382/854 (44%), Positives = 541/854 (63%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENK-ISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS-KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVW-YKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD-----FNFDEDKTPKNL------EDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-NRTSNQESKLWV----LNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKIS-NLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL--GSN---NEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELE 865
           +L+KKYDH + E  ++  W  +K     ++K+ + S+SI++PPPNVTG LHLGHA + T+QD +IR+  L G    ++ GMDHAGIATQ K E+ L   K I   D  R++ +  ++ W +     IR QW  +G  LDY  E FTL    +  V +VF+ +Y  GLIYR K +++WD   ++A+SNIEVI +E +  +YY +Y+L NS  ++L +ATTRPET+F D+C+VVNP D RY+ Y NK  +NP   + + II D+YV+  F TG MKCTPAHD ND+E+  ++ L +  C N DGT N  A  + N     AR   V  L +  L+ +++     VGFSER+ A+VEP +S+QWFVK+  +++K+I+ Q S+ KIQF+P +F   LINWM N+ DWCISRQLWWGHQIP W YK DS +I+VG  PP N + +++D DVLDTWFSS LWP+T+      K      FPTNVLVTG+DIIFFWV RMMF SL   KE PF    I GLIRDE   KMSKSLGNGVDP DVI++YGAD LR FL+++S+PG+DL +  EKV S W FINKLWN+ RYVEMN ++      NF+ +   KNL         D+WIL++  K  ++      KY F++  K + DF W+  C+ YIEL+K N  SN  +   V    L Y++K+ILI+ HP  PFVT  +Y   K   K+SI+LE   + KI+ N     +  V +I+  IR      +I    +I+I  +  + K   I+  VI+++N   + +V   +  +     +N   + I     +L  G N   +E    +KI  E+  ++ E+ R   +L+N +F+ KA  EKI+LE+ K  ++  + ++L+
  S:     4 ELTKKYDHILVETGKYQFWK-KKGYFTADVKSKQPSFSIVIPPPNVTGKLHLGHAWDTTLQDLIIRYKKLLGFDTLYLPGMDHAGIATQAKVEERLCVTKNILRHDLGREKFIEQVWAWKEEYAEIIREQWAKLGLALDYSREQFTLNNNLSAAVQKVFIDLYQKGLIYRGKRIISWDPVQKTALSNIEVIYQEQQGKMYYFKYFLENSTSEFLTIATTRPETMFADQCVVVNPNDNRYRKYWNKKVVNPANGELLPIICDDYVEQDFETGAMKCTPAHDANDFEIALRHHLAMPICMNLDGTMNELAGKYHNQDRFTARQNLVHDLNQQKLIVEIKVHSHQVGFSERSGAIVEPYLSDQWFVKMEYFAEKIIKFQSSTNKIQFYPPRFNITLINWMKNVQDWCISRQLWWGHQIPAWYYKDDSTKIHVGLTPPDNSKNWIQDADVLDTWFSSALWPMTSLGWNWDKKLFQHYFPTNVLVTGYDIIFFWVSRMMFESLEFTKEKPFNDVLIHGLIRDEEGRKMSKSLGNGVDPMDVIKEYGADTLRYFLVTNSAPGQDLRFSLEKVNSAWNFINKLWNAARYVEMNLTNNFKPLVNFEIEI--KNLLLNHQENAIDQWILSELAKTITKVQTNMEKYEFVLVGKDLYDFVWNKLCSWYIELTKVNLQSNNATIKMVSTQTLFYVLKQILIMLHPFIPFVTEEIYQ--KLNLKESIMLEV--YPKINFNYNVDYLNLVTEIVAAIRELRSNYQIKKEHIIEIWFDQASSK-NNITTNVISLINEFILKMVNSKVMGVLHQKDQNQKYVTIPLTNVILEVGLNDIVDETIEHQKINAELTRLEQELKRSKNILNNPNFLAKANAEKIKLEEEKYAQYLEQYQQLK 878
>gi|116872981|ref|YP_849762.1| valyl-tRNA synthetase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741859|emb|CAK20983.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (882 aa)
Score = 1672, Expect = 0.0e+00, Identities = 359/859 (41%), Positives = 530/859 (61%)
  Q:     9 NNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           N  ++  KY+    E+    W  +KE  K     +K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+EN IS  D  R++ +   +EW +   + IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   +L VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+AD+YV+ +FG+G +K TPAHD ND+E+G ++ L  I   +EDG  N  A  +E L   +AR   ++  +  +L  K E  + +VG SERT AVVEP +S QWFVK+   + + + LQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG K P+N   + +D DVLDTWFSS LWP +T     +++      FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN +D  + E    K  E  DKWIL + N+          KY F    + + +F WDDFC+ YIE++K          +++   VL Y +   + L HP  PFVT  ++ N   + +   + E  +++ K++ +    +++ ++++I  +R    E   P +K ID+ ++  +    +I ++ I  +    N   + I   DI+  K     V +   IFI   E L+  + E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + E K   LE++
  S:     5 NEINMPTKYEPSKVEEGKYKWWQEKEFFKAEGNTDKEPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKENNISRYDLGREKFIDKTWEWKEEYADFIREQWEKLGLGLDYSRERFTLDDGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGFLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPVLNREIPIVADDYVEREFGSGAVKITPAHDPNDFEVGNRHDLPRIIVMHEDGKMNGNAGKYEGLDRFEARKAIIQDFKDLDLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLASEALALQKTEDKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGEKEPENSSEWEQDEDVLDTWFSSALWPFSTMGWPDTENQDFQHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSFEKVESTWNFINKIWNASRFVLMNLNDMKYSEIDLTKVSEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYNFIWDDFCDWYIEIAKIPLYGEDEDAKQTTRSVLAYTLNTTMRLLHPFMPFVTEEIWQNLPHEGESITIAEWPKVNEKQMDSKASKAMQTLVEVIRAVRNIRSEVNTPLSKQIDLEIKPKDEAYKEIFEQNIAYIERFCNPEHVTIAF-DIEPSKTAMTAVVSGAEIFI-PLEALIDLDVE---IARLEKELEKWNKEVARVQGKLNNERFISKAPETVVAEERLKEKDYLEKKASVLERI 876
>gi|49483906|ref|YP_041130.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] >gi|81650951|sp|Q6GG42|SYV_STAAR Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|49242035|emb|CAG40734.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MRSA252] (876 aa)
Score = 1666, Expect = 0.0e+00, Identities = 351/849 (41%), Positives = 531/849 (62%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKES--SIEDVLQIINKIRIFNFENKIPNNKVIDIHLEV----LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  KYD +  E  ++  W       K +   +K +Y+I++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L E  I+  D  R++ +   ++W +   + IR QW  +G  LDY  E FTL++  ++ V +VFV +YN G+IYR + ++NWD K ++A+S+IEVI ++V+   Y+ +Y  ++ + ++ +ATTRPET+  D  +VVNP D+RYK+ I K  I P+  +E+ I+ADEYVDI FG+G MK TPAHD ND+E+G++++L  I   +E+G  NN A  +E +   D R + VE L++ +L+ K+E  + +VG SER+ AVVEP +S QWFV++ + +K+ ++ QK+  +I F+P +FE     WM N+ DW ISRQLWWGHQIP WY K++ EIYVG + P + E + +D DVLDTWFSS LWP +T     L+S+D    +PTN LVTG+DIIFFWV RM+F  L      PF    + GL+R E   KMSKSLGNGVDP DVI++YGAD+LR FL + SSPG DL Y  EKV+S W FINK+WN  R+  MN   DF  ++     NL   DKWIL + N+  +      +KY F    + + +F WDDFC+ YIE+SK     N    ++    VL+Y +  I+ + HP  PFVT  ++ +   + +  +     + ++    +ES  +++ +++II  +R    E   P +K I I ++     +   L +  D +I   N + +NI   D++   P+    + +I    +L  E L+  + E   I +++KE+  ++SE+ R +  LSN++F+ KAP++ I  EK KK+ ++ K
  S:     2 EMKPKYDPREVEAGRYEEWVKNGYF-KPSEDKSKETYTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQGITRYDLGREKFLEQAWDWKEEYASFIRAQWAKLGLGLDYSRERFTLDEGLSKAVKKVFVDLYNKGIIYRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYPYADVEGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPIVGRELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQLENIIVMDENGKMNNKAGKYEGMDRFDCRKQLVEDLKEQDLVIKIEDHVHSVGHSERSGAVVEPYLSTQWFVRMEDLAKRSLDNQKTDDRIDFYPQRFEHTFNQWMENIRDWTISRQLWWGHQIPAWYHKETGEIYVGEEAPTDIENWQQDEDVLDTWFSSALWPFSTLGWPDLESEDFKRYYPTNALVTGYDIIFFWVARMIFQGLEFTDRRPFNDVLLHGLVRAEDGRKMSKSLGNGVDPMDVIDEYGADSLRYFLATGSSPGHDLRYSTEKVESVWNFINKIWNGARFSLMNIGEDFKVEDIDLSGNLSLADKWILTRLNETIATVTDLSDKYEFGEVGRALYNFIWDDFCDWYIEMSKIPMNGNDEEQKQVTRSVLSYTLDNIMRMLHPFMPFVTEKIWQSLPHEGETIVKASWPEVRESLIFEESKQTMQQLVEIIKSVRQSRVEVNTPLSKEIPILIQAKDKEIETTLSQNKDYLIKFCNPSTLNI-STDVEI--PEKAMTSVVIAGKVVLPLEGLIDMDKE---ISRLEKELAKLQSELDRVDKKLSNENFVSKAPEKVINEEKRKKQDYQEK 863
>gi|153174713|ref|ZP_01930182.1| valyl-tRNA synthetase [Listeria monocytogenes FSL N3-165] >gi|133729944|gb|EBA31642.1| valyl-tRNA synthetase [Listeria monocytogenes FSL N3-165] (883 aa)
Score = 1665, Expect = 0.0e+00, Identities = 360/864 (41%), Positives = 529/864 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           M+   N  ++  KY+    E     W  +KE  K     +K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+E+ IS  D  R+  V   +EW +     IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   YL VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+ADEYV+ +FG+G +K TPAHD ND+E+G ++ L  I   +EDGT N  A  ++ L    AR + ++  +   L  K E  + +VG SERT AVVEP +S QWFVK+   + + +ELQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG K P+N   + +D DVLDTWFSS LWP +T     ++       FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN     ++E       E  DKWIL + N+          KY F    + +  F WDDFC+ YIE++K      +  + Q ++  VL Y +   + L HP  PFVT  ++ N   + +   + E  +++ ++I     +++  ++++I  +R    E   P +K I + ++  +    +I ++ I+ +    N  ++ I   D+++ K     V +   IFI   E L+  N E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + + K   LE++
  S:     1 MTTEHNEINMPTKYEPSNVEAGKYKWWLEKEFFKAEGNTDKEPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKESNISRYDLGRENFVDKTWEWKEEYAEFIREQWEKLGLGLDYSRERFTLDDGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPILNREIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHDLPRIIVMHEDGTMNENAGKYDGLDRFVARKEIIQDFKDLGLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALELQKTENKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGEKEPENLSEWEQDEDVLDTWFSSALWPFSTMGWPDTESPDFQHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSYEKVESTWNFINKIWNASRFVLMNLDGMKYNEIDLSNVTEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYSFIWDDFCDWYIEIAKIPLYGEDEVAKQTTRS-VLAYTLNATMRLLHPFMPFVTEEIWQNLPHEGESITIAEWPKVNEQQIDTKSSTAMATLVEVIRAVRNIRSEVNTPLSKPIILEIKPKDTTYKEILEQNISYIERFCNPEQVTI-SFDVEASKTAMTAVVSGAEIFI-PLEALIDLNVE---IARLEKELEKWNKEVARVQGKLNNERFISKAPESVVAEERLKEKDYLDKKASVLERI 877
>gi|82751253|ref|YP_416994.1| valyl-tRNA synthetase [Staphylococcus aureus RF122] >gi|123547885|sp|Q2YTA0|SYV_STAAB Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|82656784|emb|CAI81213.1| valyl-tRNA synthetase [Staphylococcus aureus RF122] (876 aa)
Score = 1665, Expect = 0.0e+00, Identities = 350/849 (41%), Positives = 530/849 (62%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKES--SIEDVLQIINKIRIFNFENKIPNNKVIDIHLEV----LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  KYD +  E  ++  W       K +   +K +Y+I++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L E  I+  D  R++ +   ++W +   + IR QW  +G  LDY  E FTL++  ++ V +VFV +YN G+IYR + ++NWD K ++A+S+IEVI ++V+   Y+ +Y  ++ + ++ +ATTRPET+  D  +VVNP D+RYK+ I K  I P+  +E+ I+ADEYVDI FG+G MK TPAHD ND+E+G++++L  I   +E+G  N+ A  +E +   D R + VE L++ +L+ K+E  + +VG SER+ AVVEP +S QWFV++ + +K+ ++ QK+  +I F+P +FE     WM N+ DW ISRQLWWGHQIP WY K++ EIYVG + P + E + +D DVLDTWFSS LWP +T     L+S+D    +PTN LVTG+DIIFFWV RM+F  L      PF    + GL+R E   KMSKSLGNGVDP DVI++YGAD+LR FL + SSPG DL Y  EKV+S W FINK+WN  R+  MN   DF  ++     NL   DKWIL + N+  +      +KY F    + + +F WDDFC+ YIE+SK     N    ++    VL+Y +  I+ + HP  PFVT  ++ +   +    +     + ++    +ES  +++ +++II  +R    E   P +K I I ++     +   L +  D +I   N + +NI   D++   P+    + +I    +L  E L+  + E   I +++KE+  ++SE+ R +  LSN++F+ KAP++ I  EK KK+ ++ K
  S:     2 EMKPKYDPREVEAGRYEEWVKNGYF-KPSEDKSKETYTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEKGITRYDLGREKFLEQAWDWKEEYASFIRAQWAKLGLGLDYSRERFTLDEGLSKAVKKVFVDLYNKGIIYRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYPYADGEGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPIVGRELPILADEYVDIDFGSGAMKVTPAHDLNDFEIGQRHQLENIIVMDENGKMNDKAGKYEGMDRFDCRKQLVEDLKEQDLVIKIEDHVHSVGHSERSGAVVEPYLSTQWFVRMEDLAKRSLDNQKTDDRIDFYPQRFEHTFNQWMENIRDWTISRQLWWGHQIPAWYHKETGEIYVGEEAPTDIENWQQDEDVLDTWFSSALWPFSTLGWPDLESEDFKRYYPTNALVTGYDIIFFWVARMIFQGLEFTDRRPFNDVLLHGLVRAEDGRKMSKSLGNGVDPMDVIDEYGADSLRYFLATGSSPGHDLRYSTEKVESVWNFINKIWNGARFSLMNIGEDFKVEDIDLSGNLSLADKWILTRLNETIATVTDLSDKYEFGEVGRALYNFIWDDFCDWYIEMSKIPMNGNDEEQKQITRSVLSYTLDNIMRMLHPFMPFVTEKIWQSLPHEGDTIVKASWPEVRESLIFEESKQTMQQLVEIIKSVRQSRVEVNTPLSKEIPILIQAKDKEIETTLSQNKDYLIKFCNPSTLNI-STDVEI--PEKAMTSVVIAGKVVLPLEGLIDMDKE---ISRLEKELAKLQSELDRVDKKLSNENFVSKAPEKVINEEKRKKQDYQEK 863
>gi|153196811|ref|ZP_01941138.1| valyl-tRNA synthetase [Listeria monocytogenes 10403S] >gi|127633694|gb|EBA23102.1| valyl-tRNA synthetase [Listeria monocytogenes 10403S] (883 aa)
Score = 1664, Expect = 0.0e+00, Identities = 360/864 (41%), Positives = 530/864 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           M+   N  ++  KY+    E     W  +KE  K     +K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+E+ IS  D  R+  V   +EW +     IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   YL VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+ADEYV+ +FG+G +K TPAHD ND+E+G ++ L  I   +EDGT N  A  ++ L    AR + ++  +   L  K E  + +VG SERT AVVEP +S QWFVK+   + + +ELQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG K P+N   + +D DVLDTWFSS LWP +T     ++       FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN     ++E       E  DKWIL + N+          KY F    + + +F WDDFC+ YIE++K      +  + Q ++  VL Y +   + L HP  PFVT  ++ N   + +   + E  +++ ++I     +++  ++++I  +R    E   P +K I + ++  +    +I ++ I+ +    N  ++ I   D+++ K     V +   IFI   E L+  N E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + + K   LE++
  S:     1 MTTEHNEINMPTKYEPSNVEAGKYKWWLEKEFFKAEGNTDKEPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKESNISRYDLGRENFVDKTWEWKEEYAEFIREQWEKLGLGLDYSRERFTLDDGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPILNREIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHDLPRIIVMHEDGTMNENAGKYDGLDRFVARKEIIQDFKDLGLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALELQKTENKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGEKEPENLSEWEQDEDVLDTWFSSALWPFSTMGWPDTESPDFQHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSYEKVESTWNFINKIWNASRFVLMNLDGMKYNEIDLSNVTEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYNFIWDDFCDWYIEIAKIPLYGEDEVAKQTTRS-VLAYTLNATMRLLHPFMPFVTEEIWQNLPHEGESITIAEWPKVNEQQIDTKSSTAMATLVEVIRAVRNIRSEVNTPLSKPIILEIKPKDTTYKEILEQNISYIERFCNPEQVTI-SFDVEASKTAMTAVVSGAEIFI-PLEALIDLNVE---IARLEKELEKWNKEVARVQGKLNNERFISKAPESVVAEERLKEKDYLDKKASVLERI 877
>gi|47096717|ref|ZP_00234302.1| valyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] >gi|153183903|ref|ZP_01934720.1| valyl-tRNA synthetase [Listeria monocytogenes J0161] >gi|153190991|ref|ZP_01938302.1| valyl-tRNA synthetase [Listeria monocytogenes J2818] >gi|47014901|gb|EAL05849.1| valyl-tRNA synthetase [Listeria monocytogenes str. 1/2a F6854] >gi|126943555|gb|EBA21276.1| valyl-tRNA synthetase [Listeria monocytogenes J0161] >gi|127765559|gb|EBA25907.1| valyl-tRNA synthetase [Listeria monocytogenes J2818] (883 aa)
Score = 1664, Expect = 0.0e+00, Identities = 360/864 (41%), Positives = 530/864 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           M+   N  ++  KY+    E     W  +KE  K     +K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+E+ IS  D  R+  V   +EW +     IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   YL VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+ADEYV+ +FG+G +K TPAHD ND+E+G ++ L  I   +EDGT N  A  ++ L    AR + ++  +   L  K E  + +VG SERT AVVEP +S QWFVK+   + + +ELQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG K P+N   + +D DVLDTWFSS LWP +T     ++       FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN     ++E       E  DKWIL + N+          KY F    + + +F WDDFC+ YIE++K      +  + Q ++  VL Y +   + L HP  PFVT  ++ N   + +   + E  +++ ++I     +++  ++++I  +R    E   P +K I + ++  +    +I ++ I+ +    N  ++ I   D+++ K     V +   IFI   E L+  N E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + + K   LE++
  S:     1 MTTEHNEINMPTKYEPSNVEAGKYKWWLEKEFFKAEGNTDKEPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKESNISRYDLGRENFVDKTWEWKEEYAEFIREQWEKLGLGLDYSRERFTLDDGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPILNREIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHDLPRIIVMHEDGTMNENAGKYDGLDRFVARKEIIQDFKDLGLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALELQKTENKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGEKEPENLSEWEQDEDVLDTWFSSALWPFSTMGWPDTESPDFQHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSYEKVESTWNFINKIWNASRFVLMNLDGMKYNEIDLSNVTEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYNFIWDDFCDWYIEIAKIPLYGEDEVAKQTTRS-VLAYTLNATMRLLHPFMPFVTEEIWQNLPHEGESITIAEWPKVNEQQIDTKSSTAMATLVEVIRAVRNIRSEVNTPLSKPIVLEIKPKDTTYKEILEQNISYIERFCNPEQVTI-SFDVEASKTAMTAVVSGAEIFI-PLEALIDLNVE---IARLEKELEKWNKEVARVQGKLNNERFISKAPESVVAEERLKEKDYLDKKASVLERI 877
>gi|16803592|ref|NP_465077.1| valyl-tRNA synthetase [Listeria monocytogenes EGD-e] >gi|81508987|sp|Q8Y6X9|SYV_LISMO Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|16410981|emb|CAC99630.1| valyl-tRNA synthetase [Listeria monocytogenes] (883 aa)
Score = 1664, Expect = 0.0e+00, Identities = 360/864 (41%), Positives = 530/864 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           M+   N  ++  KY+    E     W  +KE  K     +K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+E+ IS  D  R+  V   +EW +     IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   YL VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+ADEYV+ +FG+G +K TPAHD ND+E+G ++ L  I   +EDGT N  A  ++ L    AR + ++  +   L  K E  + +VG SERT AVVEP +S QWFVK+   + + +ELQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG K P+N   + +D DVLDTWFSS LWP +T     ++       FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN     ++E       E  DKWIL + N+          KY F    + + +F WDDFC+ YIE++K      +  + Q ++  VL Y +   + L HP  PFVT  ++ N   + +   + E  +++ ++I     +++  ++++I  +R    E   P +K I + ++  +    +I ++ I+ +    N  ++ I   D+++ K     V +   IFI   E L+  N E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + + K   LE++
  S:     1 MTTEHNEINMPTKYEPSNVEAGKYKWWLEKEFFKAEGNTDKEPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKESNISRYDLGRENFVDKTWEWKEEYAEFIREQWEKLGLGLDYSRERFTLDDGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPILNREIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHNLPRIIVMHEDGTMNENAGKYDGLDRFVARKEIIQDFKDLGLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALELQKTENKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGEKEPENLSEWEQDEDVLDTWFSSALWPFSTMGWPDTESPDFQHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSYEKVESTWNFINKIWNASRFVLMNLDGMKYNEIDLSNVTEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYNFIWDDFCDWYIEIAKIPLYGEDEVAKQTTRS-VLAYTLNATMRLLHPFMPFVTEEIWQNLPHEGESITIAEWPKVNEQQIDTKSSTAMATLVEVIRAVRNIRSEVNTPLSKPIVLEIKPKDTTYKEILEQNISYIERFCNPEQVTI-SFDVEASKTAMTAVVSGAEIFI-PLEALIDLNVE---IARLEKELEKWNKEVARVQGKLNNERFISKAPESVVAEERLKEKDYLDKKASVLERI 877
>gi|46907782|ref|YP_014171.1| valyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] >gi|47093088|ref|ZP_00230865.1| valyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] >gi|153167000|ref|ZP_01927422.1| valyl-tRNA synthetase [Listeria monocytogenes FSL N1-017] >gi|153202474|ref|ZP_01944010.1| valyl-tRNA synthetase [Listeria monocytogenes HPB2262] >gi|167014779|ref|ZP_02277312.1| valyl-tRNA synthetase [Listeria monocytogenes FSL J1-194] >gi|81403272|sp|Q71ZB6|SYV_LISMF Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|46881051|gb|AAT04348.1| valyl-tRNA synthetase [Listeria monocytogenes str. 4b F2365] >gi|47018528|gb|EAL09284.1| valyl-tRNA synthetase [Listeria monocytogenes str. 4b H7858] >gi|133727191|gb|EBA28889.1| valyl-tRNA synthetase [Listeria monocytogenes FSL N1-017] >gi|133735249|gb|EBA36947.1| valyl-tRNA synthetase [Listeria monocytogenes HPB2262] (883 aa)
Score = 1658, Expect = 0.0e+00, Identities = 357/859 (41%), Positives = 529/859 (61%)
  Q:     9 NNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           N  ++  KY+    E     W  +KE  K     +K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+E+ +S  D  R+  V   +EW +     IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   YL VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+ADEYV+ +FG+G +K TPAHD ND+E+G +++L  I   +EDGT N  A  ++ L    AR + ++  +   L  K E  + +VG SERT AVVEP +S QWFVK+   + + +ELQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG   P+N   + +D DVLDTWFSS LWP +T     +++      FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN     ++E       E  DKWIL + N+          KY F    + + +F WDDFC+ YIE++K      +  + Q ++  VL Y +   + L HP  PFVT  ++ N   + +   + E  +++ ++I     +++  ++++I  +R    E   P +K I + ++  +    +I ++ I+ +    N  ++ I   D+++ K     V +   IFI   E L+  N E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + + K   LE++
  S:     6 NEINMPTKYEPSNVEAGKYKWWLEKEFFKAEGNTDKKPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKESNVSRYDLGRENFVDKTWEWKEEYAEFIREQWEKLGLGLDYSRERFTLDDGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPILNREIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHELPRIIVMHEDGTMNKNAGKYDGLDRFVARKEIIQDFKDLGLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALELQKTENKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGESEPENLSEWEQDEDVLDTWFSSALWPFSTMGWPDTENPDFQHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSYEKVESTWNFINKIWNASRFVLMNLDGMKYNEIDLSNVTEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYNFIWDDFCDWYIEIAKIPLYGEDEVAKQTTRS-VLAYTLNATMRLLHPFMPFVTEEIWQNLPHEGESITIAEWPKVNEQQIDTKSSTAMATLVEVIRAVRNIRSEVNTPLSKPIVLEIKPKDTTYKEILEQNISYIERFCNPEQVTI-SFDVEASKTAMTAVVSGAEIFI-PLEALIDLNVE---IARLEKELEKWNKEVARVQGKLNNERFISKAPESVVAEERLKEKDYLDKKASVLERI 877
>gi|168266020|ref|ZP_02687985.1| valyl-tRNA synthetase [Listeria monocytogenes FSL J2-071] (886 aa)
Score = 1657, Expect = 0.0e+00, Identities = 359/864 (41%), Positives = 530/864 (61%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           M+   N  ++  KY+    E     W  +KE  K     +K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+E  IS  D  R++ V   +EW +     IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   YL VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+ADEYV+ +FG+G +K TPAHD ND+E+G ++ L  I   +EDGT N  A  ++ L   +AR + ++  ++  L  K E  + +VG SERT AVVEP +S QWFVK+   + + + LQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG K P+N   + +D DVLDTWFSS LWP +T     +++      FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN     + E    K  E  DKWIL + N+          KY F    + + +F WDDFC+ YIE++K      +  + Q ++  VL Y +   + L HP  PFVT  ++ N   + +   + E   ++  +I     +++  ++++I  +R    E   P +K I + ++  +    +I ++ I+ +    N  ++ I   D+++ K     V +   IFI   E L+  + E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + + K   LE++
  S:     1 MTTEHNEINMPTKYEPSNVEAGKYKWWLEKEFFKAEGNTDKEPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKEENISRYDLGREKFVDKTWEWKEEYAEFIREQWEKLGLGLDYSRERFTLDDGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPILNREIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHDLPRIIVMHEDGTMNENAGKYDGLDRFEARKEIIQDFKELGLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALALQKTEDKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGEKEPENLSEWEQDEDVLDTWFSSALWPFSTMGWPDTENPDFKHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSYEKVESTWNFINKIWNASRFVLMNLDGMKYSEIDLTKVTEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYNFIWDDFCDWYIEIAKIPLYGEDEVAKQTTRS-VLAYTLNATMRLLHPFMPFVTEEIWQNLPHEGESITISEWPEVNENQIDTKASTAMATLVEVIRAVRNIRAEVNTPLSKPIILEMKPKDDNYKEILEQNISYIERFCNPEQVTI-SFDVEASKTAMTAVVSGAEIFI-PLEALIDLDVE---IARLEKELEKWNKEVARVQGKLNNERFISKAPENVVAEERLKEKDYLDKKASVLERI 877
>gi|15927242|ref|NP_374775.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315] >gi|21283336|ref|NP_646424.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49486490|ref|YP_043711.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57650536|ref|YP_186549.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87160762|ref|YP_494306.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300] >gi|88195468|ref|YP_500272.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|148268144|ref|YP_001247087.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|150394211|ref|YP_001316886.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|151221770|ref|YP_001332592.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509882|ref|YP_001575541.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|122539344|sp|Q2FXR8|SYV_STAA8 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|123485492|sp|Q2FG72|SYV_STAA3 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|172048932|sp|A6QHJ8|SYV_STAAE Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|189083635|sp|A6U2D1|SYV_STAA2 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|189083636|sp|A5ITI8|SYV_STAA9 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|189083637|sp|A8Z2I4|SYV_STAAT Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|81649185|sp|Q6G8R2|SYV_STAAS Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|81704362|sp|Q7A0P4|SYV_STAAW Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|81781461|sp|Q99TJ8|SYV_STAAN Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|81859571|sp|Q5HFA8|SYV_STAAC Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|13701460|dbj|BAB42754.1| valine-tRNA ligase [Staphylococcus aureus subsp. aureus N315] >gi|21204776|dbj|BAB95472.1| valine-tRNA ligase [Staphylococcus aureus subsp. aureus MW2] >gi|49244933|emb|CAG43394.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57284722|gb|AAW36816.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] >gi|87126736|gb|ABD21250.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87203026|gb|ABD30836.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|147741213|gb|ABQ49511.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|149946663|gb|ABR52599.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|150374570|dbj|BAF67830.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368691|gb|ABX29662.1| valine--tRNA ligase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (876 aa)
Score = 1657, Expect = 0.0e+00, Identities = 349/849 (41%), Positives = 530/849 (62%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKES--SIEDVLQIINKIRIFNFENKIPNNKVIDIHLEV----LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  KYD +  E  ++  W       K +   +K +Y+I++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L E  I+  D  R++ +   ++W +   + IR QW  +G  LDY  E FTL++  ++ V +VFV +YN G+IYR + ++NWD K ++A+S+IEVI ++V+   Y+ +Y  ++ + ++ +ATTRPET+  D  +VVNP D+RYK+ I K  I P+  +E+ I+ADEYVDI FG+G MK TPAHD ND+E+G++++L  I   +E+G  N+ A  +E +   D R + V+ L++ +L+ K+E  + +VG SER+ AVVEP +S QWFV++ + +K+ ++ QK+  +I F+P +FE     WM N+ DW ISRQLWWGHQIP WY K++ EIYVG + P + E + +D DVLDTWFSS LWP +T     L+S+D    +PTN LVTG+DIIFFWV RM+F  L      PF    + GL+R E   KMSKSLGNGVDP DVI++YGAD+LR FL + SSPG DL Y  EKV+S W FINK+WN  R+  MN   DF  ++     NL   DKWIL + N+  +      +KY F    + + +F WDDFC+ YIE+SK     N    ++    VL+Y +  I+ + HP  PFVT  ++ +   +    +     + ++    +ES  +++ +++II  +R    E   P +K I I ++     +   L +  D +I   N + +NI   D++   P+    + +I    +L  E L+  + E   I +++KE+  ++SE+ R +  LSN++F+ KAP++ I  EK KK+ ++ K
  S:     2 EMKPKYDPREVEAGRYEEWVKNGYF-KPSEDKSKETYTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQGITRYDLGREKFLEQAWDWKEEYASFIRAQWAKLGLGLDYSRERFTLDEGLSKAVKKVFVDLYNKGIIYRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYPYADGEGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPIVGRELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQLENIIVMDENGKMNDKAGKYEGMDRFDCRKQLVKDLKEQDLVIKIEDHVHSVGHSERSGAVVEPYLSTQWFVRMEDLAKRSLDNQKTDDRIDFYPQRFEHTFNQWMENIRDWTISRQLWWGHQIPAWYHKETGEIYVGEEAPTDIENWQQDEDVLDTWFSSALWPFSTLGWPDLESEDFKRYYPTNALVTGYDIIFFWVARMIFQGLEFTDRRPFNDVLLHGLVRAEDGRKMSKSLGNGVDPMDVIDEYGADSLRYFLATGSSPGHDLRYSTEKVESVWNFINKIWNGARFSLMNIGEDFKVEDIDLSGNLSLADKWILTRLNETIATVTDLSDKYEFGEVGRALYNFIWDDFCDWYIEMSKIPMNSNDEEQKQVTRSVLSYTLDNIMRMLHPFMPFVTEKIWQSLPHEGDTIVKASWPEVRESLIFEESKQTMQQLVEIIKSVRQSRVEVNTPLSKEIPILIQAKDKEIETTLSQNKDYLIKFCNPSTLNI-STDVEI--PEKAMTSVVIAGKVVLPLEGLIDMDKE---ISRLEKELAKLQSELDRVDKKLSNENFVSKAPEKVINEEKRKKQDYQEK 863
>gi|15924653|ref|NP_372187.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|156979981|ref|YP_001442240.1| valyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3] >gi|166225533|sp|A7X383|SYV_STAA1 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|81774901|sp|Q931Q1|SYV_STAAM Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|14247435|dbj|BAB57825.1| valine-tRNA ligase [Staphylococcus aureus subsp. aureus Mu50] >gi|156722116|dbj|BAF78533.1| valine-tRNA ligase [Staphylococcus aureus subsp. aureus Mu3] (876 aa)
Score = 1655, Expect = 0.0e+00, Identities = 349/849 (41%), Positives = 529/849 (62%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKES--SIEDVLQIINKIRIFNFENKIPNNKVIDIHLEV----LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  KYD +  E  ++  W       K +   +K +Y+I++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L E  I+  D  R++ +   ++W +   + IR QW  +G  LDY  E FTL++  ++ V +VFV +YN G+IYR + ++NWD K ++A+S+IEVI ++V+   Y+ +Y  ++ + ++ +ATTRPET+  D  +VVNP D+RYK+ I K  I P+  +E+ I+ADEYVDI FG+G MK TPAHD ND+E+G++++L  I   +E+G  N+ A  +E +   D R + V+ L++ +L+ K+E    +VG SER+ AVVEP +S QWFV++ + +K+ ++ QK+  +I F+P +FE     WM N+ DW ISRQLWWGHQIP WY K++ EIYVG + P + E + +D DVLDTWFSS LWP +T     L+S+D    +PTN LVTG+DIIFFWV RM+F  L      PF    + GL+R E   KMSKSLGNGVDP DVI++YGAD+LR FL + SSPG DL Y  EKV+S W FINK+WN  R+  MN   DF  ++     NL   DKWIL + N+  +      +KY F    + + +F WDDFC+ YIE+SK     N    ++    VL+Y +  I+ + HP  PFVT  ++ +   +    +     + ++    +ES  +++ +++II  +R    E   P +K I I ++     +   L +  D +I   N + +NI   D++   P+    + +I    +L  E L+  + E   I +++KE+  ++SE+ R +  LSN++F+ KAP++ I  EK KK+ ++ K
  S:     2 EMKPKYDPREVEAGRYEEWVKNGYF-KPSEDKSKETYTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQGITRYDLGREKFLEQAWDWKEEYASFIRAQWAKLGLGLDYSRERFTLDEGLSKAVKKVFVDLYNKGIIYRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYPYADGEGFIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPIVGRELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHQLENIIVMDENGKMNDKAGKYEGMDRFDCRKQLVKDLKEQDLVIKIEDHFHSVGHSERSGAVVEPYLSTQWFVRMEDLAKRSLDNQKTDDRIDFYPQRFEHTFNQWMENIRDWTISRQLWWGHQIPAWYHKETGEIYVGEEAPTDIENWQQDEDVLDTWFSSALWPFSTLGWPDLESEDFKRYYPTNALVTGYDIIFFWVARMIFQGLEFTDRRPFNDVLLHGLVRAEDGRKMSKSLGNGVDPMDVIDEYGADSLRYFLATGSSPGHDLRYSTEKVESVWNFINKIWNGARFSLMNIGEDFKVEDIDLSGNLSLADKWILTRLNETIATVTDLSDKYEFGEVGRALYNFIWDDFCDWYIEMSKIPMNSNDEEQKQVTRSVLSYTLDNIMRMLHPFMPFVTEKIWQSLPHEGDTIVKASWPEVRESLIFEESKQTMQQLVEIIKSVRQSRVEVNTPLSKEIPILIQAKDKEIETTLSQNKDYLIKFCNPSTLNI-STDVEI--PEKAMTSVVIAGKVVLPLEGLIDMDKE---ISRLEKELAKLQSELDRVDKKLSNENFVSKAPEKVINEEKRKKQDYQEK 863
>gi|16800655|ref|NP_470923.1| valyl-tRNA synthetase [Listeria innocua Clip11262] >gi|81526882|sp|Q92BG2|SYV_LISIN Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|16414074|emb|CAC96818.1| valyl-tRNA synthetase [Listeria innocua] (882 aa)
Score = 1654, Expect = 0.0e+00, Identities = 360/860 (41%), Positives = 531/860 (61%)
  Q:     8 KNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDY--VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           +N  ++  KY+    E     W  +KE  K    ++K  YSI++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L+E  IS  D  R++ V   +EW +   + IR QW+ +G  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K++E + Y+++Y L++   YL VATTRPETI  D  + V+PKD+RY++ I K  + P+ N+EI I+ADEYV+ +FG+G +K TPAHD ND+E+G ++ L  I   +EDGT N+ A  ++ L    AR   ++  +   L  K E  + +VG SERT AVVEP +S QWFVK+   + + + LQK+  K+ F P +FEK    WM N++DWCISRQLWWGH+IP WY K++ EIYVG   P+N + + +D DVLDTWFSS LWP +T     +++      FPTN LVTG+DIIFFWV RM+F S+    E PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGAD+LR  L + SSPG+DL +  EKV+S W FINK+WN+ R+V MN     +DE       E  DKWIL + N+          KY F    + + +F WDDFC+ YIE++K      +  + Q ++  VL Y +   + L HP  PFVT  ++ N   +  +SI +     ++ +++ +   +++  ++++I  +R    E   P +K I + ++  +    +I ++ I+ +    N  K+ I   DI+  K     V +   IFI   E L+  + E   I +++KE+E    E++R  G L+N+ FI KAP+  +  E+ K++ + E K   LE++
  S:     4 QNEINMPTKYEPSNVEAGKYKWWLEKEFFKAEGNSDKKPYSIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGFDTLYLPGMDHAGIATQAKVEAKLKEENISRYDLGREKFVDKTWEWKEEYADFIREQWEKLGLGLDYSRERFTLDAGLSDAVKKVFVTLYNKGLIYRGQYIINWDPEAKTALSDIEVIHKDIEGSFYHLKYPLTDGSGYLEVATTRPETIPGDTAVAVHPKDERYQHLIGKTIMLPILNREIPIVADEYVEREFGSGAVKITPAHDPNDFEVGNRHDLPRIIVMHEDGTMNDNAGKYDGLDRFVARKAIIQDFKDLGLFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALALQKTEDKVNFVPARFEKTYETWMDNIHDWCISRQLWWGHRIPAWYHKETGEIYVGENEPENLDQWEQDEDVLDTWFSSALWPFSTMGWPDTENPDYKHFFPTNTLVTGYDIIFFWVSRMIFQSVEFTGERPFKDTLIHGLVRDSEGRKMSKSLGNGVDPIEVIDKYGADSLRYTLATGSSPGQDLKFSFEKVESTWNFINKIWNASRFVLMNLDGMKYDEIDLSNVTEVSDKWILTRLNETIQAVTSLGEKYEFGEVGRTLYNFIWDDFCDWYIEIAKIPLYGEDEVAKQTTRS-VLAYTLNTTMRLLHPFMPFVTEEIWQNLPHE-GESITISNWPEVNEQQMDSKASTAMRTLVEVIRAVRNIRAEVNTPLSKSIVLEIKPKDETYKEILEQNISYIERFCNPEKVTIAF-DIEPSKTAMTAVVSGAEIFI-PLEALIDLDLE---IARLEKELEKWNKEVARVQGKLNNERFISKAPENVVAEERLKEKDYLEKKASVLERI 876
>gi|161507301|ref|YP_001577255.1| valyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] >gi|160348290|gb|ABX26964.1| Valyl-tRNA synthetase [Lactobacillus helveticus DPC 4571] (879 aa)
Score = 1653, Expect = 0.0e+00, Identities = 354/850 (41%), Positives = 526/850 (61%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN---------RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-LDFKKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKL 861
           DL+ KY+    E+ ++  W  + +L K +     + YSI++PPPNVTG LHLGHA +  IQD LIRF  ++G    ++ GMDHAGIATQ K E  LR+         R+  V  +++W     + I+ QW  MG  LDY  E FTL+K  ++ V +VFV++Y +GLIYR + ++NWD  LQ+A+S+IEVI K+ +   Y+++Y  ++   Y+ +ATTRPET+F D  + V P D+RYK+ + K  + PL  + I II D++VD +FGTG++K TPAHD ND+++G ++ L  I+  N+DGT N     +  +   D R   V+ L++   L KVE  + +VG SER+   VEP +S+QWFVK+   + KV+E QK+  K+ F P +FE  L +WM +++DWCISRQLWWGH+IP WY K + E YVG + PK+ E + +D DVLDTWFSS LWP +T       S+D    FPTN LVTG+DIIFFWV RMMF SL+   + PF    + GL+RDE   KMSKSLGNGVDP DV++KYGADALR FLL+ ++PG+D  Y  +K+ + W FINK+WN+ R+V M     N   D  P ++ D       D+WI ++ N   SE  + F++Y F  + ++  +F W+DFC+ YIE+SK          +   QE+ +W+L+    +IL L HP+ PFVT  L+ +   + K  ++ E     K+  N + +S +  +++II  +R    E   P +  IDI +++ +     + DE    V N L+  ++ +  + +   L    V     IF+   E L+  ++E   +EK +K +E    E+ R    L+NK F++ AP++ +  EK KK  +E +L
  S:     3 DLAPKYNPNEVEKGRYQTWLDE-DLFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTAIQDTLIRFKRMQGYDTLYLPGMDHAGIATQAKVEAKLRKQGKDRHQMGREAFVKQVWDWKDEYASIIKGQWAKMGLSLDYSRERFTLDKGLSKAVKKVFVQLYKEGLIYRGEYIINWDPALQTALSDIEVIHKDDKGAFYHVKYPFADGSGYVEIATTRPETMFGDTAVAVAPGDERYKDIVGKELVLPLVGRHIPIIEDQHVDPEFGTGLVKITPAHDPNDFQVGNRHNLKRINVMNDDGTMNEECGKYAGMDRFDCREALVKDLKEEGYLIKVEPIVHSVGHSERSGVQVEPRLSKQWFVKMKPLADKVLENQKTDGKVNFVPERFEGTLDHWMEDVHDWCISRQLWWGHRIPAWYNKKTGETYVGEEAPKDIENWEQDPDVLDTWFSSALWPFSTLGWPDTNSEDFKRYFPTNALVTGYDIIFFWVSRMMFQSLHFTGKRPFNDVVLHGLMRDEQGRKMSKSLGNGVDPMDVVDKYGADALRWFLLNGTAPGQDTRYDPKKLSAAWNFINKIWNASRFVIM-----NLPSDAKPAHMPDVSKFDLSDRWIFDRLNHTVSEVTRLFDEYQFGEAGREAYNFIWNDFCDWYIEISKVALNGDDEELKARKQENLIWILD----QILRLMHPIMPFVTEKLWLSMPHEGKSIMVAEYPTTHKEFENKQADSDMAFLIEIIKAVRNIRMEVNAPMSSPIDIMIQLDDESNKHVLDENADYVENFLHPKELTVAAEIEAPKLAKTAVIPGAQIFVPLTE-LVNVDDELAKMEKEEKRLE---GEVQRAEKKLANKGFVDHAPEDVVNKEKEKKADYESQL 865
>gi|27468257|ref|NP_764894.1| valyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57867133|ref|YP_188802.1| valyl-tRNA synthetase [Staphylococcus epidermidis RP62A] >gi|81819377|sp|Q5HNN9|SYV_STAEQ Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|81843675|sp|Q8CS83|SYV_STAES Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|27315803|gb|AAO04938.1|AE016748_172 valine-tRNA ligase [Staphylococcus epidermidis ATCC 12228] >gi|57637791|gb|AAW54579.1| valyl-tRNA synthetase [Staphylococcus epidermidis RP62A] (876 aa)
Score = 1652, Expect = 0.0e+00, Identities = 346/849 (40%), Positives = 531/849 (62%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  KYD +  E+ ++  W +     K +   +K +Y+I++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K E  L E  IS  D  R++ +   ++W +     IR QW  +G  LDY  E FTL+   ++ V +VFV +YN G+IYR + ++NWD K ++A+S+IEVI ++V+   Y+ +Y  ++   Y+ +ATTRPET+  D  +VVNP D+RYK+ I K  I P+  +E+ I+ADEYVDI+FG+G MK TPAHD ND+E+G++++L  I   +E G  N+ A  ++ +   D R + V+ L++ +L+ K+E+   +VG SER+ A+VEP +S QWFVK+   +++ ++ Q +  +I FFP +FE     WM  + DW ISRQLWWGHQIP WY KD+ E++VG + P++ E +++D DVLDTWFSS LWP +T     T+A   K   +PTN LVTG+DIIFFWV RM+F  L      PF    + GL+R E   KMSKSLGNGVDP DVI++YGAD+LR FL + SSPG DL Y  EKV+S W FINK+WN+ R+  MN   DF  ++     NL   D+WIL + N+  S   +  +KY F    + + +F WD+FC+ YIE+SK        S +++   VL+Y++ KI+ + HP  PFVT  ++ +     +  +      +D   I N  + ++E +++II  +R    E   P +K I I ++  + K+     + I+ L    N +++ I   D +   P+      ++    +L  E L+  + E   I +++KE++ ++SE+ R +  LSN++F+ KAP++ I  EK K++ ++ K
  S:     2 EMKPKYDPREVEKGRYEEWVSNGYF-KPSEDKSKEAYTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQGISRHDLGREKFLQQAWDWKEEYATFIRQQWAKLGLGLDYSRERFTLDDGLSKAVRKVFVDLYNKGIIYRGERIINWDPKARTALSDIEVIHEDVQGAFYHFKYPYADGNGYIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPIVGRELPILADEYVDIEFGSGAMKVTPAHDPNDFEIGQRHQLENIIVMDEYGKMNDKADKYKGMDRFDCRNQLVKDLKEQDLVIKIEEHTHSVGHSERSGAIVEPYLSTQWFVKMKPLAQRALDNQNTKDRIDFFPGRFENTFNRWMEEIRDWTISRQLWWGHQIPAWYHKDTGEVFVGEEAPEDIENWIQDEDVLDTWFSSALWPFSTLGWPDTNADDFK-RYYPTNALVTGYDIIFFWVARMIFQGLEFTDRRPFNDVLLHGLVRAEDGRKMSKSLGNGVDPMDVIDEYGADSLRYFLATGSSPGHDLRYSTEKVESVWNFINKIWNAARFSLMNIGEDFKVEDIDLSGNLSLADQWILTRLNETISTVTELSDKYEFGEVGRALYNFIWDEFCDWYIEMSKIPMNGEDESQKQTTRSVLSYVLDKIMKMLHPFMPFVTETIWQSLPHHGETIVKANWPTVDQALIFNESKQTMEQLVEIIKSVRQSRVEVNTPLSKAIPILIQTKDEKIKHTLMDNISYLHKFCNPSQLTI---DTEIEIPEKAMTTVVVAGKVVLPLEGLIDMDKE---IARLEKELDKLQSELDRVDKKLSNENFVNKAPEKIINEEKEKQQHYQEK 863
>gi|184154973|ref|YP_001843313.1| valyl-tRNA synthase [Lactobacillus fermentum IFO 3956] >gi|183226317|dbj|BAG26833.1| valyl-tRNA synthase [Lactobacillus fermentum IFO 3956] (884 aa)
Score = 1650, Expect = 0.0e+00, Identities = 338/859 (39%), Positives = 529/859 (61%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-----NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-LDFKKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILN----TAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           +++ K+D +  E+    W   +   K +     + YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L +  +S  D  R++ V  +++W       I  QW  MG  +DY+ E FTL++  N+ V +VFV +YN GLIYR+  ++NWD K ++A+S+IEV  K+ +   Y+++Y  +     N KDY+ +ATTRPET+F DE + VNP D+RYK  + K  + PL N+EI+IIAD+YV   FGTG++K TPAHD ND+++GK++ L  ++  NED + N  A  +  +   DAR   V+ L+    + K++  + +VG SERT   VE  +S QWFVK+   +++ +  QK+  ++ F P +FE     WM N++DW ISRQLWWGHQIP WY K++ E+YVG + P + E +V+D DVLDTWFSS LWP +T     TDA   K   FPT  LVTG+DIIFFWV RM+F SL    + PF++  + GLIRDE   KMSKSLGNG+DP DV+EKYG DALR FL++ S+PG+D+ +  +K+ + W FINK+WN+ RYV MN  D    +       +  D+WIL++ N    +   +F K+ F  + + + +F W+DFC+ YIE++K + +N     +++   +L Y++ + L L HP+ PFVT  L+       +  ++ +  ++  +++N K E  +ED++++I  +R    +   P +  + + ++V +     + +E  + L+     + + I  + D+  L    +     ++I   E L+  + E   +E   KEI  ++ E++R    L N+ F+  AP++ +  E++K E+ + KL   ++ L+S
  S:     5 EMATKFDPQAVEEGRYQWWIDQGFFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGYDVLWLPGMDHAGIATQAKVEARLAKQGVSRYDLGREKFVKQVWDWKDEYAAIIHQQWAKMGISVDYDRERFTLDEGLNKAVRKVFVDLYNKGLIYRATYIINWDPKARTALSDIEVEHKDDKGAFYHVKYPFTDGTTFNGKDYIEIATTRPETMFGDEAVAVNPSDERYKELVGKHVMVPLVNREIEIIADDYVTPDFGTGMVKITPAHDPNDFQVGKRHNLPELNTMNEDASMNENAGKYVGMDRFDARKAIVKDLQDQGYMLKIDPIVHSVGHSERTGVQVESRLSTQWFVKMKPLAERALANQKTDDRVNFIPERFEHTFNQWMENVHDWVISRQLWWGHQIPAWYHKETGEMYVGMEAPADAENWVQDKDVLDTWFSSALWPFSTMGWPNTDAEDFK-RYFPTTTLVTGYDIIFFWVSRMIFQSLEFTGKAPFRNVLLHGLIRDEQGRKMSKSLGNGIDPMDVVEKYGVDALRWFLVTGSTPGQDIRFSYKKMDASWNFINKIWNASRYVIMNLGDMPAPQLPDQSKWDLADRWILSRLNTTVKDVTAKFEKFEFGEAGRDLYNFIWNDFCDWYIEMTKEKLTNGTDEEKDATKNILGYVLDQTLKLIHPIMPFVTEKLWQAMPHDGQSIMVADYPVEHVELANQKAEGEMEDLIELIKAVRNIRNQAGAPMSSPVKMMIKVDDQAHAAVFNENRDYLDRFCHPSDLTIATEVDVPKLAMSGILAGATVYIPMAE-LVDLDEERARME---KEITKLEKEVARSTKKLGNEKFVNSAPEQVVAKERAKAEEWQQKLASAKERLAS 880
>gi|81428459|ref|YP_395459.1| valyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] >gi|90101528|sp|Q38XD1|SYV_LACSS Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|78610101|emb|CAI55150.1| Valyl-tRNA synthetase [Lactobacillus sakei subsp. sakei 23K] (882 aa)
Score = 1650, Expect = 0.0e+00, Identities = 351/866 (40%), Positives = 535/866 (61%)
  Q:     7 IKNNNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK--NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQES---KLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL-------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKI----SDEVINILNTAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + ++ ++S KYD +++ + ++  W  +++L K N   +   YSI++PPPNVTG LHLGHA + T+QD LIR   ++G    W+ GMDHAGIATQ K E  L E  IS  D  R++ +  ++EW       I +QW  MG  LDY  E FTL+   ++ V +VFV +YN GLIYR + ++NWD K ++A+S+IEV+ ++ E   Y++ Y L++    + +ATTRPET+  D  + V+P D+RY + + K    PL N+EI IIAD YVD  FGTG +K TPAHD ND+E+G ++ L  I+  NED + N  A  +  +   +AR   V  L++   L KV+    +VG SERT   VE  +S QWFVK+   ++  ++ Q++ +K+ F P +FE     WM N++DW ISRQLWWGHQIP WY K + E+YVG + P++ E + +D+DVLDTWFSS LWP +T     T+A   K   FPTN LVTG+DIIFFWV RM+F SL   ++ PF+H  I GLIRDE   KMSKSLGNG+DP +VIEKYGADALR FL S S+PG+D+ +   K+ + W FINK+WN+ R+V MN  D      K P+  NL+  DKWIL++ N+  ++  + +  + F  + + + +F W+DFC+ YIE++K      +QE+   K + L Y++ + L L HP+ PFVT  ++ +    T +SI+          LD ++ +    + +  ++ +I  +R    E   P +K IDI + + +  L  I     D +   ++   + I +     +L    + +   +++   E LL  + E   I +++ E++ +  EI R  G L+NK F ++AP++ ++ E+ K+  +E + + +EK L+  K
  S:     1 MTDHKEMSTKYDPNQVEDGRYQDWL-KEDLFKPNANPDAKPYSIVIPPPNVTGKLHLGHAWDTTLQDMLIRQKRMQGYDVLWLPGMDHAGIATQAKVEAKLAEQGISRYDLGREKFIDQVWEWKDEYAATIHDQWAKMGLSLDYSRERFTLDDGLSDAVRKVFVNLYNKGLIYRGEYIINWDPKARTALSDIEVLHQDDEGAFYHVSYPLTDGSGSIEIATTRPETLPGDTAIAVHPDDERYADLVGKTVTLPLMNREIPIIADHYVDKDFGTGALKITPAHDPNDFEVGNRHDLPRINVMNEDASMNESAGKYNGMDRFEARKAIVADLKEQGFLIKVDPMTHSVGHSERTGVQVEARLSTQWFVKMKPLAEMALKNQETDQKVNFVPERFENTFTQWMENVHDWVISRQLWWGHQIPAWYHKQTGEMYVGEEAPEDIENWTQDSDVLDTWFSSALWPFSTMGWPNTEAPDFK-RYFPTNTLVTGYDIIFFWVSRMIFQSLEFTEQRPFEHVLIHGLIRDEQGRKMSKSLGNGIDPMEVIEKYGADALRWFLTSGSTPGQDVRFSYTKMDAAWNFINKIWNASRFVIMNLED-TPAPTKVPEAANLDLTDKWILSQLNQTVADVTRLYEGFEFGEAGRTLYNFIWNDFCDWYIEMAKEVLYGDDQEAIANKRYNLAYVLDQTLRLLHPVMPFVTEEIWQSMP-HTGESIMTASYPEVHAELDDQEAT----TQMNALIDLIRSVRNIRSEANAPLSKPIDILINIQDTPLMAIFKQNQDFIERFVHPKSLEIAEGLTAPALAKTAIISGAEVYVPLAE-LLDLDEE---ITRLEGELKRLNGEIKRAQGKLANKGFTDRAPEKVVQEERDKQADYEQQYQSVEKRLAELK 879
>gi|116513817|ref|YP_812723.1| valyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116093132|gb|ABJ58285.1| valyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (879 aa)
Score = 1649, Expect = 0.0e+00, Identities = 357/850 (42%), Positives = 519/850 (61%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWV-----LNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLD-FKKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK----LFKISDEVINILNTAKINIV-KQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKL 861
           +L+ KY+ +  E  ++  W  + +L K +       YSI++PPPNVTG LHLGHA +  IQD LIR+  ++G    ++ GMDHAGIATQ K E  LRE  +S  D  R++ V  ++EW     N I+ QW+ +G  LDY  E FTL+K  ++ V +VFV++YN+GLIYR + ++NWD KL++A+S+IEV+ ++ +   Y+I Y L++    + +ATTRPET+F D  + V P D+RYK+ + K  I PL  +EI II D++VD +FGTG++K TPAHD ND+E+G ++ L  I+  N+DGT N+ A  +  +   D R + VE L+    L KVE  + +VG SER+   VEP +S QWFVK+   + KV+E QK   ++ F P +FE  L  WM N++DW ISRQLWWGH+IP WY K + E+YVG + P + E + +D DVLDTWFSS LWP +T        A     FPTN LVTG+DIIFFWV RM+F SL+   E PF +  + GLIRDE   KMSKSLGNG+DP DVI KYGADALR FLL+ ++PG+D  +   K+ + W FINKLWN+ R+V M     N  ED  P    D       D WI ++ N    E  + F+++ F  + +++ +F W+DFC+ YIE+SK      +++L       L +++ +IL L HP+ PFVT  L+ +   + K  +     +   +  N K +  +  +++II  +R    E   P +  IDI +++ + K    L    + V N L   K+ I  K     L    V     IF+   E L+  + E   I K+ KE   +++E+ R +  L+NK F++ AP   +E EK K  ++E +L
  S:     3 ELAPKYNPQEVEAGRYQEWLDE-DLFKPSGDKKAKPYSIVIPPPNVTGKLHLGHAWDTAIQDTLIRYKRMQGYDTLYLPGMDHAGIATQAKVEARLREQGVSRYDLGREKFVEKVWEWKDEYANIIKRQWQKLGLSLDYSRERFTLDKGLSKAVRRVFVQLYNEGLIYRGEYIINWDPKLRTALSDIEVVHQDDQGAFYHINYPLADGSGSVEIATTRPETMFGDTAVAVAPGDERYKDLVGKKLILPLVGREIPIIEDQHVDPEFGTGLVKITPAHDPNDFEVGNRHDLPRINVMNDDGTMNDKAGKYAGMDRFDCRKQLVEDLKAEGYLIKVEPIVHSVGHSERSGVQVEPRLSTQWFVKMKPLADKVLENQKGEGRVNFVPDRFEGTLERWMENVHDWVISRQLWWGHRIPAWYNKQTGEMYVGEEAPADIENWDQDQDVLDTWFSSALWPFSTLGWPDEDSADFKRYFPTNALVTGYDIIFFWVSRMIFQSLHFTGERPFDNVVLHGLIRDEQGRKMSKSLGNGIDPMDVIAKYGADALRWFLLNGTAPGQDTRFSYTKMDAAWNFINKLWNASRFVIM-----NLPEDAKPAQKPDISKFDLADAWIFDRLNHTVKETNRLFDEFQFGEAGREMYNFIWNDFCDWYIEISKVALYGDDAELKARKQANLTWILDQILRLIHPIMPFVTEKLWLSMPHEGKSIMTAAYPEAHAEFDNAKADEDMAFLIEIIKAVRTIRMEVNAPMSSAIDILIQLDDEKNEAILRDNMEYVENFLQPKKLEISGKIKAPKLAKTAVIAGAQIFVPLSE-LVDLDEE---IAKMGKEEARLEAEVDRASKKLANKGFVDHAPAAVVEKEKGKLAEYENQL 865
>gi|104773811|ref|YP_618791.1| valyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103422892|emb|CAI97554.1| Valyl-tRNA synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (879 aa)
Score = 1649, Expect = 0.0e+00, Identities = 357/850 (42%), Positives = 521/850 (61%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWV-----LNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLD-FKKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK----LFKISDEVINILNTAKINIV-KQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKL 861
           +L+ KY+ +  E  ++  W  + +L K +       YSI++PPPNVTG LHLGHA +  IQD LIR+  ++G    ++ GMDHAGIATQ K E  LRE  +S  D  R++ V  ++EW     N I++QW+ +G  LDY  E FTL+K  ++ V +VFV++YN+GLIYR + ++NWD KL++A+S+IEV+ ++ +   Y+I Y L++    + +ATTRPET+F D  + V P D+RYK+ + K  I PL  +EI II D++VD +FGTG++K TPAHD ND+E+G ++ L  I+  N+DGT N+ A  +  +   D R + VE L+    L KVE  + +VG SER+   VEP +S QWFVK+   + KV+E QK   ++ F P +FE  L  WM N++DW ISRQLWWGH+IP WY K + E+YVG + P + E + +D DVLDTWFSS LWP +T        A     FPTN LVTG+DIIFFWV RM+F SL+   E PF +  + GLIRDE   KMSKSLGNG+DP DVI+KYGADALR FLL+ ++PG+D  +   K+ + W FINKLWN+ R+V M     N  ED  P    D       D WI ++ N    E  + F+++ F  + +++ +F W+DFC+ YIE+SK      +++L       L +++ +IL L HP+ PFVT  L+ +   + K  +     +   +  N K +  +  +++II  +R    E   P +  IDI +++ + K    L    + V N L+  K+ I  K     L    V     IF+   E L+  + E   I K+ KE   +++E+ R +  L+NK F+  AP   +E EK K  ++E +L
  S:     3 ELAPKYNPQEVEAGRYQEWLDE-DLFKPSGDKKAKPYSIVIPPPNVTGKLHLGHAWDTAIQDTLIRYKRMQGYDTLYLPGMDHAGIATQAKVEARLREQGVSRYDLGREKFVEKVWEWKDEYANIIKSQWQKLGLSLDYSRERFTLDKGLSKAVRRVFVQLYNEGLIYRGEYIINWDPKLRTALSDIEVVHQDDQGAFYHINYPLADGSGSVEIATTRPETMFGDTAVAVAPGDERYKDLVGKKLILPLVGREIPIIEDQHVDPEFGTGLVKITPAHDPNDFEVGNRHDLPRINVMNDDGTMNDKAGKYAGMDRFDCRKQLVEDLKAEGYLIKVEPIVHSVGHSERSGVQVEPRLSTQWFVKMKPLADKVLENQKGEGRVNFVPDRFEGTLERWMENVHDWVISRQLWWGHRIPAWYNKQTGEMYVGEEAPADIENWDQDQDVLDTWFSSALWPFSTLGWPDEDSADFKRYFPTNALVTGYDIIFFWVSRMIFQSLHFIGERPFDNVVLHGLIRDEQGRKMSKSLGNGIDPMDVIDKYGADALRWFLLNGTAPGQDTRFSYTKMDAAWNFINKLWNASRFVIM-----NLPEDAKPAQKPDISKFDLADAWIFDRLNHTVKETNRLFDEFQFGEAGREMYNFIWNDFCDWYIEISKVALYGDDAELKARKQANLTWILDQILRLIHPIMPFVTEKLWLSMPHEGKSIMTAAYPEAHAEFDNAKADEDMAFLIEIIKAVRTIRMEVNAPMSSAIDILIQLDDEKNEAILRDNMEYVENFLHPKKLEISGKIKAPKLAKTAVIAGAQIFVPLSE-LVDLDEE---IAKMGKEEARLEAEVDRASKKLANKGFVGHAPAAVVEKEKGKLAEYENQL 865
>gi|124521945|ref|ZP_01696738.1| valyl-tRNA synthetase [Bacillus coagulans 36D1] >gi|124496416|gb|EAY44015.1| valyl-tRNA synthetase [Bacillus coagulans 36D1] (881 aa)
Score = 1649, Expect = 0.0e+00, Identities = 341/853 (39%), Positives = 506/853 (59%)
  Q:    13 LSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT----DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKD--SILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-------EMKLKELE 865
           +  KYD +  E+ ++  W   K    K     K  Y+I++PPPNVTG LHLGHA +  +QD L R   ++G    W+ GMDHAGIATQ K E  LRE   S  D  R++   + ++W       IR QW  +G  LDY  E FTL++  ++ V +VFV +Y  GLIYR + ++NWD + ++A+S+IEV+ KEV+   Y++ Y LS+    + +ATTRPET+  D  + V+P D+RYK+ I K  + P+  +EI IIADEYVD+ FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N  A  ++ +   + R + VE L+   +L KVE  + +VG SER+ AVVEP +S QWFVK+   +   ++LQ S  K+ F P +FEK  ++WM N+ DWCISRQLWWGH+IP WY K++ E+YV T+PP++ E + +D DVLDTWFSS LWP +T     +  K     +PT+ LVTG+DIIFFWV RM+F  L    + PFK   I GL+RDE   KMSKSLGNGVDP +VI+KYGAD+LR FL + S+PG+DL +  EKV++ W F NK+WN+ R+  MN +   ++E          DKWIL + N+      +  +KY F  + + + +F WDDFC+ YIE++K        + +++   VL Y++   + L HP  PF+T  ++ N   + +   +     +D           ++ ++ II  +R    E   P +K I +HL+  +   L  +      I      + +K  +    PD      +  +     L G  N    + +++KE+     E+ R    LSN+ F++KAP+  +  E++K++ +       E ++KELE
  S:     8 MPTKYDPQAVEKGRYEWWVNGKFFEAKG-DPEKKPYTIVIPPPNVTGKLHLGHAWDTALQDILTRMKRMQGYDVLWLPGMDHAGIATQAKVEAKLREEGKSRYDLGREKFTEEAWKWKAEYAQFIRKQWAKLGLGLDYSRERFTLDEGLSKAVKEVFVSLYKKGLIYRGEYIINWDPETKTALSDIEVVYKEVQGAFYHLAYPLSDGSGTIEIATTRPETMLGDTAVAVHPDDERYKHLIGKTIVLPIVGREIPIIADEYVDMTFGSGAVKITPAHDPNDFEVGNRHNLERILVMNEDGTMNENAGKYKGMDRFECRKQIVEDLKALGVLVKVEDHLHSVGHSERSGAVVEPYLSTQWFVKMQPLADAAVKLQASEGKVHFVPERFEKTYLHWMENIRDWCISRQLWWGHRIPAWYHKETGEVYVDTEPPRDIENWEQDPDVLDTWFSSALWPFSTMGWPDEEAKDYKRYYPTDTLVTGYDIIFFWVSRMIFQGLAFTGKRPFKDVLIHGLVRDEQGRKMSKSLGNGVDPMEVIDKYGADSLRYFLTTGSAPGQDLRFSYEKVEAVWNFANKIWNASRFALMNMNGLKYEEMDLSGEKSVADKWILTRLNETIETVTKLADKYEFGEAGRALYNFIWDDFCDWYIEMAKLPLYSEDEAAKKTTRSVLAYVLDNTMRLLHPFMPFITEEIWQNLPHQGESITTAAWPEVDESLTDAAASEEMKLLVDIIRSVRNIRAEVNTPLSKKIKLHLKAKDETVLAALKRNEAYITRFCNPDELKMGLDLEAPDKAMTAVVSGVELFLPLEGLINFEEELARLRKELAKWNKEVERVQKKLSNQGFLKKAPENVVAEERAKEKDYLEKRSTVEARIKELE 879
>gi|56964386|ref|YP_176117.1| valyl-tRNA synthetase [Bacillus clausii KSM-K16] >gi|81822070|sp|Q5WEQ4|SYV_BACSK Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|56910629|dbj|BAD65156.1| valyl-tRNA synthetase [Bacillus clausii KSM-K16] (880 aa)
Score = 1647, Expect = 0.0e+00, Identities = 335/854 (39%), Positives = 514/854 (60%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQK-SSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT----DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL-FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  + +  KYD    E+++  +  + +  +     +K  YSI++PPPNVTG LHLGHA + TIQD L R   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R+  +   +EW       IR QW  +G  +DY  E FTL++  ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K+V+   Y++ Y LS+    + +ATTRPET+  D  + V+P D+RY++ I K    P+  +EI IIAD+YVD +FG+G +K TPAHD ND+E+G ++ L  +   NEDGT N  A  +E +   + R + V+ L+   +L K+E  + +VG SER+ AVVEP +S QWFVK+   +++ ++LQ+ +  K+ F P +FE+  I WM N+ DWCISRQLWWGHQIP WY K++ EIYVG +PP++ E + +D DVLDTWFSS LWP +T     +        +PTNVLVTG+DII FWV RM+F       + PFK   I GLIRD    KMSKSLGNGVDP +VI+KYGAD+LR FL + S+PG DL +  EKV+S W F NK+WN+ R+  MN   F++ +    +     DKWIL +  +      +  + Y F  + + +  F WDD C+ YIE++K      N  + Q ++  VL +++ + + + HP  PF+T  ++ +   +  +SI +        S + E ++ED   +  +I+ IR    E  +P +K I++ +   + ++  ++   V  I   A  +++   +    P+   ++ L  +     L G  +    + +++KE++ +  E+ R    L+N+ F+ KAP   +E EK+K++ +  K
  S:     1 MEEQHSMPTKYDPSATEKKWYTYWLKGKFFEATGDPDKQPYSIVIPPPNVTGKLHLGHAWDATIQDILARTKRMQGYDTLWLPGMDHAGIATQAKVEGKLREQGISKYDLGREAFLEKSWEWKDEYAKFIREQWAKVGISVDYSRERFTLDQGLSDAVKEVFVSLYNKGLIYRGEYIINWDPQTKTALSDIEVIYKDVQGAFYHMSYPLSDGSGSIEIATTRPETMLGDTAVAVHPDDERYQHLIGKMVKLPIVGREIPIIADDYVDREFGSGAVKITPAHDPNDFEIGNRHNLPRVLVMNEDGTMNEKAGKYEGMDRFECRKQIVKDLQAQQVLFKIEDHLHSVGHSERSGAVVEPYLSTQWFVKMRPLAEEALKLQEYADTKVTFVPQRFEQTYIRWMENIRDWCISRQLWWGHQIPAWYHKETNEIYVGKEPPRDSENWRQDEDVLDTWFSSALWPFSTMGWPDEEAPDYKRYYPTNVLVTGYDIIAFWVSRMIFQGKAFTGQRPFKDVLIHGLIRDAEGRKMSKSLGNGVDPQEVIDKYGADSLRFFLATGSTPGNDLRFYWEKVESTWNFGNKIWNASRFALMNMDGFSYSDIDINQEKSIADKWILTRLQETVESVTRLIDAYEFGEAGRVLYSFIWDDVCDWYIEMAKLALYGENEQAKQATRS-VLAHVLDQTMRMLHPFMPFITEEIWQHLPHE-GESITVANWPVYDQSLVFEEAVEDMEALKSLIHAIRTTRSELNVPMSKQIELKIRPQDEQMAARLQRGVAYIEKFANPSLLDIAVDLATPEKAMSHALSGMELFLPLAGMLDLDKEVARLEKELDKLNKEVERIEKKLNNQGFLAKAPSHVVEEEKAKQQDYAAK 867
>gi|116617448|ref|YP_817819.1| valyl-tRNA synthetase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096295|gb|ABJ61446.1| valyl-tRNA synthetase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (894 aa)
Score = 1646, Expect = 0.0e+00, Identities = 358/861 (41%), Positives = 524/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQK----ELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-----NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKS-SKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKK---DSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWV---LNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDF----KKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           D+S KYD    E  ++  W ++K    E NK+        YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   +S  D  R++ V  +++W       I+ QW  MG  LD++ E FTL++  N+ VN+VF+ +YN GLIYR + ++NWD + ++A+S+IEVI ++     Y+++Y  +     + KDY+ +ATTRPET+F D  + V+P D+RYK+ I K  + PL  +EI IIADEYV+  FGTG++K TPAHD ND+++G ++ L  I+   EDG  N +A  +  +   DAR      LE  + + KV+  + +VG SERT   VE  +S QWFVK+   +K+++++QK+  +K++F P +FE     WM N+ DW ISRQLWWGHQIP WYK    D +E+YVGT+ P  +  + RD DVLDTWFSS LWP +T    +  D  F    PTN LVTG+DIIFFWV RMMF       + PFK+  I GLIRD    KMSKSLGNGVDP DVIEKYGADALR FL++ S+PG+DL +  EK+ S W FINK+WN+ RYV M     N DED TP  L D       D+WIL++ N   +   + F+K+ F  + +++ +F W DF + YIE++K   +  + K  V   L Y++ + L L  P+ PFVT  ++     +         + +    +++SN   E + + +  +I  +R    E   P +  ID+ ++  +  L   F+ + + IN     K  I+  D+++  L    V +   I++   E L+  + E   I +++ E++    E+ R  G L N  F+  AP+  +  EK K    + KL   E+ L + K
  S:     5 DMSTKYDPTSVEAGRYDNWQSKKLFAPESNKEIQGNEPEPYSIVIPPPNVTGKLHLGHAWDTTLQDMIIRQKRMQGFDTLWLPGMDHAGIATQAKVEQRLRGEGVSRYDLGREKFVEQVWDWKNEYATTIKQQWGKMGLSLDFDRERFTLDEGLNKAVNKVFIDLYNKGLIYRGEYIINWDPQARTALSDIEVIYQDDAGAFYHVKYPFTDGTTFDGKDYIEIATTRPETMFGDVAVAVHPSDERYKDLIGKKVLVPLVGREIPIIADEYVEKDFGTGMVKITPAHDPNDFQVGNRHDLERINTMTEDGHLNEFAGKYNGMDRFDARKAIAADLEAGDYMLKVDPIVHSVGHSERTGVQVESRLSTQWFVKMEPLAKQILDMQKNDDEKVEFVPARFEDTFSRWMENIRDWVISRQLWWGHQIPAWYKNKGTDQEELYVGTEAPAGDG-WERDPDVLDTWFSSALWPFSTMGWPEKLDGDFARYYPTNTLVTGYDIIFFWVARMMFQGKEFTGQRPFKNVLIHGLIRDGEGRKMSKSLGNGVDPMDVIEKYGADALRWFLVTGSTPGQDLRFTYEKMDSAWNFINKIWNASRYVIM-----NLDED-TPSTLPDMSQLTLADQWILSRLNTVVTNVTRNFDKFEFGEAGRELYNFIWSDFADWYIEMTKETLNGDQDKAPVQQTLAYVLDQTLRLLQPIMPFVTEAIWQEMPAQNGSEADFAIVKYPVVREELSNPDAEQAFKSLQDLIVAVRNIRAEANAPMSTPIDLMIQTTDDNLKHIFEANADYINRFAHPKTLIISDDVQAPNLAMSQVISGAEIYVPLAE-LIDIDEE---ITRLQTEVKKFSGEVKRAEGKLGNDKFVSGAPEAVVAAEKEKLADWQAKLNATEERLQTLK 891
>gi|148543739|ref|YP_001271109.1| valyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|184153145|ref|YP_001841486.1| valyl-tRNA synthase [Lactobacillus reuteri F275] >gi|148530773|gb|ABQ82772.1| valyl-tRNA synthetase [Lactobacillus reuteri F275] >gi|183224489|dbj|BAG25006.1| valyl-tRNA synthase [Lactobacillus reuteri F275] (884 aa)
Score = 1644, Expect = 0.0e+00, Identities = 350/859 (40%), Positives = 526/859 (61%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-----NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIE---DVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKI----SDEVINILNTAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           D+S KYD    E+    W   +   K +     + YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  LR+  IS  D  RD+ V  +++W     + I  QW  MG  +DY+ E FTL++  N+ V +VFV +YN GLIYR   ++NWD + ++A+S+IEVI K+ +   Y+++Y  +     N KDY+ +ATTRPET+F DE + VNP D+RYK+ + K  + PL N+EI+IIAD+YV  +FGTG++K TPAHD ND+++GK++ L  ++  NED T N  A  +E +   +AR   V+ L+    + KV+  + +VG SERT   VE  +S QWFVK+   ++  ++ Q +  ++ F P +FE     WM N++DW ISRQLWWGH+IP WY K + E+YVG + PK+ E + +D DVLDTWFSS LWP +T     TD+   K   FPTN LVTG+DIIFFWV RM+F SL      PFK+  + GLIRDE   KMSKSLGNG+DP DVI+KYG DALR FL++ S+PG+D+ +   K+ + W FINK+WN+ RYV MN  +       DK+  +L   D+WIL++ N    +  +QF+K+ F  + + + +F W+DFC+ YIE++K + +N     + +   +L Y++ + L + HP+ PFVT  L+ +      +SI++             ++ E    ++++I  +R    E   P +K +DI ++V N  L ++     D +    +   + I K  +   L    +     ++I   E L+  + E + +E   KEI  ++ E+ R    L N+ F+  AP++ +E E+ K  + + KL   ++ L S
  S:     5 DMSTKYDPAAVEEGRYQWWIDQGFFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTTLQDMIIRQKRMQGYDVLWVPGMDHAGIATQAKVEARLRKQGISRYDLGRDKFVQQVWDWKDEYADIIHQQWAKMGISVDYDRERFTLDEGLNKAVRKVFVDLYNKGLIYRGTYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFTDGTTFNGKDYIEIATTRPETMFGDEAVAVNPNDERYKDLVGKKVMVPLVNREIEIIADDYVTPEFGTGMVKITPAHDPNDFKVGKRHNLPELNTMNEDATMNENAGKYEGMDRFEAREAIVKDLQDQGYMLKVDPIVHSVGHSERTGVQVEARLSTQWFVKMKPLAEAALKNQDTDDRVNFVPERFEHTFTQWMENIHDWVISRQLWWGHRIPAWYNKQTGEVYVGMEAPKDAENWEQDKDVLDTWFSSALWPFSTMGWPNTDSADFK-RYFPTNTLVTGYDIIFFWVSRMIFQSLEFTGRAPFKNVLLHGLIRDEQGRKMSKSLGNGIDPMDVIKKYGVDALRWFLITGSTPGQDIRFSYTKMDAAWNFINKIWNASRYVIMNLGEMPAPVLPDKSKWDLA--DRWILSRLNATVKQVNEQFDKFEFGEAGRALYNFIWNDFCDWYIEMTKEKLNNGTDEEKNNTKNILGYVLDQTLKMLHPIMPFVTEKLWQSMP-HDGESIMVADYPVANAELDDPAATEQMNSLIELIKAVRNIRNEANAPMSKPVDILVKVDNDHLAQMLKDNRDYIERFCHPENLTIGKDVEAPRLAMSGILTGAEVYIPMAE-LVDLDEERDRME---KEIAKLEKEVERSQKKLGNEKFVNNAPEKVVEAERQKATEWQQKLAAAKERLQS 880
>gi|31544772|ref|NP_853350.1| hypothetical protein MGA_0338 [Mycoplasma gallisepticum R] >gi|81420730|sp|Q7NAR7|SYV_MYCGA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|31541618|gb|AAP56918.1| ValS [Mycoplasma gallisepticum R] (861 aa)
Score = 1644, Expect = 1.1e-180, Identities = 373/861 (43%), Positives = 541/861 (62%)
  Q:    12 DLSKKYDHK-ICEQQFSLWTTQKELNKKN--LKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKD-SKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWP-ITTTDALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDK-TPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFK-TKDSILLERL-DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           DL++KYDHK + E     W T    N+ +     N   +SI++PPPN+TG LH+GHA N +IQD ++R+  L      WI G DHAGIATQTK+E   R  +I+ K   R     ++++WSQ     I+NQ K++G  L+++ E FTL ++SN+ V  VFVK+Y  G I +  TLVNWD KL +AISNIEVI KE    L+YI+YYL +S DYL++ATTRPETI+ D  + VNP D+RY  Y N+  INPL NK I I+ DEY+D++FG+ VMKCTP HD NDY L KKY+L  +SC N DGT N  A+ F  L + +AR   V+ L   +   K E+  SNVG+S+R+N +V+P++S+QWF+  +++  ++ +L  +  +I+ +P +F   + NW+ +  DWCISRQL WGHQIP WY KD   E+ V    P ++  Y RD+DVLDTWFSS LWP I   D L  K+  A FP ++LVT +DI+FFWV RM+F S  LKK +PF    + GLI DEHN KMSKSL NGVDP  +I++YGADALRLFL S++SPGED+ Y  EK+ +   F+NKLWN  RY+++       D+ K T + L+  D WI+++FN+  +    +  +Y F +S K++ DF WDDF N YIEL+K +    ++K  + N + +K LI+ HP  PF+T  +Y+ F+F  +K SI+LE+     KI N  +   + +  +I KIR F     + N   +D+    L         ++   L T  +N++K   + L          +F++  ED    ++ + ++   ++K+  EI  ++ E+ R + +++NK+F +KAPKEK E E  K   ++ +LK  +  L+S K
  S:     9 DLNQKYDHKTVSEGVVDFWLTTDYANQDSDFCDPNAKPFSIIMPPPNLTGILHIGHAWNLSIQDLIVRYQKLVMGKINWIPGTDHAGIATQTKFESIQRTKEINYKKDDRTTHFNNIYQWSQESSQTIKNQAKSLGLALNWKKEKFTLSQESNKYVLDVFVKLYQQGYIVKKYTLVNWDTKLNTAISNIEVINKETTQKLHYIKYYLKDSNDYLVIATTRPETIYADVAVFVNPNDQRYLKYHNQMVINPLNNKLIPILVDEYIDMEFGSAVMKCTPGHDHNDYALSKKYQLEELSCINFDGTLNELALEFSGLDLYEARELIVKKLISEDKYVKFEEITSNVGYSDRSNVIVQPLLSKQWFLITTKFVDEIKKLVNNEDQIKIYPKRFLDTINNWLDHNQDWCISRQLVWGHQIPAWYHKDHPDEVIVSINSPGDD--YYRDSDVLDTWFSSALWPLICFDDGLDQKEFNANFPNSLLVTAYDIVFFWVLRMIFMSWLLKKSIPFHDLLLHGLILDEHNRKMSKSLNNGVDPIQIIDQYGADALRLFLTSNTSPGEDVSYNVEKINAAASFLNKLWNLARYLKL------IDQSKLTDQPLDSLDHWIIHRFNEVNAGIQDKLKEYRFALSNKQLSDFIWDDFANVYIELNK-KAQWSKAKFELANDIFRKFLIMLHPSVPFITEQIYNTFEFSDSKPSIILEKWPGLIKIENALD-HFDQIFNLIIKIRNFKQSFDLKNKDTLDL----LYKNEVSYIKDLTKYLKTENVNLIKISDQKLND--------LFLIATEDNEFYVVYTQDKTKIVDKLVVEIAKLEKEVERSSNIVNNKNFKKKAPKEKYEAELKKLSNYQEELKLKQDKLNSLK 861
>gi|89098946|ref|ZP_01171826.1| valyl-tRNA synthetase [Bacillus sp. NRRL B-14911] >gi|89086350|gb|EAR65471.1| valyl-tRNA synthetase [Bacillus sp. NRRL B-14911] (880 aa)
Score = 1643, Expect = 1.1e-180, Identities = 343/863 (39%), Positives = 528/863 (61%)
  Q:    10 NNDLS--KKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK----QDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           NN+L+   KYD +  E+ ++  W   K    K+   +K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E+ L+    S  D  R+  V + ++W +   ++IR QW  +G  LDY  E FT+++  ++ VN+VFV +Y  GLIYR + ++NWD   ++A+S+IEVI ++V+   Y++ Y L++    + VATTRPET+  D  + V+P+D+RY++ I K  + P+T +EI I+AD+YVD +FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N  A  +  L   D R + V+ L+ + +L K+E+ + +VG SER+ AVVEP +S QWFVK+   + + + LQ+   K+ F P +FE   + WM N+ DWCISRQLWWGH+IP WY K++ E+YV ++PP + E + +DNDVLDTWFSS LWP +T      ++  F    PT  LVTG+DIIFFWV RM+F  L    E PFK   I GL+RDE   KMSKSLGNGVDP DVI +YGAD+LR FL + SSPG+DL +  EKV++ W F NK+WN+ R+  MN +   F++          DKWIL + N+      +  ++Y F    + + +F WDDFC+ YIE++K        + +++   +L Y++   + L HP  PF+T  ++ N     +   + E    K+    K+++  ++ +++II  +R    E   P +K I +   +L P      D+V+  L   K  I +    ++++        +  +  +++  +++    G  N    I ++KKE + +  E+ R    LSN+ F++KAP++ IE E++K++ +  K   +E  L+  K
  S:     3 NNELAMPTKYDPQNIEKGRYEWWIGNKFFEAKD-DQSKEPYTIVIPPPNVTGRLHLGHAWDTTLQDILTRMKRMQGYDVLWLPGMDHAGIATQAKVEQKLKSEGKSRYDLGREAFVQETWKWKEEYADHIRQQWSKLGLGLDYSRERFTMDEGLSKAVNKVFVSLYKKGLIYRGEYIINWDPATKTALSDIEVIHQDVQGAFYHMNYPLADGSGSIEVATTRPETMLGDTAVAVHPEDERYQHLIGKNVVLPITGREIPIVADDYVDKEFGSGAVKITPAHDPNDFEIGNRHDLPRILVMNEDGTMNENAGKYNGLDRFDCRKQIVKDLQDSGVLFKIEEHMHSVGHSERSGAVVEPYLSTQWFVKMQPLADEAVALQQKEDKVNFIPDRFENTYLRWMENIRDWCISRQLWWGHRIPAWYHKETGEVYVDSEPPADAENWTQDNDVLDTWFSSALWPFSTMGWPDEENPDFKRYYPTASLVTGYDIIFFWVSRMIFQGLEFTGERPFKDVLIHGLVRDEQGRKMSKSLGNGVDPMDVIAQYGADSLRYFLSTGSSPGQDLRFSMEKVEATWNFANKIWNASRFALMNMAGLKFEDIDLTGEKSVADKWILTRLNETIETVTRLSDRYEFGEVGRVLYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDNTMRLLHPFMPFITEEIWQNLPHSGESITIAEWPKVKEEYTDKKAAGDMKLLVEIIRSVRNSRAEVNTPLSKKIKM---ILKPN----DDDVLATLTANKAYIERFCNPEELEISPAAATPDKAMTAVVSGAEIILPLEGLINIDEEIARLKKEWDKLNKEVERVQKKLSNEGFVKKAPEKVIEEERAKEKDYTEKRAIVEARLNELK 879
>gi|163763446|ref|ZP_02170508.1| Valyl-tRNA synthetase-like protein [Bacillus selenitireducens MLS10] >gi|160356240|gb|EDP82891.1| Valyl-tRNA synthetase-like protein [Bacillus selenitireducens MLS10] (879 aa)
Score = 1641, Expect = 2.1e-180, Identities = 333/861 (38%), Positives = 520/861 (60%)
  Q:     7 IKNNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNP----KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKL 867
           +    ++  KYD    E + +  W   K       K NK  Y+I++PPPNVTG LHLGHA + T+QD LIR   ++G  A W+ GMDHAGIATQ K E  LRE  +S  D  R++ +   + W +     IR+QW  MG  LDY  E FTL+   +E V +VFV++Y +GLIYR + ++NWD   ++A+S+IEVI K+V+   Y++RY L++ +  + +ATTRPET+  D  + V+PKD+RY++ I K  I P+  +EI+I+AD+YVD++FG+G +K TPAHD ND+E+G ++ L  +   +E G  N  A  +  +   + R + V  L+ +  L K+E    +VG SER+ AVVEP +S QWFVK+   +++ IELQK   K+ F P +FEK  ++W+ N+ DWCISRQLWWGH+IP W+ K++ E+YVG   P++ E + +D DVLDTWFSS LWP +T     +  +  +  +PT+ LVTG+DII+FWV RM+F   +  +  PFK   I GL+RD    KMSKSLGNGVDP DVI+KYGADALR FL + S+PG DL +  EKV++ W F NK+WN+ R+  MN  D  ++E          D+WIL + +   +   +  + Y F    + + +F WDDFC+ YIE++K     +    +++   VL Y++ + + L HP  PF+T  ++ +   +  DSI +              S++D   + +II  +R    E  +  +K I++ +   NP    +L +    +    N +++++    I    P+   ++ L  +     L G  +    ++++++E++ +  E++R    L N+ F+ KAP+  ++ EK+K++ +   L++ EK+
  S:     1 MNQETNMPPKYDPAATEAKWYDYWVKGKYFEATGDK-NKEPYTIVIPPPNVTGKLHLGHAWDTTLQDILIRVKRMQGYDALWLPGMDHAGIATQAKVEGKLREEGVSRHDLGREKFLEQSWAWKEEYAGFIRSQWAKMGLSLDYSKERFTLDDGLSEAVKEVFVRLYEEGLIYRGEYIINWDPDTKTALSDIEVIYKDVQGAFYHMRYPLADGEGSIEIATTRPETMLGDTAVAVHPKDERYQHLIGKKVILPIVGREIEIVADDYVDMEFGSGAVKITPAHDPNDFEIGNRHDLERVLVMDEGGKMNERAGKYAGMDRFECRKQLVADLQADGTLFKIEDHSHSVGHSERSGAVVEPYLSTQWFVKMGPLAEQAIELQKGEDKVHFVPERFEKTYLHWIENIRDWCISRQLWWGHRIPAWFHKETGELYVGRTAPEDAENWEQDEDVLDTWFSSALWPFSTMGWPNEEAEDFNRYYPTDALVTGYDIIYFWVARMIFQGQHFTERRPFKDVLIHGLVRDSEGRKMSKSLGNGVDPMDVIDKYGADALRFFLSTGSTPGNDLRFFWEKVEANWNFGNKIWNASRFALMNIGDMTYEEIDITGRKTIADEWILTRLHDTIAHTTKFIDAYEFGEVGRALYNFIWDDFCDWYIEMAKLPLNGDDEEQKKTTRSVLAYVLDRTMRLLHPFMPFITEEVWQHLPHE-GDSISIAPWPEASEGLAHPQSLKDMELIQEIIRSVRNTRSELNVAPSKGIELKINANNPAVLDQLKRGEAYIRKFCNPSELDMATDLI---APEKSMSSVLSGVELYMPLAGLLDLEEEVKRLEQELKRLDDEVTRVQKKLGNEGFVAKAPQNVVDAEKAKEQDY---LEQREKV 870
>gi|58337105|ref|YP_193690.1| valyl-tRNA synthetase [Lactobacillus acidophilus NCFM] >gi|81311486|sp|Q5FKW5|SYV_LACAC Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|58254422|gb|AAV42659.1| valine-tRNA ligase [Lactobacillus acidophilus NCFM] (879 aa)
Score = 1641, Expect = 2.1e-180, Identities = 364/850 (42%), Positives = 531/850 (62%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN---------RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER--LDFKKISN-LKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEV--LNPK--LFKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKL 861
           DL+ KY+    E+ ++  W  + +L K +     + YSI++PPPNVTG LHLGHA +  IQD LIRF  ++G    ++ GMDHAGIATQ K E  LR+      +  R+  V  +++W     N I++QW  +G  LDY  E FTL+K  ++ V +VFV++YN+GLIYR + ++NWD  L++A+S+IEVI K+ +   Y+++Y  ++   ++ +ATTRPET+F D  + V P D RYK+ + K  I PL  + I II D++VD +FGTG++K TPAHD ND+++G ++ L  I+  N+DGT N  A  +  +   + R   V+ L++   L KVE  + +VG SER+   VEP +S+QWFVK+   + KV+E QKS  K+ F P +FE+ L +WM N++DW ISRQLWWGH+IP WY K + E YVG + PK+ E + +D DVLDTWFSS LWP +T     TD    K   FPTN LVTG+DIIFFWV RM+F SL+  KE PFK   + GLIRDE   KMSKSLGNG+DP DVI+KYGADALR FLL+ ++PG+D  +   K+ + W FINK+WN  R+V M     N  ED  P ++ D       DKWI ++ N    E  + F +Y F  + ++  +F W+DFC+ YIE+SK          +   QE+ +W+L+    +IL L HP+ PFVT  L+ +   + K SI+     +  K+  N   +  ++ ++++I  +R    E   P +  IDI +++  LN K  L +  D V N L+  K+  V  DI++  L    V     IF+   E +    N    + K++KE + ++ E++RC   LSNK F++ AP+  +  EK K   +E +L
  S:     3 DLAPKYNPNEVEKGRYQEWLDE-DLFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTAIQDTLIRFKRMEGYDTLYLPGMDHAGIATQAKVEAKLRKQGKDRHEMGREAFVKQVWDWKDEYANIIKSQWSKLGLSLDYSRERFTLDKGLSKAVKKVFVQLYNEGLIYRGEYIINWDPTLETALSDIEVIHKDDKGAFYHVKYPFADGSGFVEIATTRPETMFGDTAVAVAPGDPRYKDIVGKELILPLVGRHIPIIEDQHVDPEFGTGLVKITPAHDPNDFQVGNRHNLKRINVMNDDGTMNEEAGKYAGMDRFECREALVKDLKEEGYLIKVEPIVHSVGHSERSGVQVEPRLSKQWFVKMKPLADKVLENQKSEGKVNFVPERFEQTLNHWMENVHDWVISRQLWWGHRIPAWYNKKTGETYVGEEAPKDIENWEQDPDVLDTWFSSALWPFSTMGWPDTDNPDFK-RYFPTNALVTGYDIIFFWVSRMIFQSLHFTKERPFKDVVLHGLIRDEQGRKMSKSLGNGIDPMDVIDKYGADALRWFLLNGTAPGQDTRFSYTKMDAAWNFINKIWNVSRFVIM-----NLPEDAKPAHMPDTSKFDLSDKWIFDRLNHTIGEVTRLFGEYQFGEAGREAYNFIWNDFCDWYIEISKVALNGDDEELKARKQENLIWILD----QILRLMHPIMPFVTEKLWLSMPHEGK-SIMTASYPVTHKEFENKTADQEMDFLIEVIKAVRNIRMEVNAPMSSEIDIMIKLDDLNNKHILDENVDYVENFLHPKKLE-VSADIEAPKLAKTAVIPGAQIFVPLTELV----NVDEELAKMEKEAKRLEDEVARCEKKLSNKGFVDHAPEAVVNKEKEKMADYESQL 865
>gi|194468301|ref|ZP_03074287.1| valyl-tRNA synthetase [Lactobacillus reuteri 100-23] >gi|194453154|gb|EDX42052.1| valyl-tRNA synthetase [Lactobacillus reuteri 100-23] (884 aa)
Score = 1636, Expect = 8.1e-180, Identities = 348/859 (40%), Positives = 526/859 (61%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-----NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIE---DVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKI----SDEVINILNTAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           D+S KYD    E+    W   +   K +     + YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  LR+  IS  D  RD+ V  +++W     + I  QW  MG  +DY+ E FTL++  N+ V +VFV +YN GLIYR   ++NWD + ++A+S+IEVI K+ +   Y+++Y  +     N KDY+ +ATTRPET+F DE + VNP D+RYK+ + K  + PL N+EI+IIAD+YV  +FGTG++K TPAHD ND+++GK++ L  ++  NED + N  A  +E +   +AR   V+ L+    + K++  + +VG SERT   VE  +S QWFVK+   ++  ++ Q +  ++ F P +FE     WM N++DW ISRQLWWGH+IP WY K + E+YVG + PK+ E + +D DVLDTWFSS LWP +T     TD+   K   FPTN LVTG+DIIFFWV RM+F SL      PFK+  + GLIRDE   KMSKSLGNG+DP DVI+KYG DALR FL++ S+PG+D+ +   K+ + W FINK+WN+ RYV MN  +       DK+  +L   D+WIL++ N    +  +QF+K+ F  + + + +F W+DFC+ YIE++K + +N     + +   +L Y++ + L + HP+ PFVT  L+ +      +SI++             ++ E    ++++I  +R    E   P +K +DI ++V N  L ++     D +    +   + I K  +   L    +     ++I   E L+  + E + +E   KEI  ++ E+ R    L N+ F+  AP++ +E E+ K  + + KL   ++ L S
  S:     5 DMSTKYDPAAVEEGRYQWWIDQGFFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTTLQDMIIRQKRMQGYDVLWVPGMDHAGIATQAKVEARLRKQGISRYDLGRDKFVQQVWDWKDEYADIIHQQWAKMGISVDYDRERFTLDEGLNKAVRKVFVDLYNKGLIYRGTYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFTDGTTFNGKDYIEIATTRPETMFGDEAVAVNPNDERYKDLVGKKVMVPLVNREIEIIADDYVTPEFGTGMVKITPAHDPNDFKVGKRHNLPELNTMNEDASMNENAGKYEGMDRFEAREAIVKDLQDQGYMLKIDPIVHSVGHSERTGVQVEARLSTQWFVKMKPLAEAALKNQDTDDRVNFVPERFEHTFTQWMENIHDWVISRQLWWGHRIPAWYNKQTGEVYVGMEAPKDAENWEQDKDVLDTWFSSALWPFSTMGWPNTDSADFK-RYFPTNTLVTGYDIIFFWVSRMIFQSLEFTGRAPFKNVLLHGLIRDEQGRKMSKSLGNGIDPMDVIKKYGVDALRWFLITGSTPGQDIRFSYTKMDAAWNFINKIWNASRYVIMNLGEMPAPVLPDKSKWDLA--DQWILSRLNATVKQVNEQFDKFEFGEAGRALYNFIWNDFCDWYIEMTKEKLNNGTNEEKNNTKNILGYVLDQTLKMLHPIMPFVTEKLWQSMP-HDGESIMVADYPVANAELDDPAATEQMNSLIELIKAVRNIRNEANAPMSKPVDILVKVDNDHLAQMLNDNRDYIERFCHPENLTIGKGVEAPRLAMSGILTGAEVYIPMAE-LVDLDEERDRME---KEIAKLEKEVERSQKKLGNEKFVNNAPEKVVEAERQKATEWQQKLAAAKERLQS 880
>gi|70726264|ref|YP_253178.1| valyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435] >gi|90108438|sp|Q4L703|SYV_STAHJ Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|68446988|dbj|BAE04572.1| valine-tRNA ligase [Staphylococcus haemolyticus JCSC1435] (876 aa)
Score = 1633, Expect = 1.7e-179, Identities = 346/849 (40%), Positives = 526/849 (61%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD-FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSI------LLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  KY+ +  E  ++  W  + +  K +   +K +Y+I++PPPNVTG LHLGHA + T+QD + R   ++G    ++ GMDHAGIATQ K +  L+E  IS  D  R++ +   + W +   + IR QW  +G  LDY  E FTL+   ++ V +VFV +YN G+IYR + ++NWD + ++A+S+IEVI ++V+ + Y+ +Y  ++   Y+ +ATTRPET+  D  +VVNP D RYK+ I K  I P+  +E+ I+ADEYVDI FG+G MK TPAHD ND+E+G+++ L  I   +E+G  N+ A  +  L   + R + VE L+  +L+ K+E+ + +VG SER+ AVVEP +S QWFVK+   +++ ++ QK+  +I F+P +FE     WM  + DW ISRQLWWGHQIP WY K++ EIYVG + PK+ + +V+D DVLDTWFSS LWP +T      DA   K   +PTN LVTG+DIIFFWV RM+F  L      PF    + GL+R E   KMSKSLGNGVDP DVIE+YGAD+LR FL + SSPG DL Y  EKV+S W FINK+WN  R+  MN  D F F++     NL   DKWIL + N+          KY F    + + +F WD+FC+ YIE+SK        + +++   VL+Y + +I+ + HP  PFVT  ++ +   + +  +      + E L F++     + +++ +++II  +R    E   P +K I I++    E +   L +  D +    N + + I   D     P+      +I    +L  E L+  + E   I +++KE++ ++ E+ R +  LSN++F+ KAP++ I  EK K+++++ K
  S:     2 NMEPKYNPREVEAGRYEEWV-KNDYFKPSEDKSKETYTIVIPPPNVTGKLHLGHAWDTTLQDIITRMKRMQGYDTLYLPGMDHAGIATQAKVDAKLKEQGISRHDIGREKFLEHAWSWKEEYASFIRQQWAKLGLGLDYSRERFTLDDGLSKAVRKVFVDLYNKGIIYRGERIINWDPEARTALSDIEVIHEDVQGHFYHFKYPYADGDGYIEIATTRPETMLGDTAIVVNPNDDRYKDVIGKKVILPIVGRELPILADEYVDIDFGSGAMKVTPAHDPNDFEIGQRHSLENIIVMDENGKMNDKADKYAGLDRFECRKQLVEDLKAQDLVIKIEEHVHSVGHSERSGAVVEPYLSTQWFVKMKPLAQRSLDNQKTDDRIDFYPPRFENTFNRWMEEIRDWTISRQLWWGHQIPAWYHKETGEIYVGEEAPKDIDNWVQDEDVLDTWFSSALWPFSTLGWPNIDADDFK-RYYPTNALVTGYDIIFFWVARMIFQGLEFTDRRPFNDVLLHGLVRAEDGRKMSKSLGNGVDPMDVIEEYGADSLRYFLATGSSPGHDLRYSTEKVESVWNFINKIWNGARFSLMNIGDEFKFEDIDLTGNLSLADKWILTRLNETIETVTNLSEKYEFGEVGRALYNFIWDEFCDWYIEMSKIPMNGEDEAQKQTTRSVLSYTLDQIMRMLHPFMPFVTEKIWQSLPHEGETIVKASWPTVREELVFEE----SKQTMQQLVEIIKSVRQSRVEVNTPLSKAIPIYIQAKDENIKATLIENEDYIHKFCNPSDLTI---DTHIDIPEKAMTAVVIAGKVVLPLEGLIDMDKE---IARLEKELDKLQKELDRVDKKLSNENFVNKAPEKVINEEKEKQQRYQEK 863
>gi|116493039|ref|YP_804774.1| valyl-tRNA synthetase [Pediococcus pentosaceus ATCC 25745] >gi|116103189|gb|ABJ68332.1| valyl-tRNA synthetase [Pediococcus pentosaceus ATCC 25745] (888 aa)
Score = 1625, Expect = 1.7e-178, Identities = 349/861 (40%), Positives = 525/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS------NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK-----NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW-----VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-LDFKKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT----------AKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           D+S KYD +  E  ++  W  Q +  K N       YSI++PPPNVTG LHLGHA + T+QD LIR   + G    WI GMDHAGIATQ K E  LRE  +S  D  R++ V  ++EW     + I  QW  MG  LDY+ E FTL++  ++ V +VFV +Y  GLIYR + ++NWD + ++A+S+IEV  ++ +   Y+++Y+ +      N K+Y+ +ATTRPET+F D  + V+P D+RYK+ + K  I PL  + + IIAD+YVD +FGTG++K TPAHD ND+++G ++ L  I+  NED + N  A  +E +   +AR   V+ LE+ + + K++  + +VG SERT   VE  +S QWFVK+ + ++  ++ QK+  K+ F P +FE     WM N +DW ISRQLWWGHQIP WY K + E+YVG + P++ E + +D DVLDTWFSS LWP TT        A     FPT+ LVTG+DIIFFWV RM+F SL    + PFK   + GLIRDE   KMSKSLGNG+DP DVI+KYGADALR FL + S+ G+DL +  +K+ S W FINK+WN+ RYV M     N D+ + PK      L   DKWIL++ NK   +    F+ Y+F  + + +  F WDDFC+ YIE+SK   + ++ +       VL Y++ + L L HP+ PFVT  ++ +     +  +  E  +   ++ N   E+ ++ ++ +I  +R    E   P +  +D+ ++  + KL ++ +E  + ++           A +   K  + ++  D      L  ++N ED          I +++KE    + E++R    L N+ F+  AP+E +  E++K+  +E KL+  ++ L+  K
  S:     6 DMSTKYDPQSVEHGRYQKWVEQGQF-KPNGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDMLIRQKRMLGYDTVWIPGMDHAGIATQAKVEAKLREQGVSRYDLGREKFVDQVWEWKDEYADTIHQQWAKMGLSLDYDRERFTLDEGLSKAVKKVFVTLYEKGLIYRGEYIINWDPQARTALSDIEVEHQDDQGAFYHVKYFFADEGFEFNGKNYIEIATTRPETMFGDVAIAVHPSDERYKDIVGKEVILPLQGRHLPIIADQYVDPEFGTGMVKITPAHDPNDFQVGNRHDLKRINTMNEDASMNENAGKYEGMDRFEARKAMVKDLEEQDYMIKIDPIVHSVGHSERTGVQVESRLSTQWFVKMDKLAQMALDNQKTDDKVNFIPERFEHTFNQWMENAHDWVISRQLWWGHQIPAWYNKQTGEVYVGEEAPQDVENWEQDPDVLDTWFSSALWPFTTMGWPDENSADFKRYFPTSTLVTGYDIIFFWVARMIFQSLEFTGKRPFKDVLLHGLIRDEQGRKMSKSLGNGIDPMDVIDKYGADALRWFLSNGSTAGQDLRFSYDKMDSAWNFINKIWNASRYVIM-----NLDQVEQPKLPELSQLTLADKWILSRLNKTVEQVTHFFDVYDFGEAGRAMYTFIWDDFCDWYIEMSKEILNGEDEQAKVNTQNVLAYVLDQTLRLLHPVMPFVTEKIWLSMPHDGQSLVNAEYPVVHAELENQDAEAGMDHLIGLIKAVRNIRSEAGAPMSSPVDLLIKTDSTKLMQLFNENRDYIDRFCHPANFELGADVEAPKLSMSAVITDGEIYIPLAELVNLED---------EIARLEKEEAKYEQEVNRVVKKLQNERFVSNAPEEVVAAERAKQTDYEGKLEATKRRLADIK 884
>gi|192813796|ref|ZP_03042453.1| valyl-tRNA synthetase [Geobacillus sp. Y412MC10] >gi|192797385|gb|EDV73908.1| valyl-tRNA synthetase [Geobacillus sp. Y412MC10] (889 aa)
Score = 1623, Expect = 2.9e-178, Identities = 325/842 (38%), Positives = 512/842 (60%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-----TKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED--VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKI----SDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           ++   YD K  EQ++  +  +    +   + +   Y+I++PPPNVTG LH+GHAL+ T+QD LIR   ++G  A W+ G DHAGIATQTK E+ LRE  ++  D  R++ +  ++EW     N IR+QW  +G  LDY  E FTL++  +E V +VFVK+Y+ GLIYR K ++NWD   ++A+S+IEV  KEV  +LY+++Y L +    + VATTRPET+  D  + V+P+D+RYK+ I K  + P+  +EI +IADEYV+  FG+G +K TPAHD ND+E+G ++ L  I+  +E GT N +A  ++ L  A+ R + V  ++++ +L ++E  +  VG SER+ AVVEP +S QWFVK+   ++  ++ QKS K + F P +FE+  ++WM N+ DWCISRQLWWGH+IP WY + + E+ V       +    ++   +D DVLDTWFSS LWP +T     L S+D    +PT+VLVTG+DII FWV RM+F  L    ++PFK   I GL+RD    KMSKSLGNG+DP +VIE+YGADA+R  + + S+PG+DL +  E+V+    F NK+WN+ R+  MN   F   +      L   D+WIL++ N+   +  +  + Y F  + + + +F WDD C+ YIE +K        + ++    VL Y++ + + L HP  PF++  ++ +   + +  +L     + +     E+  E   ++ +I  +R    E  +P +K +++ L+ ++  +  I    SD +    NT++    +  +    PD      +  +     L G  + A  I +++KEI+ + SE+ R    L+N  F+ KAP++ IE E++K
  S:    11 EMPTTYDPKAAEQKWYPYWKEGGFFEAGKRPDAEPYTIVIPPPNVTGMLHIGHALDFTLQDILIRVKRMQGYDALWLPGSDHAGIATQTKVEQKLREEGVTRYDLGREKFLEKVWEWKDLYANTIRDQWSKIGLSLDYSRERFTLDEGLSEAVREVFVKLYDKGLIYRGKRIINWDPAARTALSDIEVEYKEVNGHLYHLQYPLKDGSGSITVATTRPETMLGDTAVAVHPEDERYKDMIGKTLVLPIVGREIPVIADEYVEKDFGSGAVKITPAHDPNDFEMGLRHDLPQITVMDESGTMNEFAGKYQGLDRAECRKQIVSDMKESGVLLRIEDHVHQVGHSERSGAVVEPYLSTQWFVKMQPLAEAAVDAQKSGKGVNFVPDRFERTYLHWMENVRDWCISRQLWWGHRIPAWYSESTGEVVVAMNEEEARAKLGKDDLRQDEDVLDTWFSSALWPFSTMGWPDLDSEDFKRYYPTSVLVTGYDIIPFWVSRMIFQGLEFTGQMPFKDTLIHGLVRDSEGRKMSKSLGNGIDPLEVIEQYGADAMRYMISTGSTPGQDLRFRWERVEQARNFANKIWNASRFALMNLEGFTAADIDISGELGTADRWILHRLNETSRDITRLIDAYEFGETGRLLYNFIWDDLCDWYIEFAKLSLYGEDQAAKKKTQSVLAYVLDRTMRLIHPFMPFISEEIWQHLPHEGETVMLASWPTYDEAFENTEAVTEMNLLMDVIRAVRNIRAEVNVPMSKKVELQLKPVSGHIAGIIDRNSDYIRRFCNTSE---YESSLALEAPDKAMTAVVTGVEMYLPLAGLIDIAQEITRLEKEIQHLNSEVERVEKKLNNPGFVSKAPEKVIEEERAK 869
>gi|28378904|ref|NP_785796.1| valyl-tRNA synthetase [Lactobacillus plantarum WCFS1] >gi|81631055|sp|Q88UX7|SYV_LACPL Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|28271741|emb|CAD64647.1| valine--tRNA ligase [Lactobacillus plantarum WCFS1] (889 aa)
Score = 1621, Expect = 4.7e-178, Identities = 347/857 (40%), Positives = 518/857 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY------YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW-----VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-LDFKKISN-LKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           D+  KYD    E  ++  W  Q +L K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ +  +++W     + I+ QW  MG  LDY  E FT++   ++ V +VFV +YN GLIYR + ++NWD + ++A+S+IEVI K+ +   Y+++Y      Y  N K Y+ +ATTRPET+  D  + VNP D RYK  + K  I PL  +EI IIAD YVD +FGTG++K TPAHD ND+++G ++ L  I+  N+D + N  A  +E +   +AR   V+ LE  +L+ K++  + +VG SERT+  VE  +S QWFVK+   +++ ++ Q+    + F P +FE     WM N++DW ISRQLWWGH+IP WY K + E YVG   PK+ E + +D DVLDTWFSS LWP +T     TDA   K   FPTN LVTG+DI+ FWV RM+F SL      PFK+  + GLIRDEH  KMSKSLGNG+DP DVIEKYGADALR FL + S+ G+D+ +   K+ + W FINK+WN+ RYV MN    +  E     +    DKWIL++ N    +    F+K++F  + + + +F W+DFC+ YIE+SK   +  +++       VL Y++ +IL L HP+ PFVT  ++ +     +  ++    +D  +  +   ES +  ++++I  +R    E     +  +D+ ++  N +L   FK +++ I      K   +  D+ +  L    V ++  ++I   E L+  + E   +EK + + E   SE++R    L N+ F+  AP++ +  EK K   ++ KL  L++ L
  S:     8 DMPTKYDPTAVEAGRYQTWLDQ-DLFKPSGDKKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEAKLREQGISRYDLGREKFIQQVWDWKDEYASIIKQQWAKMGLSLDYSRERFTMDDGLSDAVKKVFVDLYNKGLIYRGEYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFADKDYTFNGKHYIEIATTRPETMMGDTAVAVNPSDDRYKELVGKKVILPLAEREIPIIADAYVDPEFGTGMVKITPAHDPNDFKVGNRHDLKRINTMNDDASMNANAGKYEGMDRFEARKAMVKDLEDQDLMIKIDPIVHSVGHSERTDVQVEARLSTQWFVKMKPLAEQALKNQEGDDAVDFIPKRFEDAFKQWMENIHDWVISRQLWWGHRIPAWYNKTTGETYVGVDGPKDPENWEQDPDVLDTWFSSALWPFSTMGWPNTDAEDFK-RYFPTNTLVTGYDILPFWVSRMIFQSLEFTGRRPFKNVLLHGLIRDEHGVKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSTAGQDVRFSYTKMDAAWNFINKIWNASRYVIMNLGTMDKPELPAASDWTLADKWILSRLNATVKQVTTTFDKFDFGEAGRALYNFIWNDFCDWYIEMSKEVLTGDDAQAKANTQNVLAYVLDQILRLLHPIMPFVTEKIWLSMPHVGESLVVAAYPVDHPEFDDETAESDMASLIELITAVRSIRAEANAKMSSAVDLLIKTDNTRLQAVFKANEDYIQRFAHPKTLSIGADVVAPKLAMTQVISDAEVYIPLAE-LVDLDEEVKKLEKEQAKFE---SEVARATKKLGNERFVANAPEDVVNSEKEKLADNQTKLAALKQRL 882
>gi|90962047|ref|YP_535963.1| valyl-tRNA synthetase [Lactobacillus salivarius UCC118] >gi|90821241|gb|ABD99880.1| Valyl-tRNA synthetase [Lactobacillus salivarius UCC118] (886 aa)
Score = 1621, Expect = 4.9e-178, Identities = 350/861 (40%), Positives = 527/861 (61%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-----NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL-----WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-LDFKKISN-LKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNP---KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           ++S KYD    E  ++  W  +K L K N       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ V  ++EW     + I  QW  +G  LDY+ E FTL+   ++ V +VFV +Y  GLIYR + ++NWD K ++A+S+IEVI K+ +   Y+++Y  +     N K+Y+ +ATTRPET+  D  + VNP D+RYK+ + K  + PL  + I IIAD+YVD +FGTG++K TPAHD ND+E+G ++ L  I+  NED T N  A  +E L   +AR   V  LE+   + K+E  + +VG SERT   VE  +S QWFVK+   ++  ++ Q++  ++ F P +FE     WM N++DW ISRQLWWGHQIP WY K++ EIYVG + P++ E + +D+DVLDTWFSS LWP +T     ++       FPTN LVTG+DIIFFWV RM+F S+   K  PFK+  I GLIRDE   KMSKSLGNG+DP DVI+KYGADALR FL + S+PG+D+ +   K+ + W FINK+WN+ R+V MN  SD      +  +  +  DKWIL++ N    +  + F+ + F  + + + +F W+DFC+ YIE++K   + ++ KL      +L Y++ +IL L HP+ PFVT  ++ +        ++ E  ++  +  N + E  +++++++I  +R    E   P +  IDI ++  +    K+F+ + + IN     K   +  DI++  P     + +      L   DL+  N E   I +++KE + ++SE++R    L N+ F+  AP+  +  EK K   ++ +L   E  +   K
  S:     6 EMSTKYDPSQVEPGRYKEWI-EKGLFKPNEDKEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDMIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAEDGISRYDLGREKFVEKVWEWKGEYADIIHQQWAKLGLSLDYDRERFTLDDGLSKAVRKVFVTLYKKGLIYRGEYIINWDPKARTALSDIEVIHKDDKGAFYHVKYPFADDTTFNGKNYIEIATTRPETMMGDVAVAVNPDDERYKDIVGKTLVLPLQGRHIPIIADQYVDPEFGTGMVKITPAHDPNDFEVGNRHNLERINTMNEDATMNANAGKYEGLDRFEARKAIVADLEEQGYMLKIEPIVHSVGHSERTGVQVESRLSTQWFVKMKPLAEAALKNQETDDRVDFVPPRFEHTFTQWMENVHDWVISRQLWWGHQIPAWYHKETGEIYVGEEAPEDIENWEQDSDVLDTWFSSALWPFSTMGWPDTESPDFKRYFPTNTLVTGYDIIFFWVSRMIFQSVEFTKRRPFKNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIDKYGADALRWFLSNGSAPGQDVRFSYTKMDAAWNFINKIWNASRFVIMNLDSDVELSLPEASE-WQLADKWILSRLNDTVRDVTRLFDSFEFGEAGRALYNFIWNDFCDWYIEMAKENLTGEDEKLKKNTQRILRYVLDQILRLMHPIMPFVTEKIWLSMPHDGASLVVAEYPVEHTEFDNQVAEKDMDNLIELIKAVRNSRSEVNAPMSSAIDILIKTKDDDTRKVFENNVDYINRFCHPKRLEIAADIEA--PKLAMTSVITGAEVYLPLADLIDLNEE---ISRLQKEAKKLESEVTRGEKKLGNEKFVANAPEAVVAKEKEKLANYKQQLAATESRIEELK 883
>gi|409360|gb|AAA57558.1| valyl-tRNA synthetase (901 aa)
Score = 1618, Expect = 9.1e-178, Identities = 345/860 (40%), Positives = 514/860 (59%)
  Q:     9 NNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKS-SKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKD----SILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILN---TAKINIVKQDIKSLK--PDYVENNYLIFI-LNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           ++  L+ KYDHK  E+ ++  W  +        K  K  YSI++PPPNVTG LH+GHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  LR+  IS  D  R++ V  ++EW       I  QW  MG  LDY  E FTL+K  N+ V +VFV +YN GLIYR + +VNWD + ++A+S+IEVI K+ +   Y+++Y  ++   Y+ +ATTRPET+  D  + V+P D+RYK+ +    I PL N++I II D YVD +FGTG +K TPAHD ND+++G ++ L  I+  N+DGT N  A  ++ +   +AR   V  L+K  LL KVE  + +VG SERT   VE  +S QWFVK+   ++  I+ Q+   KK+ F P +FE   + WM N++DW ISRQLWWGHQIP WY K + E YVG + PK+ E + +D DVLDTWFSS LWP +T     TDA   K   +PT+ LVTG+DII FWV RM+F  L+   + PF++  I GL+RDE   KMSKSLGNG+DP DVIEKYGADALR FL++ + PG+D  +  ++V++ W FINK+WN  R+V MN  D +  +   P   +  DKW+  + N+   + +    ++ F    + + +FTW+   + Y+E+SK     +    + +K   L Y + +IL L HP+ PFV   L+       K     S  +    F+       S+++ ++ +I  +R    E   P    +DI +++ +P L  I ++  + ++    +K   V  D+   K     V     IF+ LN  +L+  + E   + K  K++E    EI+R +  L+N+ F+ KAP+  +  +++K+   E +L   ++ L
  S:    23 SDETLAPKYDHKAVEEGRYQEWLDEDVFKPSGDKKAK-PYSIVIPPPNVTGKLHMGHAWDTTLQDIVIRQKRIEGFDTLWLPGMDHAGIATQAKVEAKLRKEGISRYDLGREKFVQKVWEWKDEFAKTIHGQWAKMGLSLDYSRERFTLDKGLNQAVRRVFVDLYNQGLIYRGEYIVNWDPQARTALSDIEVIHKDDKGAFYHVKYPFADGSGYIEIATTRPETMMGDTAVAVHPGDERYKDMVGTELILPLANRKIPIIEDAYVDPEFGTGAVKITPAHDPNDFQVGNRHDLKRINTMNDDGTMNENAGKYQGMDRFEARKAMVADLDKAGLLLKVEPIVHSVGHSERTGVQVEARLSTQWFVKMKPLAEAAIKAQQEPDKKVTFVPERFEHTYLQWMENIHDWVISRQLWWGHQIPAWYNKQTGETYVGMEAPKDIENWKQDPDVLDTWFSSALWPFSTMGWPNTDAPDYK-RYYPTDTLVTGYDIIPFWVARMIFQGLHFTHQRPFQYTLIHGLMRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLITGNKPGQDTRFSYKQVEAAWNFINKIWNISRFVMMNLGDLDTPQQPDPSTFDLSDKWLFAQLNETIKQVMDLSARFEFGEMGRTLYNFTWNVLADWYVEMSKEVLYGDDEQAKAAKRVNLAYALDQILRLLHPVMPFVHGKLWLALPHTGKSIVTASYPVANTAFENAD--ATSAMDAIIALIRGVRGIRKEAGAPLKTKVDILVKLTDPALKPIFEQNFDFIDRFVNSKAFTVGTDVAEPKMAGSAVITGATIFVPLN--ELIDLDEEKAKLTKDAKKLE---QEIARIDKKLNNQGFLSKAPEAVVAEQRTKRSDFEDQLTSTKQRL 895
>gi|90101527|sp|P36420|SYV_LACCA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (883 aa)
Score = 1618, Expect = 1.1e-177, Identities = 345/860 (40%), Positives = 514/860 (59%)
  Q:     9 NNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKS-SKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKD----SILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILN---TAKINIVKQDIKSLK--PDYVENNYLIFI-LNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           ++  L+ KYDHK  E+ ++  W  +        K  K  YSI++PPPNVTG LH+GHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  LR+  IS  D  R++ V  ++EW       I  QW  MG  LDY  E FTL+K  N+ V +VFV +YN GLIYR + +VNWD + ++A+S+IEVI K+ +   Y+++Y  ++   Y+ +ATTRPET+  D  + V+P D+RYK+ +    I PL N++I II D YVD +FGTG +K TPAHD ND+++G ++ L  I+  N+DGT N  A  ++ +   +AR   V  L+K  LL KVE  + +VG SERT   VE  +S QWFVK+   ++  I+ Q+   KK+ F P +FE   + WM N++DW ISRQLWWGHQIP WY K + E YVG + PK+ E + +D DVLDTWFSS LWP +T     TDA   K   +PT+ LVTG+DII FWV RM+F  L+   + PF++  I GL+RDE   KMSKSLGNG+DP DVIEKYGADALR FL++ + PG+D  +  ++V++ W FINK+WN  R+V MN  D +  +   P   +  DKW+  + N+   + +    ++ F    + + +FTW+   + Y+E+SK     +    + +K   L Y + +IL L HP+ PFV   L+       K     S  +    F+       S+++ ++ +I  +R    E   P    +DI +++ +P L  I ++  + ++    +K   V  D+   K     V     IF+ LN  +L+  + E   + K  K++E    EI+R +  L+N+ F+ KAP+  +  +++K+   E +L   ++ L
  S:     5 SDETLAPKYDHKAVEEGRYQEWLDEDVFKPSGDKKAK-PYSIVIPPPNVTGKLHMGHAWDTTLQDIVIRQKRIEGFDTLWLPGMDHAGIATQAKVEAKLRKEGISRYDLGREKFVQKVWEWKDEFAKTIHGQWAKMGLSLDYSRERFTLDKGLNQAVRRVFVDLYNQGLIYRGEYIVNWDPQARTALSDIEVIHKDDKGAFYHVKYPFADGSGYIEIATTRPETMMGDTAVAVHPGDERYKDMVGTELILPLANRKIPIIEDAYVDPEFGTGAVKITPAHDPNDFQVGNRHDLKRINTMNDDGTMNENAGKYQGMDRFEARKAMVADLDKAGLLLKVEPIVHSVGHSERTGVQVEARLSTQWFVKMKPLAEAAIKAQQEPDKKVTFVPERFEHTYLQWMENIHDWVISRQLWWGHQIPAWYNKQTGETYVGMEAPKDIENWKQDPDVLDTWFSSALWPFSTMGWPNTDAPDYK-RYYPTDTLVTGYDIIPFWVARMIFQGLHFTHQRPFQYTLIHGLMRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLITGNKPGQDTRFSYKQVEAAWNFINKIWNISRFVMMNLGDLDTPQQPDPSTFDLSDKWLFAQLNETIKQVMDLSARFEFGEMGRTLYNFTWNVLADWYVEMSKEVLYGDDEQAKAAKRVNLAYALDQILRLLHPVMPFVHGKLWLALPHTGKSIVTASYPVANTAFENAD--ATSAMDAIIALIRGVRGIRKEAGAPLKTKVDILVKLTDPALKPIFEQNFDFIDRFVNSKAFTVGTDVAEPKMAGSAVITGATIFVPLN--ELIDLDEEKAKLTKDAKKLE---QEIARIDKKLNNQGFLSKAPEAVVAEQRTKRSDFEDQLTSTKQRL 877
>gi|172058142|ref|YP_001814602.1| valyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] >gi|171990663|gb|ACB61585.1| valyl-tRNA synthetase [Exiguobacterium sibiricum 255-15] (878 aa)
Score = 1615, Expect = 2.1e-177, Identities = 338/857 (39%), Positives = 510/857 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE--SKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +  KYD +  E+++  +  + E  K +    K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    ++ GMDHAGIATQ K E+ LR    S  +  R++ +   + W +   + IR QW  +G  LDY  E FTL++  +E V +VFVK+Y  GLIYR + +VNWD   ++AIS+IEVI K++E   Y+  Y L++   ++ +ATTRPET+  D  + VNPKD+RY++ + K    P+  +EI I+ADEYVD++FGTGV+K TPAHD ND+E+G ++ L  +   NEDGT N  A  +E +   + R + VE L+++ +L KVE  + +VG SER++A+VEP +S QWFVK+   ++K ++ Q+   KI F P +FE   + WM N+ DWC+SRQLWWGH+IP WY K++ E+YVG + P + E + +DNDVLDTWFSS LWP +T     +        FPT+ LVTG+DII FWV RM+F S     E PF    I GLIRD    KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG DL +  EK+++ W F NKLWN+ R+  MN      ++          D+WIL + N    +  +  +KY F  + + +  F W+DFCN YIE++K   + ++  +KL    +L Y + +I+ L HP  PF+T  ++ +   + +           + LDF K       + E V  +I  +R    E   P +K I + +   + ++    + +   +     A   +V++++ +  P+   +  +      +   DL+    E   I ++ KE+     E+ R    L+N  F+ KAP   IE E++K + ++ K   +E  +S
  S:     6 MPTKYDPQATEEKWYDFWMKGEYFKADQDPEKAPYTIVIPPPNVTGKLHLGHAWDTTLQDMLTRMKRMQGFDVLYLPGMDHAGIATQAKVEQKLRAEGKSRLEMGREKFLEQSWAWKEEYASTIREQWSKLGLGLDYSRERFTLDEGLSEAVQEVFVKLYEKGLIYRGEYIVNWDPATKTAISDIEVIYKDIEGAFYHFSYPLTDGSGHVELATTRPETMLGDTAIAVNPKDERYEHLVGKTITLPIVGREIPIVADEYVDMEFGTGVVKITPAHDPNDFEVGNRHDLPRVLVMNEDGTMNENAGKYEGMDRFECRKQIVEDLKESGVLIKVEPHLHSVGHSERSDAIVEPYLSLQWFVKMEPLAEKALQEQQGEDKINFIPQRFENTYVRWMENIRDWCVSRQLWWGHRIPAWYHKETGEVYVGKEAPADLENWEQDNDVLDTWFSSALWPFSTMGWPNEGAADYQKYFPTSTLVTGYDIIAFWVSRMIFQSYEFTGERPFNDVLIHGLIRDSEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLTTGSTPGNDLRFYWEKIEATWNFSNKLWNASRFALMNMDRLTHEQIDLSGEKSLADQWILTRLNTTIDDVTRLSDKYEFGEAGRVLYHFIWEDFCNWYIEMAKLPLNGEDEAAKLTTRSILAYTLDQIMRLMHPFMPFITEEIWQHLPHEGETVTRAAWPTRNDSLDFPKAV----PAFEAVQNVIRSVRNIRAEVNAPMSKQIQLMIATSDDQVQHDLETNLSYLKKFTNASELLVERNMTA--PEKAMSAIVTGAELFIPLADLINIEEE---IARLNKELVKYTKEVERVEKKLNNPGFVGKAPAHVIEEEQAKAQDYKEKRAAVEVRIS 874
>gi|171920261|ref|ZP_02691263.2| valyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902665|gb|EDT48954.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 1 str. ATCC 27813] (874 aa)
Score = 1614, Expect = 2.7e-177, Identities = 385/855 (45%), Positives = 548/855 (64%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKS-SKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSK---DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFD------KWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK---NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNP-----KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEAN-----NIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           LSKKY  K  E    L+  +  L K  + + K  ++I+LPPPNVTG+LH+GHA + T+ D L+R+  LKG  ++ I G DHAGIATQTK+EK L+ N  +N+ +  R+  +  L  W     N I  QW  +G  LDY N  FTL+    + V +VFVKM+N+ +IYR K LVNWDI+L++AISNIEVI KEVE  LYYI+Y   + KD+++VAT+RPET+F D+ LV+NPKDKRY +  NK  INP+ N E+ +I D+Y+DI+FGTGVMKCTPAHDFNDYEL KK+ L II+  N DGT N     F+ L   +AR   ++ L+KNN L KVE   ++VGFSERTN +VEP +S QWF+K+    K  I++Q   + K+ F+P +F K L+ W+ N  DWCISRQLWWGHQIPVWY K + +IY  T PPK+ E +++D DVLDTWFSSG+WP+ TT    +    D  FPT+++VTG DI+FFWV RMM FS YL ++ PFK   I GLIRD    KMSKSLGNG+DP D+I+KYG DA+RLF  S ++ GEDL +  E++ + W ++NK+WN  +Y+E      N DE     N ED D      KWIL + +K   E  +  +KYN +V+ K + DF W+ F + Y+E +K      + +   +  + Y+  KILI+  P  P ++  ++     +T +SILL+    ++F+  + + +   + +L+    IR    E  I NNK I++  E+++P     K       ++ IL  A+IN +K+           NNY   ++  + +L ++ E        ++K  +++ ++++EI R   +L+N  FI KAP + I  EK+K    K++H   LK L  L
  S:     5 LSKKYSFKEVEANKLLFWQENNLFKAQINSTKKPFTIVLPPPNVTGHLHIGHAYDFTLSDILMRYKKLKGYDSFIIPGTDHAGIATQTKFEKNLKVNAQTNRFNLGRELFLEKLKIWKDEQINYIHKQWNALGLGLDYSNYLFTLDPIVVQTVREVFVKMFNEHIIYRDKKLVNWDIQLKTAISNIEVIHKEVEQKLYYIKYLSQDQKDFVVVATSRPETMFGDKYLVINPKDKRYFHLHNKIFINPINNIEMTVILDDYIDIEFGTGVMKCTPAHDFNDYELAKKHNLEIINIMNADGTLNEKCGEFKGLDRLEARSLIIDKLQKNNHLLKVESYRTSVGFSERTNEIVEPYLSHQWFIKMDSLIKDTIKMQDDCNNKVDFYPNRFNKTLLTWLKNTEDWCISRQLWWGHQIPVWYHKKTNQIYCDTIPPKDLENWIQDEDVLDTWFSSGMWPLLTTKWNYNSHFFDRYFPTSLIVTGMDILFFWVSRMMNFSQYLVEKKPFKDVLIHGLIRDSQGRKMSKSLGNGIDPFDIIDKYGLDAMRLFFASCTTIGEDLNFSTERLGANWNYLNKIWNIAKYIE------NLDEINDNLNFEDVDKFCDVNKWILTELSKLTLEINKNMDKYNLVVATKYLYDFIWNTFASYYLEYTKVLLQDLTLKNETIKTIRYVFNKILIMLQPFAPNISEEIWLCLN-QTNNSILLQEYPIINFEFETIIIDKIAKIILE----IRKLRLEENI-NNK-INLCFELISPNDAFYKSKIKLVNLLLILVNAEINEIKKT--------SSNNYTYELVIDDFILKTSYEKPIDYVFQMKKASEQLNYLENEIQRATNLLNNSGFINKAPAQLIIKEKNKLINLKKEHANLLKTLTDL 869
>gi|13357827|ref|NP_078101.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762145|ref|YP_001752350.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508747|ref|ZP_02958221.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701957|ref|ZP_02971594.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|12585354|sp|Q9PQM4|SYV_UREPA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|11271419|pir||E82913 valyl-tRNA synthetase UU267 [imported] - Ureaplasma urealyticum >gi|6899238|gb|AAF30676.1|AE002123_9 valyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827722|gb|ACA32984.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675679|gb|EDT87584.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700717|gb|EDU18999.1| valyl-tRNA synthetase [Ureaplasma parvum serovar 6 str. ATCC 27818] (874 aa)
Score = 1613, Expect = 4.3e-177, Identities = 383/855 (44%), Positives = 546/855 (63%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKS-SKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSK---DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFD------KWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK---NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNP-----KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEAN-----NIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           LSKKY  K  E    L+  +  L K  + + K  ++I+LPPPNVTG+LH+GHA + T+ D L+R+  LKG  ++ I G DHAGIATQTK+EK L+ N  +N+ +  R+  +  L  W     N I  QW  +G  LDY N  FTL+    + V +VFVKM+N+ +IYR K LVNWDI+L++AISNIEVI KEVE  LYYI+Y   + KD+++VAT+RPET+F D+ LV+NPKDKRY +  NK  INP+ N E+ +I D+Y+DI+FGTGVMKCTPAHDFNDYEL KK+ L II+  N DGT N     F+ L   +AR   ++ L+KNN L KVE   ++VGFSERTN +VEP +S QWF+K+    K  I++Q   + K+ F+P +F K L+ W+ N  DWCISRQLWWGHQIPVWY K + +IY  T PPK+ E +++D DVLDTWFSSG+WP+ TT    +    D  FPT+++VTG DI+FFWV RMM FS YL ++ PFK   I GLIRD    KMSKSLGNG+DP D+I+KYG DA+RLF  S ++ GEDL +  E++ + W ++NK+WN  +Y+E      N DE     N ED D      KWIL + +K   E  +  +KYN +V+ K + DF W+ F + Y+E +K      + +   +  + Y+  KILI+  P  P ++  ++     +T +SILL+    ++F+  + + +   + +L+    IR    E  I N   I++  E+++P     K       ++ IL  A+IN +K+           NNY   ++  + +L ++ E        ++K  +++ ++++EI R   +L+N  FI KAP + I  EK+K    K++H   LK L  L
  S:     5 LSKKYSFKEVEANKLLFWQENNLFKAQINSTKKPFTIVLPPPNVTGHLHIGHAYDFTLSDILMRYKKLKGYDSFIIPGTDHAGIATQTKFEKNLKVNAQTNRFNLGRELFLEKLKIWKDEQINYIHKQWNALGLGLDYSNYLFTLDPIVVQTVREVFVKMFNEHIIYRDKKLVNWDIQLKTAISNIEVIHKEVEQKLYYIKYLSQDQKDFVVVATSRPETMFGDKYLVINPKDKRYFHLHNKIFINPINNIEMTVILDDYIDIEFGTGVMKCTPAHDFNDYELAKKHNLEIINIMNADGTLNEKCGEFKGLDRLEARSLIIDKLQKNNHLLKVESYRTSVGFSERTNEIVEPYLSHQWFIKMDSLIKDTIKMQDDCNNKVDFYPNRFNKTLLTWLKNTEDWCISRQLWWGHQIPVWYHKKTNQIYCDTIPPKDLENWIQDEDVLDTWFSSGMWPLLTTKWNYNSHFFDRYFPTSLIVTGMDILFFWVSRMMNFSQYLVEKKPFKDVLIHGLIRDSQGRKMSKSLGNGIDPFDIIDKYGLDAMRLFFASCTTIGEDLNFSTERLGANWNYLNKIWNIAKYIE------NLDEINDNLNFEDVDKFCDVNKWILTELSKLTLEINKNMDKYNLVVATKYLYDFIWNTFASYYLEYTKVLLQDLTLKNETIKTIRYVFNKILIMLQPFAPNISEEIWLCLN-QTNNSILLQEYPIINFEFETIIIDKIAKIILE----IRKLRLEENINNR--INLCFELISPNDAFYKSKIKLVNLLLILVNAEINEIKKT--------SSNNYTYELVIDDFILKTSYEKPIDYVFQMKKASEQLNYLENEIQRATNLLNNSGFINKAPAQLIIKEKNKLINLKKEHANLLKTLTDL 869
>gi|15615600|ref|NP_243904.1| valyl-tRNA synthetase [Bacillus halodurans C-125] >gi|12585349|sp|Q9K8G8|SYV_BACHD Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|10175660|dbj|BAB06757.1| valyl-tRNA synthetase [Bacillus halodurans C-125] (880 aa)
Score = 1608, Expect = 1.5e-176, Identities = 339/850 (39%), Positives = 509/850 (59%)
  Q:     8 KNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT----DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL--------KPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH 857
           K + ++  KY  +  E ++  +  + +  +      K  Y+I++PPPNVTG LHLGHA +  +QD L R   ++G    W+ GMDHAGIATQ K E  LRE   S  D  R+  V   +EW +   + IR QW  +G  LDY  E FTL++  ++ V +VFVK+Y  GLIYR + ++NWD   ++A+S+IEVI K+V+   Y+++Y L++    + VATTRPET+  D  + V+P+D+RY++ I K    P+T +EI I+AD+YVD++FG+G +K TPAHD ND+E+G ++ L  I   NEDGT N  A  +E +   + R + V+ L++  +L K+E+ + +VG SER+ AVVEP +S QWFVK+   +++ IELQ +  K+ F P +FEK  + WM N+ DWCISRQLWWGH+IP WY K++ E+YVG + P++ + + +D DVLDTWFSS LWP +T     +        + T+ LVTG+DIIFFWV RM+F  L    + PFK   I GL+RD    KMSKSLGNGVDP +VI+KYGADALR FL + SSPG DL +  EKV+S W F NK+WN+ R+  MN    ++DE          D+WIL +  +      +  + Y F    + + +F WDD C+ YIE++K          +++   VL Y++ + + L HP+ PF+T  ++ +   +  +SI +     K      E ++ D   +  II  +R    E  +P +K I++H++  N       ++V+  L   K  I K    S         KP+   +N L  +     L G  +    I +++KE   ++ E+ R    LSN+ F+ KAP++ IE E+ K+  +
  S:     3 KQDQEMPTKYHPQDIESKWYEYWIEGKFFEATSDETKKPYTIVIPPPNVTGKLHLGHAWDTALQDILSRLKRMQGYDTLWLPGMDHAGIATQAKVEAKLREEGKSRYDLGREAFVEKTWEWKEEYADFIRQQWAKLGLSLDYSRERFTLDEGLSKAVREVFVKLYEKGLIYRGEYIINWDPVTKTALSDIEVIYKDVQGYFYHMKYPLADGDGAIEVATTRPETMLGDTAVAVHPEDERYQHLIGKMVKLPITGREIPIVADDYVDMEFGSGAVKITPAHDPNDFEIGNRHNLPRILVMNEDGTMNEKAGQYEGMDRFECRKQIVKDLQEQGVLFKIEEHVHSVGHSERSGAVVEPYLSTQWFVKMKPLAEQAIELQTTENKVNFVPDRFEKTYLRWMENIRDWCISRQLWWGHRIPAWYHKETGEVYVGHEAPQDIDNWKQDEDVLDTWFSSALWPFSTMGWPDEEAPDYKRYYSTDALVTGYDIIFFWVSRMIFQGLEFTGQPPFKDVLIHGLVRDAEGQKMSKSLGNGVDPMEVIDKYGADALRFFLATGSSPGNDLRFYWEKVESTWNFGNKIWNASRFALMNMDGMSYDEIDLTGEKSIADQWILTRLQETIETVTRLIDAYEFGEVGRHLYNFIWDDLCDWYIEMAKLPLYGEDEVAKKTTRSVLAYVLDQTMRLLHPLMPFITEEIWQHLPHE-GESITVASWPVKSEEFTFEQAMGDMELLKDIIRSVRNTRAELNVPMSKEIELHIQAKN-------EDVLTQLERGKHYIEKFCNPSTLVMGTAIEKPEKSMSNVLSGVELYLPLAGLLDLEEEIARLEKEENKLEKEVERVQKKLSNQGFLAKAPEKVIEEERKKEADY 864
>gi|170016586|ref|YP_001727505.1| valyl-tRNA synthetase [Leuconostoc citreum KM20] >gi|169803443|gb|ACA82061.1| Valyl-tRNA synthetase [Leuconostoc citreum KM20] (894 aa)
Score = 1608, Expect = 1.5e-176, Identities = 343/859 (39%), Positives = 515/859 (59%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQK----ELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-----NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIEL-QKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKK---DSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWV---LNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKIS-----NLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT---AKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           D+S KY+    E  ++  W  +K    E N+         Y+I++PPPNVTG LHLGHA + T+QD +IR   ++G+   W+ GMDHAGIATQ K E+ LR   +S  D  R++ V  +++W       I+ QW  MG  LD++ E FTL++  N+ VN+VF+ +YN GLIYR + ++NWD + ++A+S+IEVI ++ E   Y+++Y  +     + +DY+ +ATTRPET+F D  + V+P D+RYK+ I K  + PL  +EI IIADEYV+  FGTG++K TPAHD ND+++G ++ L  I+   +DG  N  A  +  ++  +AR   V  LE  + + KV+  + +VG SERT   VE  +S QWFVK++  +++ + + QK  +K++F P +FE     WM N+ DW ISRQLWWGHQIP WYK    D +EI+VGT+ P  +  + RD DVLDTWFSS LWP +T    ++    F    PTN LVTG+DIIFFWV RMMF       + PFK+  I GLIRD    KMSKSLGNGVDP DVIEKYGADALR FL + S+PG+D+ +  +K+ + W FINK+WN+ RYV MN       +D TP  L D       DKWIL++ N       + F+K+ F  + +++ +F W DF + YIE++K   +    K  V   L Y++ + L L  P+ PFVT  ++     +    +      +  ++        ES+ + +  +I  +R    E   P +  ID+ ++  +  L +I +E  + +N     K   +  DI+   PD   +  +        L    +    IE++  E++    E+ R +G L+N+ F+  AP+  +  EK K    + KL+  ++ L++
  S:     5 DMSTKYEPTSVESGRYDTWQAKKLFAPESNQAIQGNEPAPYAIVIPPPNVTGKLHLGHAWDTTLQDMIIRQKKMQGMDVLWLPGMDHAGIATQAKVEQRLRAEGVSRYDLGREKFVEQVWDWKNEYAATIKQQWGKMGLSLDFDRERFTLDEGLNKAVNKVFIDLYNKGLIYRGEYIINWDPQARTALSDIEVIYQDDEGAFYHVKYPFTDGTTFDGQDYIEIATTRPETMFGDVAVAVHPSDERYKDLIGKTVMVPLVGREIPIIADEYVEKDFGTGMVKITPAHDPNDFQVGNRHNLERINTMTDDGHLNALAGKYNGMERFEARKAIVADLEAGDYMLKVDPIVHSVGHSERTGVPVESRLSTQWFVKMAPLAEQALAMQQKPDEKVEFVPARFEDTFTRWMENIRDWVISRQLWWGHQIPAWYKNKGTDQEEIFVGTQAPDGDG-WERDPDVLDTWFSSALWPFSTMGWPENTTGDFAKYYPTNTLVTGYDIIFFWVARMMFQGKEFTGQRPFKNVLIHGLIRDGEGRKMSKSLGNGVDPMDVIEKYGADALRWFLATGSTPGQDVRFTYDKMDAAWNFINKIWNASRYVIMNL------DDHTPSTLPDLTQLTLADKWILSRLNTTIDNVTRNFDKFEFGEAGRELYNFIWSDFADWYIEMTKETLNGDGDKTPVQQTLAYVLDQTLRLLQPIMPFVTEAIWQEMPDEAGKDVDFSITRYPVVNAALHDEQAESAFKSLQDLIVAVRNIRSEANAPMSTEIDLLIKTTDDNLIQIFNENTDYINRFVHPKSLSIAADIEV--PDLAMSQVITGAEIYVPLAELIDITVEIERLSGEVKKFTGEVKRASGKLNNEKFVNSAPEAVVTAEKQKLADWQEKLRATQERLAA 889
>gi|23099516|ref|NP_692982.1| valyl-tRNA synthetase [Oceanobacillus iheyensis HTE831] >gi|81746073|sp|Q8EPN2|SYV_OCEIH Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|22777745|dbj|BAC14017.1| valyl-tRNA synthetase [Oceanobacillus iheyensis HTE831] (883 aa)
Score = 1607, Expect = 1.8e-176, Identities = 345/865 (39%), Positives = 532/865 (61%)
  Q:     8 KNNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQ-KSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERL-----DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINI---VKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +N   L  KY+ K  E+ ++  W   K         +K  YSI++PPPNVTG LHLGHA + ++QD + R   ++G    W+ GMDHAGIATQ K E  L+E+  +  +  R++ +   +EW +     IR+QW+ +G  LDY  E FTL++  ++ V +VFVK+Y  GLIYR + ++NWD   ++A+S+IEVI +E++   Y++RY +  S + + +ATTRPET+  D  + V+PKD+RY++ I K  I P+  +EI+I+AD+YVD++ G+G +K TPAHD ND+E+G +++L  I   NEDG+ N  A  ++ L   + R + V+ L++  ++  +E+    VG SER+ AVVEP +S QWFVK+   +K  +++Q  + +K+ F P +FE+   NWM N+ DWCISRQLWWGH+IP WY K++KEIYVG + P + E + +D DVLDTWFSS LWP +T        A     FPTNVLVTG+DIIFFWV RM+F S     E PF+   + GLIRD    KMSKSLGNGVDP DVIEKYGAD+LR FL++ S+PG+DL +  EKV+S W F NK+WN+ R+  MN   F +++      L   D+WIL + N+   +  +  NKY F  + + + +F WD+FC+ YIE++K        + +++   VL +++ + + + HP  PF+T  ++     +   SI + +      +F     ++E  ++ ++ II  +R    E   P +K I + +    E L  +L K  D +    N ++++I   ++   K++    V     IF L  E L+  + E   I++++ E+     E+ R    LSN+ F+ KAP+  +E EK K++ +  K  +++  LS  K
  S:     6 ENKQSLPSKYNPKEVEEGRYQFWLDGKFFEATG-DPDKEPYSIVIPPPNVTGRLHLGHAWDTSMQDTITRMKRMQGYDVLWLPGMDHAGIATQAKVEARLKESGTNRYELGREKFLEKAWEWKEEYAAFIRSQWEKLGLGLDYSRERFTLDEGLSDAVREVFVKLYEKGLIYRGEYIINWDPSTKTALSDIEVIYEEIQGKFYHMRYPIKGSDETIEIATTRPETMLGDTAVAVHPKDERYQHLIGKTVILPIVGREIEIVADDYVDMELGSGAVKITPAHDPNDFEIGNRHQLERILVMNEDGSMNENAGKYQGLDRFECRKQIVKDLKEQGVMFNIEERTHQVGHSERSGAVVEPYLSTQWFVKMDPLAKSALDMQADADEKVNFVPDRFERTYFNWMDNIRDWCISRQLWWGHRIPAWYHKETKEIYVGKEAPADIENWEQDEDVLDTWFSSALWPFSTMGWPNEDSADLKRYFPTNVLVTGYDIIFFWVSRMIFQSKEFMNEKPFEDTLLHGLIRDADGRKMSKSLGNGVDPMDVIEKYGADSLRYFLMTGSTPGQDLRFHWEKVESTWNFANKVWNASRFSIMNMEGFTYEDIDLTGELSLPDRWILARLNETIEQVTRNSNKYEFGEAGRHLYNFIWDEFCDWYIEMAKLSLYGEDENKKKTTRSVLAHVLDQTMRMLHPFMPFITEEIWQQLPHEGP-SITVSKWPEVNSEFDNPQAVQE--MQRLVSIIRSVRNSRAEVDTPMSKQIKMLIKTENEQLTAELEKNRDYLERFCNPSELSISTVIEAPDKAMTS--VVTGAEIF-LPLEGLIDFDKE---IKRLENELAKWTKEVERVQKKLSNQGFVSKAPESVVEEEKRKEKDYLDKQAKVKTRLSELK 883
>gi|73662410|ref|YP_301191.1| valyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90108439|sp|Q49Y96|SYV_STAS1 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|72494925|dbj|BAE18246.1| valyl-tRNA synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (876 aa)
Score = 1607, Expect = 1.9e-176, Identities = 341/849 (40%), Positives = 516/849 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSI--LLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           ++  KY+ +  E  ++  W        K+   +K +Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    ++ GMDHAGIATQ K E  L E  +S  D  R++ +   ++W +   N IR QW  +G  LDY  E FTL++  ++ V +VFV MYN GLIYR + ++NWD   ++A+S+IEVI ++V+   Y+ +Y  ++   Y+ +ATTRPET+  D  +VVNP D+RYK+ I K  I P+  +E+ I+ADEYVDI+FG+G MK TPAHD ND+E+G ++ L  I   +E G  N+ A  ++ +   D R + V+ LE  NL+ K+E+   +VG SER+ AVVEP +S QWFVK+   +++ +  QK+  +I F P +FEK    WM  + DW ISRQLWWGHQIP WY K++ EI+VG   P++ E +V+D DVLDTWFSS LWP +T     +++ D    FPTN LVTG+DIIFFWV RM+F  L    + PF    + GL+R E   KMSKSLGNGVDP DVI++YGAD+LR FL + SSPG DL Y  EKV+S W FINK+WN+ R+  MN   DF  ++     +L   DKWIL + N+      +  +KY F    + + +F WD+FC+ YIE+SK        + ++    VL Y++   + + HP  PFVT  ++ N   + +  +     +++   + +  + +++ +++II  +R    E   P +K I I +    E +   L   S+ +    + +++ I   D     P+    +       +L  E L+  + E   I +++ E+   + E+ R N  L+N++F+ KAP++ I  E+ KK+ ++ K
  S:     2 EMKPKYNPREVESGRYDQWVNSGYFKAKD-DQSKETYTIVIPPPNVTGKLHLGHAWDTTLQDILTRMKRMQGYDTLYLPGMDHAGIATQAKVEAKLNEQGLSRHDLGREKFLEQAWDWKEEYANFIRQQWAKLGLGLDYSRERFTLDEGLSKAVKKVFVDMYNKGLIYRGEYIINWDPIARTALSDIEVIHEDVQGKFYHFKYPYADGNGYIEIATTRPETMLGDTAIVVNPNDERYKDVIGKTVILPIVGRELPILADEYVDIEFGSGAMKVTPAHDPNDFEIGNRHDLERIIVMDESGKMNDKADKYQGMDRFDCREQLVKDLEAENLVIKIEEHEHSVGHSERSGAVVEPYLSTQWFVKMKPLAEQALNNQKTDDRIDFVPARFEKTFNRWMEEIRDWTISRQLWWGHQIPAWYHKETGEIFVGEHEPEDIENWVQDEDVLDTWFSSALWPFSTLGWPDVEADDFQRYFPTNALVTGYDIIFFWVARMIFQGLEFTGKRPFNDVLLHGLVRAEDGRKMSKSLGNGVDPMDVIDEYGADSLRYFLATGSSPGHDLRYSTEKVESIWNFINKIWNAARFSIMNIGEDFTVEQVDLSGDLSLADKWILTRLNETIENVTELSDKYEFGEVGRTLYNFIWDEFCDWYIEMSKIPMNGEDEAQKQITRSVLTYVLDNTMRMLHPFMPFVTEQIWQNLPHEGETIVKAAWPKVNEALVFDDSKETMQQLVEIIKSVRQSRLEVDTPLSKAIPIFIKAKDENIKETLLNNSNYIDRFCHPSELTI---DTTIEIPEKAMTSVTTAGEVVLPLEGLIDMDKE---IARLENELLKWEKELDRVNKKLANENFVNKAPEKVINEEREKKQTYQEK 863
>gi|187605498|ref|ZP_02991692.1| valyl-tRNA synthetase [Exiguobacterium sp. AT1b] >gi|187482437|gb|EDU20447.1| valyl-tRNA synthetase [Exiguobacterium sp. AT1b] (883 aa)
Score = 1607, Expect = 2.0e-176, Identities = 343/863 (39%), Positives = 512/863 (59%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQ-KSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA-----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSIL-----LERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK-QDIKSLK-------PDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-------EMKLKELEK 866
           M++  N   +  KYD    E ++  +  + ++ K +   +K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E+ LRE  +   D  R++ +   +EW       IR+QW  +G  LDY  E FTL++  ++ V +VFV++Y  GLIYR + +VNWD   ++A+S+IEVI +EVE   Y+++Y L++   ++ +ATTRPET+  D  + VNPKD+RY + I K  + P+ N+EI I+AD+YVD++FGTG +K TPAHD ND+E+G +++L  I   +E G  N  A  +E L   + R + V+ LE +  L K+E    +VG SER+ AV+EP +S+QWFV +   +K  +E Q     K+ F P +FE   + WM N+ DWCISRQLWWGH+IP WY  ++ E+YVG + P + E + +D DVLDTWFSS LWP +T       DA      FPT+ LVTG+DIIFFWV RM+F SL    + PF    I GLIRD    KMSKSLGNGVDP +VI++YGAD+LR FLL+ S+PG DL +  EK++S W F NK+WN+ R+  MN      ++          DKWIL + N    +  +  +KY F  + + + +F W++FCN YIE++K        + + +   VL + +  I+ L HP  PF+T  ++ +   +  DSI+       R D     ++   + E V+ +I  +R    E   P +K I + +   +       D     L+  ++ I K  +   L+       PD   +  +      +   DL+    E   I +++KE+   + E+ R    L N+ FI KAP   I+ EK+K++ +         +L+EL K
  S:     1 MAHETNEITMPTKYDPSATESKWYDYWLENDVFKADEDDSKQPYTIVIPPPNVTGKLHLGHAWDTTLQDLLTRLKRMQGYDVLWLPGMDHAGIATQAKVEQKLREEGVMRYDLGREKFLEKTWEWKDEYAKTIRDQWSKLGLGLDYSRERFTLDEGLSKAVQEVFVRLYEKGLIYRGEYIVNWDPAQKTAVSDIEVIYQEVEGAFYHMKYPLADGSGHIEIATTRPETMLGDTAVAVNPKDERYTHLIGKTIMLPVMNREIPIVADDYVDMEFGTGCVKITPAHDPNDFEIGNRHELPRILVMDEGGKMNENAGKYEGLDRFECRKQLVKDLEADGTLVKIEPHTHSVGHSERSGAVIEPYLSKQWFVDMEPLAKAALEAQGNDDTKVNFVPERFEGTYLRWMENIRDWCISRQLWWGHRIPAWYHNETGEVYVGKEAPADSENWTQDEDVLDTWFSSALWPFSTM-GWPDADAPDFNRYFPTSALVTGYDIIFFWVSRMIFQSLEFTGKQPFNDVLIHGLIRDSEGRKMSKSLGNGVDPMEVIDQYGADSLRWFLLTGSTPGNDLRFYWEKIESTWNFANKIWNASRFALMNMDGLKVEDIDLTGEKTLADKWILTRLNDTIDQVTRLVDKYEFGEAGRYLYNFIWEEFCNWYIEMAKLTLYGEDEAAKHTTRSVLAHTLDSIMRLMHPFMPFLTEEIWQHLPHE-GDSIVRASYPTRRDDLHFADSV--PAFEAVMNVIRSVRNIRAEVNAPMSKPIQLFISTSD-------DATQGYLSANEMTIGKFTNATELEIGRGLTAPDKSMSAIMTGAELFIPLADLINFEEE---IARLEKEVAKYEKEVERVQKKLGNQGFIAKAPAHVIDEEKAKEKDYLDKRDAVRARLEELRK 883
>gi|42518883|ref|NP_964813.1| valyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] >gi|81667980|sp|Q74JZ8|SYV_LACJO Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|41583169|gb|AAS08779.1| valyl-tRNA synthetase [Lactobacillus johnsonii NCC 533] (879 aa)
Score = 1607, Expect = 2.1e-176, Identities = 353/850 (41%), Positives = 524/850 (61%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN---------RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKE--SSIEDVLQIINKIRIFNFENKIP--------------NNK-VIDIHLE----VLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKL 861
           DL+ KY+    E+ ++  W  + +L K +     + YSI++PPPNVTG LHLGHA +  IQD LIRF  ++G    ++ GMDHAGIATQ K E  LR       +  R+  V  +++W     + I++QW  MG  LDY  E FTL+K  ++ V +VFV++YN+GLIYR + ++NWD KL++A+S+IEVI K+ +   Y+I+Y  ++   ++ +ATTRPET+F D  + V P D+RYK+ + K  + PL  + I II D++VD +FGTG++K TPAHD ND+++G ++ L  I+  N++GT N  A  +  +   +AR   V+ L++   L KVE  + +VG SER+   VEP +S+QWFVK+   ++KV+E QK+  K+ F P +FE  L  WM++++DW ISRQLWWGH+IP WY K + E YVG + PK+ E + +D DVLDTWFSS LWP +T     +  +     FPTN LVTG+DIIFFWV RM+F SL+   + PF    + GLIRD    KMSKSLGNGVDP DV+++YGADALR FLL+ ++PG+D  Y  +K+ + W FINK+WN+ R+V M     N  ED  P ++ D       D WI ++ N   SE  + F++Y F  + +++ +F W+DFC+ YIE+SK          +T  QE+ +W+L+    +IL L HP+ PFVT  L+ +     K  ++ +  +  K    KE  S +  ++++I  +R    E   P              NNK V+D + E     L+PK   ++ ++              +   L    V     IF+   E L+  + E   +EK +K +E   +E+ R    LSN+ F+  AP+  I  EK KK  +E +L
  S:     3 DLAPKYNPNEVEKGRYQEWLDE-DLFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTAIQDTLIRFKRMQGYDTLYLPGMDHAGIATQAKVEAKLRTQGKDRHEMGREAFVKQVWDWKDEYASIIKSQWAKMGLSLDYSRERFTLDKGLSKAVRKVFVQLYNEGLIYRGEYIINWDPKLETALSDIEVIHKDDKGAFYHIKYPFADGSGFVEIATTRPETMFGDTAVAVAPGDERYKDIVGKELVLPLVGRHIPIIEDQHVDPEFGTGLVKITPAHDPNDFQVGNRHNLERINVMNDNGTMNEEAGKYAGMDRFEAREALVKDLKEEGFLIKVEPIVHSVGHSERSGVQVEPRLSKQWFVKMKPLAEKVLENQKTDDKVNFVPERFEHTLEQWMSDVHDWVISRQLWWGHRIPAWYNKKTGETYVGLEAPKDSENWEQDPDVLDTWFSSALWPFSTLGWPDENSEDFKRYFPTNTLVTGYDIIFFWVSRMIFQSLHFTGKRPFDDVVLHGLIRDPQGRKMSKSLGNGVDPMDVVDEYGADALRWFLLNGTAPGQDTRYDPKKMGAAWNFINKIWNASRFVIM-----NLPEDAKPAHMPDTSKFDLADSWIFDRLNHTVSEVTRLFDEYQFGEAGRELYNFIWNDFCDWYIEISKVALNGDDEELKTRKQENLIWILD----QILRLLHPIMPFVTEKLWLSMPHDGKSIMVAKYPETHKEFENKEADSQMAFLIEVIKAVRNIRMEVNAPMSSPIDIMIQIDDDNNKAVLDNNAEYVENFLHPKALSVAADI--------------EAPKLAKTAVIPGAQIFVPLTE-LVNVDEELAKMEKEEKRLE---AEVERAEKKLSNQGFVAHAPEAVINKEKEKKADYESQL 865
>gi|116494743|ref|YP_806477.1| valyl-tRNA synthetase [Lactobacillus casei ATCC 334] >gi|191638254|ref|YP_001987420.1| Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) [Lactobacillus casei] >gi|116104893|gb|ABJ70035.1| valyl-tRNA synthetase [Lactobacillus casei ATCC 334] >gi|190712556|emb|CAQ66562.1| Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) [Lactobacillus casei BL23] (880 aa)
Score = 1606, Expect = 2.4e-176, Identities = 343/842 (40%), Positives = 509/842 (60%)
  Q:    13 LSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSS-KKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILN---TAKINIVKQDIKSLK--PDYVENNYLIFI-LNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKK 854
           L+ KYDHK  E  ++  W  + ++ K +       YSI++PPPNVTG LH+GHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  LR+  IS  D  RD+ V  ++EW       I +QW  MG  LDY  E FTL+K  NE V +VFV++Y  GLIYR + +VNWD + ++A+S+IEVI ++ +   Y+++Y  ++   Y+ +ATTRPET+  D  + V+P DKRY++ + K  I PL N++I II D YVD  FGTG +K TPAHD ND+++G ++ L  I+  NEDGT N  A  +  +   +AR   V  L+K  LL KVE  + +VG SERT   VE  +S QWFVK+   +   I+ Q+ + KK+ F P +FE   + WM N++DW ISRQLWWGHQIP WY K + E YVG + PK+ E + +D DVLDTWFSS LWP +T     TD+   K   +PT+ LVTG+DII FWV RM+F  L+   E PFK+  I GL+RDE   KMSKSLGNG+DP DVIEKYGADALR FL++ + PG+D  +  ++V++ W FINK+WN  R+V MN  D    +   P   +  DKW+  + N+   +      ++ F    + + +FTW+ F + Y+E+SK     +    + +K   L Y + +IL L HP+ PFVT  L+       +  +      +   ++  E+S     ++ ++ +I  +R    +   P    +DI +++ +P L  I ++  + ++    +K   V  D+   K     V     IF+ LN  +L+  + E     K+ K+ + ++ EI R +  L+N+ F+ KAP+  +E +++K+
  S:     6 LAPKYDHKAVEAGRYQEWLDE-DVFKPSGDQKAKPYSIVIPPPNVTGKLHMGHAWDTTLQDIVIREKRMQGFDTLWLPGMDHAGIATQAKVEAKLRKEGISRYDLGRDKFVQKVWEWKDEFAKTIHSQWAKMGLSLDYSRERFTLDKGLNEAVRKVFVELYKQGLIYRGEYIVNWDPQARTALSDIEVIHEDDKGAFYHVKYPFADGSGYIEIATTRPETMMGDTAVAVHPGDKRYQDLVGKELILPLANRKIPIIEDAYVDPAFGTGAVKITPAHDPNDFQVGNRHDLKRINTMNEDGTMNENAGKYNGMDRFEARKAMVADLDKEGLLLKVEPIVHSVGHSERTGVQVEARLSTQWFVKMKPLADAAIKAQQEADKKVTFVPDRFEHTYLQWMENIHDWVISRQLWWGHQIPAWYNKQTGETYVGMEAPKDIENWQQDPDVLDTWFSSALWPFSTMGWPDTDSPDYK-RYYPTDTLVTGYDIIPFWVARMIFQGLHFTGERPFKYTLIHGLMRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLITGNKPGQDTRFSYKQVEAAWNFINKIWNISRFVMMNLGDLEKPQQPDPSTFDLSDKWLFAQLNETIKQVTDLSERFEFGEMGRTLYNFTWNVFADWYVEMSKEVLYGDDEKAKAAKRVNLAYALDQILRLLHPVMPFVTEKLWLALPHAGQSIVTAS---YPVANDAFENSAAVDAMDSIIALIRGVRSIRKDAGAPLKTKVDIIVKLTDPALKPIFEDNFDFIDRFVNSKAFTVGTDVAEPKMAGSTVITGATIFVPLN--ELVDLDEER---AKLTKDAKKLQQEIDRIDKKLNNQGFLAKAPEAVVEEQRTKR 860
>gi|116333862|ref|YP_795389.1| valyl-tRNA synthetase [Lactobacillus brevis ATCC 367] >gi|116099209|gb|ABJ64358.1| valyl-tRNA synthetase [Lactobacillus brevis ATCC 367] (888 aa)
Score = 1600, Expect = 1.1e-175, Identities = 344/861 (39%), Positives = 510/861 (59%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKD------YLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-LDFKKISN-LKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE------DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           D+  KYD    E  ++  W  + ++ K +       YSI++PPPNVTG LHLGHA + T+QD LIR   ++G    W+ GMDHAGIATQ K E  LRE  IS  D  R++ V  ++EW     + I  QW  MG  LDY  E FTL+   ++ V +VFV +Y  GLIYR + ++NWD + ++A+S+IEVI K+ +   Y+++Y  +N  D      Y+ +ATTRPET+  D  + VNP D+RYK  + K  I PL ++EI IIAD+YVD +FGTG++K TPAHD ND+ +G ++ L  I+  N+D + N  A  +  +   DAR   V  L++  LL KV+  + +VG SERT   VE  +S QWFVK+   + + I+ Q+    + F P +FE     WM N++DW ISRQLWWGH+IP WY K + E+YV TK PK+ E + +D DVLDTWFSS LWP +T        A     FPT+ LVTG+DIIFFWV RMMF SL    + PFK+  + GLIRDE   KMSKSLGNG+DP +VI+KYGADALR FL + S+ G+D+ +   K+ + W FINK+WN+ R+V MN  D         +  +  DKWIL++ N       + F+K+ F  + + + +F W+DFC+ YIE+SK     +  + + +K  +L Y++ + L L  P+ PFVT  ++       +  +     +D  + +N   ES +  ++ +I  +R    E   P +  ID+ ++  + KL   F+ + + I+     K   +  D+ + K           I + E      +L+  N+EA  +E   KE+    +E+ R    L N+ F+  AP+  +  E+ K+  ++ KL+  ++ L+  K
  S:     7 DMPTKYDPTAVEAGRYQTWLDE-DVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDMLIRQKRMQGYDTLWLPGMDHAGIATQAKVEAKLREQGISRYDLGREKFVEKVWEWKDEYADTIHKQWAKMGLSLDYSRERFTLDDGLSDAVKKVFVTLYKKGLIYRGEYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFANPDDTFNGQHYIEIATTRPETMMGDTAVAVNPGDERYKELVGKKVILPLADREIPIIADQYVDPEFGTGMVKITPAHDPNDFLVGNRHNLERINTMNDDASMNEKAGKYAGMDRFDARKAMVADLDEQGLLLKVDPIVHSVGHSERTGIQVEARLSTQWFVKMKPLADEAIKNQQGDDAVNFVPERFENTFTQWMDNVHDWVISRQLWWGHRIPAWYNKQTGEVYVDTKAPKDIENWEQDPDVLDTWFSSALWPFSTMGWPDEDSADFKRYFPTSTLVTGYDIIFFWVSRMMFQSLEFTGKRPFKNVLLHGLIRDEEGRKMSKSLGNGIDPMEVIDKYGADALRWFLSTGSTAGQDVRFSYTKMDAAWNFINKIWNASRFVIMNLGDKTQPVLPAAETWDLTDKWILSRLNDTVKHVTEMFDKFEFGEAGRALYNFIWNDFCDWYIEMSKEVLTGDDETAKANKQDLLAYVLDQTLRLLQPIMPFVTEAIWQAMPHDGQSLVTAAYPVDHPEFTNPTAESDMTSLIDLIKAVRNIRAEANAPMSTPIDLQIKTSDAKLQAVFEANKDYIDRFVHPKALEIGADLVAPKLAMTS-----VITDAEVSVPLAELVDLNDEAARLE---KEVAKFTAEVQRAEKKLGNERFVANAPEAVVAGEREKQADNQKKLEATQQRLAEIK 885
>gi|149181773|ref|ZP_01860264.1| valyl-tRNA synthetase [Bacillus sp. SG-1] >gi|148850514|gb|EDL64673.1| valyl-tRNA synthetase [Bacillus sp. SG-1] (881 aa)
Score = 1600, Expect = 1.3e-175, Identities = 339/863 (39%), Positives = 518/863 (60%)
  Q:    10 NNDLS--KKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           NN++S   KYD +  E  ++  W   K     N K  K  Y+I++PPPNVTG LHLGHA + T+QD L R   ++G    W+ GMDHAGIATQ K E+ LR    +  D  R++ + + ++W +    +IR QW  +G  LDY  E FTL++  ++ V +VFV +Y  GLIYR + ++NWD   ++A+S+IEVI ++V+   Y++RY L++   ++ +ATTRPET+  D  + V+P+D RYK+ I K    P+  ++I I+ D+YVD++FG+G +K TPAHD ND+E+G ++ L  I   NEDG+ N  A  +  +     R + V+ L+++ +L K+E+ + +VG SER+ AVVEP +S QWFVK+   + K IELQ   +K+ F P +FE + + WM N  DWCISRQLWWGH+IP WY K++ EI+VG + P + E + ++ DVLDTWFSS LWP +T     T+A   K   +PT+ LVTG+DII FWV RM+F  L      PF    I GL+R E   KMSKSLGNGVDP +VI++YGADALR  L + SSPG+DL Y  EKV+S W F NK+WN+ R+  MN     ++E          DKWIL + N+      +  ++Y F    + + +F WDDFC+ YIE++K        + +++   +L Y++   + L HP  PF+T  ++ N   +  +SI        +     +++ ED   +++II  +R    E   P +K I + L+  + +  K  ++    +    N  ++ I   DI++  PD         +     L G  N A  I +++KE+E    E++R  G L+N+ F+ KAP++ ++ E++K+  +  K   +E  ++  K
  S:     3 NNEISMPTKYDPQAIESGRYQWWLDGKFFEAANDK-EKEPYTIVIPPPNVTGKLHLGHAWDTTLQDILTRMKRMQGYDVLWLPGMDHAGIATQAKVEEKLRSEGTTRYDLGREKFLEETWKWKEEYAKHIRAQWSKLGLGLDYSRERFTLDEGLSDAVKEVFVTLYEKGLIYRGEYIINWDPATKTALSDIEVIHQDVQGAFYHMRYPLADGSGHIEIATTRPETMLGDTAVAVHPQDDRYKHLIGKKVTLPIVGRKIPIVGDDYVDMEFGSGAVKITPAHDPNDFEIGNRHNLERILVMNEDGSMNEKAGKYNGMDRFACRKEIVKDLQESGVLFKIEEHMHSVGHSERSGAVVEPYLSTQWFVKMQPLADKAIELQNGEEKVNFVPDRFETSYLRWMENTRDWCISRQLWWGHRIPAWYHKETGEIHVGKEEPADIENWRQEEDVLDTWFSSALWPFSTMGWPDTEAEDFK-RYYPTDALVTGYDIIGFWVSRMIFQGLEFTGTRPFNDVLIHGLVRAEDGRKMSKSLGNGVDPMEVIDQYGADALRYMLSTGSSPGQDLRYSTEKVESVWNFANKIWNASRFALMNMDGLKYEEIDLTGEKSAADKWILTRLNETIETVTKLADRYEFGEVGRILYNFIWDDFCDWYIEMAKLPLYGEDEAAKKTTRSILAYVLDNTMRLLHPFMPFITEEIWQNLPHE-GESITTAAWPVVREEFSDKAAAEDMKLLVEIIRAVRNIRAEVNTPLSKQIKLLLKAKDEQTKKTLEKNKGYIERFCNPEELTI-STDIEA--PDKAMTAVATGVELFLPLEGLINIAEEIARLEKELEKWNKEVARVQGKLNNEKFVSKAPQKVVDEERAKEADYLEKRSTVEARINELK 879
>gi|188568638|ref|ZP_03005422.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 2] (874 aa)
Score = 1600, Expect = 1.4e-175, Identities = 368/860 (42%), Positives = 545/860 (63%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLREN-KISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQK-SSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK---NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFK---ISDEVINILNTAKIN-IVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           L+K Y  K  E    L+  +  L K    + K  ++I+LPPPNVTG+LH+GHA + T+ D L+R+  L+G  A+ + G DHAGIATQTK+EK L+ N ++      R   +  L  W       I  QW  +G  LDY N  FTL++   + V +VFVKM+N+ +IYR+K LVNWDI+L++AISNIEVI KE+E  LYYI+Y   + KD+++VAT+RPET+F D+ L++NP D+RY +  NK  INP+ N ++ +I D+Y+DI+FGTGVMKCTPAHDFNDYEL KK+ L +I+  NEDGT N     F+ L    AR   V+ L+K+N L K+E   SNVGFSERTN +VEP +S QWF+K+    K  I++Q  S+ K+ F+P +F K L+ W+ N  DWCISRQLWWGHQIPVWY K + EIY  T PPK+ E +++D DVLDTWFSSG+WP+ TT    S D      FPT ++VTG DI+FFWV RMM FS YL ++ PFK   I GLIRD    KMSKSLGNG+DP D+I +YG D +RLF  SS++ GEDL +  E++ + W ++NK+WN  +Y+E N  + N  E  + +N+ +F   +KWI+ + +K   E  +  +KYN +V+ K + DF W+ F + Y+E +K     T+ +   +  + Y+  +ILI+ HP  P ++  ++ N   +T +SILL++   ++F+  S +     + +L+    IR    +  I N   +   L   N + +        ++ +L  AK++ I K  + S   + V +++++    ++ +    +    I+K+ ++++++++EI R   +L+N+ F+ KAP E I  EK K    E +   L K+ +  K
  S:     5 LNKNYLFKEVEANKLLFWQENNLFKAQANSTKPPFAIVLPPPNVTGHLHIGHAYDFTLPDILMRYKKLQGYDAFIVPGTDHAGIATQTKFEKILKTNEQVDRFVLGRKAFLEKLKIWKDEQTYYIHKQWNALGLGLDYNNYLFTLDEPVVQTVREVFVKMFNENIIYRAKKLVNWDIQLKTAISNIEVIHKEIEQKLYYIKYSSEDQKDFVIVATSRPETMFGDKHLIMNPNDQRYVHLHNKIFINPINNAKMSVILDDYIDIEFGTGVMKCTPAHDFNDYELAKKHNLELINIMNEDGTLNEKCAEFKGLDRLQARALIVDKLQKSNHLVKIENYQSNVGFSERTNEIVEPYLSYQWFIKMDNLVKNTIKMQNDSNDKVDFYPNRFNKTLLTWLENTEDWCISRQLWWGHQIPVWYHKKTNEIYCNTTPPKDLENWIQDEDVLDTWFSSGMWPLLTTK-WNSNDQFFKRYFPTALMVTGMDILFFWVSRMMNFSQYLVQKRPFKDVLIHGLIRDAQGKKMSKSLGNGIDPFDIINEYGLDTMRLFFASSTTVGEDLNFSTERLGANWNYLNKIWNIAKYIE-NLDEIN--ESFSIQNVHEFCDVNKWIIAELSKLSVEMNKNMDKYNLVVATKDLYDFIWNTFASNYLEYTKVLLQDTTFKNETIKTIRYVFNQILIMLHPFAPNISEEIWLNLN-QTNESILLQKYPMVNFEFESIIINKIAKIILE----IRKLRLQENINNKTNLCFELVSANDEFYNSNIKLINLLLVLVNAKVSEIKKSSVNSCTYELVIDDFILKTWYEKSI----DYDTQIKKVSEQLKYLENEIKRATNLLNNQGFVNKAPTELIAKEKDKLNNLEKEQANLLKIFADLK 870
>gi|116629854|ref|YP_815026.1| valyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323] >gi|116095436|gb|ABJ60588.1| valyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323] (879 aa)
Score = 1598, Expect = 2.1e-175, Identities = 356/850 (41%), Positives = 532/850 (62%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN---------RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERL-----DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKL 861
           DL+ KY+    E+ ++  W  + +L K +     + YSI++PPPNVTG LHLGHA +  IQD LIRF  ++G    ++ GMDHAGIATQ K E  LR+         R+  V  +++W     N I+ QW  MG  LDY  E FTL+K  ++ V +VFV++YN+GLIYR + ++NWD +LQ+A+S+IEVI K+ +   Y+I+Y   +   ++ +ATTRPET+F D  + V P D+RYK+ + K  + PL  + I II D++VD +FGTG++K TPAHD ND+++G ++ L  I+  N+DGT N  A  +  +   +AR   V+ L+K   L KVE  + +VG SER+   VEP +S+QWFVK+   +++V++ QK+  K+ F P +FE  L +WM +++DW ISRQLWWGH+IP WY K + E YVG + PK+ E + +D DVLDTWFSS LWP +T     TD    K   FPTN LVTG+DIIFFWV RM+F  L+  K+ PFK   + GL+RDE   KMSKSLGNGVDP DV++KYGADALR FLL+ ++PG+D  Y  +K+ + W FINK+WN+ R+V M     N  ED  P ++ D       D WI ++ N   SE  + F++Y F  + +++ +F W+DFC+ YIE+SK          +   QE+ +W+L+    +IL L HP+ PFVT  L+ +   + K SI+  +      +F+  +   +S +  ++++I  +R    E   P +  IDI +++ +     I D+    V N L+   +  V  DI++  L    V     IF+   E +    N  + ++K++KE + ++ E+ R    L+N+ F+  AP+  +  EK KK  +E +L
  S:     3 DLAPKYNPNEVEKGRYQEWLDE-DLFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTAIQDTLIRFKRMEGYDTLYLPGMDHAGIATQAKVEAKLRKQGKDRHQMGREAFVKQVWDWKDEYANIIKGQWAKMGLSLDYSRERFTLDKGLSKAVRKVFVQLYNEGLIYRGEYIINWDPELQTALSDIEVIHKDDKGAFYHIKYPFVDGSGFVEIATTRPETMFGDTAVAVAPGDERYKDIVGKELVLPLVGRHIPIIEDQHVDPEFGTGLVKITPAHDPNDFQVGNRHNLERINVMNDDGTMNEEAGKYAGMDRFEAREALVKDLKKEGYLIKVEPIVHSVGHSERSGVQVEPRLSKQWFVKMKPLAEEVLKNQKTDGKVNFVPERFEGTLNHWMEDVHDWVISRQLWWGHRIPAWYNKKTGETYVGEEAPKDIENWEQDPDVLDTWFSSALWPFSTLGWPDTDNPDFK-RYFPTNTLVTGYDIIFFWVSRMIFQGLHFTKKRPFKDVVLHGLMRDEQGRKMSKSLGNGVDPMDVVDKYGADALRWFLLNGTAPGQDTRYDPKKLAAAWNFINKIWNASRFVIM-----NLPEDAKPAHMPDTTKFDLADSWIFDRLNHTVSEVTRLFDEYKFGEAGRELYNFIWNDFCDWYIEISKVALNGDDEELKARKQENLIWILD----QILRLMHPIMPFVTEKLWLSMPHEGK-SIMTAKYPETHAEFE--NKQADSDMAFLIEVIKAVRNIRMEVNAPMSSQIDIMIQLDDEANKHILDDNAEYVENFLHPKDLQ-VAADIEAPKLAKTAVIPGAQIFVPLTELV----NVDDELKKMEKEEKRLEEEVQRAEKKLANQGFVAHAPEAVVNKEKEKKADYESQL 865
>gi|188518664|ref|ZP_03004101.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188997721|gb|EDU66818.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (874 aa)
Score = 1595, Expect = 4.1e-175, Identities = 366/860 (42%), Positives = 541/860 (62%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLREN-KISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKS-SKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLE------DFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK---NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFK---ISDEVINILNTAKIN-IVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           L+K Y  K  E    L+  +  L K    + K  ++I+LPPPNVTG+LH+GHA + T+ D L+R+  L+G  A+ + G DHAGIATQTK+EK L+ N ++      R   +  L  W       I  QW  +G  LDY N  FTL++   + V +VFVKM+N+ +IYR+K LVNWDI+L++AISNIEVI KE+E  LYYI+Y   + KD+++VAT+RPET+F D+ L++NP D+RY +  NK  INP+ N ++ +I D+Y+DI+FGTGVMKCTPAHDFNDYEL KK+ L +I+  NEDGT N     F+ L    AR   V+ L+K+N L K+E   SNVGFSERTN +VEP +S QWF+K+    K  I++Q   + K+ F+P +F K L+ W+ N  DWCISRQLWWGHQIPVWY K + EIY  T PPK+ E +++D DVLDTWFSSG+WP+ TT    S D      FPT ++VTG DI+FFWV RMM FS YL ++ PFK   I GLIRD    KMSKSLGNG+DP D+I +YG D +RLF  SS++ GEDL +  E++ + W ++NK+WN  +Y+E      N DE     +++      D +KWI+ + +K   E  +  +KYN +V+ K + DF W+ F + Y+E +K     T+ +   +  + Y+  +ILI+ HP  P ++  ++ N   +T +SILL++   ++F+  S +     + +L+    IR    +  I N   +   L   N + +        ++ +L  AK++ I K  + S   + V +++++    ++ +    +    I+K+ ++++++++EI R   +L+N+ F+ KAP E I  EK K    E +   L K+ +  K
  S:     5 LNKNYLFKEVESNKLLFWQENNLFKAQANSTKPPFAIVLPPPNVTGHLHIGHAYDFTLPDILMRYKKLQGYDAFIVPGTDHAGIATQTKFEKILKTNEQVDRFVLGRKAFLEKLKIWKDEQTYYIHKQWNTLGLGLDYNNYLFTLDEPVVQTVREVFVKMFNENIIYRAKKLVNWDIQLKTAISNIEVIHKEIEQKLYYIKYSSEDQKDFVIVATSRPETMFGDKHLIMNPNDQRYVHLHNKIFINPINNAKMSVILDDYIDIEFGTGVMKCTPAHDFNDYELAKKHNLELINIMNEDGTLNEKCAEFKGLDRLQARALIVDKLQKSNHLVKIENYQSNVGFSERTNEIVEPYLSYQWFIKMDNLVKNTIKMQNDFNDKVDFYPNRFNKTLLTWLENTEDWCISRQLWWGHQIPVWYHKKTNEIYCNTTPPKDLENWIQDEDVLDTWFSSGMWPLLTTK-WNSNDQFFKRYFPTALMVTGMDILFFWVSRMMNFSQYLVQKRPFKDVLIHGLIRDAQGKKMSKSLGNGIDPFDIINEYGLDTMRLFFASSTTVGEDLNFSTERLGANWNYLNKIWNIAKYIE------NLDEINESFSIQDVHEFCDVNKWIIAELSKLSVEMNKNMDKYNLVVATKDLYDFIWNTFASNYLEYTKVLLQDTTFKNETIKTIRYVFNQILIMLHPFAPNISEEIWLNLN-QTNESILLQKYPMVNFEFESIIINKIAKIILE----IRKLRLQENINNKTNLCFELVSANDEFYNSNIKLINLLLVLVNAKVSEIKKSSVNSCTYELVIDDFILKTWYEKSI----DYDTQIKKVSEQLKYLENEIKRATNLLNNQGFVNKAPTELIAKEKDKLNNLEKEQANLLKIFADLK 870
>gi|81097305|ref|ZP_00875600.1| Valyl-tRNA synthetase, class Ia [Streptococcus suis 89/1591] >gi|80976644|gb|EAP40232.1| Valyl-tRNA synthetase, class Ia [Streptococcus suis 89/1591] (883 aa)
Score = 1595, Expect = 4.9e-175, Identities = 354/859 (41%), Positives = 524/859 (61%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  Q ++ K +  A    YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  ++  D  R++ +  ++EW       IR QW  +G  LDY+ + FTL++  ++ V +VFV++Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  L++   L ++E  + +VG SERT  VVEP +S QWFVK+ + +K  I  Q ++ K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  +S E+YVG + P  +  +V+D DVLDTWFSS LWP +T        A     FPT+ LVTG+DIIFFWV RM+F SL      PFK+  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + +IL L HP+ PFVT  ++  +    + SI++    +  ++   E++     +E +  +I  +R    E  +  +K I I ++  + +L   FK ++  I      +   +   I +  L    V     IF L   DLL    E   + ++ KE+   + E+      LSN+ FI  A  E +E EK K+  ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQTWLDQ-DVFKPSGDAEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGVTRYDLGREKFLDKVWEWKDEYAATIREQWGKLGLSLDYQRDRFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKPIPIVADEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKATVAKLQELGALVEIENRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTADKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWY-NESGEMYVGEEAPAGDG-WVQDEDVLDTWFSSALWPFSTMGWPDENAADFQRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGSQPFKNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDAAR--ENVAKVAAGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVMTRSVLLYTLDQILRLLHPIMPFVTEEIFAQY---AEGSIVVAA--YPVVNPAFENAEAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILIKTADSELETFFKANENYIRRFTNPEQLEISSSIAAPELAMSAVITGAEIF-LPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFIANAKPEVVEKEKEKQADYQAKYDATVGRIAEMKKLV 882
>gi|171920754|ref|ZP_02931957.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179054|ref|ZP_02964793.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024300|ref|ZP_02996988.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039478|ref|ZP_02998231.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 8] >gi|188524452|ref|ZP_03004463.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188531050|ref|ZP_03005297.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188592448|ref|ZP_03005805.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 10] >gi|195867607|ref|ZP_03079609.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903504|gb|EDT49793.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209039|gb|EDU06082.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018974|gb|EDU57014.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|195659607|gb|EDX52987.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660664|gb|EDX53919.1| valyl-tRNA synthetase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (874 aa)
Score = 1594, Expect = 5.6e-175, Identities = 366/860 (42%), Positives = 541/860 (62%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLREN-KISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKS-SKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLE------DFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK---NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFK---ISDEVINILNTAKIN-IVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           L+K Y  K  E    L+  +  L K    + K  ++I+LPPPNVTG+LH+GHA + T+ D L+R+  L+G  A+ + G DHAGIATQTK+EK L+ N ++      R   +  L  W       I  QW  +G  LDY N  FTL++   + V +VFVKM+N+ +IYR+K LVNWDI+L++AISNIEVI KE+E  LYYI+Y   + KD+++VAT+RPET+F D+ L++NP D+RY +  NK  INP+ N ++ +I D+Y+DI+FGTGVMKCTPAHDFNDYEL KK+ L +I+  NEDGT N     F+ L    AR   V+ L+K+N L K+E   SNVGFSERTN +VEP +S QWF+K+    K  I++Q   + K+ F+P +F K L+ W+ N  DWCISRQLWWGHQIPVWY K + EIY  T PPK+ E +++D DVLDTWFSSG+WP+ TT    S D      FPT ++VTG DI+FFWV RMM FS YL ++ PFK   I GLIRD    KMSKSLGNG+DP D+I +YG D +RLF  SS++ GEDL +  E++ + W ++NK+WN  +Y+E      N DE     +++      D +KWI+ + +K   E  +  +KYN +V+ K + DF W+ F + Y+E +K     T+ +   +  + Y+  +ILI+ HP  P ++  ++ N   +T +SILL++   ++F+  S +     + +L+    IR    +  I N   +   L   N + +        ++ +L  AK++ I K  + S   + V +++++    ++ +    +    I+K+ ++++++++EI R   +L+N+ F+ KAP E I  EK K    E +   L K+ +  K
  S:     5 LNKNYLFKEVESNKLLFWQENNLFKAQANSTKPPFAIVLPPPNVTGHLHIGHAYDFTLPDILMRYKKLQGYDAFIVPGTDHAGIATQTKFEKILKTNEQVDRFVLGRKAFLEKLKIWKDEQTYYIHKQWNALGLGLDYNNYLFTLDEPVVQTVREVFVKMFNENIIYRAKKLVNWDIQLKTAISNIEVIHKEIEQKLYYIKYSSEDQKDFVIVATSRPETMFGDKHLIMNPNDQRYVHLHNKIFINPINNAKMSVILDDYIDIEFGTGVMKCTPAHDFNDYELAKKHNLELINIMNEDGTLNEKCAEFKGLDRLQARALIVDKLQKSNHLVKIENYQSNVGFSERTNEIVEPYLSYQWFIKMDNLVKNTIKMQNDFNDKVDFYPNRFNKTLLTWLENTEDWCISRQLWWGHQIPVWYHKKTNEIYCNTTPPKDLENWIQDEDVLDTWFSSGMWPLLTTK-WNSNDQFFKRYFPTALMVTGMDILFFWVSRMMNFSQYLVQKRPFKDVLIHGLIRDAQGKKMSKSLGNGIDPFDIINEYGLDTMRLFFASSTTVGEDLNFSTERLGANWNYLNKIWNIAKYIE------NLDEINESFSIQDVHEFCDVNKWIIAELSKLSVEMNKNMDKYNLVVATKDLYDFIWNTFASNYLEYTKVLLQDTTFKNETIKTIRYVFNQILIMLHPFAPNISEEIWLNLN-QTNESILLQKYPMVNFEFESIIINKIAKIILE----IRKLRLQENINNKTNLCFELVSANDEFYNSNIKLINLLLVLVNAKVSEIKKSSVNSCTYELVIDDFILKTWYEKSI----DYDTQIKKVSEQLKYLENEIKRATNLLNNQGFVNKAPTELIAKEKDKLNNLEKEQANLLKIFADLK 870
>gi|139473421|ref|YP_001128137.1| valyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] >gi|134271668|emb|CAM29901.1| valyl-tRNA synthetase [Streptococcus pyogenes str. Manfredo] (882 aa)
Score = 1594, Expect = 5.9e-175, Identities = 354/857 (41%), Positives = 523/857 (61%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFI---------------LNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEV+ K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +    + SI+   +D+  ++   E+      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I +               L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVVHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPTVTPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAVPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIAEMQKLV 881
>gi|118586620|ref|ZP_01544060.1| valine-tRNA ligase [Oenococcus oeni ATCC BAA-1163] >gi|118432935|gb|EAV39661.1| valine-tRNA ligase [Oenococcus oeni ATCC BAA-1163] (918 aa)
Score = 1592, Expect = 9.2e-175, Identities = 362/871 (41%), Positives = 527/871 (60%)
  Q:     2 VTMSNIKNNNDLSKK-YDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY------YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQK-SSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWY---KKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL------WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL-----KESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILN----TAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + MS   N +++ K  YDH   E+ F+    +K    K       +YSI++PPPNVTG LHLGHA + T+QD LIR   ++G    W+ GMDHAGIATQ K E  LRE+ IS  D  R++ V  +++W     + I+ QW  MG  LD+  E FTL+K  NE V +VFV +Y  GLIYR + ++NWD + ++A+S+IEVI K+ +   Y+++Y      +  N K+Y+ +ATTRPET+F D  + VNP D+RYK  + K  + PL N+EI+IIAD+YVD  FGTG++K TPAHD ND+++G ++ L  I+  NED + N  A  ++ +    AR   V+ L+  N + K+E  + +VG SERT+  VE  +S QWFVK+   +++ +++QK  + K+ F+PI+FE     WM N++DW ISRQLWWGH+IP WY   K+  KE YVG   PK +  + +D DVLDTWFSS LWP +T     + ++     +PT+ +VTG+DIIFFW+ RM+F +       PFK+  I GLIRD    KMSKSLGNG+DP DVI KYG DALR FL + S+PG+DL +  +K+ S W FINK+WN  RYV MN       E      L   DKWIL++ N       + F+K+ F  + +++ +F WDDF + YIE++K  T N +S L       VL Y++ + L L HP+ PFVT  ++     + +D+  L   D+ KI         E S   +  +I  IR    E K P +  +DI +++ + KL +I    I+ +N      ++ I K+    SL    V +   ++I   E +    N    I +++KE +   +E+ R +G LSN  F+  APK+ +E E+SK    + KL   E  +   K
  S:    20 INMSTKYNPSEIEKGIYDHWQQEELFNPDVDKKLKPAKYADGQPEAYSIVIPPPNVTGKLHLGHAWDTTLQDMLIRQKRMQGYDTLWLPGMDHAGIATQAKVEARLREDGISRYDLGREKFVDKVWQWKDEYASIIKEQWAKMGLSLDFSRERFTLDKGLNEAVRKVFVDLYKKGLIYRGEYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFVDKKFKFNGKNYIEIATTRPETMFGDTAVAVNPSDERYKEIVGKKIVVPLVNREIEIIADQYVDKDFGTGMVKITPAHDPNDFQVGNRHNLPRINTMNEDASMNENAGKYQGMDRFQARKAIVDDLQDGNYMLKIEPIVHSVGHSERTDVQVEARLSTQWFVKMKPLAEQALKMQKQQNDKVDFWPIRFEDTYQTWMNNIHDWVISRQLWWGHRIPAWYRDTKEGEKETYVGLTAPKGDG-WTQDPDVLDTWFSSALWPFSTLGWPDTNNSDYKRFYPTSTMVTGYDIIFFWISRMIFQAKEFTGTRPFKNVLIHGLIRDSKGRKMSKSLGNGIDPMDVINKYGTDALRWFLSTGSTPGQDLNFSNDKMDSAWNFINKIWNVSRYVLMNLETDTKIELPDRNLLTLADKWILSRLNSTIENVTKNFDKFEFGEAGRQLYNFIWDDFADWYIEMTK-ETLNNDSALNKRPVQQVLAYVLDQTLRLLHPIMPFVTEAIWQQLP-QHQDNQSLVIADYPKIDKALNDPQAEKSFTILQDLIVAIRNIRTEAKAPISIPVDILIQIDDEKLEEIFRSNIDYINRFGHPKQLEISKKIQAPSLSMSRVISGATVYIPLAELI----NLDEEINRLQKEAKKFTAEVKRSSGKLSNDKFVHSAPKQVVEAERSKLSDWQKKLNATESRIKELK 914
>gi|19746507|ref|NP_607643.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS8232] >gi|81632599|sp|Q8P040|SYV_STRP8 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|19748714|gb|AAL98142.1| putative valine-tRNA ligase [Streptococcus pyogenes MGAS8232] (882 aa)
Score = 1592, Expect = 9.7e-175, Identities = 355/861 (41%), Positives = 521/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL-EKLLSSHK 872
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+   + +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +    + SI+   +D+  ++   E+      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K     E++   HK
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDDSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLSLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPTVTPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIAEMHK 879
>gi|116491375|ref|YP_810919.1| valyl-tRNA synthetase [Oenococcus oeni PSU-1] >gi|116092100|gb|ABJ57254.1| valyl-tRNA synthetase [Oenococcus oeni PSU-1] (902 aa)
Score = 1592, Expect = 1.1e-174, Identities = 361/871 (41%), Positives = 527/871 (60%)
  Q:     2 VTMSNIKNNNDLSKK-YDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY------YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQK-SSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWY---KKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL------WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL-----KESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILN----TAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + MS   N +++ K  YDH   E+ F+    +K    K       +YSI++PPPNVTG LHLGHA + T+QD LIR   ++G    W+ GMDHAGIATQ K E  LRE+ IS  D  R++ V  +++W     + I+ QW  MG  LD+  E FTL+K  NE V +VFV +Y  GLIYR + ++NWD + ++A+S+IEVI K+ +   Y+++Y      +  N K+Y+ +ATTRPET+F D  + VNP D+RYK  + K  + PL N+EI+IIAD+YVD  FGTG++K TPAHD ND+++G ++ L  I+  NED + N  A  ++ +    AR   V+ L+  N + K+E  + +VG SERT+  VE  +S QWFVK+   +++ +++QK  + K+ F+P++FE     WM N++DW ISRQLWWGH+IP WY   K+  KE YVG   PK +  + +D DVLDTWFSS LWP +T     + ++     +PT+ +VTG+DIIFFW+ RM+F +       PFK+  I GLIRD    KMSKSLGNG+DP DVI KYG DALR FL + S+PG+DL +  +K+ S W FINK+WN  RYV MN       E      L   DKWIL++ N       + F+K+ F  + +++ +F WDDF + YIE++K  T N +S L       VL Y++ + L L HP+ PFVT  ++     + +D+  L   D+ KI         E S   +  +I  IR    E K P +  +DI +++ + KL +I    I+ +N      ++ I K+    SL    V +   ++I   E +    N    I +++KE +   +E+ R +G LSN  F+  APK+ +E E+SK    + KL   E  +   K
  S:     4 INMSTKYNPSEIEKGIYDHWQQEELFNPDVDKKLKPAKYADGQPEAYSIVIPPPNVTGKLHLGHAWDTTLQDMLIRQKRMQGYDTLWLPGMDHAGIATQAKVEARLREDGISRYDLGREKFVDKVWQWKDEYASIIKEQWAKMGLSLDFSRERFTLDKGLNEAVRKVFVDLYKKGLIYRGEYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFVDKKFKFNGKNYIEIATTRPETMFGDTAVAVNPSDERYKEIVGKKIVVPLVNREIEIIADQYVDKDFGTGMVKITPAHDPNDFQVGNRHNLPRINTMNEDASMNENAGKYQGMDRFQARKAIVDDLQDGNYMLKIEPIVHSVGHSERTDVQVEARLSTQWFVKMKPLAEQALKMQKQQNDKVDFWPVRFEDTYQTWMNNIHDWVISRQLWWGHRIPAWYRDTKEGEKETYVGLTAPKGDG-WTQDPDVLDTWFSSALWPFSTLGWPDTNNSDYKRFYPTSTMVTGYDIIFFWISRMIFQAKEFTGTRPFKNVLIHGLIRDSKGRKMSKSLGNGIDPMDVINKYGTDALRWFLSTGSTPGQDLNFSNDKMDSAWNFINKIWNVSRYVLMNLETDTKIELPDRNLLTLADKWILSRLNSTIENVTKNFDKFEFGEAGRQLYNFIWDDFADWYIEMTK-ETLNDDSALNKRPVQQVLAYVLDQTLRLLHPIMPFVTEAIWQQLP-QHQDNQSLVIADYPKIDKALNDPQAEKSFTILQDLIVAIRNIRTEAKAPISIPVDILIQIDDEKLEEIFRSNIDYINRFGHPKQLEISKKIQAPSLSMSRVISGATVYIPLAELI----NLDEEINRLQKEAKKFTAEVKRSSGKLSNDKFVHSAPKQVVEAERSKLSDWQKKLNATESRIKELK 898
>gi|195978584|ref|YP_002123828.1| valyl-tRNA synthetase ValS [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975289|gb|ACG62815.1| valyl-tRNA synthetase ValS [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (883 aa)
Score = 1590, Expect = 1.7e-174, Identities = 354/859 (41%), Positives = 522/859 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQ-------DIKS--LKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  Q        K  K  YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  +G  LDY  + FTL++  ++ V +VFV++Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  + P+ NK I I+ DE+ D  FGTGV+K TPAHD ND+E+G ++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L ++EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K+ F+P +F    + WM N++DW ISRQLWWGHQIP WY  ++ ++YVG + P+ +  + +D DVLDTWFSS LWP +T     TDA   K   FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRD+   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     ++     N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  ++  +    + SI+     +  ++ + E++     +E +  +I  +R    E  +  +K I I        L K SD  +     A +N +K+       +I S  + P+   +  +      L   DLL   N    + +++KE+   + E+      LSN+ F+  A  E ++ E+ K+  ++ K       +KE+EKL+
  S:     2 SKELSPKYNPAEVEAGRYQAWLDQDVFKPSGDKKAK-PYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYAATIKEQWGKLGLSLDYARDRFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGQHVVLPIVNKLIPIVGDEHADPAFGTGVVKITPAHDPNDFEVGGRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKAVVAKLEEIGALVEIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTDDKVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWY-NEAGDMYVGEEAPEGDG-WKQDEDVLDTWFSSALWPFSTMGWPDTDAEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRKPFSNVLIHGLIRDQEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEQ--ATANVEQVVSGAAGNVTDRWILHNLNETIGKVTESFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQY---AEGSIVTAA--YPTVTPVFENAAAHKGVESLKDLIRTVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFKANVNYIKRFTNPERLEIASSIVTPELAMSAVITGAEIFLPLADLL---NVTEELARLEKELAKWQKELDLVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDATVERIKEMEKLV 882
>gi|169188009|ref|ZP_02848166.1| valyl-tRNA synthetase [Paenibacillus sp. JDR-2] >gi|169005033|gb|EDS51887.1| valyl-tRNA synthetase [Paenibacillus sp. JDR-2] (883 aa)
Score = 1588, Expect = 2.8e-174, Identities = 321/863 (37%), Positives = 507/863 (58%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKES--SIEDVLQIINKIRIFNFENKIPNNKVIDIHLEV---LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKE----KHEMKLKELEKLLS 869
           + +   +   YD K  EQ++  +  Q +  K   + +   ++I++PPPNVTG LH+GHAL+ T+QD +IR   ++G    W+ G DHAGIATQTK E+ LRE  +S  D  R++ +  +++W +     IR QW  MG  LDY  E FTL++  ++ V +VFV+++  GLIYR K ++NWD   ++A+S+IEV  KE+  +LY+++Y L +   ++ VATTRPET+  D  + V+P+D+RYK+ I +  + P+  +EI IIADEYV+  FG+G +K TPAHD ND+E+G ++ L  I   +E GT N +A  ++ L  AD R + V+ L++  +  ++E  +  VG SER+ AVVEP +S QWFV +   +++ IE QKS   + F P +FEK  +NW+ N+ DWCISRQLWWGH+IP WY +   E++V  +              +D DVLDTWFSSGLWP +T    +  +     +PT+VLVTG+DI++FWV RM+F +L    ++PFK   + GL+RD    KMSKSLGNGVDP DVIE YGADA+R  + + S+PG+DL +  EKV+    F NK+WN+ R+  MN   F   +     NL   ++WIL++ N+   E  +  + Y F  + + + +F WDD C+ YIE +K          + +   VL Y++ +   L HP  P+++  ++ +   + +   L     +++     E+   +E ++ II  +R    E  +P +K +++ ++        +   ++E I        +  +  +    PD      +        L G  + +  I +++KE+  + SE+ R    L N+ F+ KAP + IE E++K      K +  L  +E+L S
  S:     1 MSDKTTMPTTYDPKAAEQKWYDFWQQGQFFKAGQRPDAKPFTIVIPPPNVTGMLHIGHALDFTLQDIIIRTKRMQGFDTLWLPGTDHAGIATQTKVEQKLREQGLSRYDLGREKFLEQVWDWKELYAGTIREQWGKMGLSLDYSRERFTLDEGLSKAVREVFVRLHEKGLIYRGKKIINWDPAARTALSDIEVEYKELNGHLYHLQYPLKDGSGHITVATTRPETMLGDTAVAVHPEDERYKHLIGQMIVLPVVGREIPIIADEYVEKDFGSGAVKITPAHDPNDFEVGLRHDLPQIIVMDETGTMNEHAGPYQGLDRADCRKQLVKDLQEQGVCIRIEDHVHQVGHSERSGAVVEPYLSTQWFVAMKPLAERAIEAQKSGNGVNFVPDRFEKIYLNWIENVRDWCISRQLWWGHRIPAWYCESCGEMHVAREDVTACAACGSASLRQDEDVLDTWFSSGLWPFSTLGWPEETEDFKRYYPTDVLVTGYDIVYFWVARMIFTALEFTDQIPFKDVLMHGLVRDAEGRKMSKSLGNGVDPLDVIENYGADAMRYMISTGSTPGQDLRFRIEKVEQARNFANKIWNASRFALMNLEGFTSSDIDIKSNLGTAERWILHRLNETVREATRLIDSYEFGETGRILYNFIWDDLCDWYIEFAKLNLYGTDEQAKRATQSVLAYVLDRTQRLIHPFMPYISEEIWQHLPHEGESITLAAWPVYEEALEAPEAVKEMELLMDIIRAVRNVRAEVNVPMSKKVELMIKPSGEAEAAIVSRNEEFIR--RFCGTSSFETGLGLAAPDKAMTAIVTGAELYLPLAGLIDISQEIARLEKELATLNSEVERVEKKLGNEGFVAKAPAKVIEEERAKMADYAGKRDKVLARIEELRS 883
>gi|167465172|ref|ZP_02330261.1| valyl-tRNA synthetase [Paenibacillus larvae subsp. larvae BRL-230010] (853 aa)
Score = 1587, Expect = 4.2e-174, Identities = 329/824 (39%), Positives = 502/824 (60%)
  Q:    44 KNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFK----TKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK----LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +  Y I++PPPNVTG LH+GHAL+ T+QD +IR   ++G  A W+ G DHAGIATQTK E+ LRE  +S  D  R+  +  +++W +     IR QW  MG  LD+  E FTL++  ++ V +VFVK+Y+ GLIYR K ++NWD   ++A+S+IEV  KE++ NLY++ Y L +    + VATTRPET+  D  + V+P+D+RYK+ + K  + P+  +EI +IADEYVD +FG+G +K TPAHD ND+E+G ++ L  I   +E G  N  A  ++ +     R K V  L++  +L ++E+ I  VG SER+ AVVEP +S QWFVK+   ++K IE+QKS K + F P +FEK  ++W+ N+ DWCISRQLWWGH+IP WY     E+ V  +              +D DVLDTWFSS LWP +T    +  D L   FPTNVLVTG+DII+FWV RM+F SL    ++PFK   + GL+RD    KMSKSLGNG+DP +VI++YGADA+R  L +SS+PG+DL +  E+V+    F NK+WN+ R+  MN   FN ++      L   D+WIL++FN+   +  +  ++Y F  + + + +F WDD C+ YIE SK     +    ++    VL Y++   + L HP  PF++  ++ +   +    T+ +       F+    ++E  +  ++ +I  +R    E  +P +K I++ ++  + +    L K  + V    NT+ + I +       PD      +        L G  + A  I +++KE++ +  E++R    L+N+ F+ KAP++ IE EK+K     EK +  +  L +L
  S:     8 REPYMIVIPPPNVTGMLHIGHALDFTLQDIIIRAKRMQGYDALWLPGSDHAGIATQTKVEQKLREEGVSRYDLGREAFLEKVWDWKELYAGTIREQWGKMGLSLDFSRERFTLDEGLSKAVRKVFVKLYDKGLIYRGKYIINWDPAARTALSDIEVEYKEIQGNLYHLEYPLKDGSGSITVATTRPETMLGDAAVAVHPEDERYKDMVGKTLVLPIVGREIPVIADEYVDKEFGSGAVKITPAHDPNDFEVGHRHNLPQILVMDESGKMNAEAGPYQGMDRFVCRKKIVADLKEQGVLIRIEEHIHQVGHSERSGAVVEPYLSTQWFVKMKPLAEKAIEVQKSDKGVHFVPDRFEKIYLHWIENIRDWCISRQLWWGHRIPAWYCNSCGEVTVSGEDVTCCQHCQSNDIRQDEDVLDTWFSSALWPFSTLGWPEQTDDLKRYFPTNVLVTGYDIIYFWVARMIFSSLEFTGQIPFKDVLVHGLVRDAEGRKMSKSLGNGIDPLEVIKQYGADAMRYMLSTSSTPGQDLRFRWERVEQARNFANKIWNASRFALMNLEGFNMEDLDFGGELGTSDRWILHRFNETARDVTRLLDQYEFGETGRLLYNFIWDDLCDWYIEFSKLSLYGDDEQAKKKTQSVLVYVLDHTMRLIHPFMPFISEEIWQHLPHEGETITRTAWPHPDDRFEAPDAVREMVL--LMDLIRAVRNIRAEVNVPMSKKIELLIKPSDAENLNILHKNEEYVRRFCNTSVLEISE---ALASPDKAMTAVVTGAELFLPLAGLIDIAQEIARLEKELQTLHGEVARIEKKLANEGFMAKAPEKVIEEEKAKLADYSEKRDKVIARLAEL 851
>gi|50914656|ref|YP_060628.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS10394] >gi|81822714|sp|Q5XAW8|SYV_STRP6 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|50903730|gb|AAT87445.1| Valyl-tRNA synthetase [Streptococcus pyogenes MGAS10394] (882 aa)
Score = 1586, Expect = 4.6e-174, Identities = 348/861 (40%), Positives = 515/861 (59%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL-EKLLSSHK 872
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEV+ K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  + P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD+   K   FPT+ LVTG+DIIFFWV RM+F SL   +  PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +   +  +     +     +      +E +   I  +R    E  +  +K I I ++  + +L    +  IN +     N  K +I S    P+    + +      L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K     E+++  HK
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVVHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVLLPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDSEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTERQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQYAQGSIVTAAYPTVTPAFENEAAHKGVESLKDFIRAVRNARAEVNVAPSKPITILVKTADSELEDFFNSNINYIKRFT-NPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIVEMHK 879
>gi|89210952|ref|ZP_01189333.1| Valyl-tRNA synthetase, class Ia [Halothermothrix orenii H 168] >gi|89159410|gb|EAR79077.1| Valyl-tRNA synthetase, class Ia [Halothermothrix orenii H 168] (882 aa)
Score = 1586, Expect = 5.4e-174, Identities = 348/853 (40%), Positives = 513/853 (60%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKD------SKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE-DKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR------TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK--LFKISDEVINILNTAKINIVKQDIKSLKPDYVEN---NYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAP-------KEKIELEKSKKEKHEMKLKELE 865
           L K YD    E ++  +  +K   +   K ++ S+SI++PPPN+TG LHLGHAL+ T+QD L R+  +KG +  W+ G DHA IAT+ K    +R+  +      RD  +   +EW +  G  I +Q + +G   D+  E FT+++  +  V +VFV++Y  GLIY+   +VNW     + +S+IEV  +E E  LY+I+Y L +   Y+ VATTRPET+  D  + V+P D RYK+ +    + PL ++EI IIADEYVD +FGTG++K TPAHD ND+E+G+++ L ++   +ED      A  +  L   + R K VE L+K  LLEK+E    +VG   R + V+EP++S+QWFVK+   ++  I + K   K++F P +F K  +NWM N+ DWCISRQLWWGH+IPVWY +D      SKE  V   P    E   +D DVLDTWFSS LWP +T    D  +  D  +PT+VLVTG DIIFFWV RM+F +L    E PFK  YI GLIRD    KMSKSLGNG+DP +V+EKYGADALR  L++ ++PG D+ + EE++++   F NK+WN+ R++ MN+ D +  E D+    L   DKW+L++  K   E  + F KY F  + K + DF W +FC+ YIEL K R         + +  +    +++KIL L HP+ PF+T  ++        +SI++     ++ + I+   E  ++ ++ II  IR    E K+   + I   L     K  L +   E I  L   K   + + ++  KPD V     N +  IL  E ++    E   +E++KKE+E V  EI+R  G L+N+ F+ KAP       +EK++  + KKEK   +LKEL+
  S:     4 LPKTYDPGKVEDKWYEYWEEKGFFEAETKPDRESFSIVMPPPNITGQLHLGHALDNTLQDILTRWKRMKGYNTLWLPGTDHASIATEVKVVDKIRDEGLDKDSLGRDGFLKRAWEWKEEYGGRITSQLRKLGSSCDWSRERFTMDEGCSRAVREVFVELYKRGLIYQGDYIVNWCPDCHTTLSDIEVEHEEKEGKLYHIKYPLKDGDGYITVATTRPETMLGDTAVAVHPGDDRYKDLVGSHVVLPLMDREIPIIADEYVDSEFGTGMVKVTPAHDPNDFEMGQRHDLPLVKVIDEDAKMTEEAGDYAGLDRYECREKVVEDLKKQGLLEKIEDHQHSVGQCYRCDTVIEPLVSKQWFVKMKPLAEPAIRIVKEG-KVRFVPERFSKVYLNWMENIQDWCISRQLWWGHRIPVWYCQDCGETIVSKEEEVKVCPGCGSENLKQDEDVLDTWFSSALWPFSTMGWPDRTEDLDYFYPTDVLVTGRDIIFFWVARMIFMALEFMDEPPFKDVYIHGLIRDALGRKMSKSLGNGIDPLEVVEKYGADALRFMLITGNTPGNDMRFREERLEASRNFANKIWNAARFILMNTDDLDPSEIDENDLKLTLADKWMLSRLQKVIEEVDKAFEKYYFGEAAKVLYDFIWSEFCDWYIELIKPRLYQDKDVMEKRTAQYTGLKVLEKILRLLHPVMPFITEEIWQQLSISNGESIMISSWPEVESELINEEVEEHMQLIMNIIKSIRNIRNEMKVNPGRRITAILNSPTQKLELLEAGAEYIKDLARVKELTITESLQK-KPDKVSTAVVNGVEIILPLEGMVDLEKE---VERLKKEMEKVDFEINRARGKLANEGFVNKAPQHLVEAEREKLKTYQDKKEKLLSRLKELK 882
>gi|168492725|ref|ZP_02716868.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] >gi|183577078|gb|EDT97606.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC3059-06] (883 aa)
Score = 1584, Expect = 8.0e-174, Identities = 355/859 (41%), Positives = 516/859 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE-----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   I+  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+E K+    VL Y + KIL L HP+ PFVT  ++      ++ SI+        L F+ ++    + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGITRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEEEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQI---SEGSIVTAAYPTVNLAFEDLA--AHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVTVARIDEMKKLV 882
>gi|22536625|ref|NP_687476.1| valyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|76797752|ref|ZP_00780019.1| valyl-tRNA synthetase [Streptococcus agalactiae 18RS21] >gi|81455031|sp|Q8E1B5|SYV_STRA5 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|22533463|gb|AAM99348.1|AE014212_7 valyl-tRNA synthetase [Streptococcus agalactiae 2603V/R] >gi|76586900|gb|EAO63391.1| valyl-tRNA synthetase [Streptococcus agalactiae 18RS21] (883 aa)
Score = 1584, Expect = 8.3e-174, Identities = 354/859 (41%), Positives = 525/859 (61%)
  Q:    10 NNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+  ++ E ++  W  Q ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I++QW  MG  +DY  E FTL++  ++ V +VFV +YN G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE    L K++KT  +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    ++WM N++DW ISRQLWWGHQIP WY  +  E+YVG   P+ +  + +D DVLDTWFSS LWP +T     ++ A     FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D+ +  +N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++  +    + SI+L    +++    +      +E +  +I  +R    E  +  +K I I ++  + +L   FK +   I      +   +   I +  L    V     IF L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       ++E++KL+
  S:     2 SKELSPKYNPAEVEEGRYQTWLDQ-DVFKPSGDTEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYNKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDARYKDLIGQNVILPIINKPIPIVADEHADPEFGTGVVKITPAHDPNDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIKKTTHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMENVHDWVISRQLWWGHQIPAWYNVNG-EMYVGEDAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDQAR--ENVEKVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDEKVITRSVLLYTLDQILRLLHPIMPFVTEEIFGQY---AEGSIVLASYPQVNATFENQTAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILVKTSDSELESFFKDNSNYIKRFTNPETLEISSAIATPELAMSSVITGAEIF-LPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKLV 882
>gi|77406180|ref|ZP_00783251.1| valyl-tRNA synthetase [Streptococcus agalactiae H36B] >gi|77175220|gb|EAO78018.1| valyl-tRNA synthetase [Streptococcus agalactiae H36B] (883 aa)
Score = 1584, Expect = 8.5e-174, Identities = 352/859 (40%), Positives = 525/859 (61%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  Q ++ K +  A    YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I++QW  MG  +DY  E FTL++  ++ V +VFV +YN G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE    L K++KT  +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    ++WM N++DW ISRQLWWGHQIP WY  +  E+YVG   P+ +  + +D DVLDTWFSS LWP +T     ++ A     FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D+ +  +N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++  +    + SI+L    +++    +      +E +  +I  +R    E  +  +K I I ++  + +L   FK +   I      +   +   I +  P+   ++ +      L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       ++E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQTWLDQ-DVFKPSGDAEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYNRGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDARYKDLIGQNVILPIINKPIPIVADEHADPEFGTGVVKITPAHDPNDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIKKTTHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMENVHDWVISRQLWWGHQIPAWYNVNG-EMYVGEDAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDQAR--ENVEKVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDEKVITRSVLLYTLDQILRLLHPIMPFVTEEIFGQY---AEGSIVLASYPQVNATFENQTAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILVKTSDSELESFFKDNSNYIKRFTNPETLEISSAIAT--PELAMSSVITGAEIFLPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKLV 882
>gi|15675460|ref|NP_269634.1| valyl-tRNA synthetase [Streptococcus pyogenes M1 GAS] >gi|81533485|sp|Q99YS1|SYV_STRP1 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|13622652|gb|AAK34355.1| putative valine-tRNA ligase [Streptococcus pyogenes M1 GAS] (882 aa)
Score = 1584, Expect = 8.6e-174, Identities = 351/861 (40%), Positives = 520/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ ++ + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     ++ ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +    + SI+   +D+  +    E+      +E +  +I  +R    E  +  +K I I ++  + +L    +  IN +     N  K +I S    P+    + +      L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K    ++ ++  K
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDD-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEDAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPVVRPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITILVKTADSELEDFFNSNINYIKCFT-NPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIAEMK 878
>gi|12045191|ref|NP_073002.1| valyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|1351181|sp|P47576|SYV_MYCGE Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|3844913|gb|AAC71557.1| valyl-tRNA synthetase [Mycoplasma genitalium G37] >gi|166078837|gb|ABY79455.1| valyl-tRNA synthetase [synthetic Mycoplasma genitalium JCVI-1.0] (837 aa)
Score = 1584, Expect = 8.9e-174, Identities = 360/863 (41%), Positives = 521/863 (60%)
  Q:     7 IKNNNDLSKKYDHK-ICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSN-SKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEM--NSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL-WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +K+     K YD   + +  + +W        K+     NS++ +LPPPN+TG LH+GHA   +I D ++RF  ++G S  WI G DHAGIATQTKYEK   +      D   D+K   +  W+ N    I+NQ K++G  L++    FTL +++N++VN  F  +Y +G IY++ TLVNWD KL +AISNIEVI K V  +L+Y+ Y L+N SK  L+VATTRPETIF D CL+VNPKDKRY N+ NK  +NPLT K+I ++ D YVDI+FGTG++KCTPAHDFNDYE+  KYK + +SC + +G  N  A  F+ L +  AR K V++LEKN LL K     SNVGFSER+  VVEPM+S+QWFV + +  K  + L+K      F P +F K + NW+  L  WCISRQL WGH+IPVW++ ++ EI VG KP KN + Y R  DVLDTWFSS LWP+   +  +  D+   T +LVTG+DI+FFWV RM+F S +  K++PFK   I GL+RDE N KMSKSL NG+DP D+I  YGADA+RLFL S+ +PG+DL + E+K+KS W F+NKLWN  ++V    N  + ++D DK    L   + WIL K +K   +  +  +K+   ++ + ++ F WDDFCNT+IE  K   +  + +L +    ++  I IL     PF++  +Y  F  K+            KI  L     + VL  IN +R +  +  + + + + + L   N          +++      + ++  I++ K   V   Y I           ++    ++ ++K+  F +SE+ R   ++ NKSF+EKAPKEK++ E  K E+++ KL E  +L++
  S:     1 MKDKFSFQKNYDFNLVSDGLYEIWNNAGFFKPKD---KNNSFTAILPPPNLTGTLHIGHAFEVSITDQIMRFKKMQGFSINWIPGFDHAGIATQTKYEKIALKENQKYFDADDDKKSEMIMNWALNQSEIIKNQLKSLGVCLNWSETKFTLSEQANKIVNNCFKNLYENGFIYQAYTLVNWDTKLNTAISNIEVINKPVNQHLHYVVYKLANDSKQELIVATTRPETIFADVCLLVNPKDKRYTNFWNKLVVNPLTGKQIPVVTDSYVDIKFGTGILKCTPAHDFNDYEINTKYKFDFLSCIDSNGILNQNASKFQGLSVLQARNKIVKWLEKNKLLVKSIPLTSNVGFSERSGTVVEPMLSKQWFVDLPKL-KDHLYLKKYP---DFIPKRFNKQVSNWLNKLKPWCISRQLIWGHKIPVWFENNTGEIVVGEKPSKNLQNYTRSKDVLDTWFSSSLWPLICLN-WEQDDSFHETELLVTGYDILFFWVLRMLFNSFFETKKLPFKTVLIHGLVRDEQNRKMSKSLNNGIDPVDLIRNYGADAVRLFLCSNHTPGDDLIFSEQKIKSAWNFLNKLWNVTKFVIQLENDQEISYDLDK----LSLSETWILAKLDKVIQKITKLLDKFQLALANQILVKFVWDDFCNTFIEAIKKEPNQLKPQLFYTAKSVLSNIAILLSITVPFLSERIYQQFNNKSVMQATWPLATKIKIPKL----FDLVLAAINDLRNYRKQYMLNSQQKLVVILSGKN---------AVDVKQYFNFSWIELKIETNKK--VSFKYQIV----------DDTTQRLKSLQKQQAFFESEVKRSQAIVKNKSFLEKAPKEKVKSEFLKLEEYQKKLTETNQLIA 831
>gi|94988916|ref|YP_597017.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94992808|ref|YP_600907.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS2096] >gi|94542424|gb|ABF32473.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS9429] >gi|94546316|gb|ABF36363.1| Valyl-tRNA synthetase [Streptococcus pyogenes MGAS2096] (882 aa)
Score = 1584, Expect = 9.3e-174, Identities = 353/861 (40%), Positives = 519/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +    + SI+   +D+  +    E+      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K    ++ ++  K
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPVVRPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LVRLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIAEMK 878
>gi|148990086|ref|ZP_01821340.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] >gi|147924612|gb|EDK75699.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73] (883 aa)
Score = 1584, Expect = 9.5e-174, Identities = 355/859 (41%), Positives = 516/859 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE-----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   I+  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+E K+    VL Y + KIL L HP+ PFVT  ++      ++ SI+        L F+ ++    + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGITRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEEEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQI---SEGSIVTAAYPTVNLAFEDLA--AHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGSEIFLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVTVARIDEMKKLV 882
>gi|56807922|ref|ZP_00365746.1| COG0525: Valyl-tRNA synthetase [Streptococcus pyogenes M49 591] (882 aa)
Score = 1583, Expect = 1.3e-173, Identities = 352/861 (40%), Positives = 518/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ A VEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +    + SI+   +D+  +    E+      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K    ++ ++  K
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAAVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEQAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPVVRPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKSEVVQKEKDKQADYQAKYDATQERIAEMK 878
>gi|71903958|ref|YP_280761.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] >gi|90108441|sp|Q48SA4|SYV_STRPM Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|71803053|gb|AAX72406.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS6180] (882 aa)
Score = 1582, Expect = 1.4e-173, Identities = 353/861 (40%), Positives = 519/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KI+ L HP+ PFVT  +Y  +    + SI+   +D+  +    E+      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E I+ EK K+  ++ K    ++ ++  K
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDNRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKIVRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPVVRPAFENEAAHKGVERLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVIQKEKDKQADYQAKYDATQERIAEMK 878
>gi|94990882|ref|YP_598982.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] >gi|94544390|gb|ABF34438.1| Valyl-tRNA synthetase [Streptococcus pyogenes MGAS10270] (882 aa)
Score = 1582, Expect = 1.7e-173, Identities = 353/861 (40%), Positives = 518/861 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L   +  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +    + SI+   +D+  +    E+      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K    ++ ++  K
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQANVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPVVRPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAASELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIAEMK 878
>gi|76786857|ref|YP_329179.1| valyl-tRNA synthetase [Streptococcus agalactiae A909] >gi|90108440|sp|Q3K2S4|SYV_STRA1 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|76561914|gb|ABA44498.1| valyl-tRNA synthetase [Streptococcus agalactiae A909] (884 aa)
Score = 1580, Expect = 2.5e-173, Identities = 349/851 (41%), Positives = 516/851 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           + +LS KY+    E  ++  W  Q ++ K +  A    YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I++QW  MG  +DY  E FTL++  ++ V +VFV +YN G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE    L K+EK   +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    ++WM N++DW ISRQLWWGHQIP WY  +  E+YVG   P+ +  + +D DVLDTWFSS LWP +T     ++ A     FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D+ +  +N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++  +    + SI+L    +++    +      +E +  +I  +R    E  +  +K I I ++  + +L   FK +   I      +   +   I +  P+    + +      L   DLL    E   + +++KE+   + E++     LSN+ F+  A  E ++ EK K+  ++ K
  S:     2 SKELSPKYNPAEVEAGRYQTWLDQ-DVFKPSGDAEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYNRGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPIINKPIPIVADEHADPEFGTGVVKITPAHDPNDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIEKMTHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMENVHDWVISRQLWWGHQIPAWYNVNG-EMYVGEDAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDQAR--ENVEKVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDEKVVTRSVLLYTLDQILRLLHPIMPFVTEEIFGQY---AEGSIVLASYPQVNATFENQTAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILVKTSDSELESFFKDNSNYIKRFTNPETLEISSAITA--PELAMTSIITGAEIFLPLADLLNVEEE---LARLEKELAKWQKELNMVGKKLSNERFVANAKPEVVQKEKDKQTDYQTK 867
>gi|148983947|ref|ZP_01817266.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] >gi|147924094|gb|EDK75206.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP3-BS71] (883 aa)
Score = 1580, Expect = 2.7e-173, Identities = 351/859 (40%), Positives = 510/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+   +    F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVVHDNVTKVATGEAGNVTDRWILHNLNETIGKATANFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDATVARIDEMKKLV 882
>gi|146318113|ref|YP_001197825.1| valyl-tRNA synthetase [Streptococcus suis 05ZYH33] >gi|146320294|ref|YP_001200005.1| valyl-tRNA synthetase [Streptococcus suis 98HAH33] >gi|145688919|gb|ABP89425.1| Valyl-tRNA synthetase [Streptococcus suis 05ZYH33] >gi|145691100|gb|ABP91605.1| Valyl-tRNA synthetase [Streptococcus suis 98HAH33] (883 aa)
Score = 1579, Expect = 3.3e-173, Identities = 351/859 (40%), Positives = 524/859 (61%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  Q ++ K +  A    YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  ++  D  R++ +  ++EW       IR QW  +G  LDY+ + FTL++  ++ V +VFV++Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  L++   L ++E  + +VG SERT  VVEP +S QWFVK+ + +K  I  Q ++ K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  +S E+YVG + P  +  +V+D DVLDTWFSS LWP +T        A     FPT+ LVTG+DII FWV RM+F  +    + PFK+  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + +IL L HP+ PFVT  ++  +    + SI++    +  ++   E++     +E +  +I  +R    E  +  +K I I ++  + +L   FK ++  I      +   +   I +  L    V     IF L   DLL    E   + ++ KE+   + E+      LSN+ FI  A  E +E EK K+  ++ K       ++E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQTWLDQ-DVFKPSGDAEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGVTRYDLGREKFLDKVWEWKDEYAATIREQWGKLGLSLDYQRDRFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKPIPIVADEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKATVAKLQELGALVEIENRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTADKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWY-NESGEMYVGEEAPAGDG-WVQDEDVLDTWFSSALWPFSTMGWPDENAADFQRYFPTSTLVTGYDIIPFWVSRMIFQGIEFTGKSPFKNALIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDAAR--ENVAKVAAGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVMTRSVLLYTLDQILRLLHPIMPFVTEEIFAQY---AEGSIVVAA--YPVVNPAFENAEAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILIKTADSELETFFKANENYIRRFTNPEQLEISSSIAAPELAMSAVITGAEIF-LPLADLLNVEEE---LARLDKELVKWQKELDMVGKKLSNERFIANAKPEVVEKEKEKQADYQAKYDATVARIEEMKKLV 882
>gi|21910809|ref|NP_665077.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS315] >gi|28895501|ref|NP_801851.1| valyl-tRNA synthetase [Streptococcus pyogenes SSI-1] >gi|81759036|sp|Q8K6M9|SYV_STRP3 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|21905014|gb|AAM79880.1| putative valine-tRNA ligase [Streptococcus pyogenes MGAS315] >gi|28810747|dbj|BAC63684.1| putative valine-tRNA ligase [Streptococcus pyogenes SSI-1] (882 aa)
Score = 1578, Expect = 4.8e-173, Identities = 347/857 (40%), Positives = 514/857 (59%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   I+  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F +L      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     +E ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +   +  +     +     +      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGQGITRYDLGREKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQTLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEEAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQYAQGSIVTAAYPTVTPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIAEMQKLV 881
>gi|194398081|ref|YP_002037231.1| valyl-tRNA synthetase [Streptococcus pneumoniae G54] >gi|194357748|gb|ACF56196.1| valyl-tRNA synthetase [Streptococcus pneumoniae G54] (883 aa)
Score = 1577, Expect = 5.6e-173, Identities = 353/859 (41%), Positives = 515/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE-----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   I+  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + +NP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAH  ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+E K+    VL Y + KIL L HP+ PFVT  ++      ++ SI+        L F+ ++    + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPADVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGITRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAINPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHXPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEEEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQI---SEGSIVTAAYPTVNLAFEDLA--AHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVTVARIDEMKKLV 882
>gi|94994796|ref|YP_602894.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS10750] >gi|94548304|gb|ABF38350.1| Valyl-tRNA synthetase [Streptococcus pyogenes MGAS10750] (882 aa)
Score = 1577, Expect = 6.5e-173, Identities = 349/849 (41%), Positives = 513/849 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   I+  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     ++ ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KI+ L HP+ PFVT  +Y  +    + SI+   +D+  +    E+      +E +  +I  +R    E  +  +K I I        L K +D  +    T+ +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E I+ EK K+  ++ K
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGQGITRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKHVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEDAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKIVRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPVVRPAFENEAAHKGVERLKDLIRAVRNARAEVNVAPSKPITI--------LVKTADSELEDFFTSNVNYIK---RFTNPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVIQKEKDKQADYQAK 866
>gi|162447403|ref|YP_001620535.1| valyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] >gi|161985510|gb|ABX81159.1| valyl-tRNA synthetase [Acholeplasma laidlawii PG-8A] (859 aa)
Score = 1575, Expect = 8.7e-173, Identities = 345/860 (40%), Positives = 522/860 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNK-KNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNF--DEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN---QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLF---KISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSH 871
           +L  KYD K  E+ ++  W  +      K+L  NK  +++++PPPNVTG LHLGHA +  IQD +IR   ++G  A ++ GMDHAGIATQ + +  L+   IS  D  R++ +   +EW +    +IR QWK +G  LDY  E FTL++K NE VN+VF+ +YN G IYR   ++NWD + ++A+SNIEV  +E + NLY+  Y   +    L +ATTRPET+F D+ L+V+P+D+RYK YI K    P TN +I +I D+YVD  FGTGV+K TPAHD NDYE+ K++ L +  C NEDGT N  A+ +      + R   V+ L+  NL  KVE     VG+SERT  +VEP +S QWFV +   +++ +++     ++ F P +F+    NW+ N+ DW ISRQLWWGH+IP W+K D  E+ V  + P  +  + +D DVLDTWFSS LWP +T       D  F    PT+VLVTG+DIIFFWV RMMF  L   K+ PFK   + GLIRDE   KMSKSL NGVDP DVI+KYG DALR F++S+++PG+D  Y   K++S W FINKLWN  R+V +N  D +   DED+    L  FDKWIL + ++  +E  + + ++ F  + + + +F W++F N Y+E+SK    +   +++   VL Y++K IL L HP  PFVT  LY       ++S+++ +    K    +   ++++  +I K+R    E ++  +K ID+ LE+ + ++    K+ +  +      K    +  + S    ++   ++   + K D++    E  ++ K K  +E    E+ R  G+LSN +F  KAP+ KI++E+ K + ++ +  ++ ++L  +
  S:     4 ELQTKYDFKSVEEGRYDFWLKEGFFESGKDL--NKTPFTVVIPPPNVTGKLHLGHAWDTAIQDIIIRRKRMQGFDALYLPGMDHAGIATQARIDDRLKSQGISRYDLGREKYLVKAWEWKEEYSLHIRAQWKALGLSLDYTKERFTLDEKLNEAVNKVFITLYNKGWIYRGYRIINWDCQAKTALSNIEVEYEETQGNLYHFTYPFVDMDGGLTIATTRPETMFADQALMVHPEDERYKKYIGKLVYIPGTNTKIPVIEDDYVDKAFGTGVVKVTPAHDPNDYEVAKRHNLEMPLCMNEDGTMNELALKYVGQDRFECRKNVVKDLQALNLCPKVEPYTHQVGYSERTGVMVEPRLSLQWFVDMKGLTEQTLKMN----QVNFVPERFKNTFENWLNNIQDWTISRQLWWGHRIPAWFKGD--EVKVQVESPGVD--WTQDEDVLDTWFSSALWPFSTLGWPNEDDPNFKRYYPTDVLVTGYDIIFFWVARMMFQGLEFTKKDPFKTVLLHGLIRDEQGRKMSKSLNNGVDPMDVIDKYGVDALRFFIVSNAAPGQDTRYDITKIESSWNFINKLWNITRFVSLNIKDKSLVIDEDR----LNVFDKWILTRLSETITEADKYYERFEFNEASRVLTNFIWEEFANWYLEISKVSLQDPKIEQNTQAVLIYVLKDILKLLHPFLPFVTDKLY--MDIFNENSVMIAQWPVVKYKFNQIDLVKEIQDVIVKVRNLRNEYQVAPSKPIDVTLEIKSMEMIEEVKLYENYLTKFLNTKALAYETSVDSSDMIFIAGTHINIYIEKSDMIDLEQEKASLLKQKDTLE---KELERSKGLLSNVNFTSKAPQAKIDIEQRKYDDYKKQYDDVVEMLKKY 858
>gi|169832567|ref|YP_001694056.1| valyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] >gi|168995069|gb|ACA35681.1| valyl-tRNA synthetase [Streptococcus pneumoniae Hungary19A-6] (883 aa)
Score = 1575, Expect = 1.1e-172, Identities = 349/859 (40%), Positives = 511/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVI+KYG D+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  ++D +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIDKYGTDSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVTEEIFDQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKNLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVTVARIDEMKKLV 882
>gi|168482808|ref|ZP_02707760.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] >gi|172043865|gb|EDT51911.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00] (883 aa)
Score = 1573, Expect = 1.8e-172, Identities = 348/859 (40%), Positives = 510/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   +  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ E+ K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVIAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDATVARIDEMKKLV 882
>gi|149021523|ref|ZP_01835578.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] >gi|147930219|gb|EDK81204.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP23-BS72] (883 aa)
Score = 1573, Expect = 1.8e-172, Identities = 350/859 (40%), Positives = 511/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAIAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNIMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVTVARIDEMKKLV 882
>gi|182683501|ref|YP_001835248.1| valyl-tRNA synthetase [Streptococcus pneumoniae CGSP14] >gi|182628835|gb|ACB89783.1| valyl-tRNA synthetase [Streptococcus pneumoniae CGSP14] (883 aa)
Score = 1572, Expect = 2.4e-172, Identities = 349/859 (40%), Positives = 511/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   +  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVIAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDATVARIDEMKKLV 882
>gi|149012557|ref|ZP_01833554.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] >gi|147763362|gb|EDK70299.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP19-BS75] (883 aa)
Score = 1571, Expect = 2.8e-172, Identities = 349/859 (40%), Positives = 511/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   +  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVIAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVTVVRIDEMKKLV 882
>gi|148998241|ref|ZP_01825710.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|168576529|ref|ZP_02722403.1| valyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] >gi|147755884|gb|EDK62928.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP11-BS70] >gi|183577726|gb|EDT98254.1| valyl-tRNA synthetase [Streptococcus pneumoniae MLV-016] (883 aa)
Score = 1571, Expect = 3.2e-172, Identities = 349/859 (40%), Positives = 511/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  ++ EIYVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ E+ K+  ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVRDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTDDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWY-NEAGEIYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDATVARIDEMKKLV 882
>gi|15900480|ref|NP_345084.1| valyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] >gi|111657453|ref|ZP_01408202.1| hypothetical protein SpneT_02001347 [Streptococcus pneumoniae TIGR4] >gi|81532202|sp|Q97S45|SYV_STRPN Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|14972043|gb|AAK74724.1| valyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] (883 aa)
Score = 1570, Expect = 3.4e-172, Identities = 352/859 (40%), Positives = 514/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE-----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   I+  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D + GTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  ++      ++ SI+        L F+ ++    + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ E  K+  ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGITRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVNLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPELGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQI---SEGSIVTAAYPTVNLAFEDLA--AHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKECDKQADYQAKYDATVARIDEMKKLV 882
>gi|149002240|ref|ZP_01827182.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] >gi|147759555|gb|EDK66546.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP14-BS69] (883 aa)
Score = 1569, Expect = 4.4e-172, Identities = 349/859 (40%), Positives = 509/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ E  K+  ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAIAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNIMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKECDKQADYQAKYDATVARIDEMKKLV 882
>gi|168333858|ref|ZP_02692101.1| valyl-tRNA synthetase [Epulopiscium sp. 'N.t. morphotype B'] (877 aa)
Score = 1569, Expect = 5.0e-172, Identities = 340/852 (39%), Positives = 509/852 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN----EELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE-----SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL----KESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL---EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYL---IFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           L K YD  + E++ +  W      +++ +  +K  ++I++PPPN+TG LH+GHAL+ T+QD L R+  + G +  W+ G DHA IAT+ K    L+E  I   D  RDE +   ++W    G  I  Q + +G   D++ E FT++   +  V  VF+K+Y  G IY+   ++NW    +++IS+ EVI +E E N Y++ Y +  S + +  ATTRPET+  D  + VNP DKRY + + K  + P  N+EI +IADEYVD++FGTGV+K TP HD ND+E+G+++ L  I   N+DGT N  A  F  + +A AR   ++ L+K   L+K+E  + NVG  +R N V+EPM+ EQWFVK+   ++  IE  KS  ++ F P +F K  + W+ N+ DW ISRQLWWGH+IP +Y +   E+ V +  P         +V+D D LDTWFSS LWP +T    ++   L   +PT+VLVTG+DIIFFWV RM+F  +    EVPFK   I GLIRD    KMSKSLGNG+DP DVI++YGADALRL L++ ++PG D+ +  E+V+    F+NKLWN+ R++ MN  + + D    PKNL   DKWIL+K N   +   +  +KY   +++ K+ DF W++FC+ YIE+ K R  + +     + L+ L  ++  IL + HP  PFVT  ++   +  T++SI++       I+N     +E+ IE +   + ++R    E  +P +K   I++   +     +F     V   L  A   +VK D  S++ D V    L   I+I   E L+    E   IE++ KE    +SEI+R +  L N  FI+KAP   IE EK KK K++  L E+
  S:     2 LEKTYDPSLVEERLYKKWENLGYFHQE-VDKSKKPFTIMMPPPNITGQLHMGHALDNTLQDILTRYKRMXGYNTLWMPGTDHASIATEVKIVNKLKEEGIDKNDLGRDEFLKRAWQWKDEYGGLITQQLRKLGSSCDWDRERFTMDAGLSAAVEAVFIKLYEKGYIYKGSRIINWCPVCKTSISDAEVIHEEREGNFYHLNYKIVGSDEVIRFATTRPETLLGDTAIAVNPNDKRYAHLVGKTVLVPFVNREIPVIADEYVDMEFGTGVVKITPYHDPNDFEVGQRHGLAEICVINDDGTMNENAAQFAGMTLAQARTAILDALQKIGQLDKIEPHVHNVGIHDRCNCVIEPMIKEQWFVKMKAMAEPAIEALKSG-ELNFVPERFGKTYLRWLENIRDWXISRQLWWGHRIPAYYCQKCGEVIVSSTKPSQCKCGHTEFVQDKDTLDTWFSSALWPFSTLGWPETTAELAHFYPTSVLVTGYDIIFFWVVRMVFSGIEQMGEVPFKDVLIHGLIRDSEGRKMSKSLGNGIDPLDVIKQYGADALRLTLVTGNAPGNDMRFYFERVEGNRNFLNKLWNATRFILMNCENEDIDLCTMPKNLTTTDKWILSKANNLTTIVTENLDKYELGMAVGKVYDFAWEEFCDWYIEMVKPRLYDNDDLTRPAALYTLKTVMIDILKMLHPFIPFVTEEIFMGLQ-NTENSIMISSWP-TFIANRSFVDEENEIETIKNAVRQVRNLRTEMNVPPSKKAKIYVVSDDEAVRSIFTNGAIVFKTLAFAAEVLVKADTASIEKDAVSVIVLGATIYIPLSE-LVDIRKE---IERLTKEQYKYESEIARVDKKLGNAGFIKKAPPSLIEEEKLKKAKYKQLLVEV 868
>gi|15902536|ref|NP_358086.1| valyl-tRNA synthetase [Streptococcus pneumoniae R6] >gi|116516342|ref|YP_816000.1| valyl-tRNA synthetase [Streptococcus pneumoniae D39] >gi|81450080|sp|Q8DQU7|SYV_STRR6 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|15458063|gb|AAK99296.1| Valyl-tRNA synthetase [Streptococcus pneumoniae R6] >gi|116076918|gb|ABJ54638.1| valyl-tRNA synthetase [Streptococcus pneumoniae D39] (883 aa)
Score = 1569, Expect = 5.5e-172, Identities = 349/859 (40%), Positives = 510/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N     F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAIAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNIMNDDGTMNELVFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDVTVARIDEMKKLV 882
>gi|149005678|ref|ZP_01829417.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] >gi|147762618|gb|EDK69578.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP18-BS74] (883 aa)
Score = 1567, Expect = 8.5e-172, Identities = 347/859 (40%), Positives = 510/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVI+KYG D+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  ++  +   +  +     ++         + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ E+ K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIDKYGTDSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQYAEGSIVTAAYPTVNPAFEDLAAHTGVESLKNLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDATVARIDEMKKLV 882
>gi|15895665|ref|NP_349014.1| valyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] >gi|81529863|sp|Q97GG8|SYV_CLOAB Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|15025413|gb|AAK80354.1|AE007740_1 Valyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824] (881 aa)
Score = 1567, Expect = 9.0e-172, Identities = 339/866 (39%), Positives = 520/866 (60%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNY-LIKKILI----LFHPMCPFVTSNLYDNF--KFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNK--VIDIHLEVLNPKLFKISDEVINILNTA-KINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +K  ++++K YD K  E +   W  ++      +  NK  Y+I++PPPN+TG LHLGHAL+  +QD +IR   ++G  A W+ G DHA IAT+ + EK + +  ++ K+  R++ +  +++W++     I+ Q K +G   D+  E FT+++K N+ V  VFVK+Y DGLIY+   + NW  K Q+A+S+ E+  KE +   ++I+Y +     ++ +ATTRPET+  D  + VNPKD+RYK +I K  + PL  ++I ++AD+YVD++FGTG +K TPAHD NDYE+GK++ L  I   N DGT       +  +   +AR   V  L++   L K+++ + NVG  +R   ++EPM+S+QW+VK+   +K  IE  K+ K  +F P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  EI V  K PK     N E   +D DVLDTWFSS LWP +T    D  +  +  +PT+ LVTG+DIIFFWV RM+F  +Y   EVPFKH YI GL+RD    KMSKSLGNGVDP DVI+ +GADALR  L++ ++PG D+ Y  EKV++   F NK+WN+ R+V MN      D+ K  +     D+WIL++ N    E      K+   ++ +K+ DF W++FC+ YIEL K     ++ K   + Y ++ K+L     L HP+ P++T  +Y +   ++K          + K  +   E+++  +++ I  IR    E  +P +K   + I  E  N   F++ +     L  A  ++ +K      K +  EN         E    LL   +    IE++ KE + +K+EI R +  LSNK F++KAP+  +E E+ K EK++  L+ +E+ +++ K
  S:     1 MKEFDEMAKTYDPKEFEDRIYKWWEEEGFFTPKVDKNKKPYTIMMPPPNITGKLHLGHALDCALQDFMIRAKRMQGYEALWLPGQDHASIATEVRVEKEILKEGLNKKEMGREKFLERVWDWTKEYRERIKGQQKKLGVSADFTRESFTMDEKLNKAVRTVFVKLYEDGLIYQGNRITNWCPKCQTALSDAEIEYKEDQGFFWHIKYPVEGEDSFIEIATTRPETMLGDTAVAVNPKDERYKEFIGKLLVLPLLGRKIPVVADDYVDMEFGTGAVKITPAHDPNDYEVGKRHDLKEIVMLNNDGTIKEGFGKYSGMDRYEARKAIVSDLKEEGYLVKIKEHVHNVGTHDRCGNIIEPMVSKQWYVKMESLAKPAIEAVKAGKT-KFVPERFDKIYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEIIVSEKEPKACSKCNSENLEQDKDVLDTWFSSALWPFSTLGWPDKNEDLEYFYPTDTLVTGYDIIFFWVARMVFSGIYNMGEVPFKHVYIHGLVRDAEGRKMSKSLGNGVDPLDVIDTFGADALRFMLITGNAPGNDIRYKTEKVEAARNFANKIWNASRFVLMNLDKEIMDKYKDLEEYSLADRWILSRCNSLVREVTDNIEKFELGIASQKVYDFMWNEFCDWYIELVKPVMYGEDEKAKGIAYNVLYKVLTVGLQLLHPVMPYITEEIYQHLGGEYKAIAISAWPTYEEKLKNETSENAMNQIIEAIKSIRNVRAEMNVPPSKKAKVMIFTEAENKAAFEMGEHYFEKLAYASSVSFLKS-----KDEAPENAVSSVTKGAELFMPLLDLIDVTKEIERLSKEKDKLKAEIQRVDKKLSNKGFVDKAPESVVEAERVKGEKYKKMLEAVEERIAALK 881
>gi|55736545|gb|AAV60187.1| valyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] (901 aa)
Score = 1565, Expect = 1.5e-171, Identities = 355/867 (40%), Positives = 527/867 (60%)
  Q:     2 VTMSNIKNNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSIL-----LERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           +T  +   + +LS KY+    E  ++  W  +        K  K  YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V+ LE+   L ++EK   +VG SERT   VEP +S QWFVK+ + +K  I  Q +  K+ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PFK+  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+   +  + F+K+ F V+   + +F WD+F + Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++      ++ SI+     + R +F+  +    + +E +  +I  +R    E  +  +K I I ++  + KL    ++ IN +    N   + I   D++   PD V ++ +      L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ E+ K++ ++ K       + E++KL+
  S:    12 ITRKDTHMSKELSPKYNPAEVEAGRYQKWLDEDVFKPSGDKKAK-PYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAESGISRYDLGREKFLDKVWEWKDEYAATIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGKNVILPILNKPIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFNGMDRFEARKAIVKKLEEIGALVEIEKMTHSVGHSERTGVPVEPRLSTQWFVKMDQLAKNAIANQDTDDKVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WKQDEDVLDTWFSSALWPFSTMGWPDVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFKNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVAR--ENVAKVAAGQAGNVTDRWILHNLNETIRKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSDNEDEKVITRSVLLYTLDQILRLLHPIMPFVTEEIFGQI---SEGSIVTAEYPVARPEFE--NEEAAAGVEALKDVIRSVRNSRAEVNVAPSKPITILIKTSDSKLDAFFNDNINYIKRFTNPEHLEIAA-DVEV--PDLVMSSIITGAEIYLPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQKDYQAKYDAIVVRIDEMKKLV 900
>gi|157151226|ref|YP_001449942.1| valyl-tRNA synthetase [Streptococcus gordonii str. Challis substr. CH1] >gi|157076020|gb|ABV10703.1| valyl-tRNA synthetase [Streptococcus gordonii str. Challis substr. CH1] (882 aa)
Score = 1563, Expect = 2.2e-171, Identities = 351/857 (40%), Positives = 518/857 (60%)
  Q:    12 DLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE---------DKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLD-----FKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N+ A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     ++         +K   N+ D   WIL+  N+   +  + F+K+ F V+   + +F WD+F + Y+EL+K    + N+E K+    VL Y + KIL L HP+ PFVT  ++      ++ SI+          F+ ++    + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E +  I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ E+ K+  ++ K       + E++KL+
  S:     3 ELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGREKFLEKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNDLAFEFAGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEQATANVEKVVNKEAGNVTDC--WILHNLNETIGKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSDNEEEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQI---SEGSIVTAEYPTVNPAFEDLA--AHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEISSNIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDATVARIDEMKKLV 881
>gi|55738435|gb|AAV62076.1| valyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] (901 aa)
Score = 1562, Expect = 3.3e-171, Identities = 354/867 (40%), Positives = 525/867 (60%)
  Q:     2 VTMSNIKNNNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDF--KKISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           +T  +   + +LS KY+    E  ++  W  +        K  K  YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V+ LE+   L ++EK   +VG SERT   VEP +S QWFVK+ + +K  I  Q +  K+ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PFK+  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+   +  + F+K+ F V+   + +F WD+F + Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++      ++ SI+         +  N + ++ +E +  +I  +R    E  +  +K I I ++  + KL    ++ IN +    N   + I   D++   PD V ++ +      L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ E+ K++ ++ K       + E++KL+
  S:    12 ITRKDTHMSKELSPKYNPAEVEAGRYQKWLDEDVFKPSGDKKAK-PYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAESGISRYDLGREKFLDKVWEWKDEYAATIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGKNVILPILNKPIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFNGMDRFEARKAVVKKLEEIGALVEIEKMTHSVGHSERTGVPVEPRLSTQWFVKMDQLAKNAIANQDTDDKVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WKQDEDVLDTWFSSALWPFSTMGWPDVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFKNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVAR--ENVAKVAAGQAGNVTDRWILHNLNETIGKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSDNEDEKVITRSVLLYTLDQILRLLHPIMPFVTEEIFGQI---SEGSIVTAEYPVVCPEFENEEAAAGVEALKDVIRSVRNSRAEVNVAPSKPITILIKTSDSKLDAFFNDNINYIKRFTNPEHLEIAA-DVEV--PDLVMSSIITGAEIYLPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQKDYQAKYDAIVVRIDEMKKLV 900
>gi|13508219|ref|NP_110168.1| valyl-tRNA synthetase [Mycoplasma pneumoniae M129] >gi|2501066|sp|P75304|SYV_MYCPN Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|1674039|gb|AAB96009.1| valyl-tRNA synthetase [Mycoplasma pneumoniae M129] (838 aa)
Score = 1561, Expect = 4.3e-171, Identities = 329/829 (39%), Positives = 500/829 (60%)
  Q:    41 KANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS-KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYV-EMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVL-NYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSI-EDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           + NK  ++ +LPPPN+TG LH+GHA   +I D ++RF  L+G    WI G DHAGIATQTKYEK  RE         R +KV  + +W+   G+ I++Q K++G  L++   +FTL KK++++VN  F++++  G IY+++TLVNWD KL +AISNIEVI K V+  LYYI Y L+N+ K  L+VATTRPETIFVD CL V+PKDK Y +++ +  +NPLT   + +  D YVD +FGTGV+KCTPAHDFND+ L +KY+L  +SC + +G  N +A  F  L ++ AR + VE+L+   LL K     SNVGFSER++ VVEP++S+QWFV + +  K +   +      +  P +F K +  W++ L  WCISRQL WGH IPVW  K S  ++VG+  P +++ Y +  DVLDTWFSS LWP+   D  K+K    PT++LVTG+DI+FFWV RM F S +  K++PFK   I GL+RD  N KMSKSL NG++P D+I  YGADA RLFL S+ +PG+DL + E+K+KS   F+NKLWN  +YV ++            P  L   ++WI  K  +   +  +  +KY   ++ + +++F W+DFCNT+IE  K   +    +L+     ++   +++   + PF+   +Y  F      S  + +  +     +K   +  DV++ ++ +R +   N++  N+ + +   VL+ K   +      + N    N V   I+  K       + I I+        +N ANN+  ++K+  F  +E+ R   + +N +F++KAP  K++ E  K E+++ KL E+  L++
  S:    33 QKNKVPFTAILPPPNLTGTLHIGHAFEVSITDQIMRFKRLRGYGVNWIPGFDHAGIATQTKYEKLARETNPEYFQAPRKQKVKMIMDWALTQGDTIQSQIKSLGASLNWNQVNFTLSKKASQIVNDSFIQLFEQGFIYQAETLVNWDTKLNTAISNIEVINKPVDQQLYYIAYKLANNPKKRLVVATTRPETIFVDVCLFVHPKDKHYHSFVKQKVVNPLTGALMPVFTDSYVDKKFGTGVLKCTPAHDFNDFALNEKYRLPFVSCIDHNGLLNEHAKQFTGLTVSAARQQVVEFLQTQKLLVKTMPLTSNVGFSERSDTVVEPLLSKQWFVDLPKLKKALAIKKYP----ELIPKRFNKQVTRWLSQLKPWCISRQLIWGHPIPVWTHKQSGALHVGSTAPTDKQNYTQSTDVLDTWFSSSLWPLICLDWHKNKH-FVPTDLLVTGYDILFFWVLRMTFNSYFQTKQLPFKQVLIHGLVRDAQNRKMSKSLNNGINPMDLIRDYGADATRLFLTSNHTPGDDLIFNEQKLKSAANFLNKLWNVTKYVLQLGEQAKTVPSTHLPSTLS--ERWIWAKLKQLIVQTTKLLDKYQLALANQALVNFIWNDFCNTFIETIKQEDTALLPQLYTTAKTVLSTAVVMLSTVTPFLAERIYQQFH-----SGSVMQASWPTAKAVKPPKLFADVVEAVSSLRHYKANNQLVANQNLAV---VLSGKAAPV------VQNYFHFNWVDLRIEVNKTP----GFQIKIV--------DNAANNLAHLEKQRSFYLAEVQRSQAITTNPAFLKKAPPHKVKAELLKLEEYQKKLAEVNHLIA 832
>gi|168490541|ref|ZP_02714684.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] >gi|183574795|gb|EDT95323.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04] (883 aa)
Score = 1560, Expect = 5.6e-171, Identities = 348/859 (40%), Positives = 512/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLD--FKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   I+  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D + GTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L H + PFVT  ++  +   +  +     ++  F+ ++    + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + ++ KE+   + E+      LSN+ F+  A  E ++ E  K+  ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGITRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVNLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPELGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHSIMPFVTEEIFGQYAEGSIVTAAYPTVNPVFEDLA--AHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQKECDKQADYQAKYDATVARIDEMKKLV 882
>gi|167037935|ref|YP_001665513.1| valyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167040834|ref|YP_001663819.1| valyl-tRNA synthetase [Thermoanaerobacter sp. X514] >gi|166855074|gb|ABY93483.1| valyl-tRNA synthetase [Thermoanaerobacter sp. X514] >gi|166856769|gb|ABY95177.1| valyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] (879 aa)
Score = 1559, Expect = 6.3e-171, Identities = 345/857 (40%), Positives = 513/857 (59%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENK-ISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNP---KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYL---IFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +++K Y+ K  E +   +  +K      +   K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  ++G +A WI G DHA IAT+ K    +RE   ++ K+  R+E +   + W     N I +Q K +G   D+    FT+++  +  V +VFV +Y  GLIYR   ++NW     +A+S+ EV  KE + +L+YI+Y +     Y+++ATTRPET+  D  + VNP D+RYK+ + K  I PL  +EI +IAD YVD  FGTG +K TPAHD ND+E+G ++ L  I+  NE+   N     ++ L   +AR + VE L+   LL KVE  + NVG   R + VVEP++S+QWFVK+   +K  +E+ K   KI+F P +FEK   NW+ N+ DWCISRQLWWGH+IP WY  D   I V  K P+  E        +D DVLDTWFSS LWP +T    +  +     +PT+VLVTG+DIIFFWV RM+F SL   KEVPFKH  I GL+RD    KMSKSLGNG+DP +VIE+YGAD LR  L+  ++PG D+ + ++KV+    F NKLWN+ RYV +N +D   D +     L   DKWIL ++N    E  +   K+   ++  K+ DF W +FC+ YIELSK    + N E+K     VL Y++   L L HP  PF+T  ++ N   + +  ++ E   +K+  +  E +   E +++ I  IR    E  +  +K   + + V N    K+F++    I  L  A   +++ D KS  P    +  +   + +L  EDL+    E   I+++ +E + V SEI R  G+L+N++F++KAP++ +  E+ K EK+   LK +E+ L
  S:     3 EIAKTYNPKEFEDRIYAFWMEKGYFTPKIDPEKQPFTIVIPPPNITGQLHMGHALDNTLQDILIRWKRMQGYAALWIPGSDHASIATEIKVLDTIREETGLTKKEIGREEFLKRAWAWKDKYENRILSQLKKLGSSCDWTRTRFTMDEVCSRAVREVFVSLYEKGLIYRGDRIINWCPDCNTALSDAEVEHKEQKGHLWYIKYPIKGEDGYVVIATTRPETMLGDVAVAVNPDDERYKDVVGKTLILPLVGREIPVIADSYVDPSFGTGAVKVTPAHDPNDFEMGLRHNLPFINIMNENAIINENGGKYKGLDRYEARERIVEDLKNLGLLLKVEDHVHNVGHCYRCDTVVEPLLSKQWFVKMEPLAKPALEVVKEG-KIKFVPERFEKIYTNWLENIKDWCISRQLWWGHRIPAWYCDDCGHITVSRKDPQKCEACGSPHIHQDEDVLDTWFSSALWPFSTMGWPEGTEDLQYFYPTDVLVTGYDIIFFWVARMIFMSLEFMKEVPFKHVLIHGLVRDAQGRKMSKSLGNGIDPLEVIEEYGADTLRFTLVIGNAPGNDMRFSQDKVELSRNFANKLWNASRYVLLNLTD--NDTNLYTDGLTIADKWILTRYNNIVKEVTENLEKFELGIAATKLYDFVWSEFCDWYIELSKPVLYSDNLEAKKVTKSVLRYVLDNTLRLLHPFMPFITEEIWQNLPHEGESIMIAEWPKYKEELDFTEEAKNAEIIMEAIRTIRNLRAEANVSPSKKAKVIVAVENENYVKVFEVGTNYIMKLAGASEVVIETD-KSKIPHKALSGAIEGGLVVLPLEDLIDLEEE---IKRLNEERQKVISEIERAQGLLNNENFVKKAPEKVVNAEREKLEKYTTMLKNIEERL 874
>gi|161611294|ref|YP_139002.2| valyl-tRNA synthetase [Streptococcus thermophilus LMG 18311] >gi|90108443|sp|Q5M5J8|SYV_STRT2 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (883 aa)
Score = 1559, Expect = 7.1e-171, Identities = 354/859 (41%), Positives = 524/859 (61%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSIL-----LERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  +        K  K  YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V+ LE+   L ++EK   +VG SERT   VEP +S QWFVK+ + +K  I  Q +  K+ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PFK+  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+   +  + F+K+ F V+   + +F WD+F + Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++      ++ SI+     + R +F+  +    + +E +  +I  +R    E  +  +K I I ++  + KL    ++ IN +    N   + I   D++   PD V ++ +      L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ E+ K++ ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQKWLDEDVFKPSGDKKAK-PYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAESGISRYDLGREKFLDKVWEWKDEYAATIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGKNVILPILNKPIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFNGMDRFEARKAIVKKLEEIGALVEIEKMTHSVGHSERTGVPVEPRLSTQWFVKMDQLAKNAIANQDTDDKVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WKQDEDVLDTWFSSALWPFSTMGWPDVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFKNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVAR--ENVAKVAAGQAGNVTDRWILHNLNETIRKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSDNEDEKVITRSVLLYTLDQILRLLHPIMPFVTEEIFGQI---SEGSIVTAEYPVARPEFE--NEEAAAGVEALKDVIRSVRNSRAEVNVAPSKPITILIKTSDSKLDAFFNDNINYIKRFTNPEHLEIAA-DVEV--PDLVMSSIITGAEIYLPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQKDYQAKYDAIVVRIDEMKKLV 882
>gi|116627368|ref|YP_819987.1| valyl-tRNA synthetase [Streptococcus thermophilus LMD-9] >gi|116100645|gb|ABJ65791.1| valyl-tRNA synthetase [Streptococcus thermophilus LMD-9] (883 aa)
Score = 1558, Expect = 8.6e-171, Identities = 354/859 (41%), Positives = 524/859 (61%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSIL-----LERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  +        K  K  YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V+ LE+   L ++EK   +VG SERT   VEP +S QWFVK+ + +K  I  Q +  K+ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PFK+  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+   +  + F+K+ F V+   + +F WD+F + Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++      ++ SI+     + R +F+  +    + +E +  +I  +R    E  +  +K I I ++  + KL    ++ IN +    N   + I   D++   PD V ++ +      L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ E+ K++ ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQKWLDEDVFKPSGDKKAK-PYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAESGISRYDLGREKFLDKVWEWKDEYAATIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGKNVILPILNKPIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFNGMDRFEARKAVVKKLEEIGALVEIEKMTHSVGHSERTGVPVEPRLSTQWFVKMDQLAKNAIANQDTDDKVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNTEG-EIYVGEEAPEGDG-WKQDEDVLDTWFSSALWPFSTMGWPDVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFKNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVAR--ENVAKVAAGQAGNVTDRWILHNLNETIGKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSDNEDEKVITRSVLLYTLDQILRLLHPIMPFVTEEIFGQI---SEGSIVTAEYPVVRPEFE--NEEAAAGVEALKDVIRSVRNSRAEVNVAPSKPITILIKTSDSKLDAFFNDNINYIKRFTNPEHLEIAA-DVEV--PDLVMSSIITGAEIYLPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQKDYQAKYDAIVVRINEMKKLV 882
>gi|161936377|ref|YP_140891.2| valyl-tRNA synthetase [Streptococcus thermophilus CNRZ1066] >gi|90108442|sp|Q5M111|SYV_STRT1 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (883 aa)
Score = 1556, Expect = 1.5e-170, Identities = 353/859 (41%), Positives = 522/859 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDF--KKISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  +        K  K  YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V+ LE+   L ++EK   +VG SERT   VEP +S QWFVK+ + +K  I  Q +  K+ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    FPT+ LVTG+DIIFFWV RM+F SL      PFK+  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+   +  + F+K+ F V+   + +F WD+F + Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++      ++ SI+         +  N + ++ +E +  +I  +R    E  +  +K I I ++  + KL    ++ IN +    N   + I   D++   PD V ++ +      L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ E+ K++ ++ K       + E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQKWLDEDVFKPSGDKKAK-PYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAESGISRYDLGREKFLDKVWEWKDEYAATIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGKNVILPILNKPIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFNGMDRFEARKAVVKKLEEIGALVEIEKMTHSVGHSERTGVPVEPRLSTQWFVKMDQLAKNAIANQDTDDKVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDG-WKQDEDVLDTWFSSALWPFSTMGWPDVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFKNVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVAR--ENVAKVAAGQAGNVTDRWILHNLNETIGKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSDNEDEKVITRSVLLYTLDQILRLLHPIMPFVTEEIFGQI---SEGSIVTAEYPVVCPEFENEEAAAGVEALKDVIRSVRNSRAEVNVAPSKPITILIKTSDSKLDAFFNDNINYIKRFTNPEHLEIAA-DVEV--PDLVMSSIITGAEIYLPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQKDYQAKYDAIVVRIDEMKKLV 882
>gi|171778747|ref|ZP_02919843.1| hypothetical protein STRINF_00695 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282704|gb|EDT48128.1| hypothetical protein STRINF_00695 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (883 aa)
Score = 1553, Expect = 3.4e-170, Identities = 346/851 (40%), Positives = 514/851 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE-----DK----TPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQ-DIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK 860
           + +LS KY+    E  ++  W  + ++ K +     + YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  ++EW     + I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP D RYK+ I +  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  I+  N+DGT N  A  F  +   +AR   V+ LE+   L ++EK + +VG SERT   VEP +S QWFVK+ + +K  I  Q +  +++F+P +F    + WM N++DW ISRQLWWGHQIP WY  + K +YVG + P+ +  + +D DVLDTWFSS LWP +T     T+A   K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+ D   D+     DK    T  N+   D+WIL+  N+  ++  + F+K+ F V+   + +F WD+F + Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  +++     +  +     ++    +      +E +  +I  +R    E  +  +K I + ++  + +L    +  +N +    N  K+ I    +   L    V     IF L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ E+ K+  ++ K
  S:     2 SKELSPKYNPAEVEAGRYQKWLDE-DVFKPSGDKKAHPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAEDGISRYDLGREKFLDKVWEWKDEYASTIKQQWGKMGISVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYMLEDGSRSLEVATTRPETMFGDVAVAVNPNDDRYKDLIGQNVILPIVNKAIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQINVMNDDGTMNELAGEFAGMDRFEARKAVVKKLEEIGALVEIEKMVHSVGHSERTGVPVEPRLSTQWFVKMDQLAKNAITNQDTDDEVKFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEGK-MYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRRPFENVLIHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDAAWNFINKIWNISRYILMNNEDLTLDQASANVDKVVAGTGGNVT--DRWILHNLNETIAKVTENFDKFEFGVAGYILYNFIWDEFADWYVELTKEVLYSDNEDEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFEQISEGSIVTAEYPTVNPTFENEAAHKGVESLKDLIRAVRNARSEVNVAPSKPITLLVKTSDKELENFFNSNVNYIKRFTNPEKLEISSTIEAPELAMSSVITGAEIF-LPLADLLNVEEE---LARLNKELAKWQKELDMVARKLGNEKFVANAKPEVVQKERDKQVDYQAK 867
>gi|28211899|ref|NP_782843.1| valyl-tRNA synthetase [Clostridium tetani E88] >gi|75541792|sp|Q891R5|SYV_CLOTE Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|28204342|gb|AAO36780.1| valyl-tRNA synthetase [Clostridium tetani E88] (880 aa)
Score = 1551, Expect = 6.7e-170, Identities = 349/866 (40%), Positives = 528/866 (60%)
  Q:     7 IKNNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED----VLQIINKIRIFNFENKIPNNKVIDIHLEVLNP----KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + +N +++K YD K  E++ + +W   +    K +  +K  Y+I++PPPN+TG LHLGHAL+ ++QD LIR   ++G S  W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EWS+     IR+Q K +G   D+  E FT++   ++ V  VFVK+Y +GLIY+   +VNW  K  +A+S+ E+  +E   N ++++Y L +S++YL +ATTRPET+  D  + VNP D+RYK+ I K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDYE+GK++ L  I   NE+GT N     +  +   +AR   VE L+K   L KV++ I NV   +R N ++EPM+S+QW+VK+ E +K  IE+ KS  +I+F P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  E  V  +  K     + E  ++D DVLDTWFSS LWP +T    D  +  +  +PT+VL TG+DIIFFWV RM+F  L+  KE+PFK   I G++RD    KMSKSLGNGVDP +VI+KYGADALR  L++ ++PG D+ + EE+V+S   F NK+WN+ RYV MN      ++ K  K+    D WIL++ N+   E      K+   ++ +K+ DF W++FC+ YIELSK     ++ K       VL  ++   L L HP+ PF+T  ++ N + + K     +  +FK+   LK   +E     V++ I  IR    E  +P ++   I +  L+     K  KI  E +   +  +    K++        V     I+I     L    +    +E++ KE E ++ EI R +  LSN++F++KAP+  +  EK+K EK++  L+ + + + S K
  S:     1 MNDNINIAKTYDPKEFEERIYKMWEEGEYFTPK-VDKDKKPYTIVMPPPNITGKLHLGHALDNSMQDFLIRVKRMQGYSTLWLPGQDHASIATEVKVENELLKTGLKKKEMGREAFLERVWEWSEEYRGRIRDQLKKLGSSADFTRESFTMDDNLDKAVRAVFVKLYEEGLIYKGNRIVNWCPKCMTALSDAEIEYEENYGNFWHVKYPLVDSEEYLEIATTRPETMLGDTAVAVNPNDERYKHLIGKKLMLPLVNREIPIVADDYVDVEFGTGAVKITPAHDPNDYEVGKRHDLEEIIIMNENGTINELGGKYSGMDRYEARKAIVEDLKKEGFLVKVKEHIHNVSCHDRCNTIIEPMISKQWYVKMKELAKPAIEVVKSG-EIKFVPERFDKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGETIVSLEEAKKCSKCSSENLIQDEDVLDTWFSSALWPFSTLGWPDKTEDLEYFYPTDVLATGYDIIFFWVARMIFSGLHNMKEIPFKTVLIHGIVRDSEGKKMSKSLGNGVDPLEVIDKYGADALRFMLITGNAPGNDIRFYEERVESARNFANKIWNASRYVMMNLDKNLMEKYKDCKDYNIADTWILSRLNEVIKEVTDNIEKFELGMASQKVYDFMWNEFCDWYIELSKPVLYGEDEKAKGVTFNVLFNVLTSGLKLLHPIMPFITEEIFINIQEEEKTITTSKWPEFKE--ELKNEEVEKKMSHVIEAIKAIRNVRIEMDVPPSRKAKIMIYALDGIDAFKDGKIYFEKLASASEVEFLNSKEEAPENAVSAVTKGAEIYI----PLFDLVDLEKEMERLNKEREKLEKEIERVDKKLSNENFVKKAPEAVVNEEKAKGEKYKEMLEAVLERIKSLK 880
>gi|24380137|ref|NP_722092.1| valyl-tRNA synthetase [Streptococcus mutans UA159] >gi|81450887|sp|Q8DSL1|SYV_STRMU Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|24378137|gb|AAN59398.1|AE015005_4 putative valyl-tRNA synthetase [Streptococcus mutans UA159] (883 aa)
Score = 1549, Expect = 9.8e-170, Identities = 341/822 (41%), Positives = 500/822 (60%)
  Q:    47 YSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNL---------EDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           YSI++PPPNVTG LHLGHA + T+ D +IR   ++G    W+ GMDHAGIATQ K E  L E+ IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD K ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP D RYK+ I +  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V+ LE+   L ++EK   +VG SERT   +EP +S QWFVK+ + +K  I  Q +  K+ F+P +F    + WM N++DW ISRQLWWGHQIP WY  D  ++YVG + P+ +  + +D DVLDTWFSS LWP +T     TD+   K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DV++KYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+   + D+    KN+            D+WIL+  N+  ++  + F+K+ F V+   + +F WD+F + Y+EL+K    + ++  K+    VL Y + KIL L HP+ PFVT  ++  +   +  +     ++    +    S +E +  +I  +R    E  +  +K I I        L K SD  +     A +N +K   +   P+ +E +  I                 L   DLL    E   + ++ KE+   + E+      LSN  F++ A  E ++ E+ K+  ++ K       +KE+EKL+
  S:    39 YSIVIPPPNVTGKLHLGHAWDTTLPDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEARLAEDGISRYDLGREKFLDKVWEWKDEYAATIKEQWGKMGISVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPKARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDTAVAVNPNDDRYKDLIGQNVILPIVNKLIPIVADEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAGEFAGMDRFEARKATVKKLEEIGALVEIEKMTHSVGHSERTGVPIEPRLSTQWFVKMDQLAKNAIANQDTDDKVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNADG-DMYVGEEAPEGDG-WKQDEDVLDTWFSSALWPFSTMGWPDTDSEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGCRPFQNVLIHGLIRDEQGRKMSKSLGNGIDPMDVVDKYGADALRWFLSNGSAPGQDVRFSYEKMDAAWNFINKIWNISRYILMNNEGLSLDQ--ASKNVVLVTNGKAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSEDEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQYADGSIVTAAYPTVNPAFENQTAHSGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSNLEDFFKANVNYIK---RFTNPETLEISSAIATPELAMSAVITGAEIFLPLADLLNVEEE---LARLNKELAKWQKELDIVAKKLSNDRFVQNAKPEIVQKERDKQIDYQTKYDATVERIKEMEKLI 882
>gi|125718618|ref|YP_001035751.1| valyl-tRNA synthetase [Streptococcus sanguinis SK36] >gi|125498535|gb|ABN45201.1| Valyl-tRNA synthetase, putative [Streptococcus sanguinis SK36] (890 aa)
Score = 1547, Expect = 1.5e-169, Identities = 344/859 (40%), Positives = 521/859 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTD--ALKSKD--ALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKT--KDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQ--DIKSLK-------PDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N+ A  F  +   +AR   V+ LE+   L K+EK + +VG SERT  +VEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ +  + +D DVLDTWFSS LWP +T     + S+D    +PT+ LVTG+DII FWV RM+F  L    + PFK+  I GLIRDE   KMSKSLGNG+DP DV++KYG D+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D  +  +N+            D+WIL+  N+   +  + F+K+ F V+   + +F WD+F + Y+EL+K    + N + K+    VL Y + +IL L +P+ PFVT  ++      T    +  + R +F+       + +E +  +I  +R    E  +  +K I I        L K +D  +       IN +K+  + + L+       P+ V ++ +      L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ E+ K+  ++ K       + E++KL+
  S:    10 SKELSPKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVELYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPIANKLIPIVADEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNDLAFEFAGMDRFEARKAVVKKLEEIGALVKIEKRVHSVGHSERTGVMVEPRLSTQWFVKMDQLAKNAIANQATDDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPECDG-WTQDEDVLDTWFSSALWPFSTMGWPDVDSEDFKRYYPTSTLVTGYDIIPFWVSRMIFQGLEFTGKSPFKNALIHGLIRDEEGRKMSKSLGNGIDPMDVVDKYGTDSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDAAR--ENVAQVTAGQAGNVTDRWILHNLNETIGKVTENFDKFEFGVAGHILYNFIWDEFADWYVELTKEVLYSDNDDEKVITRSVLLYTLDQILRLLYPIMPFVTEEIFGQISEGTIVTAAYPVVRPEFENAE--AAAGVEALKDLIRSVRNSRAEVNVAPSKPITI--------LIKTTDSALETFFKDNINYIKRFTNPEHLEIAADLAVPELVMSSIITGAEIYLPLADLLNIEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDATVARIDEMKKLI 890
>gi|118443167|ref|YP_877806.1| valyl-tRNA synthetase [Clostridium novyi NT] >gi|118133623|gb|ABK60667.1| valyl-tRNA synthetase [Clostridium novyi NT] (879 aa)
Score = 1546, Expect = 2.5e-169, Identities = 343/856 (40%), Positives = 513/856 (59%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDF--KKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +++K YD K  E +      QK      +   K  Y+I++PPPN+TG LHLGHAL+GT+QD LIR   ++G S  W+ G DHA IAT+ K EK L E  +  K+  R+  +  +++W+    + I+ Q++ +G   DY  E FT+++  N+ V +VFV++YN+GLIY+   +VNW  K Q+AIS+ E+  +E   + ++I+Y +  S ++L +ATTRPET+  D  + VNP D+RY + I K  + PL N+EI I+ADEYVD++FGTG +K TPAHD NDYE+GK++ L  +   N+DG+       +  L   +AR + V+ L++   L K+++   NVG  +R  + +EPM SEQW+VK+   ++  I++ +   +I+F P +F K   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V T+ P        E   +D DVLDTWFSS LWP +T    +  +  +  +PTN LVTG+DIIFFWV RM+F  L+  K++PF    I G++RD    KMSKSLGNGVDP +VIEKYGADALR  L++ ++PG D+ Y EEKV++   F NK+WN+ R+V MN      ++ K  K     DKWIL++ N    E  +  +K+   ++ +KI DF W++FC+ YIEL K      + K     L VLN ++KK L L HP+ PF+T  +Y N    T+++I+        +++S+ K E  +  +++ I  +R    E  +P ++   + +     K  FK        L +A     + D    K    EN         E    LL   +    +E++ KE E ++ EI R    LSN+ F+ KAP+  +  E+ K    KE +E  ++ +E L
  S:     5 NIAKTYDPKEFEDKLYEKWEQKGYFTPEIDKTKKPYTIMMPPPNITGQLHLGHALDGTLQDFLIRTKRMQGYSTLWLPGEDHASIATEVKVEKSLLEQGLHKKEMGREAFLEKVWDWAYKYRDRIKTQYQKLGISADYTRERFTMDEGLNKAVRKVFVELYNEGLIYKGNRIVNWCPKCQTAISDAEIEYEEQNGHFWHIKYPVVGSDEFLEIATTRPETMLGDTAVAVNPNDERYTHLIGKKLMLPLVNREIPIVADEYVDVEFGTGAVKITPAHDPNDYEVGKRHNLPQVVILNKDGSIAEGYGKYSGLDRYEARKELVKDLDEAGFLVKIKEHAHNVGTHDRCGSTLEPMTSEQWYVKMKPLAEPAIKVVREG-EIKFVPERFSKTYYNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVSTEDPTKCPKCGSEHLEQDKDVLDTWFSSALWPFSTLGYPEKTEDLEYFYPTNTLVTGYDIIFFWVARMIFSGLHSMKKIPFNTVLIHGIVRDSEGRKMSKSLGNGVDPLEVIEKYGADALRFMLITGNAPGNDIRYYEEKVEAARNFANKIWNASRFVMMNLDKDLMEKYKDCKEYTLADKWILSRINTVVKEATENIDKFELGIAAQKIYDFMWNEFCDWYIELVKPALYGDDEKAKGVVLNVLNEVLKKGLKLLHPVMPFITEEIYTNLP-NTEETIVTSAWPVFEEELSDAKTEEQMNYIIEAIKSLRNVRSEMNVPPSRKAKVTIFATEGKDAFKQGTIYFERLASAS----EVDFVDSKDSIPENTVSAVTKGAEMFMPLLDLVDIEKELERLNKEKEKLQKEIERVEKKLSNEKFVSKAPEAVVNEEREKGKKYKEMYEAVIQRIENL 878
>gi|168485679|ref|ZP_02710187.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] >gi|183571212|gb|EDT91740.1| valyl-tRNA synthetase [Streptococcus pneumoniae CDC1087-00] (883 aa)
Score = 1545, Expect = 2.6e-169, Identities = 347/859 (40%), Positives = 512/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE-----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  ++ EIYVG + P  +  + +D DVLDTWFSS LWP +T     ++   F    P + LVTG+DII FWV RM+F  +    + PFK+  I GLIRDE   KMSKSLGNG+DP DVI+KYG D+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  ++      ++ SI+        L F+ ++    + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAIAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWY-NEAGEIYVGEEAPAGDG-WKQDEDVLDTWFSSALWPFSTMGWPNTETTDFKRYYPNSTLVTGYDIIPFWVSRMIFQGIEFTGKSPFKNALIHGLIRDEEGRKMSKSLGNGIDPMDVIDKYGTDSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVVHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDDKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQI---SEGSIVTAAYPTVNLAFEDLA--AHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQADYQAKYDATVARIDEMKKLV 882
>gi|15674155|ref|NP_268330.1| valyl-tRNA synthetase [Lactococcus lactis subsp. lactis Il1403] >gi|81537370|sp|Q9CDP6|SYV_LACLA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|12725235|gb|AAK06271.1|AE006446_3 valyl-tRNA synthetase (EC 6.1.1.9) [Lactococcus lactis subsp. lactis Il1403] (880 aa)
Score = 1542, Expect = 7.2e-169, Identities = 334/862 (38%), Positives = 511/862 (59%)
  Q:    11 NDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD---------EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDI-----HLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           N+L+ K++    E  ++  W  + ++ K +   +   YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K    L E+ I  +D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++YN G IYR + L+NWD K  +A+S+IEVI KE++   Y+I Y +  S +++ +ATTRPET   D  ++VN KD+RYK+ + K  I P+ N+ I I+ D++ D++ GTGV+K TPAHD ND+E+  ++ L +I+  N DGT N     +E L   +AR + V  L++   L  ++     VG SERT  VVEP +S QWFVK+ E +K  I  Q +   ++F+P +F    + WM N++DW ISRQLWWGHQIP WY  ++ E+YVG + P+ E  + +D DVLDTWFSS LWP +T        A     FPT+ LVTG+DIIFFWV RM+F SL    + PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  +K+ + W FINK+WN  RY+ MN+ D + D          +KT  N+   D+WIL + N       +Q +K+ F V+   + +F WD+F N Y+EL+K        + ++    VL +++ ++L L HP+ PF T  +++     +   ++ E    +   N  ++S  +  ++++I  +R    E   P +K + +     H + LN     +S  +    N +++ I K D+    P+   +  +        L G  N    I +++KE+   + E+   N  L N+ F+  A  E ++ EK K   ++ K   ++  ++  K
  S:     3 NELTPKFNPTEVEAGRYEKWL-EADVFKPSGNPDAEPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVAARLAEDGILPQDLGREKFLDKVWEWKDEYATTIKEQWGKMGISVDYSRERFTLDEGLSQAVRKVFVQLYNKGWIYRGEKLINWDPKAMTALSDIEVIHKEIDGAFYHITYQIEGSDEFVEIATTRPETFLGDTAVIVNEKDERYKHLVGKNVILPIINRVIPILTDDHADMEKGTGVVKITPAHDPNDFEVAMRHDLPMINMMNNDGTINENGGKYEGLDRFEARKQIVADLKELGQLVDIKPVRHEVGHSERTGVVVEPRLSTQWFVKMDELAKNAIANQTTEDAVEFYPPRFNDTFMQWMENVHDWVISRQLWWGHQIPAWY-NEAGEMYVGEEAPEGEG-WTQDEDVLDTWFSSALWPFSTMGWPDENSADFIRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGKSPFHNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYDKMDAAWNFINKIWNVSRYILMNAEDISADAVSSALTKVANKTAGNVT--DRWILTRLNDTVERVTEQMDKFEFGVAGHILYNFIWDEFANWYLELTKEVMFGEDEAEKDITRAVLLHVLDQVLRLLHPIMPFFTEEIFEKLPNTSGSIVVAEYPKVRPEFNDDKASEGVAMLIELITAVRNIRAEVNTPLSKAVPMLIKSEHADFLN----AVSPYISRFTNPSELTIAK-DLAV--PEQAMSAVITGAELYLPLAGLINIEEEIARLEKELAKWQKELDLVNKKLGNERFVANAKAEVVQKEKDKLADYQEKFDTVKARIAELK 878
>gi|77414609|ref|ZP_00790750.1| valyl-tRNA synthetase [Streptococcus agalactiae 515] >gi|77159348|gb|EAO70518.1| valyl-tRNA synthetase [Streptococcus agalactiae 515] (883 aa)
Score = 1541, Expect = 8.0e-169, Identities = 353/859 (41%), Positives = 519/859 (60%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W  Q ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I++QW  MG  +DY  E FTL++  ++ V +VFV +YN G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I IIADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE    L K+EK   +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    ++WM N++DW ISRQLWWGHQIP WY  +  E+YVG + P+ +  + +D DVLDTWFSS LWP +T     ++ A     FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D+ +  +N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + KIL L HP+ PFVT  ++  +   +  +     ++    +      +E +  +I  +R    E  +  +K I I ++  + +L   FK +   I      +   +   I +  L    V     IF L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ EK K+  ++ K       ++E++KL+
  S:     2 SKELSPKYNPAEVEAGRYQTWLDQ-DVFKPSGDTEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYNKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYLLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPIINKPIPIIADEHADPEFGTGVVKITPAHDPNDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIEKMTHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMENVHDWVISRQLWWGHQIPAWYNVNG-EMYVGEEAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDQAR--ENVEKVVNSQVGNVTDRWILHNLNETVGKVTESFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDEKVVTRSVLLYTLDKILRLLHPIMPFVTEEIFGQYADSSIVTAAYPTVNPAFENAAAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILVKTSDSELESFFKDNSNYIKRFTNPETLEISSAIATPELAMSSVITGAEIF-LPLADLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKLV 882
>gi|148992322|ref|ZP_01822045.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|168488257|ref|ZP_02712456.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP195] >gi|147928948|gb|EDK79960.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68] >gi|183573136|gb|EDT93664.1| valyl-tRNA synthetase [Streptococcus pneumoniae SP195] (883 aa)
Score = 1539, Expect = 1.4e-168, Identities = 347/859 (40%), Positives = 511/859 (59%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD--EDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKE-----SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---------------FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKLL 868
           + +LS KY+    E  ++  W    ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LR   IS  D  R+  +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L K+EK + +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    + WM N++DW ISRQLWWGHQIP WY  ++ EIYVG + P  +  + +D DVLDTWFSS LWP +T     ++   F    P + LVTG+DII FWV RM+F  +    + PFK+  I GLIRDE   KMSKSLGNG+DP DVI+KYG D+LR FL + S+PG+D  +  EK+ + W FINK+WN  RY+ MN+     D   D   K          D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+E K+    VL Y + KIL L HP+ PFVT  ++      ++ SI+    ++  I+   E     + +E +  +I  +R    E  +  +K I I        L K SD  +     + +N +K   +   P+++E    I                 L   DLL    E   + +++KE+   + E+      LSN+ F+  A  E ++ E+ K+  ++ K       + E++KL+
  S:     2 SKELSSKYNPAEVEAGRYQKWL-DADVFKPSGDQKAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEGISRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKITPAHDPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALVKIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWY-NEAGEIYVGEEAPAGDG-WKQDEDVLDTWFSSALWPFSTMGWPNTETTDFKRYYPNSTLVTGYDIIPFWVSRMIFQGIEFTGKSPFKNALIHGLIRDEEGRKMSKSLGNGIDPMDVIDKYGTDSLRWFLSNGSAPGQDARFSYEKMDASWNFINKIWNISRYILMNNEGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEEEKVITRSVLLYTLDKILRLLHPIMPFVTEEIFGQI---SEGSIVTA--EYPTINPAFEDLAAHTGVESLKDLIRAVRNARAEVNVAPSKPITI--------LVKTSDSDLEAFFNSNVNYIK---RFTNPEHLEIASTIPAPELAMSSVITGAEIFLPLVDLLNVEEE---LARLEKELAKWQKELDMVGKKLSNERFVANAKPEVVQKERDKQADYQAKYDATVARIDEMKKLV 882
>gi|77412415|ref|ZP_00788722.1| valyl-tRNA synthetase [Streptococcus agalactiae CJB111] >gi|77161529|gb|EAO72533.1| valyl-tRNA synthetase [Streptococcus agalactiae CJB111] (884 aa)
Score = 1539, Expect = 1.4e-168, Identities = 353/858 (41%), Positives = 524/858 (61%)
  Q:    10 NNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKL 867
           + +LS KY+  ++ E ++  W  Q ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I++QW  MG  +DY  E FTL++  ++ V +VFV +YN G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I IIADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE    L K+EK   +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    ++WM N++DW ISRQLWWGHQIP WY  +  E+YVG   P+ +  + +D DVLDTWFSS LWP +T     ++ A     FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D+ +  +N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL+K    + N+E K+    VL Y + +IL L HP+ PFVT  ++  +    + SI+L    +++    +      +E +  +I  +R    E  +  +K I I ++  + +L   FK +   I      +   +   I +  P+    + +      L   DLL    E   + +++KE+   + E++     LSN+ F+  A  E ++ EK K+  ++ K       ++E++KL
  S:     2 SKELSPKYNPAEVEEGRYQTWLDQ-DVFKPSGDTEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYNKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPIINKPIPIIADEHADPEFGTGVVKITPAHDPNDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIEKMTHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMENVHDWVISRQLWWGHQIPAWYNVNG-EMYVGEDAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDQAR--ENVEKVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEEEKVVTRSVLLYTLDQILRLLHPIMPFVTEEIFGQY---AEGSIVLASYPQVNATFENQTAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILVKTSDSELESFFKDNSNYIKRFTNPETLEISSAITA--PELAMTSIITGAEIFLPLADLLNVEEE---LARLEKELAKWQKELNMVGKKLSNERFVANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKL 881
>gi|148377404|ref|YP_001256280.1| valyl-tRNA synthetase [Mycoplasma agalactiae PG2] >gi|148291450|emb|CAL58835.1| Valyl-tRNA synthetase (Valine-tRNA ligase)(VALRS) [Mycoplasma agalactiae PG2] (829 aa)
Score = 1539, Expect = 1.5e-168, Identities = 362/838 (43%), Positives = 519/838 (61%)
  Q:    29 WTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDK-SRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKIS-NLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEA---NNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           W  +K  +K +L   K  +S+LLPPPNVTG LH+GHAL+  IQD ++RF  L+G   ++I GMDHAGIATQ+K E+ L E +  NK    R++ +  ++EW +   N  R QW  +G  LD+E E FTL+K SN+ VN+VF+++YN GLIY+    VNWD  L++A+SNIEVI K  E  +YYIRY + NS D+L +AT R ET+  D   V NP D+RYK+  N++ I+PLTN+ I II DEYVD +F +G+MK + AH   D ++ KK+ L I    N+DG  +  +  F +L    AR +  +YL++NNL+ K EKT+SNVG+SER+NA VE ++  QWFVK+   +K V E  KS  +++F+P +F K + NW+ N++DW ISRQLWWGH+IP WYK +  EI V    P   E +V+D+DVLDTWFSSG+ P +      S + L   +PT++LVTG+DIIFFWV RM FF L    + PF+   + GL+RDE N KMSKSL NGVDP+ +IE+YG+DALR FL+++S+PG D  +  EKV+  WG  NKLWN  RY++M   D NF            D WI NK     ++  +  N+Y   V+  ++ +F ++DF + YIEL +       +K + L  L +K+LI+ HP  PFVT  LY +     K  +L E+    K+S ++K   I+ ++ ++  +R F  E  I   ++I+          + +S+   N+   +K  I +     LK    EN+ ++F   K  +    NE    + +  + K+IE VK EI R   MLSN +FI KAPK+KI LE+ K +K++ +L E EK
  S:    21 WVDKKIFSKHDL--TKKPFSLLLPPPNVTGALHIGHALDQHIQDTILRFKKLEGYDTFYIAGMDHAGIATQSKVERILMETEGVNKHTLGREKFLERIWEWKEEYANKFRKQWHLLGIGLDFERERFTLDKLSNDAVNKVFIELYNRGLIYKDTKAVNWDPVLKTALSNIEVINKPTEQIMYYIRYKIKNSSDFLTIATVRLETLLSDVAAVFNPSDERYKHLENQYVIHPLTNEAIPIIKDEYVDKKFASGLMKLS-AHAEVDIDIIKKHNLQIRETINKDGKIDCPSSIFHDLTREQAREQISKYLKENNLIVKEEKTVSNVGYSERSNAPVETLVMPQWFVKMDTLAKNVTEHLKSDDQVKFYPKRFIKTVNNWLKNIHDWTISRQLWWGHRIPAWYKDN--EIKVQVDSPG--EGWVQDSDVLDTWFSSGIAPFSFLGWPASDELLKRYYPTSLLVTGYDIIFFWVVRMYFFGLEFTGKKPFETVLLHGLVRDEQNRKMSKSLNNGVDPSKIIEEYGSDALRFFLVTNSTPGLDTRFSLEKVRVAWGLCNKLWNIARYIDMLDDDSNFKPSAA-------DIWINNKLKHLQNKITKAMNRYELTVAGTELSNFIYNDFSSWYIELLR----IYPNKKYALENL-RKLLIITHPFLPFVTDYLYQSI---YKTELLDEQFPVLKLSRSMKVKEIDLIINVVKILRRFREEKSISKKEIIN----------YWVSE---NLSEESKSAINRMTNGCLK----ENDNILFTDGKLKVWIEENETLKKDRLIDLNKKIEQVKFEIERAQKMLSNPNFINKAPKDKIALEQEKLQKYQKQLAEYEK 827
>gi|25010562|ref|NP_734957.1| valyl-tRNA synthetase [Streptococcus agalactiae NEM316] >gi|81457458|sp|Q8E6S0|SYV_STRA3 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|23094915|emb|CAD46136.1| valyl-tRNA synthetase [Streptococcus agalactiae NEM316] (884 aa)
Score = 1537, Expect = 2.6e-168, Identities = 352/858 (41%), Positives = 524/858 (61%)
  Q:    10 NNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMK-------LKELEKL 867
           + +LS KY+  ++ E ++  W  Q ++ K +       YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I++QW  MG  +DY  E FTL++  ++ V +VFV +YN G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I IIADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE    L K+EK   +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    ++WM N++DW ISRQLWWGHQIP WY  +  E+YVG   P+ +  + +D DVLDTWFSS LWP +T     ++ A     FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D+ +  +N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL+K    + N++ K+    VL Y + +IL L HP+ PFVT  ++  +    + SI+L    +++    +      +E +  +I  +R    E  +  +K I I ++  + +L   FK +   I      +   +   I +  P+    + +      L   DLL    E   + +++KE+   + E++     LSN+ F+  A  E ++ EK K+  ++ K       ++E++KL
  S:     2 SKELSPKYNPAEVEEGRYQTWLDQ-DVFKPSGDTEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYNKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPIINKPIPIIADEHADPEFGTGVVKITPAHDPNDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIEKMTHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMENVHDWVISRQLWWGHQIPAWYNVNG-EMYVGEDAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDQAR--ENVEKVVNSQVGNVTDRWILHNLNETVGKVTESFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEDEKVVTRSVLLYTLDQILRLLHPIMPFVTEEIFGQY---AEGSIVLASYPQVNATFENQTAHKGVESLKDLIRSVRNSRAEVNVAPSKPITILVKTSDSELESFFKDNSNYIKRFTNPETLEISSAITA--PELAMTSIITGAEIFLPLADLLNVEEE---LARLEKELAKWQKELNMVGKKLSNERFVANAKPEVVQKEKDKQTDYQTKYDATIARIEEMKKL 881
>gi|125625212|ref|YP_001033695.1| valyl-tRNA synthetase [Lactococcus lactis subsp. cremoris MG1363] >gi|124494020|emb|CAL99020.1| ValS protein [Lactococcus lactis subsp. cremoris MG1363] (880 aa)
Score = 1536, Expect = 3.5e-168, Identities = 333/862 (38%), Positives = 510/862 (59%)
  Q:    11 NDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD---------EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDI-----HLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           N+L+ K++    E  ++  W  + ++ K +   +   YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K    L E+ I  +D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++YN G IYR + L+NWD K  +A+S+IEVI KE++   Y+I Y +  + +++ +ATTRPET   D  ++VN KD+RYK+ + K  I P+ N+ I I+ D++ D++ GTGV+K TPAHD ND+E+  ++ L +I+  N DGT N     +E L   +AR + V  L++   L   +     VG SERT  VVEP +S QWFVK+ E +K  I  Q +   ++F+P +F    + WM N++DW ISRQLWWGHQIP WY  ++ E+YVG + P+ E  + +D DVLDTWFSS LWP +T        A     FPT+ LVTG+DIIFFWV RM+F SL    + PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  +K+ + W FINK+WN  RY+ MN+ D + D          +KT  N+   D+WIL + N       +Q +K+ F V+   + +F WD+F N Y+EL+K        + ++    VL +++ ++L L HP+ PF T  +++     +   ++ E    +   N  ++S  +  ++++I  +R    E   P +K + +     H + LN     +S  +    N +++ I K D+    P+   +  +        L G  N    I +++KE+   + E+   N  L N+ F+  A  E ++ EK K   ++ K   ++  ++  K
  S:     3 NELTPKFNPTEVEAGRYEKWL-EADVFKPSGNPDAEPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVAARLAEDGILPQDLGREKFLDKVWEWKDEYATTIKEQWGKMGISVDYSRERFTLDEGLSQAVRKVFVQLYNKGWIYRGEKLINWDPKAMTALSDIEVIHKEIDGAFYHITYQIEGTDEFVEIATTRPETFLGDTAVIVNEKDERYKHLVGKNVILPIINRVIPILTDDHADMEKGTGVVKITPAHDPNDFEVAMRHDLPMINMMNNDGTINENGGKYEGLDRFEARKQIVADLKELGQLLDAKPVRHEVGHSERTGVVVEPRLSTQWFVKMDELAKNAIANQATEDAVEFYPPRFNDTFMQWMENVHDWVISRQLWWGHQIPAWY-NEAGEMYVGEEAPEGEG-WTQDEDVLDTWFSSALWPFSTMGWPDENSADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGKSPFHNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYDKMDAAWNFINKIWNVSRYILMNAEDVSADAVSSALTKVANKTAGNVT--DRWILTRLNDTVERVTEQMDKFEFGVAGHILYNFIWDEFANWYLELTKEVMFGEDEAEKDITRAVLLHVLDQVLRLLHPIMPFFTEEIFEKLPNTSGSIVVAEYPKVRPEFNDDKASEGVAMLIELITAVRNIRAEVNTPLSKAVPMLIKSEHADFLN----AVSPYISRFTNPSELTIAK-DLAV--PEQAMSAVITGAELYLPLAGLINIEEEIARLEKELAKWQKELDLVNKKLGNERFVANAKAEVVQKEKDKLADYQEKFDTVKARIAELK 878
>gi|167766367|ref|ZP_02438420.1| hypothetical protein CLOSS21_00871 [Clostridium sp. SS2/1] >gi|167711958|gb|EDS22537.1| hypothetical protein CLOSS21_00871 [Clostridium sp. SS2/1] (879 aa)
Score = 1533, Expect = 7.1e-168, Identities = 327/858 (38%), Positives = 516/858 (60%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSK-DYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERL-DFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE---VINILNTAKINIVKQDIKSLKPDYVEN---NYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +L   YD    E++ +  W   K  + + +   K  Y+I++PPPN+TG LH+GHAL+ T+QD LIRF  ++G +A WI G DHA IAT+ K    L+E  I  +D  R++ +   ++W +  G  I  Q K +G   D++ E FT+++  +E V +VF+K+Y  G IYR   ++NW    Q++IS+ EV  ++   + ++I+Y +  S+ +Y+ +ATTRPET+  D  + V+P D+RY + + K    PL N++I ++ADEYVD +FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N     +E +   +AR   V  LE+   L K+++   NVG  +R    VEPM+  QWFVK+ E +K  IE  K+   ++F P ++ K  ++W+ N+ DWCISRQLWWGH+IP +Y  +  E+ V  + P+       + + +D D LDTWFSS LWP +T    +  K  D  +PTN LVTG+DIIFFWV RM+F       + PF    I GL+RDE   KMSKSLGNG++P DVI +YGADALR  L++ ++PG D+ Y E++V +   F NK+WN+ R++ MN    +F  D T ++L   DKWIL+K N    +      KY   ++++K+ DF W++FC+ YIE+ K R  N E +     LW LN ++ + L L HP  PF+T  +Y N     ++SI+L +  +FK+  N K  E ++E + + +  IR    E  +   K   +++   + ++  I ++       L  A   I++ +   +  D V +     +I++   E +    + A   E++ KE + +  EI RC GML N+ F+ KAP+ K++ EK K  K++  L+++++ ++
  S:     4 ELETTYDPGAIEERLYQKWLDNKYFHAE-VDETKQPYTIVIPPPNITGKLHMGHALDETLQDILIRFKKMQGYNALWIPGTDHASIATEVKIINALKEEGIEKEDLGREKFLERAWDWKEEYGGTIIEQMKKLGSSCDWDRERFTMDEGCSEAVKEVFIKLYEKGYIYRGSRIINWCPVCQTSISDAEVEYEDQAGHFWHIKYPVVGSEGEYVEIATTRPETLLGDSAVAVHPDDERYTHLVGKMLELPLCNRQIPVVADEYVDREFGTGAVKITPAHDPNDFEVGKRHDLPEINILNDDATINKNGGKYEGMDRYEARKAIVADLEEQGYLVKIKEHEHNVGTHDRCGTTVEPMIKPQWFVKMEELAKPAIEAVKNG-DLKFVPERYTKTYLHWLENIRDWCISRQLWWGHRIPAYYCDECGEVVVARETPEVCPKCGCKHFTQDEDTLDTWFSSALWPFSTLGWPEKTKELDYFYPTNTLVTGYDIIFFWVVRMVFSGYEQTGKSPFDTVLIHGLVRDEQGRKMSKSLGNGINPLDVIAQYGADALRFTLITGNAPGNDMRYTEKRVIASRNFANKIWNASRFIMMNLEQADF-SDVTLEDLTSADKWILSKLNTLAKDVTDNMEKYELGIAVQKLNDFLWEEFCDWYIEMVKPRLYNDEDQTKAAALWTLNTVLTEALKLLHPYMPFITEEIYCN--LTDEESIMLAKWPEFKEEWNFKADEKAVETIKEAVRGIRNVRAEMNVSPKKKAQVYVVSEDAEIRDIFEQGKVFFATLGYASEVIIQDNKDGIGDDAVSSVIAGAVIYMPFAELV----DIAKEKERLAKEEKRLNGEIKRCEGMLGNERFVSKAPEAKVQEEKDKLAKYQQMLEQVKEQIA 876
>gi|116513122|ref|YP_812029.1| valyl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11] >gi|116108776|gb|ABJ73916.1| valyl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11] (880 aa)
Score = 1528, Expect = 2.7e-167, Identities = 336/862 (38%), Positives = 509/862 (59%)
  Q:    11 NDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD---------EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDI-----HLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           N+L+ K++    E  ++  W  + ++ K +   +   YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K    L E+ I  +D  R++ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV++YN G IYR + L+NWD K  +A+S+IEVI KE++   Y+I Y +  S +++ +ATTRPET   D  ++VN KD+RYK+ + K  I P+ N+ I I+ D++ D++ GTGV+K TPAHD ND+E+  ++ L +I+  N DG  N     +E L   +AR + V  L++   L  V+     VG SERT  VVEP +S QWFVK+ E +K  I  Q +   ++F+P +F    + WM N++DW ISRQLWWGHQIP WY  ++ E+YVG + P+ E  + +  DVLDTWFSS LWP +T        A     FPT+ LVTG+DIIFFWV RM+F SL    + PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  +K+ + W FINK+WN  RY+ MN+ D + D          +KT  N+   D+WIL + N       +Q +K+ F V+   + +F WD+F N Y+EL+K        + ++    VL +++ ++L L HP+ PF T  +++     +   ++ E    +   N  ++S  +  ++++I  +R    E   P +K + +     H + LN     +S  +    N +++ I K D+  L     E      I   E    L G  N    I +++KE+   + E+   N  L N+ F+  A  E ++ EK K   ++ K   ++  ++  K
  S:     3 NELTPKFNPTEVEAGRYEKWL-EADVFKPSGNPDAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVAARLAEDGILPQDLGREKFLDKVWEWKDEYATTIKEQWGKMGISVDYSRERFTLDEGLSQAVRKVFVQLYNKGWIYRGEKLINWDPKAMTALSDIEVIHKEIDGAFYHITYQIEGSDEFVEIATTRPETFLGDTAVIVNEKDERYKHLVGKNVILPIINRVIPILTDDHADMEKGTGVVKITPAHDPNDFEVAMRHDLPMINMMNNDGIINENGGKYEGLDRFEARKQIVADLKELGQLLDVKPVRHEVGHSERTGVVVEPRLSTQWFVKMDELAKNAIANQATEDAVEFYPPRFNDTFMQWMENVHDWVISRQLWWGHQIPAWY-NEAGEMYVGEEAPEGEG-WTQYEDVLDTWFSSALWPFSTMGWPDENSADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGKSPFHNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYDKMDAAWNFINKIWNVSRYILMNAEDVSADAVSSALTKVANKTAGNVT--DRWILTRLNDTVERVTEQMDKFEFGVAGHILYNFIWDEFANWYLELTKEVMFGEDEAEKDITRAVLLHVLDQVLRLLHPIMPFFTEEIFEKLPNTSGSIVVAEYPKVRPEFNDDKASEGVAMLIELITAVRNIRAEVNTPLSKAVPMLIKSEHADFLN----AVSPYISRFTNPSELTIAK-DLAVL-----EQAMSAVITGAELYLPLAGLINIEEEIARLEKELAKWQKELDLVNIKLGNERFVANAKAEVVQKEKDKLADYQEKFDTVKARIAELK 878
>gi|154484613|ref|ZP_02027061.1| hypothetical protein EUBVEN_02329 [Eubacterium ventriosum ATCC 27560] >gi|149734461|gb|EDM50378.1| hypothetical protein EUBVEN_02329 [Eubacterium ventriosum ATCC 27560] (879 aa)
Score = 1528, Expect = 3.1e-167, Identities = 332/858 (38%), Positives = 522/858 (60%)
  Q:    12 DLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKP----PKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL-------ERLDFKKISNLKESSIEDVLQIINKIRIFNFE-NKIPNNKVIDIHLEVLNPKLFKIS--DEVINILNTAKI---------NIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNE----ANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           ++ K Y+  +I ++ +S W  +K  + + +  +K  ++I++PPPN+TG LH+GHAL+ T+QD L RF  ++G  A W+ G DHA IAT+ K  + +RE  I+ +D  R++ +   ++W    G  I +Q K +G   D++ E FT+++  ++ V +VFV +YN G IYR + ++NW     ++IS+ EV  ++     +++RY L++   Y+ +ATTRPET+  D  + VNP D RYK+ + K    PL  +EI I+AD+YV I FGTGV+K TPAHD ND+E+G ++ L +I+   +D    +    +  +   +AR   VE L+K   L K+E    NVG   R +  +EP +S+QWFVK+ E +K  IE  K+    +F P  F+K   +W+ N+ DWCISRQLWWGH+IP +Y  D  E+ V  +     PK  +   +D D LDTWFSS LWP +T    D  +  D  +PTNVLVTG+DIIFFWV RMMF  L    +VPF    I GL+RD    KMSKSLGNG+DP +VI+KYGADALR  L++ ++PG D+ +  E+V++   F NK+WN+ R+++MN  +   D    P+NL D DKWIL+K N    +  +  +K+   ++  KI +F W++FC+ YIE+ K R  N     +++ LW L  ++   L L HP  PF+T  ++ N +   +++I+L       E  DF K    +E ++E + + +  IR    E N  P+ K           K+F +S  +E+  I    K+          ++ QD KS     + ++ +  ++ K  +     E    +  IE++ KE+E +  E++R NGMLSN +F+ KAP++KI  EK+K+ K++  + ++++ L+
  S:     3 EIEKNYNPAEIEDRLYSKWQEKKYFHAE-VDRSKKPFTIVMPPPNITGQLHMGHALDNTMQDILTRFKRMQGYEALWLPGTDHASIATEAKIVEKMREEGITKEDLGREKFLDRAWQWKAQYGGRIVSQLKKIGSSCDWDRERFTMDEGCSKAVKEVFVNLYNKGQIYRGERIINWCPHCLTSISDAEVEYEDQAGKFWHLRYPLTDGSGYIQLATTRPETLLGDTAVAVNPNDDRYKDLVGKTLTLPLVGREIPIVADDYVGIDFGTGVVKITPAHDPNDFEVGLRHNLPVINVLTDDAKIVDDYPKYAGMDRYEARKAIVEDLDKEGYLVKIEDHEHNVGTCYRCHTTIEPRVSKQWFVKMEEIAKPAIEAVKNGDT-KFVPPHFDKTYFHWLENIRDWCISRQLWWGHRIPAFYCDDCGEMVVTKEDHAVCPKCGKEMRQDPDTLDTWFSSALWPFSTLGWPDNTEELDYFYPTNVLVTGYDIIFFWVIRMMFSGLEHTGKVPFDTVLIHGLVRDSQGRKMSKSLGNGIDPLEVIDKYGADALRFTLITGNAPGNDMRFYWERVEASRNFANKVWNASRFIQMNMPEEGIDVKNKPENLTDADKWILSKVNTLAKDVTENLDKFELGIAADKIYEFIWEEFCDWYIEMVKPRLYNDDDDTKKAALWTLKKVLIDALKLLHPYMPFITEEIFCNLQ-DEEETIMLSKWPEFTEEYDFAK----EEKAVETIKEAVRNIRNIRSEMNVAPSKKA----------KVFVVSSEEEIKTIFENGKVFFATLGYASEVIIQDDKS----GIGDDAVSVVIPKATIYMPFAELVDISKEIERLNKEVEKLNKELARVNGMLSNPNFVSKAPEKKINEEKAKQAKYQQMMDQVKEQLA 875
>gi|153814976|ref|ZP_01967644.1| hypothetical protein RUMTOR_01191 [Ruminococcus torques ATCC 27756] >gi|145847544|gb|EDK24462.1| hypothetical protein RUMTOR_01191 [Ruminococcus torques ATCC 27756] (881 aa)
Score = 1525, Expect = 6.0e-167, Identities = 318/857 (37%), Positives = 514/857 (59%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQES-------KLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINI--VKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           + +L+K YD K  E++ +  W   K  + + +  ++  ++ ++PPPN+TG LH+GHAL+ T+QD LIR+  ++G +A WI G DHA I+T+ K    L+E  I  K+  R+  +   ++W +     I NQ K +G   D++ E FT+++  ++ V +VF+K+Y  G IY+   ++NW  K ++++S+ EV  +E E + ++I+Y +  +  +L +ATTRPET+  D  + V+P D+RY++ I K  I PL N+EI I+AD YVD +FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N     +  ++  +AR   V+ LE+   L KV      VG  +R    VEP++ +QWFVK+ E +K  IE  KS  +++F P +F+K  ++W+ N+ DWCISRQ+WWGH+IP +Y  +  E  V    P+         + +D D LDTWFSS LWP +T    D  +  D  +PT+VLVTG+DIIFFWV RM+F       + PF    I GL+RD    KMSKSLGNG+DP ++I+KYGADALRL L++ ++PG D+ +  E+V++   F NK+WN+ R++ MN  D N  ++ +       D+WIL+  N    +     +K+   ++++K+ DF WD+FC+ Y+E++K R  ++E         LWVL  ++ + L L HP  PF+T  +Y     + +  ++ E   +K+  N  +    +E V  +   IR    E  +PNN+  ++ +    E L   +      V+ ++  + I +   K+ I+      V  + +++ L  EDL+    E    E++ KE E +  EI R  GML+N+ F+ KAP+ K++ E+ K EK+E  L ++++
  S:     2 SKELAKTYDPKAIEEKLYEKWCENKYFHAE-VDRSRKPFTTVMPPPNITGKLHMGHALDNTLQDILIRYKRMEGYNALWIPGTDHAAISTEVKVTNQLKEEGIDKKELGREGFLERTWQWKEEYAGTIENQLKKLGISCDWDRERFTMDEGCSKAVEEVFIKLYEKGYIYKGSRIINWCPKCKTSLSDAEVEHEEQEGHFWHIKYPIVGTDRFLEIATTRPETLLGDTAIAVHPDDERYQDIIGKNVILPLVNREIPIVADYYVDKEFGTGAVKITPAHDPNDFEVGKRHDLEEINVMNDDATINEKGGKYAGMERYEARKAIVKDLEEQGYLVKVVPHTHAVGTHDRCGTTVEPLIKQQWFVKMEELAKPAIEALKSG-ELKFVPERFDKIYLHWLENIKDWCISRQIWWGHRIPAYYCDECGEFVVDRHAPEKCPHCGCTHFTQDEDTLDTWFSSALWPFSTLGWPDKTEDLDYFYPTDVLVTGYDIIFFWVIRMVFSGYEHTGKSPFHTVLIHGLVRDSQGRKMSKSLGNGIDPLEIIDKYGADALRLTLVTGNAPGNDMRFYNERVEASRNFANKVWNASRFIMMN-MDENIIDEPSHDLFTPADRWILSAANTLAKDVTDNMDKFELGIAVQKVYDFIWDEFCDWYVEMAKFRIYHKEEAPEAANCALWVLKTVLAQGLKLLHPFMPFITEEIYGALVPEEESLMMSEWPKYKEEWNFAQDEFVMERVKAVTRGIRNIRAEMDVPNNRKTNVFIVSEKEELTKAIEGFKQSVMPLMLASDIIVQSTKEGIEDNAVSIVVPDAVVY-LPLEDLVDFEQEK---ERLTKEEERLNKEIKRAKGMLANEKFVSKAPEAKVQEERDKLEKYEQMLAQVKE 875
>gi|164686738|ref|ZP_02210766.1| hypothetical protein CLOBAR_00333 [Clostridium bartlettii DSM 16795] >gi|164604128|gb|EDQ97593.1| hypothetical protein CLOBAR_00333 [Clostridium bartlettii DSM 16795] (889 aa)
Score = 1521, Expect = 1.8e-166, Identities = 342/858 (39%), Positives = 520/858 (60%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKY-EKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKF-EKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD---EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR-----TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL--KESSIEDVLQIINKIRIFNFENKIPNN---KVIDIHLEVLNPKLFKISDEVINILNTAKINI--VKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKE-LEKLLS 869
           +LSK Y+ K  EQ+       K   K +   +K  + I+LPPPN+TG LH+GHAL+ T+QD LIR+  + G  A W  G DHA IAT+ K  EK  +E   S  +  R+E +    +W    G  I +Q K +G   D++ E FT+++  NE V + FVK+Y  G IYR   ++NW    ++ +S+ EV  +E + N Y+++YYL +S  YL VATTRPET+  D  + VNP D+RYK+ + K AI P+  +E+ I+AD+YVD++FGTGV+K TPAHD ND+ +G+++ L  I+  NEDG+ N+    +  +   + R + ++ LE+   L K+      VG   R + VVEP +SEQWFVK+ E +K  I++ K +++++F P ++     + W+ N+ DWCISRQLWWGHQIP +Y ++  E+ V  + P   E      + +D DVLDTWFSS LWP +T     + + L   +PTNVLVTG+DIIFFWV RM F  ++   E PF+H  I GL+RD    KMSKSLGNG++P +VI++YGADALR  L++ +SPG D+ +  E+V++   F NKLWN+ R++ MN  D   +    +    N    DKWI+++ N+   E  +  +K++  ++  K+ DF W +FC+ YIE+ K R        +++ L+VL Y+++KIL L HP  PF+T  +Y          ++ E   +K+  N+   E+ +E  +  I  IR    E  +P +   KVI I  E   P +    D  + + + +++ I   ++++       V     IFI   ++L+  + E + + K K +IE   SEI R NG LSN+ F+ KAP++ +  EK+KKEK+E  LK  LE+L S
  S:     5 NLSKTYNPKDFEQRLYQEWMDKGYFKSSPNPDKKPFCIVLPPPNITGQLHMGHALDHTLQDVLIRWKRMDGYEALWQPGTDHASIATEVKVVEKIRKEEGKSKYELGREEFLKRAMDWKDEYGRVIVDQMKQLGSSCDWDRERFTMDQGCNEAVTEFFVKLYEKGHIYRGNRIINWCPDCKTTLSDAEVEHEEKDGNFYHVKYYLKDSDQYLEVATTRPETMLGDTGIAVNPNDERYKDIVGKVAILPIVGRELPIVADDYVDMEFGTGVVKMTPAHDPNDFGVGQRHNLEQINVMNEDGSMNDLCGKYAGMDRYECRKELIKDLEEEGFLIKIVPHPHAVGTCYRCHTVVEPRLSEQWFVKMDELAKPAIDILK-NEELKFVPERYGTGTYLQWLENIRDWCISRQLWWGHQIPAYYCQECGEVVVAKEAPHKCEKCGCTEFKQDEDVLDTWFSSALWPFSTLGWPHNTEELEYYYPTNVLVTGYDIIFFWVVRMAFAGMFCMNETPFEHVLIHGLVRDSQGRKMSKSLGNGINPLEVIDEYGADALRFMLITGNSPGNDMRFYFERVEASRNFANKLWNASRFIFMNIDDEIMNGVTRESVEANFTLADKWIISRANRVAKEVTENMDKFDLGIAATKVEDFAWSEFCDWYIEIVKPRLYGEDKEAKQTALYVLTYVLEKILKLLHPYMPFITEEIYSCLPTVEGSIMVSEWPHYKEEDNMAQDEAMMELAMDGIRNIRNARAEMDVPPSKKAKVIIIPTEEKLPAIEAGKDYFVTLASASEVQIQMTEENVPEDAVSVVIEGAKIFI-PLDELVDFSKELDRLNKEKAKIE---SEIKRVNGKLSNQGFLAKAPEKLVNEEKAKKEKYEEMLKSVLERLES 883
>gi|168187608|ref|ZP_02622243.1| valyl-tRNA synthetase [Clostridium botulinum C str. Eklund] >gi|169294536|gb|EDS76669.1| valyl-tRNA synthetase [Clostridium botulinum C str. Eklund] (879 aa)
Score = 1520, Expect = 2.1e-166, Identities = 333/833 (39%), Positives = 501/833 (60%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDF--KKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPK 844
           +++K Y+ K  E +      QK      +  +K  Y+I++PPPN+TG LHLGHAL+GT+QD LIR   ++G S  W+ G DHA IAT+ K EK L E  +  K+  R+  +  +++W+    + I+ Q++ +G   DY  E FT+++  N+ V +VFV++YN+GLIY+   +VNW  K Q+AIS+ E+  +E   + ++I+Y +  + ++L +ATTRPET+  D  + VNP D+RY + + K  + PL N+EI I+ADEYVD++FGTG +K TPAHD NDYE+GK++ L  I   N+DG+       +  L   +AR   V+ LE++  L K+++   NVG  +R  + +EPM SEQW+VK+   ++  I++ +   +I+F P +F K   NWM N+ DWCISRQLWWGH+IPVWY K+  E+ V T+ P        E   +D DVLDTWFSS LWP +T    +  +  +  +PT+ LVTG+DIIFFWV RM+F  L+  K++PF    I G++RD    KMSKSLGNGVDP +VIEKYGADALR  L++ ++PG D+ Y EEKV++   F NK+WN+ R+V MN      ++ K  K     DKWIL++ N    E  +  +K+   ++ +KI DF W++FC+ YIEL K      + K     L VLN ++KK L L HP+ PF+T  +Y N    T+++I+        +++S+ K E  +  +++ I  +R    E  +P ++   + +     K  FK        L +A     + D    K    EN         E    LL   +    +E++ KE E ++ EI R    LSN+ F+ KAP+
  S:     5 NIAKTYNPKEFEDKLYEKWEQKGYFTPEVDKSKKPYTIMMPPPNITGQLHLGHALDGTLQDVLIRTKRMQGYSTLWLPGEDHASIATEVKVEKSLLEQGLHKKEMGREAFLEKVWDWAYKYRDRIKTQYQKLGISADYTRERFTMDEGLNKAVRKVFVELYNEGLIYKGNRIVNWCPKCQTAISDAEIEYQEQNGHFWHIKYPVVGTDEFLEIATTRPETMLGDTAVAVNPNDERYSHLVGKKLMLPLVNREIPIVADEYVDVEFGTGAVKITPAHDPNDYEVGKRHNLPQIVILNKDGSIVEGYGKYSGLDRYEARKVLVKDLEESGFLVKIKEHAHNVGTHDRCGSTLEPMTSEQWYVKMKPLAEPAIKVVREG-EIKFVPERFSKTYYNWMENIQDWCISRQLWWGHRIPVWYCKNCGEVIVSTEDPTKCPKCGSEHLEQDKDVLDTWFSSALWPFSTLGYPERTEDLEYFYPTSTLVTGYDIIFFWVARMIFSGLHSMKKIPFDTVLIHGIVRDSEGRKMSKSLGNGVDPLEVIEKYGADALRFMLITGNAPGNDIRYYEEKVEAARNFANKIWNASRFVMMNLDKDLMEKYKDCKEYTLADKWILSRINTVVKEATENIDKFELGIAAQKIYDFMWNEFCDWYIELVKPALYGDDEKAKGVVLNVLNEVLKKGLKLLHPVMPFITEEIYTNLP-NTEETIVTSAWPVFEEELSDAKTEEQMNYIIEAIKSLRNVRSEMNVPPSRKAKVTIFATEGKDAFKQGTIYFERLASAS----EVDFVDSKDSIPENTVSAVTKGAEMFMPLLDLVDIEKELERLNKEKEKLQKEIERVEKKLSNEKFVSKAPE 851
>gi|150389212|ref|YP_001319261.1| valyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] >gi|149949074|gb|ABR47602.1| valyl-tRNA synthetase [Alkaliphilus metalliredigens QYMF] (884 aa)
Score = 1520, Expect = 2.6e-166, Identities = 340/861 (39%), Positives = 514/861 (59%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKY-EKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPP------KNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR-----TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDF--KKISNLKESSIEDVLQIINKIRIFNFE-NKIPNNKVIDIHLEVLNPKLF---KISDEVINILNTAKINIV-----KQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +L K Y  +  E +       K   K  +  +K SYSI+LPPPN+TG LH+GHAL+ T+QD LIR+  ++G    W  G DHA IAT+ K  EK  RE  +S  D  RD  +   +EW    G  I NQ K MG   D+  E FT+++  NE V +VF+K+Y  GLIYR   ++NW  + ++++S+ EV  ++   + ++I+Y + ++ +Y+ +ATTRPET+  D  + V+P+D+RY + I KFAI PL ++EI I ADEYVD +FGTG +K TPAHD ND+E+G ++ L  I   N+D T N     +E +   DAR + V+ L+    L  V+    +VG   R N +VEP+ S+QWFVK+   +K  IE  K  K+IQF P +F K    W+ N+ DWCISRQLWWGH+IP +Y +D  E+ V    P      +  +L  +D DVLDTWFSS LWP +T    +     D  +PT+VLVTG+DIIFFWV RM F  L    E+PFKH +I GL+RD    KMSKSLGNG+DP ++I++YGADALR  L++ +SPG D+ +  EK++S   F NKLWN+ R+V MN  +    E++  ++L   D+WI+++ N+   E  +  +K+   ++ +KI DF W ++C+ YIEL+K R        +++  + L  ++  IL L HP  PF+T  ++ +        I+     +  ++I ++    +E ++  I  IR    E N +P+ K     L VL  + F    I +  +     A ++ +     +Q++       V +   +FI   +DL+    E   I++++KE E ++ EI+R  G L+N+ F+ KAP   IE EK K+ K++  L  +++ L S K
  S:     4 NLDKNYQPQEFEDRIYKEWENKGYFKPVINPDKESYSIVLPPPNITGQLHMGHALDHTLQDILIRWKRMQGFETLWQPGTDHASIATEVKVVEKIKREEGLSKLDIGRDGFLQRAWEWRDEHGRTIVNQMKRMGDSCDWSRERFTMDEGCNEAVTEVFIKLYEKGLIYRGNRIINWCPECKTSLSDAEVEHEDKAGHFWHIQYPIKDTDEYIEIATTRPETMLGDTGIAVHPEDERYNHLIGKFAILPLLDREIPIFADEYVDPEFGTGAVKITPAHDPNDFEIGARHNLEQIVVMNDDATINKRGGKYEGMARYDARKQIVKDLDALGQLAHVKDHQHSVGQCYRCNTIVEPLTSDQWFVKMEPLAKPAIEAVK-EKEIQFVPERFSKTYTQWLENIRDWCISRQLWWGHRIPAYYCQDCGEVIVSKTTPTVCGKCQGNQLK-QDEDVLDTWFSSALWPFSTLGWPEKTAELDYFYPTDVLVTGYDIIFFWVVRMAFSGLEFMDEIPFKHVFIHGLVRDADGRKMSKSLGNGIDPLNIIDQYGADALRFTLVTGNSPGNDMRFHMEKLESSRNFANKLWNATRFVLMNLDEKEITEEEVKEHLNTADRWIISRVNQVTKEVTENMDKFELGMAAQKIYDFIWSEYCDWYIELTKTRLYGENEDKRKAAQYTLTSVLADILKLLHPFMPFITEEIWQHLPTVDGSVIIAAWPTYEEEQIDDIAIGKMELLMNAIKNIRNVRAEMNVVPSRKA---KLMVLTNEEFVKTTIQESELYFGALASVSTIEFVSSEQEVPDDAVSAVVDGAKLFI-PLDDLIDFEKE---IQRLEKEKEKLEDEITRVTGKLANQGFVAKAPAHLIETEKEKQVKYQQMLDAVDERLVSLK 881
>gi|196163415|ref|ZP_03123946.1| valyl-tRNA synthetase [Clostridium difficile QCD-23m63] (888 aa)
Score = 1519, Expect = 2.8e-166, Identities = 342/861 (39%), Positives = 521/861 (60%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD---FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR-----TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQI----INKIRIFNFENKIPNNKVIDIHLEVLNPKLFKIS---DEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEAN---NIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           N +LSK Y+ K  E + +  W  +     K    +K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  + G  A+W+ G DHA IAT+ K  + +++ +   K +  R+E +   +EW    G  I NQ K +G   D++ E FT+++  NE V + FV +Y  G IYR   ++NW    ++ +S+ EV  +E + N Y+I+Y L +S+D+L +ATTRPET+  D  + VNP+D RYK+ I K AI PL  +E+ I+AD YVD++FGTG +K TPAHD ND+E+G ++ L  ++  NEDGT N     +E +   + R   V  L++   L K+++   NVG   R + VVEP +SEQWFVK+ E +K  I++ K   +++F P KF+K  + W+ N+ DWCISRQLWWGHQIP +Y ++  EI V  K P          + +D D LDTWFSS LWP +T    +  ++ D  +PT+VLVTG+DIIFFWV RM F  ++   E PF H  + GL+RD    KMSKSLGNG+DP ++IE+YGADALR  L + +SPG D+ +  E+V+    F NKLWN+ R+V MN  +    N   +   ++L   DKWI+++ N    E     +K++  ++++KI DFTW ++C+ YIE+ K R     T+ + + L+ L Y+++KIL L HP  PF+T  +Y +        I+ E   + +  N+ E   ED++ +    I  IR    E  +P +K   + +     K+  I    D  I + + + + I K      K +  E+   + I   E  +  N   +    IE++ KE + ++ EI R NG L+N+ F+ KAP+  IE EK+KKEK E  +K +E+ L++
  S:     3 NTNLSKTYNPKEFEARLYKKWMDEGYFKSKP-NPDKKPFTIMMPPPNITGQLHMGHALDHTLQDILIRWKRMDGYEAFWLPGTDHASIATEVKVVERIKKQEGKTKYEIGREEFLKRAWEWKDEFGGKISNQLKQLGDSCDWDKERFTMDEGCNEAVIEFFVSLYEKGHIYRGNRIINWCPDCKTTLSDAEVEHEEHDGNFYHIKYPLKDSEDFLEIATTRPETMIGDTGIAVNPEDDRYKHLIGKTAILPLVGRELPIVADSYVDLEFGTGAVKMTPAHDPNDFEVGLRHNLEQLNTMNEDGTMNEVCGKYEGMDRFECRKAIVADLKEQGYLIKIKEHNHNVGTCYRCHTVVEPRLSEQWFVKMEELAKPAIDILKKG-ELEFVPEKFDKTYLQWLENIRDWCISRQLWWGHQIPAYYCQECGEIVVARKMPDKCPKCGSTHFKQDEDALDTWFSSALWPFSTLGWPNKTEALDYYYPTSVLVTGYDIIFFWVVRMAFAGMFCMNEKPFDHVLVHGLVRDSQGRKMSKSLGNGIDPLEIIEQYGADALRFTLTTGNSPGNDMRFYMERVEFARNFANKLWNASRFVFMNIDEDIIKNMTRESVKEDLTLADKWIISRANNIVKEATNNMDKFDLGIALQKIYDFTWSEYCDWYIEMVKPRLYGEDTNAKSAALYTLTYVLEKILKLLHPYMPFITEEIYTHLPTVEGCIIVSEWPKYNEEDNMAEE--EDMMNLLMEGIRSIRNVRAEMNVPPSKKAKLIIIPSEEKIEAIELGKDYFITLASASNVEIAKD-----KSNVPEDAVGVVIDGVEIFIPLNELVDFEKEIERLSKEKKKLEGEIKRVNGKLANQGFLAKAPESLIEEEKAKKEKFEEMIKSVEERLTN 882
>gi|167630790|ref|YP_001681289.1| valyl-tRNA synthetase [Heliobacterium modesticaldum Ice1] >gi|167593530|gb|ABZ85278.1| valyl-tRNA synthetase [Heliobacterium modesticaldum Ice1] (894 aa)
Score = 1519, Expect = 3.0e-166, Identities = 314/858 (36%), Positives = 499/858 (58%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTK-------PPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR-----------TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINI--VKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           LSK YD K  E ++  W ++K     ++++   ++S+++PPPNVTG+LHLGHA++ T+QD L RF  ++G    W+ G DHAGIATQ K E+ L +  +S  D  R+  +  +++W    G  I  Q + +G   D+  E FT+++  +E V +VF+++Y  GLIYR   ++NW  K Q+ IS+IEV  +E   +L++IRY + +    ++VATTRPET+  D  + V+P D RYK+ I K  I P+ N+ I +IAD YVD  FGTGV+K TPAHD ND+E+  ++ L  I+   ++   N  A  +      + R + V+ LE    L KV   +  VG   R + VVEPM+S QWFV++   ++  +E+ K+  +++F P +F K  + W+ N+ DWCISRQLWWGH+IPVWY  D   IY G         P      + +D DVLDTWFSSGLWP +T    +    L   +PT+VLVTG DIIFFWV RM+F  L    +VPF+  +I GLI D    KMSKSLGNGVDP ++I++YGAD LR  L++ ++PG D+ +  E+++    F NK+WN+ R+V MN   F   +      L   D+WIL+++N+   E      +Y+   + + + +F W+++C+ YIEL+K R            +++++   VL Y+++  L L HP  PF+T  ++        +SI++      + ++I++  E  +  V+ +I  IR    E  +   K  ++ L   N K  ++  +    ++N+   +++ I  +           +  +  I++     L G  +    I+++ KE+  V+ E+ R    L+N  F+ KAP E +  E+ K+ +   K   LE+ L +
  S:     9 LSKTYDPKQVESKWYAWWSEKGYFTADVQSGGKAFSVVMPPPNVTGSLHLGHAMDNTLQDILSRFKRMQGYHVLWVPGTDHAGIATQAKVEEALAKEGLSKYDLGREAFLERVWDWKHQYGTRITTQLRTLGTSCDWTRERFTMDEGCSEAVQEVFIRLYEKGLIYRGNRIINWCPKCQTTISDIEVEHEERGGHLWHIRYPVQDGDGEVVVATTRPETMLGDTAVAVHPDDDRYKHLIGKMVILPILNRAIPVIADAYVDPAFGTGVVKITPAHDPNDFEVALRHNLPQITVMTKEAVMNEEAGPYVGQDRYECRKRIVKDLEAKGFLVKVNDHVHAVGQCYRCDTVVEPMVSPQWFVRMKPLAEPAMEVVKNG-RLKFVPERFTKIYLGWLENIRDWCISRQLWWGHRIPVWYCDDCDYIYCGRAEELPEVCPKCGASHFEQDPDVLDTWFSSGLWPFSTLGWPEKTPELVKYYPTSVLVTGRDIIFFWVARMVFMGLEFMGDVPFREVFIHGLILDAQGRKMSKSLGNGVDPIEIIDQYGADTLRFMLVTGNTPGNDIRFHFERLEGIRNFANKIWNASRFVLMNLEGFAIHQPWGELTLA--DRWILSRYNRLIGETTAALERYDLGEAARLLYEFLWNEYCDWYIELAKPRLYGKEVGVADAAASRQTAQQVLTYVLRGTLQLLHPFMPFLTEEIWQQLPHH-GESIMVAPWPEAEPERINSSIEEEMALVMDVIRAIRNIRAEMNVAPGKRAEVILVCGNEKQRRVLTQGAAYIVNLAGASQVAIEGIGYGQSEGAATAIVGDTAIYL----PLKGLIDLTKEIDRLTKELRAVEDEVRRLGSKLNNAGFVAKAPAEVVAKEREKEGEALRKKAALEERLRT 888
>gi|20807263|ref|NP_622434.1| valyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4] >gi|81482270|sp|Q8RBN5|SYV_THETN Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|20515771|gb|AAM24038.1| Valyl-tRNA synthetase [Thermoanaerobacter tengcongensis MB4] (879 aa)
Score = 1518, Expect = 4.5e-166, Identities = 347/858 (40%), Positives = 523/858 (60%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTK-YEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS--IEDVLQIINKIRIFNFENKIPNNKVIDIHLEV---LNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           D++K Y+ K  E + +S W  +K      +   K  ++I++PPPNVTG LH+GHAL+ T+QD LIR+  ++G +A WI G DHA IAT+ K  +K   E   + KD +R+E +   +EW     N I +Q K +G   D+    FT+++K ++ V +VFV +Y  GLIY+   ++NW     +A+S+ EV  KE + +L+YI+Y +   +DY+++ATTRPET+  D  + V+P+D+RY++ I K  I PL  +EI +IADEYVD  FGTG +K TPAHD ND+E+G ++ L  ++  NE+ T N     +E L   +AR K V+ LE+  LL KVE+ + NVG   R + VVEP++SEQWFVK+   +K  +++ K   KI+F P +FEK   NW+ N+ DWCISRQLWWGH+IP WY +D   + V  + P   E+       +D +VLDTWFSS LWP +T    +  + L   +PT+VLVTG+DIIFFWV RM+F SL   KE+PFK+  I GL+RD    KMSKSLGNG+DP +VIEKYGAD LR  L+  ++PG D+ +  EKV+    F NKLWN+ RYV +     N DE+ T   L++    DKWIL ++N    E      K+   V+  K+ DF W +FC+ YIELSK    + N+E+K     VL Y++   L L HP  PF+T  ++ N   + +  ++ E   +++  N +E +   E +++ I  IR    E  +  +K   + + V    + K+F+     I  L  A    ++++  ++ P    +  +   L    L    +    I+++++E E V  EI R   +L+N++F++KAP++ +  E+ K EK+   LK +E+ LS
  S:     3 DIAKTYNPKEFEDRIYSFWM-EKGFFTPEIDPEKKPFTIVIPPPNVTGELHMGHALDNTLQDILIRWRRMQGYAALWIPGTDHASIATEIKVLDKIREETGKTKKDLTREEFLEKAWEWKDKYENRILSQLKKLGSSCDWTRTAFTMDEKRSKAVREVFVSLYEKGLIYKGNRIINWCPSCNTALSDAEVEHKEHKGHLWYIKYPVKGEEDYVVIATTRPETMLGDVAVAVHPEDERYRHLIGKTLILPLVGREIPVIADEYVDPSFGTGAVKVTPAHDPNDFEIGVRHNLPFVNIMNENATINENGGKYEGLDRYEAREKIVKDLEEQGLLLKVEEHVHNVGHCYRCDTVVEPLLSEQWFVKMEPLAKPALQVVKEG-KIKFVPERFEKIYTNWLENIKDWCISRQLWWGHRIPAWYCEDCGHVTVSREDPVKCEVCGSTNIHQDENVLDTWFSSALWPFSTMGWPEETEDLKYFYPTDVLVTGYDIIFFWVARMIFMSLEFMKEIPFKYVLIHGLVRDALGRKMSKSLGNGIDPLEVIEKYGADTLRFTLVIGNAPGNDMRFSWEKVEHSRNFANKLWNASRYVLL-----NLDENDTNLYLDNLALADKWILTRYNNIVKEITDNLEKFELGVAASKLYDFVWSEFCDWYIELSKPVLYSDNEEAKKVTKSVLRYVLDNTLRLLHPFMPFITEEIWQNLPHEGESIMVAEWPKYREDLNFEEDAKKAEIIMEAIRAIRNIRAEANVSPSKKAKVIIAVEKEEHEKIFESGKNYIMKLAGASEVAIERNRDNI-PQKAMSAAISAGLIAVPLEELIDLEEEIKRLEEEREKVLKEIERAQSLLNNENFVKKAPEKVVNAEREKLEKYTAMLKNIEERLS 875
>gi|168713750|ref|ZP_02746027.1| valyl-tRNA synthetase [Clostridium difficile QCD-63q42] (888 aa)
Score = 1517, Expect = 5.2e-166, Identities = 341/861 (39%), Positives = 520/861 (60%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD---FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQI----INKIRIFNFENKIPNNKVIDIHLEVLNPKLFKIS---DEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEAN---NIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           N +LSK Y+ K  E + +  W  +     K    +K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  + G  A+W+ G DHA IAT+ K  + +++ +   K +  R+E +   +EW    G  I NQ K +G   D++ E FT+++  NE V + FV +Y  G IYR   ++NW    ++ +S+ EV  +E + N Y+I+Y L +S+D+L +ATTRPET+  D  + VNP+D RYK+ I K AI PL  +E+ I+AD YVD++FGTG +K TPAHD ND+E+G ++ L  ++  NEDGT N     +E +   + R   V  L++   L K+++   NVG   R + VVEP +SEQWFVK+ E +K  I++ K   +++F P KF+K  + W+ N+ DWCISRQLWWGHQIP +Y ++  EI V  K P          + +D D LDTWFSS LWP +T    +  ++ D  +PT+VLVTG+DIIFFWV RM F  ++   E PF H  + GL+RD    KMSKSLGNG+DP ++IE+YGADALR  L + +SPG D+ +  E+V+    F NKLWN+ R+V MN  +    N   +   ++L   DKWI+++ N    E     +K++  ++++KI DFTW ++C+ YIE+ K R   +++      L+ L Y+++KIL L HP  PF+T  +Y +        I+ E   + +  N+ E   ED++ +    I  IR    E  +P +K   + +     K+  I    D  I + + + + I K      K +  E+   + I   E  +  N   +    IE++ KE + ++ EI R NG L+N+ F+ KAP+  IE EK+KKEK E  +K +E+ L++
  S:     3 NTNLSKTYNPKDFEARLYKKWMDEGYFKSKP-NPDKKPFTIMMPPPNITGQLHMGHALDHTLQDILIRWKRMDGYEAFWLPGTDHASIATEVKVVERIKKQEGKTKYEIGREEFLKRAWEWKDEFGGKISNQLKQLGDSCDWDKERFTMDEGCNEAVIEFFVSLYEKGHIYRGNRIINWCPDCKTTLSDAEVEHEEHDGNFYHIKYPLKDSEDFLEIATTRPETMIGDTGIAVNPEDDRYKHLIGKTAILPLVGRELPIVADSYVDLEFGTGAVKMTPAHDPNDFEVGLRHNLEQLNTMNEDGTMNEVCGKYEGMDRFECRKAIVADLKEQGYLIKIKEHNHNVGTCYRCHTVVEPRLSEQWFVKMEELAKPAIDILKKG-ELEFVPDKFDKTYLQWLENIRDWCISRQLWWGHQIPAYYCQECGEIVVARKMPDKCPKCGSTHFKQDEDALDTWFSSALWPFSTLGWPNKTEALDYYYPTSVLVTGYDIIFFWVVRMAFAGMFCMNEKPFDHVLVHGLVRDSQGRKMSKSLGNGIDPLEIIEQYGADALRFTLTTGNSPGNDMRFYMERVEFARNFANKLWNASRFVFMNIDEDIIKNMTRESVKEDLTLADKWIISRANNIVKEATNNMDKFDLGIALQKIYDFTWSEYCDWYIEMVKPRLYGEDANAKSAALYTLTYVLEKILKLLHPYMPFITEEIYTHLPTVEGCIIVSEWPKYNEEDNMAEE--EDMMNLLMEGIRSIRNVRAEMNVPPSKKAKLIIIPSEEKIEAIELGKDYFITLASASNVEIAKD-----KSNVPEDAVGVVIDGVEIFIPLNELVDFEKEIERLSKEKKKLEGEIKRVNGKLANQGFLAKAPESLIEEEKAKKEKFEEMIKSVEERLTN 882
>gi|168694547|ref|ZP_02726824.1| valyl-tRNA synthetase [Clostridium difficile QCD-37x79] >gi|168724212|ref|ZP_02756489.1| valyl-tRNA synthetase [Clostridium difficile QCD-76w55] >gi|168731552|ref|ZP_02763829.1| valyl-tRNA synthetase [Clostridium difficile QCD-97b34] >gi|196160444|ref|ZP_03121005.1| valyl-tRNA synthetase [Clostridium difficile CIP 107932] (888 aa)
Score = 1516, Expect = 6.0e-166, Identities = 341/861 (39%), Positives = 518/861 (60%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD---FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQI----INKIRIFNFENKIPNNKVIDIHLEVLNPKLFKIS---DEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEAN---NIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           N +LSK Y+ K  E + +  W  +     K    +K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  + G  A+W+ G DHA IAT+ K  + +++ +   K +  R+E +   +EW    G  I NQ K +G   D++ E FT+++  NE V + FV +Y  G IYR   ++NW    ++ +S+ EV  +E + N Y+I+Y L +S+D+L +ATTRPET+  D  + VNP+D RYK+ I K AI PL  +E+ I+AD YVD++FGTG +K TPAHD ND+E+G ++ L  ++  NEDGT N     +E +   + R   V  L++   L K++    NVG   R + VVEP +SEQWFVK+ E +K  I++ K   +++F P KF+K  + W+ N+ DWCISRQLWWGHQIP +Y ++  EI V  K P          + +D D LDTWFSS LWP +T    +  ++ D  +PT+VLVTG+DIIFFWV RM F  ++   E PF H  + GL+RD    KMSKSLGNG+DP ++IE+YGADALR  L + +SPG D+ +  E+V+    F NKLWN+ R+V MN  +    N   +   ++L   DKWI+++ N    E     +K++  ++++KI DFTW ++C+ YIE+ K R   +++      L+ L Y+++KIL L HP  PF+T  +Y +        I+ E   + +  N+ E   ED++ +    I  IR    E  +P +K   + +     K+  I    D  I + + + + I K      K +  E+   + I   E  +  N   +    IE++ KE + ++ EI R NG L+N+ F+ KAP+  IE EK KKEK E  +K +E+ L++
  S:     3 NTNLSKTYNPKDFEARLYKKWMDEGYFKSKP-NPDKKPFTIMMPPPNITGQLHMGHALDHTLQDILIRWKRMDGYEAFWLPGTDHASIATEVKVVERIKKQEGKTKYEIGREEFLKRAWEWKDEFGGKISNQLKQLGDSCDWDKERFTMDEGCNEAVIEFFVSLYEKGHIYRGNRIINWCPDCKTTLSDAEVEHEEHDGNFYHIKYPLKDSEDFLEIATTRPETMIGDTGIAVNPEDDRYKHLIGKTAILPLVGRELPIVADSYVDLEFGTGAVKMTPAHDPNDFEVGLRHNLEQLNTMNEDGTMNEVCGKYEGMDRFECRKAIVADLKEQGYLIKIKAHNHNVGTCYRCHTVVEPRLSEQWFVKMEELAKPAIDILKKG-ELEFVPDKFDKTYLQWLENIRDWCISRQLWWGHQIPAYYCQECGEIVVARKMPDKCPKCGSTHFKQDEDALDTWFSSALWPFSTLGWPNKTEALDYYYPTSVLVTGYDIIFFWVVRMAFAGMFCMNEKPFDHVLVHGLVRDSQGRKMSKSLGNGIDPLEIIEQYGADALRFTLTTGNSPGNDMRFYMERVEFARNFANKLWNASRFVFMNIDEDIIKNMTRESVKEDLTLADKWIISRANNIVKEATNNMDKFDLGIALQKIYDFTWSEYCDWYIEMVKPRLYGEDANAKSAALYTLTYVLEKILKLLHPYMPFITEEIYTHLPTVEGCIIVSEWPKYNEEDNMAEE--EDMMNLLMEGIRSIRNVRAEMNVPPSKKAKLIIIPSEEKIEAIELGKDYFITLASASNVEIAKD-----KSNVPEDAVGVVIDGVEIFIPLNELVDFEKEIERLSKEKKKLEGEIKRVNGKLANQGFLAKAPESLIEEEKVKKEKFEEMIKSVEERLTN 882
>gi|170759549|ref|YP_001788482.1| valyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] >gi|169406538|gb|ACA54949.1| valyl-tRNA synthetase [Clostridium botulinum A3 str. Loch Maree] (881 aa)
Score = 1515, Expect = 9.8e-166, Identities = 343/866 (39%), Positives = 517/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKI--SNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL---EVLNPKLFKISDEVINILNTA-KINIVKQDIKSLKP-DYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K YD K  E++      +K      +  +K  Y+I+LPPPN+TG LHLGHAL+ T+QD L+R   ++G S  W+ G DHA IAT+ K E  L +  I  K+  R+  +  ++EW+      IRNQ K +G  LD+  E FT++++ ++ V   FVK+YN+GLIY+   + NW  K ++A+S+ E+   E E + ++++Y +  S +YL +ATTRPET+  D  + VNPKD+RY + + K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDY++GK++ L  I+   +DG  N     +  +   +AR   VE L+    L K+++   NV   +R N V+EP++S+QWFVK+ E +K  IE+ K +K ++F P +FEK   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V T+ P      N E   +DNDVLDTWFSS LWP +T    D        +P N LVTG+DIIFFWV RM+F  LY   ++PF    I G++RD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y  E+V++   F NK+WN+ R+V MN      D+ K  KN    DKWIL++ N    E  +   K+   ++ +KI DF W +FC+ YIEL K      +++SK     VL+ +++  L L HP+ PF+T  +Y +   + +   + +  ++ +I      E  +E +++ I  IR    E  +P ++   + +   E    + FK  +     L +A +++ ++    S K    V     IFI     LL   +    +E++ KE E ++ EI R    LSN+ F+ KAP+  +  E+ K EK+   LK + + L S K
  S:     1 MSETREMAKTYDPKEFEERLYKNWEEKSYFTPEVDEDKKPYTIVLPPPNITGKLHLGHALDDTLQDILMRTKRMQGYSTLWLPGQDHASIATEVKVENELLKEGIVKKEIGREAFLGKVWEWTDEYRGKIRNQIKKLGCSLDFTRERFTMDEQLDKAVKHFFVKLYNEGLIYQGNRITNWCPKCKTALSDAEIEYSEHEGHFWHVKYPVVGSDEYLEIATTRPETMLGDTAVAVNPKDERYAHLVGKTLMLPLVNREIPIVADDYVDMEFGTGAVKITPAHDPNDYQVGKRHNLPEINVMFDDGRINYEETRYHEMDRYEARKAIVEDLKNEGFLVKIKEHNHNVSCHDRCNTVIEPIISKQWFVKMDELAKPAIEVVK-NKNVKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVATEEPTKCPKCNSEKLQQDNDVLDTWFSSALWPFSTLGWPDKTPDLKYFYPNNTLVTGYDIIFFWVARMVFSGLYCMDDIPFDTVLIHGIVRDSEGKKMSKSLGNGVDPIEVIDEYGADALRFTLVTGNAPGNDIRYYPERVEAARNFANKIWNASRFVLMNLDKDLMDKYKDNKNYTIADKWILSRLNTVVKEVTENIEKFELGIASQKIYDFIWGEFCDWYIELVKPVLYGEDEQSKGIAFNVLHKVLETSLQLLHPIMPFITEEIYTHLYTEYESIAISKWPEYDEILKDEKSEKDMEYIIEAIKSIRNVRTEMDVPPSRKAKLMIYLTEKEAERSFKEGEVYFQKLASASEVSFLENKETSDKNVSVVTRGAEIFI----PLLELVDIEKELERLNKEKEKLEKEIDRVEKKLSNEKFVSKAPESVVNEEREKGEKYRAMLKSVLESLESLK 881
>gi|121534137|ref|ZP_01665962.1| valyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] >gi|121307240|gb|EAX48157.1| valyl-tRNA synthetase [Thermosinus carboxydivorans Nor1] (884 aa)
Score = 1514, Expect = 1.1e-165, Identities = 315/851 (37%), Positives = 501/851 (58%)
  Q:    17 YDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSN-SKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKP---PKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR------TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL-------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILN----TAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK-KEKHEMKLKELEKL 867
           YD    E ++  +   + L    ++ +K  +SI++PPPNVTG LH+GHAL+ T+QD LIRF  ++G +  W+ G DHAGIATQ K E+ L +  ++  D  R++ +  ++EW +  G+ I  Q K++G   D+  E FT+++  +  V +VFV +Y  GLIY+   + NW  + ++A+S+IEV  +E   +LY++RY +     +Y+ VATTRPETI  D  + V+P D RY++ + K  I PL  + + I+ADEYVD  FGTG +K TPAHD ND+E+G +++L  I   N DGT       +  +   + R   V  L++   L ++++ + +VG  +R + VVEP++S+QWFV++   ++  IE   +S KI+F P +F K  INW+ N+ DWCISRQ+WWGH+IP WY +  + I         PK      +D DVLDTWFSS LWP +T    +    L   +PT+VLVTG+DIIFFWV RM+F ++  ++E+PF++ +I GL+RD    KMSKSLGNG+DP +VIEKYGAD LR  L++ ++PG D+ +  E+V+S   F NK+WN+ R+V MN   F+      P      D+WIL+++ +  ++      K+    + + + +F W+++C+ YIEL+K R        ++E+  +VL Y+++  L L HP  PF+T  ++       K  ++        E +D +      E  +  ++  I  +R    E  +P  K  ++ L V   +L ++  + I  L        + I   D  + KP   EN     +   E    L G  +      ++ KE+  ++ EI+R  G L+N  F+ KAP + +E E+++ +E  E +   LE+L
  S:    10 YDPATVESKWYKYWEDEGLFHVEVEPDKEPFSIVIPPPNVTGQLHMGHALDNTLQDILIRFKRMQGYNTLWMPGTDHAGIATQIKVEEMLAKEGLTRYDLGREKFIDRVWEWKRQYGSRIIKQLKSLGASCDWVRERFTMDEGCSRAVREVFVSLYEKGLIYQGNRITNWCPRCKTALSDIEVEHEEKSGHLYHVRYPVEGMDGEYVTVATTRPETILGDTAVAVHPDDARYRHLVGKQLILPLVGRRLPIVADEYVDPSFGTGAVKVTPAHDPNDFEIGLRHQLPEIIVINPDGTMAENTGKYAGMDRYECRQVLVRDLKEQGYLVRIDEHVHSVGHCQRCSTVVEPLISKQWFVRMKPLAEPAIE-AVASGKIKFVPERFTKIYINWLENIRDWCISRQIWWGHRIPAWYCECGETIVSREDVSCCPKCGGKVEQDPDVLDTWFSSALWPFSTMGWPEKTAELAHFYPTSVLVTGYDIIFFWVARMVFMAMEFQREIPFRYVFIHGLVRDAQGRKMSKSLGNGIDPLEVIEKYGADTLRFTLVTGNTPGNDMRFYWERVESSRNFANKIWNASRFVLMNLDGFDAAAQPDPARFALADRWILSRYAQTVADVTANLEKFELGEAARLLYEFIWNEYCDWYIELTKGRLYRKENAQDRETAQYVLWYVLRGTLELLHPFMPFITEAIWQALPHDGKSIVVAPWPKEQPELIDVE-----AERHMTAIMDTIKAVRNMRAEVNVPPGKKSEVILHVGADELAEVFRKNIAYLQALAAAEPVAICGTD--AAKP---ENAMAAVVSGVEVYLPLKGLIDVEKETARLSKELAGIEKEIARIAGKLANPGFLAKAPADVVEKERAREREYQEKRAAILERL 877
>gi|196126977|ref|ZP_03118726.1| valyl-tRNA synthetase [Clostridium difficile ATCC 43255] (888 aa)
Score = 1514, Expect = 1.1e-165, Identities = 341/861 (39%), Positives = 520/861 (60%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD---FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQI----INKIRIFNFENKIPNNKVIDIHLEVLNPKLFKIS---DEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEAN---NIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           N +LSK Y+ K  E + +  W  +     K    +K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  + G  A+W+ G DHA IAT+ K  + +++ +   K +  R+E +   +EW    G  I NQ K +G   D++ E FT+++  NE V + FV +Y  G IYR   ++NW    ++ +S+ EV  +E + N Y+I+Y L +S+D+L +ATTRPET+  D  + VNP+D RYK+ I K AI PL  +E+ I+AD YVD++FGTG +K TPAHD ND+E+G ++ L  ++  NEDGT N     +E +   + R   V  L++   L K+++   NVG   R + VVEP +SEQWFVK+ E +K  I++ K   +++F P KF+K  + W+ N+ DWCISRQLWWGHQIP +Y ++  EI V  K P          + +D D LDTWFSS LWP +T    +  ++ D  +PT+VLVTG+DIIFFWV RM F  ++   E PF H  + GL+RD    KMSKSLGNG+DP ++IE+YGADALR  L + +SPG D+ +  E+V+    F NKLWN+ R+V MN  +    N   +   ++L   DKWI+++ N    E     +K++  ++++KI DFTW ++C+ YIE+ K R   +++      L+ L Y+++KIL L HP  PF+T  +Y +        I+ E   + +  N+ E   ED++ +    I  IR    E  +P +K   + +     K+  I    D  I + + + + I K      K +  E+   + I   E  +  N   +    IE++ KE + ++ EI R NG L+N+ F+ KAP+  IE EK+KKEK E  +K +E+ L++
  S:     3 NTNLSKTYNPKDFEARLYKKWMDEGYFKSKP-NPDKKPFTIMMPPPNITGQLHMGHALDHTLQDILIRWKRMDGYEAFWLPGTDHASIATEVKVVERIKKQEGKTKYEIGREEFLKRAWEWKDEFGGKISNQLKQLGDSCDWDKERFTMDEGCNEAVIEFFVSLYEKGHIYRGNRIINWCPDCKTTLSDAEVEHEEHDGNFYHIKYPLKDSEDFLEIATTRPETMIGDTGIAVNPEDDRYKHLIGKTAILPLVGRELPIVADSYVDLEFGTGAVKMTPAHDPNDFEVGLRHNLEQLNTMNEDGTMNEVCGKYEGMDRFECRKAIVVDLKEQGYLIKIKEHNHNVGTCYRCHTVVEPRLSEQWFVKMEELAKPAIDILKKG-ELEFVPDKFDKTYLQWLENIRDWCISRQLWWGHQIPAYYCQECGEIVVARKMPDKCPKCGSTHFKQDEDALDTWFSSALWPFSTLGWPNKTEALDYYYPTSVLVTGYDIIFFWVVRMAFAGMFCMNEKPFDHVLVHGLVRDSQGRKMSKSLGNGIDPLEIIEQYGADALRFTLTTGNSPGNDMRFYMERVEFARNFANKLWNASRFVFMNIDEDIIKNMTRESVKEDLTLADKWIISRANNIVKEATNNMDKFDLGIALQKIYDFTWSEYCDWYIEMVKPRLYGEDANAKSAALYTLTYVLEKILKLLHPYMPFITEEIYTHLPTVEGCIIVSEWPKYNEEDNMAEE--EDMMNLLMEGIRSIRNVRAEMNVPPSKKAKLIIIPSEEKIEAIELGKDYFITLASASNVEIAKD-----KSNVPEDAVGVVIDGVEIFIPLNELVDFEKEIERLSKEKKKLEGEIKRVNGKLANQGFLAKAPESLIEEEKAKKEKFEEMIKSVEERLTN 882
>gi|158321063|ref|YP_001513570.1| valyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] >gi|158141262|gb|ABW19574.1| valyl-tRNA synthetase [Alkaliphilus oremlandii OhILAs] (884 aa)
Score = 1514, Expect = 1.3e-165, Identities = 336/862 (38%), Positives = 514/862 (59%)
  Q:    11 NDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKY-EKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR-----TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFK--KISNLKESSIEDVLQIINKIRIFNFE-NKIPNNK----VIDIHLEVLNPKLFKISDEVINILNTAKINIV--KQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           N+L K Y+ +  E +      +    K  +  +K  + I+LPPPN+TG LH+GHAL+ T+QD LIR+  ++G    W  G DHA IAT+ K  EK   E  +S  +  R+  +   ++W +  G  I +Q K +G   D+  E FTL++  +  V +VF+K+Y  GLIYR   ++NW    ++++S+ EV  +E   + ++I Y + +S + L +ATTRPET+  D  + V+P+D+RY++ I K+AI PL N+EI I+ADEYVD +FGTG +K TP HD ND+E+G ++ L  I+  N+D + N     +  +   +AR   V+ LE+  LL KV++   NVG   R + VVEP+ S+QWFVK+   +   I+  K+   I+F P +F K  ++W+ N+ DWCISRQLWWGH+IP +Y +D   I V  + P      N   + +D DVLDTWFSS LWP +T    +A K  +  +PT+VLVTG+DIIFFWV RM F  L   + VPFKH ++ GL+RD    KMSKSLGNG+DP ++I++YGADALR  L++ +SPG D+ +  EK++S   F NKLWN+ R+V MN    + ++     N    DKWI+++ NK   E  +  +K+   ++++K+ DF W ++C+ YIEL K R     T  + +  + L Y+++ IL L HP  PF+T  ++ N        I+    +F   +I    E+ +E ++  I  IR    E N IP+ K    V+    +V N  + +     + + + ++I +V  K+ I S     V     +F L  +DL+    E   IE+++KE   ++ EI R  G LSN+ F+ KAP+  I  EK K+ K+E  L  + + L+S K
  S:     3 NNLEKNYNPQEFEGRIYEHWMKNNYFKAEVNPDKKPFCIVLPPPNITGQLHMGHALDHTLQDILIRWKRMQGYETLWQPGSDHASIATEVKVVEKIKAEEGLSKLEVGREGFLERAWKWKEEYGGRIVDQMKKLGDSCDWSRERFTLDEGLSNAVTEVFIKLYEKGLIYRGNRIINWCPDCKTSLSDAEVEHEEKVGHFWHISYPIKDSDEVLEIATTRPETMLGDTAIAVHPEDERYQHLIGKYAILPLVNREILIVADEYVDPEFGTGAVKITPCHDPNDFEVGLRHNLPQINVMNDDASINEKGGKYAGMSRYEARKAIVKDLEEAGLLVKVKEHSHNVGQCYRCDTVVEPITSDQWFVKMESLAAPAIDAGKNG-DIKFIPDRFTKTYLHWLENIRDWCISRQLWWGHRIPAYYCQDCGHIVVAKEAPTTCEKCNSTNFKQDEDVLDTWFSSALWPFSTLGWPEATKELEYFYPTDVLVTGYDIIFFWVVRMAFSGLEFMENVPFKHVFLHGLVRDAEGRKMSKSLGNGIDPLEIIDQYGADALRFTLVTGNSPGNDMRFHMEKLESSRNFANKLWNATRFVLMNLEVDHIEKSSVESNFTIADKWIISRMNKVAKEMTENMDKFELGIAVQKLYDFIWSEYCDWYIELVKPRLYGEDTEAKRAAQYTLTYVLENILKLLHPFMPFITEEIWQNLPTVQGSVIVAPWTEFSATEIDANSEAKMELIMTAIKSIRNVRAEMNVIPSRKAKLMVLATDSQVAN-TILENEKYFMTLGSVSEIELVANKEQIPSDAVSTVIQGAELF-LPLDDLIDFEKE---IERLEKEKAKLEGEIKRVVGKLSNEGFVSKAPEHLINEEKQKQAKYEQMLNGVVERLASLK 881
>gi|153812839|ref|ZP_01965507.1| hypothetical protein RUMOBE_03246 [Ruminococcus obeum ATCC 29174] >gi|149831051|gb|EDM86140.1| hypothetical protein RUMOBE_03246 [Ruminococcus obeum ATCC 29174] (895 aa)
Score = 1511, Expect = 2.7e-165, Identities = 329/860 (38%), Positives = 506/860 (58%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKD-YLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE-------SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKES--SIEDVLQIINKIRIFNFENKIPNNKVIDIHL---EVLNPKLFKISDEVINILNTAKINIVKQDIKSL--KPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           + +L+K YD K  E + +  W      + K +  +K  ++I++PPPNVTG LH+GHAL+ T+QD LIRF  ++G  A W  G DHA IAT+ K    L++  I   D  R+E +   + W +  G  I NQ K +G   D+E E FT+++  ++ V +VF+++Y  G IY+   ++NW    Q++IS+ EV  ++ +   ++I Y +   +  ++ +ATTRPET+  D  + VNP D+RYK+ I K    PLT++EI +IADEYVD +FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N+    +  +   +AR   V  LE   LL KV     +VG  +R    VEPM+  QWFV++ E +K  +E  +   +++F P  F K  ++W+ N+ DWCISRQLWWGH+IP +Y  +  E+ V  + P+         + +D D LDTWFSS LWP +T    D     +  +PT+VLVTG+DIIFFWV RM+F +L    EVPF H  I GL+RD    KMSKSLGNG+DP +VI+KYGADALRL L++ ++PG D+ +  E+V+S   F NK+WN+ R++ MN       E      L   DKWIL+K N    E     +KY   ++++K+ DF WD+ C+ YIE++K R    E       + LW L   + + L L HP  PF+T  +Y     + +  ++ +   F++  +  E+  ++E   + I  IR    E  +P N+   +++   +      ++   +    L  AK  +V++    +      V  +  +  +  EDL+    E   IE++KKE E +  EI+RC GMLSN +F+ KAP+ K+  EK K +K+E  +++++  L+
  S:    13 SKELAKTYDPKGLEDRLYQKWMDNGYFHAK-VNPDKKPFTIVMPPPNVTGQLHMGHALDETMQDILIRFKRMQGYEALWQPGTDHAAIATEVKVIDKLKKEGIDKLDIGREEFLKHAWAWKEEYGGKIINQLKKLGASADWERERFTMDEGCSKAVQEVFIRLYEKGYIYKGSRIINWCPVCQTSISDAEVEHEDQDGFFWHINYPIVGEEGRFVEIATTRPETLLGDTAVAVNPDDERYKDLIGKMLKLPLTDREIPVIADEYVDKEFGTGCVKITPAHDPNDFEVGKRHNLEEINILNDDATINSLGGKYAGMDRYEARKAMVADLEAQGLLVKVVPHNHSVGTHDRCGTTVEPMIKPQWFVRMDEMAKAAMESLRPG-ELEFVPASFGKTYLHWLENIRDWCISRQLWWGHRIPAYYCDECGEVVVAREMPEKCPKCGCTHFHQDEDTLDTWFSSALWPFSTLGWPDKTPELEYFYPTDVLVTGYDIIFFWVIRMVFSALEQTGEVPFHHVLIHGLVRDSQGRKMSKSLGNGIDPLEVIDKYGADALRLTLITGNAPGNDMRFYWERVESSRNFANKIWNASRFIMMNLEGKTVTEPADLNELCLEDKWILSKLNTVIREVTDNMDKYELGIAVQKVYDFLWDELCDWYIEMAKVRLWKAEEDPKAANNALWTLRTALTEGLKLLHPYMPFITEEIYCTLLPEEESIMISDWPVFQEAWSFPEAEKAVESFKEAIRGIRNTRTEMNVPMNRKTSLYIVGKDADTCARYEACKKSFVNLAFAKEILVQESKDGIGEDAVSVVVSDAVVYMPLEDLVDREKE---IERLKKEQERLAKEIARCQGMLSNPNFVNKAPEAKVNAEKEKLQKYEEMMEKVKTQLT 891
>gi|160947447|ref|ZP_02094614.1| hypothetical protein PEPMIC_01381 [Peptostreptococcus micros ATCC 33270] >gi|158446581|gb|EDP23576.1| hypothetical protein PEPMIC_01381 [Peptostreptococcus micros ATCC 33270] (875 aa)
Score = 1510, Expect = 3.0e-165, Identities = 340/847 (40%), Positives = 524/847 (61%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNE-ELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD---FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRT--SNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYD------------NFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHE 858
           +L K Y+ K  E++ +  W   K+   + +  +K  Y+I++PPPNVTGNLHLGHALN TIQD LIR+  + G  A W+ G DHA I+T+ K  + ++++  S +   RD  + + ++W++  G NI+NQ K +G   D+  + FTL++  ++ V +VF+KMYNDGLIYR   +VNW     +AIS+ EV   + + N Y+I+Y+  +S++YL +ATTRPET+  D  + V+P D+RYK+ + K  I P+ N EI IIAD+YVD++FGTG +K TP+HD ND+E+G ++ L      + DG        F  L+   AR + ++ L++N  L K+E     VG  ER   ++EP++S+QWFV++ E +K   +      K+   P +F K  INW+ N+ DWCISRQLWWGH++PV+Y K++ E+ V  K PK E + ++RD D LDTWFSS LWP +T    D  +     FPTN LVTG+DI+FFWV RM+F SLY   EVPF++ Y TGLIRDE   KMSKSLGNG+DP ++I+KYGADALR  L+  ++PG D+ + E++V+S   F NKLWN+ R+V MN +D   ++ D +K    +E  DKWIL + N+   E  +  +K+ F ++  KI DF W++FC+ YIE SK R    N   K+    VL Y++  IL L HP  PF+T  +Y             NF    + ++ +E          +E+ +E++++ I  IR    E  IP +K  D++     EV       +      + + +K+ ++ +D      + + N+ ++   N++    L G  +    +EK+  +++  + EI R +  LSN+ F+  AP++ +  E+ K +K++
  S:     3 NLEKTYNPKDFEKKIYDSWLEDKDFVAR-VNPDKVPYTIVMPPPNVTGNLHLGHALNNTIQDILIRWKRMSGYEALWVPGTDHASISTEAKVVEKIKKDGNSKEKLGRDGFLEEAWDWTEKYGGNIKNQLKTLGVSCDWSRDAFTLDENLSKAVEEVFIKMYNDGLIYRGDRIVNWCCNCGTAISDAEVEHNDEDGNFYHIKYFFKDSEEYLTIATTRPETMLGDLAVAVHPDDERYKDKVGKTLILPILNIEIPIIADDYVDMEFGTGCVKITPSHDPNDFEVGSRHNLGQKLIMDYDGKIAKGFGKFSGLEREVARKEIIKELKENGYLIKIEPHNHAVGHCERCKTIIEPIISKQWFVRMEELAKPAKQAYLDG-KLNIIPERFGKVYINWLDNIKDWCISRQLWWGHRLPVYYCKETGEVVVSKKEPKEEGKTFIRDEDTLDTWFSSALWPFSTLGWPDKTEDLKYFFPTNTLVTGYDILFFWVIRMVFSSLYNLNEVPFRNVYFTGLIRDELGRKMSKSLGNGIDPIEIIDKYGADALRFTLVGGNTPGNDMRFYEKRVESNRNFANKLWNASRFVLMNLNDEEIYDIDLNK----IEIEDKWILTRLNRTIEELTENLSKFEFGLASSKIYDFIWNEFCDWYIEFSKTRLYGDNLGKKIVVKSVLVYVLNNILKLLHPFMPFITEEIYSFMPNSVGKLINANFPVYNEKNMFIE----------EETEVENLIETITAIRNKRSEKNIPPSKKSDLYFISSNEVTKKYTCSLEHLYRFLASCSKVLVMDKD------EEIANSMVVICNNQKIYIPLDGLVDYEKELEKLNLDLQKYEGEIKRASSKLSNEKFVNNAPEKVVNEEREKLKKYQ 859
>gi|154503249|ref|ZP_02040309.1| hypothetical protein RUMGNA_01073 [Ruminococcus gnavus ATCC 29149] >gi|153796243|gb|EDN78663.1| hypothetical protein RUMGNA_01073 [Ruminococcus gnavus ATCC 29149] (882 aa)
Score = 1510, Expect = 3.0e-165, Identities = 321/863 (37%), Positives = 524/863 (60%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-------LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL--KESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDI--KSLKPDYVEN------NYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + +L+K YD K  E++ +  W   K  + + +  ++  ++ ++PPPN+TG LH+GHAL+ T+QD LIR+  ++G +A WI G DHA I+T+ K    L+E  I  K+  R+  +   ++W +     I NQ K +G   D++ E FT+++  ++ V +VF+K+Y  G IY+   ++NW  K ++++S+ EV  +E   N ++I+Y +  +  +L +ATTRPET+  D  + V+P D+RYK+ + K  + PL NKEI ++AD YVD +FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N     +  +   +AR   VE L++   L ++E    NVG  +R    VEP++ +QWFVK+ E +K  IE  K+  +++F P +F K  ++W+ N+ DWCISRQ+WWGH+IP +Y  +  +  V  + P+         + +D D LDTWFSS LWP +T    D  +  D  +PT+VLVTG+DIIFFWV RM+F       + PF    I GL+RD    KMSKSLGNG+DP +VI++YG DALRL L++ ++PG D+ +  E+V+S   F NK+WN+ R++ MN  + N   +     L + DKWIL++ N+   +  +  +K+   ++++K+ DF WD+FC+ Y+E +K R  ++E +       LWVL  ++K+ L L HP  PF+T  +Y     + +  ++ E   F    +   +E+ +E V +I   IR    E  +PNN+   +++   +    +I D +  + N+ K  ++ + I  +  K +  +N         +  L  EDL+    E   +E+++KE E +K EI R  GMLSN+ FI KAP+ K++ E+ K EK+   L+++++ ++  K
  S:     2 SKELAKTYDPKAIEEKLYERWCENKYFHAE-VDRSRKPFTTVMPPPNITGKLHMGHALDNTLQDILIRYKRMQGYNALWIPGTDHAAISTEVKVTNQLKEEGIDKKELGREGFLERTWQWKEEYAGTIENQLKKLGISCDWDRERFTMDEGCSKAVEEVFIKLYEKGYIYKGSRIINWCPKCKTSLSDAEVEHEEQAGNFWHIKYPIVGTDRFLEIATTRPETMLGDTAIAVHPDDERYKDIVGKNVLLPLVNKEIPVVADYYVDKEFGTGAVKITPAHDPNDFEVGKRHNLEEINIMNDDATINEKGGKYAGMDRYEARKAIVEDLKEQGYLVEIEPHSHNVGTHDRCGTTVEPLIKQQWFVKMEELAKPAIEALKTG-ELKFVPERFNKIYLHWLENIKDWCISRQIWWGHRIPAYYCDECGDFVVAREMPETCPHCGCTHFTQDEDTLDTWFSSALWPFSTLGWPDKTEDLDYFYPTDVLVTGYDIIFFWVIRMVFSGYEHTGKSPFHTVLIHGLVRDSQGRKMSKSLGNGIDPLEVIDQYGCDALRLTLVTGNAPGNDMRFYHERVESSRNFANKVWNASRFIMMNMEE-NVVAEPDASLLNEADKWILSRVNRLAKDVTENMDKFELGIAVQKVYDFIWDEFCDWYVETAKYRIYHKEEEKAAADCVLWVLKTVLKQALKLLHPFMPFITEEIYSVLVPEEESLMMSEWPQFHAEWDFPAEENVMEHVKEITRGIRNMRAEMNVPNNRKTKVYVVCEDT---EICDGISTLENSIKPLMMAEKILVQQTKENIADNAVSVVVPDAVVYLPLEDLVDFEQE---MERLQKEEEKLKKEIKRAEGMLSNERFISKAPEAKVQEEREKLEKYTQMLQQVQERMAGLK 881
>gi|160933630|ref|ZP_02081018.1| hypothetical protein CLOLEP_02484 [Clostridium leptum DSM 753] >gi|156867507|gb|EDO60879.1| hypothetical protein CLOLEP_02484 [Clostridium leptum DSM 753] (874 aa)
Score = 1509, Expect = 4.4e-165, Identities = 319/853 (37%), Positives = 496/853 (58%)
  Q:    10 NNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN------EELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR-TSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISN-----LKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAK-------------INIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLK 862
           + +L+K Y+ +  E +   +  Q       +   K  Y+I++PPPN+TG LH+GHAL+ TIQD LIRF  ++G SA W+ G DHA IAT+ K  + +++  ++ +D  R+  +   ++W    G  I  Q K +G   D+E E FTL++  +E V +VFV++Y  GLIYR + ++NW    +++IS+ EV   E + N +++RY L++    L +ATTRPET+  D  + V+P D+RYK Y+ K    PL  +EI ++ADEYV++ FGTGV+K TPAHD ND+E+G ++ L +I+  +E    N     ++ +   +AR   V+ L++   L KVE    NVG   R   VVEP +S+QWFVK+   +K  I++ +   KI+  P + EK   NWM N+ DWCISRQLWWGH+IP WY +D  E  V  + P+         L+ +D D LDTWFSS LWP +T    +    L   +PT+ LVTG+DIIFFWV RM+F  L    ++PFK  +  GL+RD    KMSKSLGNG+DP +VIEKYGADALR  L++ +SPG D+ + EEK++S   F NK+WN+ R++ MN   F+  +++ P++L   D+WI++  N    E  +   KY   ++++K+ DF WD FC+ YIEL+K R  +  E+ +    VL +    IL L HP  P++T  ++     + +    L   D+ K +        E+ +  +++ I  IR    E  +P ++   +++     + F+   + +  L  A              + IV  D K   P              ++L+    E   ++++ KE+E  + ++ + N  L+N  F  KAP   +E  +   +K E K+K
  S:     2 SKELAKAYEPREVEDRIYDFWLQGGYFHAEVDPEKKPYTIVIPPPNITGQLHMGHALDETIQDILIRFKRMQGYSALWLPGTDHASIATEAKIVEAMKKEGLTKEDVGREGFLERAWDWKAKFGGRIVEQLKKLGSSCDWERERFTLDEGCSEAVKEVFVRLYEKGLIYRGERIINWCPHCKTSISDAEVEFDEHDGNFWHLRYPLTDGTGELRLATTRPETLLGDTAVAVHPDDERYKAYVGKTVTLPLVGREIPVVADEYVEMDFGTGVVKITPAHDPNDFEVGLRHNLPVINVMDEGAVINENGGKYQGMTREEARKAIVKDLDEGGYLVKVEPIKHNVGSCYRCGTVVEPRVSKQWFVKMEPLAKPAIDVVREG-KIRLIPERMEKIYYNWMENIKDWCISRQLWWGHRIPAWYCEDCGETIVAKETPEKCPKCGGSHLH-QDEDTLDTWFSSALWPFSTLGWPEKTPELSYFYPTDTLVTGYDIIFFWVARMIFSGLEHMGDIPFKTVFFHGLVRDAQGRKMSKSLGNGIDPIEVIEKYGADALRFTLVTGNSPGNDMRFTEEKLESSRNFANKIWNAARFIHMNIDGFDV-KNELPESLTLEDQWIVSALNTVTKEVTENLEKYELGIAVQKLYDFIWDQFCDWYIELAKTRLMAKDETSVGARQVLVWTFTSILKLMHPFMPYITEEIWQTMPHEGE---ALMAADYPKYNEKYAYPQAEAEMHRIMEAIRAIRNRRAEMNVPPSRRAKVYVASSFKETFRKGAQFVARLAYASEVEVGEAFSIPGAVTIVTADAKVYIP-------------MDELVDKEAE---LKRLNKELETAQKQLDQVNAKLNNPGFTGKAPANVVEGARQNAQKLEDKIK 863
>gi|163813949|ref|ZP_02205343.1| hypothetical protein COPEUT_00102 [Coprococcus eutactus ATCC 27759] >gi|158450819|gb|EDP27814.1| hypothetical protein COPEUT_00102 [Coprococcus eutactus ATCC 27759] (920 aa)
Score = 1508, Expect = 6.2e-165, Identities = 326/856 (38%), Positives = 515/856 (60%)
  Q:    12 DLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY-YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-----LFKISDEVINILNTAKINIVKQDIKSLKPDYVE---NNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           +L K YD  +I ++ +  W  +K  + + +  +K  ++I++PPPNVTG LH+GHAL+ T+QD LIRF  ++G SA W  G DHA IAT+ K  + L+E  I  K+  R+E +   + W +  GN I +Q K MG   D++ E FT+++  +  V +VFV++Y+ G IY+   ++NW    +++IS+ EVI +E +   ++I Y  +     ++ +ATTRPET+  D  + VNP D+RY + + K    PLT+++I +IAD YVD +FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N     +  +   +AR + V  L+   LL KV     NVG  +R    VEPM+  QWFV++ E  +  +++ K+  ++ F P +F+K  I+W+ N+ DWCISRQLWWGH+IP WY  +  E  V  + P            +D D LDTWFSS LWP +T    D     +  +PT+VLVTG+DIIFFWV RM+F +L    + PFKH  I GL+RD+   KMSKSLGNG+DP +VI+KYGADALRL L++ ++PG D+ +  E+V++   F NK+WN+ R++ MN    +F   K   +L   D+WIL+K N    E      K+   +++ K+ DF W++FC+ YIE+ K R  N E +     LW L  ++ + L L HP  PF+T  ++ N + + +  ++ +  ++    N +  E++++ +   +  IR       +P ++   ++  V++ K     +F+ S      L  A    V++D   +  + V    ++  ++I   E+L+  + E   IE+++KE   +  EI R +GML+N  F++KAP  K+E EK+K  K+ EM  +  E+L
  S:    43 ELEKTYDPSQIEDRLYRKWEEKKYFHAE-VDRSKKPFTIVMPPPNVTGQLHMGHALDNTMQDILIRFKRMQGYSALWQPGTDHAAIATEVKVTEKLKEQGIDKKEIGREEFLKHAWAWKEEYGNRIVSQLKKMGSSADWDRERFTMDEGCSRAVKEVFVRLYDKGYIYKGSRIINWCPVCKTSISDAEVIHEEQDGYFWHINYPVVGEPGRFVEIATTRPETLLGDTAVAVNPDDERYTDIVGKMLELPLTDRQIPVIADPYVDKEFGTGCVKITPAHDPNDFEVGKRHNLEEINILNDDATINELGGKYAGMDRYEARKQMVADLDALGLLVKVVPHSHNVGTHDRCKTTVEPMIKPQWFVRMKEMGQAALDIIKTD-ELSFVPEQFDKTYIHWLENIRDWCISRQLWWGHRIPAWYCDECGETIVSRETPTVCPKCGCTHLTQDEDTLDTWFSSALWPFSTLGWPDKTPEYEYFYPTSVLVTGYDIIFFWVIRMVFSALEQTGKSPFKHVLIHGLVRDDQGRKMSKSLGNGIDPLEVIDKYGADALRLTLITGNAPGNDMRFYWERVENSRNFANKIWNATRFIMMNMEKADFSAVKL-SDLTIADRWILSKVNTLAKEMTDNMEKFELGIAVSKVYDFIWEEFCDWYIEMVKPRLYNDEDETKAAALWTLKTVLIQALKLLHPYMPFITEEIFCNIQDEEESIMISKWPEYTDEWNFEADEAAVDTIKAAVRAIRNLRTGMNVPPSRKAKVY--VVSAKEDVRYIFESSKSFFATLGYASEVHVQEDKTGIDENAVSTLIHDAAVYI-PLEELVDIDKE---IERLEKEAAKLAGEIKRASGMLANPKFVDKAPAAKVEEEKAKLAKYTEMSEQVAERL 915
>gi|77409780|ref|ZP_00786432.1| valyl-tRNA synthetase [Streptococcus agalactiae COH1] >gi|77171610|gb|EAO74827.1| valyl-tRNA synthetase [Streptococcus agalactiae COH1] (655 aa)
Score = 1506, Expect = 9.2e-165, Identities = 300/645 (46%), Positives = 418/645 (64%)
  Q:    10 NNDLSKKYDHKICEQ-QFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDA----LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIEL 654
           + +LS KY+    E  ++  W  Q ++ K +  A    YSI++PPPNVTG LHLGHA + T+QD +IR   ++G    W+ GMDHAGIATQ K E+ LRE  IS  D  R++ +  ++EW       I++QW  MG  +DY  E FTL++  ++ V +VFV +YN G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I +  I P+ NK I I+ADE+ D +FGTGV+K TPAHD ND+ +G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE    L K+EK   +VG SERT  VVEP +S QWFVK+ + +K  I  Q +  K++F+P +F    ++WM N++DW ISRQLWWGHQIP WY  +  E+YVG   P+ +  + +D DVLDTWFSS LWP +T     ++ A     FPT+ LVTG+DIIFFWV RM+F SL      PF +  I GLIRDE   KMSKSLGNG+DP DVIEKYGADALR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     D+ +  +N+E           D+WIL+  N+   +  + F+K+ F V+   + +F W++F N Y+EL
  S:     2 SKELSPKYNPAEVEAGRYQTWLDQ-DVFKPSGDAEAKPYSIVIPPPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISRYDLGREKFLDKVWEWKDEYAATIKSQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYNKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVATTRPETMFGDVAVAVNPEDPRYKDLIGQNVILPIINKPIPIVADEHADPEFGTGVVKITPAHDPNDFAVGQRHNLPQVNVMNDDGTMNELADEFNGMDRFEARKAVVAKLESLGNLVKIEKMTHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDTFMSWMENVHDWVISRQLWWGHQIPAWYNVNG-EMYVGEDAPEGDG-WTQDEDVLDTWFSSALWPFSTMGWPDTEAADFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFSNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLDQAR--ENVEKVVNSQVGNVTDRWILHNLNETVGKVTENFDKFEFGVAGHILYNFIWEEFANWYVEL 655
>gi|126700875|ref|YP_001089772.1| valyl-tRNA synthetase [Clostridium difficile 630] >gi|115252312|emb|CAJ70153.1| valyl-tRNA synthetase [Clostridium difficile 630] (888 aa)
Score = 1506, Expect = 1.1e-164, Identities = 340/861 (39%), Positives = 519/861 (60%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD---FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQI----INKIRIFNFENKIPNNKVIDIHLEVLNPKLFKIS---DEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEAN---NIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           N +LSK Y+ K  E + +  W  +     K    +K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  + G  A+W+ G DHA IAT+ K  + +++ +   K +  R+E +   +EW    G  I NQ K +G   D++ E FT+++  NE V + FV +Y  G IYR   ++NW    ++ +S+ EV  +E + N Y+I+Y L +S+D+L +ATTRPET+  D  + VNP+D RYK+ I K AI PL  +E+ I+AD YVD++FGTG +K TPAHD ND+E+G ++ L  ++  NEDGT N     +E +   + R   V  L++   L K+++   NVG   R + VVEP +SEQWFVK+ E +K  I++ K   +++F P KF+K  + W+ N+ DWCISRQLWWGHQIP +Y ++  EI V  K P          + +D D LDTWFSS LWP +T    +  ++ D  +PT+VLVTG+DIIFFWV RM F  ++   E PF H  + GL+RD    KMSKSLGNG+DP ++IE+YGADALR  L + +SP  D+ +  E+V+    F NKLWN+ R+V MN  +    N   +   ++L   DKWI+++ N    E     +K++  ++++KI DFTW ++C+ YIE+ K R   +++      L+ L Y+++KIL L HP  PF+T  +Y +        I+ E   + +  N+ E   ED++ +    I  IR    E  +P +K   + +     K+  I    D  I + + + + I K      K +  E+   + I   E  +  N   +    IE++ KE + ++ EI R NG L+N+ F+ KAP+  IE EK+KKEK E  +K +E+ L++
  S:     3 NTNLSKTYNPKDFEARLYKKWMDEGYFKSKP-NPDKKPFTIMMPPPNITGQLHMGHALDHTLQDILIRWKRMDGYEAFWLPGTDHASIATEVKVVERIKKQEGKTKYEIGREEFLKRAWEWKDEFGGKISNQLKQLGDSCDWDKERFTMDEGCNEAVIEFFVSLYEKGHIYRGNRIINWCPDCKTTLSDAEVEHEEHDGNFYHIKYPLKDSEDFLEIATTRPETMIGDTGIAVNPEDDRYKHLIGKTAILPLVGRELPIVADSYVDLEFGTGAVKMTPAHDPNDFEVGLRHNLEQLNTMNEDGTMNEVCGKYEGMDRFECRKAIVADLKEQGYLIKIKEHNHNVGTCYRCHTVVEPRLSEQWFVKMEELAKPAIDILKKG-ELEFVPDKFDKTYLQWLENIRDWCISRQLWWGHQIPAYYCQECGEIVVARKMPDKCPKCGSTHFKQDEDALDTWFSSALWPFSTLGWPNKTEALDYYYPTSVLVTGYDIIFFWVVRMAFAGMFCMNEKPFDHVLVHGLVRDSQGRKMSKSLGNGIDPLEIIEQYGADALRFTLTTGNSPENDMRFYMERVEFARNFANKLWNASRFVFMNIDEDIIKNMTRESVKEDLTLADKWIISRANNIVKEATNNMDKFDLGIALQKIYDFTWSEYCDWYIEMVKPRLYGEDANAKSAALYTLTYVLEKILKLLHPYMPFITEEIYTHLPTVEGCIIVSEWPKYNEEDNMAEE--EDMMNLLMEGIRSIRNVRAEMNVPPSKKAKLIIIPSEEKIEAIELGKDYFITLASASNVEIAKD-----KSNVPEDAVGVVIDGVEIFIPLNELVDFEKEIERLSKEKKKLEGEIKRVNGKLANQGFLAKAPESLIEEEKAKKEKFEEMIKSVEERLTN 882
>gi|171853606|emb|CAM11477.1| Valyl-tRNA synthetase [Candidatus Phytoplasma australiense] (856 aa)
Score = 1505, Expect = 1.2e-164, Identities = 356/858 (41%), Positives = 528/858 (61%)
  Q:    13 LSKKYDHKICE-QQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-----NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSK---DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSD----FNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTK--DSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVL-NPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDL------LGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           + KKYD K  E Q++  W ++      +  + K S+++++PPPNVTG LHLGHA N  IQD LIRF  ++G    ++ GMDHAGIATQ K +++L++  + NKD  +   +   +EW +    NIRNQWK +G  LDY  E FTL+   ++ V  VF+K+Y+ GLIYR   ++NWD K ++A+SN+EV  +E E  LYY++Y+ +         +L VATTRPETIF D+ L+V+P D RY+++I K  + P TN +I +++D YVD QFGTGV+K TP HD ND+E+G++ +L  + C NEDGT N  A  ++ L     R   V+ LEK  ++ K+E  +  VG+S  + A++EP +S QWF+K  + +++ ++      KI F+P +F K   NW+ N+ DWCISRQLWWGH IP+WYK  ++EI   ++ P   E +V D DVLDTWFSS LWP++T      K   +  FP +VLVTG+DI+ FWV +M+  S +L ++ PFK   + GLIRD    KMSKS GNGVDP D+I KYG DALR FL++S++PG DL Y E KVK+ W FINKLWN  R++++N++     F  D+   P+        +L +      +  Q + KY      + +  F W++F N ++E  KN   N ++ L   + L Y++K IL L HP  PFVT  LY  F  KT    ++L + +   K  +L++   ED+ Q+I K+R F  E+KI +  ++D+ LEV+ +PK +      +N+ N  K     ++ K           L+F+  K +L      L S +EAN +    K+ +F+ SEI R   +L N  F+ KA  +K+ LEK K + +    K+ +KLL +
  S:     1 MKKKYDFKEVESQRYQEWLSKNYFASVS-TSRKKSFTVVIPPPNVTGKLHLGHAWNNVIQDILIRFKKMQGFEVLFLPGMDHAGIATQKKVKEHLKKENLLNKDLDKATFLKYAWEWKEKFATNIRNQWKALGLHLDYNFEKFTLDPDLSKTVQDVFIKLYHQGLIYRDYKIINWDPKSKTALSNVEVNYQETEGKLYYLKYFFAQPHQNQKTSFLEVATTRPETIFADQALIVHPDDLRYQSFIGKKVLIPETNIQIPVLSDTYVDPQFGTGVVKVTPGHDINDFEIGQRKQLKSLLCMNEDGTLNELAGKYQGLNRFVCRKNLVKDLEKKQIITKIENHLHQVGYSSISGAIIEPRLSLQWFLKTKDIAQEALK----KNKINFYPQRFLKVFNNWLENIEDWCISRQLWWGHPIPIWYK--NQEIKAQSESPG--EGWVCDCDVLDTWFSSSLWPLSTLGWPNKKSFFNKRFPADVLVTGYDILTFWVSKMVLQSSFLTQKDPFKDVLLHGLIRDNEGQKMSKSKGNGVDPLDIINKYGVDALRFFLITSAAPGLDLLYDEIKVKNAWNFINKLWNITRFIKLNTNTTLDCFEVDKLSLPQTA------LLTQLASTTEKITQLYQKYELKEIGQILYQFVWENFANWHLEFVKNDLDNYKNDLNTQFFLVYVMKYILQLLHPFIPFVTDALYFYFDNKTNITQTLLSKVVSVNKQQDLQD--FEDLKQLIIKMRQFRNEHKIDSQFLLDMELEVVSDPKNY------LNLENALKKFFYAKNFKITNKVTDPYKTLLFLGKKFNLYIDKKVLQSFHEANFL----KQKQFLLSEIKRSEKILKNPLFLTKASPQKVALEKKKYQTYR---KQYQKLLDN 853
>gi|153852712|ref|ZP_01994149.1| hypothetical protein DORLON_00131 [Dorea longicatena DSM 13814] >gi|149754354|gb|EDM64285.1| hypothetical protein DORLON_00131 [Dorea longicatena DSM 13814] (886 aa)
Score = 1504, Expect = 1.7e-164, Identities = 325/863 (37%), Positives = 516/863 (59%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED--FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK----NRTSNQE---SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISN--LKESSIEDVLQIINKIRIFNFENKIPNNK----VIDIHLEVLNPKLFKISDEVINI--LNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + +L K Y+ K  E + +  W   K  + + +  +K  ++ ++PPPN+TG LH+GHAL+ T+QD LIR+  ++G +A WI G DHA I+T+ K    L+E  I  K+  R++ +   ++W +     I  Q K +G   D++ E FT+++  ++ V +VF+K+YN+G IY+   ++NW    ++++S+ EV  +E +   ++I+Y +  + DYL +ATTRPET+  D  + V+P D+RYK+ + K    PLT++EI I+AD YVD +FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N  Y   +  +   +AR   V  LE+   L KV     NVG  +R +  VEPM+ +QWFVK+ E +K  IE  K+   ++F P +F K  ++W+ N+ DWCISRQ+WWGH+IP +Y  +  E+ VG   P+         + +D D LDTWFSS LWP +T    D  +  D  +PT+VLVTG+DIIFFWV RM+F       + PF   +I GL+RD    KMSKSLGNG+DP ++I++YGADALR+ L++ ++PG D+ +  E+V++   F NK+WN+ R++ MN  +    E K P N E    D WI++K N    +  +  +K+   +++ KI DF WD+FC+ YIE++K    +   +QE   + LW L  ++KK L L HP  PFVT  +Y     + +  ++ +   +++  N  + E+ ++   +II  IR    E  +PN++     +    E L   L  +     N+  LN   I   K  I       V  +  ++ L  E+L+    E   IE++ KE   +  EI+R NGML+N+ F+ KAP  K++ E+ K E ++  + ++++ L   K
  S:     2 SENLEKTYNPKAIEAKLYEKWCDNKYFHAE-VDRSKKPFTTVMPPPNITGKLHMGHALDNTLQDILIRYKRMQGYNALWIPGTDHAAISTEVKVTNQLKEEGIDKKELGREKFLERTWQWKEEYAGTIEGQLKKLGVSCDWDRERFTMDEGCSKAVEEVFIKLYNEGYIYKGSRIINWCPVCKTSLSDAEVEHEEQDGFFWHIKYPIVGTDDYLEIATTRPETLLGDTAIAVHPDDERYKDIVGKMCKLPLTDREIPIVADYYVDKEFGTGAVKITPAHDPNDFEVGKRHNLPEINIMNDDATINEQYGGKYAGMDRYEARKAMVADLEEQGYLVKVVPHSHNVGTHDRCHTTVEPMIKQQWFVKMEELAKPAIEAIKNG-DLRFVPERFNKIYLHWLENIRDWCISRQIWWGHRIPAYYCDECGEVVVGHGAPEKCPKCGCTHFTQDEDTLDTWFSSALWPFSTLGWPDQTEDLDYFYPTDVLVTGYDIIFFWVIRMVFSGYAHTGKAPFHTVFIHGLVRDSQGRKMSKSLGNGIDPLEIIDQYGADALRMTLMTGNAPGNDMRFYNERVEASRNFANKVWNASRFIMMNLDE---KELKKPANFEKRPADCWIMSKCNSLVKDVTENMDKFELGIALSKIYDFMWDEFCDWYIEMAKYPIYHADEDQEAANAALWTLREVLKKSLKLLHPYMPFVTEEIYSKLVPEEESLMMSDWPVYEEEWNFPVDENIVDHYKEIIRGIRNVRAEMNVPNSRKATAFVVCEDEELGAGLALLGHAAQNMAALNELVIQKDKSGIADDAVSIVVPDATVY-LPLEELIDFEQE---IERLTKEEARLTKEIARSNGMLNNEKFVSKAPAAKVQEERDKLETYQQMMAQVKERLEGLK 882
>gi|160894055|ref|ZP_02074834.1| hypothetical protein CLOL250_01610 [Clostridium sp. L2-50] >gi|156864433|gb|EDO57864.1| hypothetical protein CLOL250_01610 [Clostridium sp. L2-50] (923 aa)
Score = 1504, Expect = 1.9e-164, Identities = 330/866 (38%), Positives = 514/866 (59%)
  Q:     2 VTMSNIKNNNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKD-YLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITTTDALKSK---DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKI--NIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEA----NNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEKL 867
           +    ++   +L K Y+   I ++ +  W  +K  + + +  +K  ++I++PPPNVTG LH+GHAL+ T+QD LIRF  ++G SA W  G DHA IAT+ K  + L+   I  K+  R+  +   ++W +  G  I NQ K +G   D++ E FT+++  +E V +VFV +Y  G IY+   ++NW    +++IS+ EV   E E + ++I Y +   +  Y+ +ATTRPET+  D  + VNPKD+RYK+ I K    PLT++EI +IADEYVD++FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N     +  +   +AR   V  LEK  LL KV     NVG  +R    VEPM+  QWFV++ E  +  ++L K+  +++F P +F+K  I+W+ N+ DWCISRQLWWGH+IP +Y  +  E  V  + P            +D D LDTWFSS LWP +T    K     +  +PT+VLVTG+DIIFFWV RM+F +L    + PFKH  I GL+RD+   KMSKSLGNG+DP +VI+KYGADALRL L++ ++PG D+ +  E+V++   F NK+WN+ R++ MN    +F   K   +L   D+WIL+K N    E      KY   +++ K+ DF W++FC+ YIE+ K R  N     + + LW L  ++ + L L HP  PF+T  ++ N + + +  ++ +   +K+  + K  E++++ +   +  IR       +P +K   +++     ++  I +   N   T      +  QD K    + ++ N +  +++   L     E       IE+++KE   +  EI R +GML+N  F++KAP  K+E EK+K  K+ EMK +  E+L
  S:    36 IKTERMEQMKELEKTYNPADIEDRLYRKWEDKKYFHAE-VDRSKKPFTIVMPPPNVTGQLHMGHALDNTMQDILIRFKRMQGYSALWQPGTDHAAIATEVKVTEKLKAEGIDKKEIGREAFLQHAWKWKEEYGGRIVNQLKKLGSSADWDRERFTMDEGCSEAVKEVFVNLYEKGYIYKGSRIINWCPVCKTSISDAEVEHVEQEGHFWHINYPIVGEEGRYVEIATTRPETLLGDTAVAVNPKDERYKDIIGKMLKLPLTDREIPVIADEYVDMEFGTGCVKITPAHDPNDFEVGKRHNLEEINILNDDATINEKGGKYAGMDRYEARKAMVADLEKEGLLVKVVPHTHNVGTHDRCKTTVEPMIKPQWFVRMKEMGQAALDLIKTD-ELEFVPEQFDKTYIHWLENIRDWCISRQLWWGHRIPAYYCDECHETIVSREVPTVCPKCGCTHLTQDEDTLDTWFSSALWPFSTLGWPKKTPEYEYFYPTDVLVTGYDIIFFWVIRMVFSALEQTGKSPFKHVLIHGLVRDDQGRKMSKSLGNGIDPLEVIDKYGADALRLTLITGNAPGNDMRFYWERVENSRNFANKIWNASRFIMMNMEKADFSNVKL-SDLTIADRWILSKVNDLAVEMTDNMEKYELGIAVSKVYDFIWEEFCDWYIEMVKPRLYNDADETKAAALWTLKTVLIRALKLLHPYMPFITEEIFCNIQDEEESIMISDWPVYKEEWSFKQDENAVDTIKAAVRAIRNLRTGMNVPPSKKATVYVVSAKSEIRDIFEASKNFFATLGYASEVFIQDSK----NGIDENAVSTLIHDAALYIPLAELVDIDKEIERLEKESGRLAGEIKRASGMLANPKFVDKAPAAKVEEEKAKLAKYTEMKAQVEERL 918
>gi|167770372|ref|ZP_02442425.1| hypothetical protein ANACOL_01715 [Anaerotruncus colihominis DSM 17241] >gi|167667694|gb|EDS11824.1| hypothetical protein ANACOL_01715 [Anaerotruncus colihominis DSM 17241] (879 aa)
Score = 1503, Expect = 2.4e-164, Identities = 318/858 (37%), Positives = 490/858 (57%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD-EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTS----NQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER-------LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           L K YD K  E + +  W      + +    +K  Y+I++PPPN+TG LH+GHAL+ T+QD LIR+  ++G  A W+ G DHA IAT+ K  + +R+  ++ +   R+  +   + W +  G +I +Q K +G   D++ E FTL++  +  V +VFV+ +  GLIYR + +VNW     S IS+IEV  +E +   ++I Y +  + D L +ATTRPET+  D  + V+P D+RYK+ I K  + P+ NK+I I+ADEYV++ FGTGV+K TPAHD ND+E+G ++ L I++  N+D T N     ++ L   + R + V+ LE    L+ VE    NVG   R  +V+EP +S+QWFVK+   +K  +E  +S +  +F P +F+K   NWM N+ DWCISRQLWWGH+IP WY     E+ V  + P+           +D D LDTWFSS LWP +T    D        +PT+ LVTG+DIIFFWV RM+F  L    E PFK   I GL+RD    KMSKSLGNG+DP ++I++YGADALR  L + +SPG D+ + +EKV +   F NK+WN+ R++ MN SD   D E   P+ L   DKW+L+K+     E      K+   ++++K+ DF WD  C+ YIEL K+R        E+   VL Y++   L L HP  PF+T  ++        +SI++         LDF    +  ES  E ++Q+I  IR    E  +P +K   + +   +  +F+        L  A    +     +     V  +     +  ++L+    E   + ++ +E    + +I+  +  L N  F+ KAP + ++ E++K  K   +L ++E+ +++
  S:    12 LDKVYDPKQVEDKTYRFWQDGGYFHAEP-NPDKKPYTIVIPPPNITGRLHMGHALDETLQDILIRWRRMQGYEALWLPGTDHASIATEAKIVEAMRQEGVTKEQLGREGFLERAWAWKREYGGHILDQLKKLGSSCDWQRERFTLDEGCSRAVREVFVRFFEQGLIYRGERIVNWCPHCLSTISDIEVEYEEKDGFFWHINYPIVGTDDVLEIATTRPETLLGDTAVAVHPDDERYKHLIGKMVLLPIVNKQIPIVADEYVEMDFGTGVVKITPAHDPNDFEVGLRHGLPIVNVMNDDATINENGGKYKGLTREECRRQIVKDLEDGGFLKAVEPYKHNVGSCYRCGSVIEPRVSKQWFVKMEPLAKPAVEAVRSGRT-RFIPERFDKIYFNWMENIKDWCISRQLWWGHRIPAWYCTGCGEMIVSRETPQTCPKCGSHRLEQDPDTLDTWFSSALWPFSTLGWPDDTPELRYFYPTDTLVTGYDIIFFWVARMIFSGLAHMDEAPFKTVLIHGLVRDAQGRKMSKSLGNGIDPLEIIDRYGADALRFTLATGNSPGNDMRFSDEKVNASRNFANKIWNASRFILMNLSD---DVEPGLPETLNIEDKWVLSKYRTLVREVTDNLEKFELGLAVQKLYDFIWDILCDWYIELCKSRLQAGGETSEAAQRVLVYVMTGTLKLLHPFMPFITEEIWQALP-HDGESIMVATWPQADAALDF----SADESDFEMIMQVIRAIRARRGEMNVPPSKKTRLFIMTAHKAVFEQGRPFFARLAFASDVELGDSFDADGSVQVVTDAARVFIPMDELVDREKE---LARLGREKAACEKDIAALSSKLDNPGFVAKAPAQVVDGERAKLAKARERLAKIEESIAA 877
>gi|78044410|ref|YP_359197.1| valyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|90103530|sp|Q3AF87|SYV_CARHZ Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|77996525|gb|ABB15424.1| valyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901] (878 aa)
Score = 1502, Expect = 3.1e-164, Identities = 325/810 (40%), Positives = 485/810 (59%)
  Q:    44 KNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKP----PKNEELYV-RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQ----ESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE----RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE---VINILNTAKINIV-KQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           +  + I++PPPNVTG LH+GHAL+ T+QD L R+  ++G +  W+ G DHAGIATQ K E+ LR+  ++  D  R++ +  ++ W +N GN I  Q + +G   D++ E FTL++  +E V +VF+++Y  GLIYR   + NW    ++ IS+IEV   E E  LYYI Y L +   YL VATTRPET+  D  + V+P+D+RY+  I K  I PL N+ I +IADEYVD +FGTG +K TPAHD ND+E+G ++KL  +   ++D   N  A  +  L   +AR K VE L+   LL K E+   +VG   R + V+EP +S+QWFVK+   ++  IE   +  K++F P +F K  +NW+ N+ DWCISRQLWWGH+IPVWY  +  E+    +     PK +   V +D DVLDTWFSS LWP +T    ++ + L   +PT+VLVTG DIIFFWV RM+F  L   KEVPFK   I GL+ D    KMSKSLGNGVDP +VI  +GAD+LR  L++ ++PG DL +  E++     F NKLWN+ R+V MN   F      TP+ ++       D+WIL + N          ++Y    + +++ +F WD+FC+ Y+EL+K R   +    ++   VL  ++K  L L HP  PF+T  ++     + K  +L      R D++    +K+ S   ++++I +IR    E  +P  K  ++ L   + +L ++ +E    I  L  ++  +V K ++       V     I+ L  +DL+    E    E++ KE++ V +EI R N  L+N  F+ KAP E +  E+ K
  S:    35 REPFCIVMPPPNVTGQLHMGHALDNTMQDILARYKRMQGFNTLWLPGTDHAGIATQAKVEEELRKEGLTKDDLGREKFLERVWAWKENYGNRITEQLRTLGASCDWKRERFTLDEGCSEAVKEVFLRLYEKGLIYRDYYITNWCPHCKTTISDIEVEHLEREGKLYYINYPLEDGSGYLTVATTRPETMLGDTAVAVHPEDERYRELIGKNVILPLVNRPIPVIADEYVDKEFGTGAVKITPAHDPNDFEVGLRHKLPQVVVLDDDAVMNENAGKYRGLDRYEARKKIVEDLKDLGLLVKEEEITHSVGHCYRCDTVIEPRLSKQWFVKMKPLAEPAIEAALTG-KVKFVPERFTKIYLNWLYNIRDWCISRQLWWGHRIPVWYCDECGEVIPSREEVKSCPKCQSTKVHQDPDVLDTWFSSALWPFSTLGWPQNTEELKYYYPTSVLVTGRDIIFFWVARMLFMGLEFMKEVPFKEVLIHGLVLDAQGRKMSKSLGNGVDPVEVIASHGADSLRFMLVTGNTPGNDLRFHFERLDGARNFANKLWNASRFVLMNLEGF------TPQGIKQEELTLADRWILARLNAVIDRVTAFLDEYELGEAARELYEFIWDEFCDWYVELTKPRLYGKMPGGDTAREVLYAVLKTTLELLHPFMPFITEEIWQRLPHEGKTIMLAPWPKGRADYENPEAVKQMS--SLMEVIREIRRLRAEVNVPPAKRGEVILVTADEQLTRLLNENAWAIAALAQSEPRVVPKMEVPQGALTGVAAGVTIY-LPLKDLIDLEKEK---ERLNKELKKVLAEIERLNQKLNNPGFLAKAPAEVVNKEREK 856
>gi|89895934|ref|YP_519421.1| valyl-tRNA synthetase [Desulfitobacterium hafniense Y51] >gi|89335382|dbj|BAE84977.1| hypothetical protein [Desulfitobacterium hafniense Y51] (881 aa)
Score = 1501, Expect = 4.1e-164, Identities = 322/843 (38%), Positives = 504/843 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKD-SKEIYVGTKPPKNEEL----YVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE------SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIE----DVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISD---EVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKE 855
           + K YD    E ++  +  +K     ++   K  +SI++PPPNVTG LHLGHA++ TIQD L RF  ++G +  W+ G DHAGIATQ K E+ L +   +     R++ +  +++W +  G  I  Q + +G   D+  E FT+++  +E V +VFV +Y+ GLIYR   +VNW     + IS+IEV   + E +L+++RY + +S + L+VATTRPET+  D  + V+P+D+RY++ + K  I PLTN+EI IIAD+YVD +FGTG +K TPAHD ND+E+G +++L  I+  + +   N  A  ++ ++   AR + V+ LE   LL KV+     VG   R + VVEPM+S+QWFVK+   +K  +E+ +    ++F P +F K  + W+ N+ DWCISRQLWWGH+IPVWY +D   EI     P    E      V+D DVLDTWFSSGLWP +T      T  LK     +PT+VLVTG DIIFFWV RM+F  L   K++PF+   I GL+ D    KMSKSLGNGVDP +VI++YGAD LR  L++ ++PG DL +  E++++   F NK+WN+ R+V +N  D+   E+     L+  D+WIL+++ K   E  +   K++   + + + +F W++FC+ YIEL+K R  ++E      +   +L  +++  + L HP  PF+T  ++ N    + +SI+++   + K++  +E   E     ++ +I  +R    E  +   K  +I L       F++ +   E I +L       V  +++ +KP    +  L  +     L G  +    I +++KEI   + E SR  G L+N+ F+ KAP++ +  E+ K E
  S:     7 MEKVYDPSQVEGKWYPYWEEKGYFHADVDDAKEPFSIVMPPPNVTGALHLGHAIDSTIQDILTRFKRMQGYNTLWLPGTDHAGIATQAKVEEQLAKEGTNRHALGREKFLDRVWDWKKEYGGRITQQLRRLGASCDWSRERFTMDEGCSEAVREVFVDLYHKGLIYRGNYIVNWCPHCHTTISDIEVEHVDREGHLWHLRYPVKDSDEVLIVATTRPETMLGDTAVAVHPEDERYRHLLGKTIILPLTNREIPIIADDYVDREFGTGAVKITPAHDPNDFEMGLRHQLPSITVMDREAKMNEQAGKYQGMERYAARKEIVKDLEAQGLLVKVDNHQHAVGECYRCSTVVEPMVSKQWFVKMEPLAKPAMEVVREG-IMEFVPERFAKIYLGWLENIRDWCISRQLWWGHRIPVWYCEDCGAEICAKEDPETCPECGSKHIVQDPDVLDTWFSSGLWPFSTMGWPEETPELKQ---FYPTSVLVTGRDIIFFWVARMVFMGLEFMKDMPFQKVMIHGLVLDAQGRKMSKSLGNGVDPLEVIDQYGADTLRFMLITGNTPGNDLRFHPERLEATRNFANKIWNASRFVLLNLQDY---EEGPRGQLKLEDRWILSRYEKTAGEVTEALEKFDLGEAARLLYEFIWNEFCDWYIELAKGRLYDKEHPEARHTVQSILLEVLEGTMRLLHPYMPFITEEIWHNLPI-SGESIMIQ--SWPKVNGYREDDFEKQMNQIMDVIKAVRNIRAEMNVQPGKKAEIILVAPEKAAFEVLESGRESIRLLAGGSAVDVVSNLE-VKPAQAASAVLEGVEVYLPLRGLLDLDKEIARVEKEIAQAQLEQSRLAGKLNNQGFVAKAPEQVVAKEREKLE 862
>gi|167759909|ref|ZP_02432036.1| hypothetical protein CLOSCI_02273 [Clostridium scindens ATCC 35704] >gi|167662528|gb|EDS06658.1| hypothetical protein CLOSCI_02273 [Clostridium scindens ATCC 35704] (883 aa)
Score = 1498, Expect = 7.3e-164, Identities = 318/864 (36%), Positives = 518/864 (59%)
  Q:     9 NNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-------LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL------FKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           N  ++  K   K CE ++       E+++     ++  ++ ++PPPN+TG LH+GHAL+ T+QD LIR+  ++G +A W+ G DHA I+T+ K    L+E  I  K+  R++ +   ++W +     I +Q K +G   D++ E FT+++  ++ V +VF+K+Y +G IYR   ++NW    ++++S+ EV  +E + + ++I+Y +  S   L +ATTRPET+  D  + V+P D+RYK+ + K AI PL N+EI I+AD YVD +FGTG +K TPAHD ND+E+GK++ L  I+  N+D T N     +  ++  +AR   V+ LE+   L KV     NVG  +R +  VEPM+ +QWFV++ E +K  IE  K+   ++F P +F+K  ++W+ N+ DWCISRQ+WWGH+IP +Y  +  +I V    P+         + +D D LDTWFSS LWP +T    +  +  D  +PT+VLVTG+DIIFFWV RM+F       + PF   +I GL+RD    KMSKSLGNG+DP ++IE+YGADALR+ L++ ++PG D+ +  E+V++   F NK+WN+ R++ MN  D    E    K L   D+WI++K N    +  +  +KY   +++ KI DF WD+FC+ YIE++K R  + E         +W L  ++KK L L HP  PFV+  +Y     + +  ++ E  + D K    + E+ +E   +II  IR    +  +PN++ +  +L   + KL       + S + +  +N   I   K  I       V  +  ++ L  E+L+    E   IE++ KE   ++ EI+R +GML+N+ F+ KAP+ K++ E+ K E ++  ++++++ L+  K
  S:    10 NPKEIESKLYEKWCENKY----FHAEVDR-----SRKPFTTVMPPPNITGKLHMGHALDNTLQDILIRYKRMQGYNALWVPGTDHAAISTEVKVTNQLKEEGIDKKELGREKFLERTWQWKEEYAGTIEDQLKKLGVSCDWDRERFTMDEGCSKAVEEVFIKLYEEGYIYRGSRIINWCPVCKTSLSDAEVEHEEQDGDFWHIKYPIVGSDACLEIATTRPETMLGDTAIAVHPDDERYKDLVGKKAILPLVNREIPIVADYYVDKEFGTGAVKITPAHDPNDFEVGKRHNLPEINVMNDDATINENGGKYAGMERYEARKVMVKDLEEQGYLVKVVPHSHNVGTHDRCHTTVEPMVKQQWFVRMEELAKPAIEAVKNG-DLKFVPERFDKIYLHWLENIRDWCISRQIWWGHRIPAYYCDECGDIVVSCDVPEKCPKCGCTHFTQDEDTLDTWFSSALWPFSTLGWPEKTEDLDYFYPTDVLVTGYDIIFFWVIRMVFSGYAHTGKTPFHTVFIHGLVRDSQGRKMSKSLGNGIDPLEIIEQYGADALRMTLITGNAPGNDMRFYNERVEASRNFANKVWNASRFIMMNIEDKEITEPADFK-LRPADRWIMSKCNNLVKDVTENMDKYELGIALSKIYDFMWDEFCDWYIEIAKYRIYHVEEDQKSANDAMWTLREVLKKSLKLLHPYMPFVSEEIYGKLVPEEESLMMSEWPKYDEKWNYPIAENIVEHYKEIIRGIRNVRAKMNVPNSRKVTAYLVCEDQKLCTGLEYLRNSAQSMAFVNDLIIQHDKAGIAEDAVSIVVPDATVY-LPLEELIDLEQE---IERLSKEEARLEKEIARASGMLNNERFVSKAPEAKVQEERDKLETYKQMMEQVKERLAGLK 881
>gi|169824504|ref|YP_001692115.1| valyl-tRNA synthetase [Finegoldia magna ATCC 29328] >gi|167831309|dbj|BAG08225.1| valyl-tRNA synthetase [Finegoldia magna ATCC 29328] (872 aa)
Score = 1497, Expect = 1.2e-163, Identities = 345/833 (41%), Positives = 504/833 (60%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL-----WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL--------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVI---DIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPK 844
           +L K Y+ K  E + + +W  +    K  +  +K  ++I++PPPNVTGNLHLGHALN TIQD LIR N + G SA W+ G DHA IAT+ K    L+E   S +   RD  +   ++W++  G NI+NQ K +G   D+  E FTL+    E V +VF+KMYND LIY+   +VNW     +AIS+IEV+ ++   + + IRY   +S+DY+++ATTRPET+  D  + VNP D+RY + + K  I PL N+EIK+IAD YVD++FGTG++K TP+HD ND+E+G ++ L      +ED         +  L   +AR   +E LEK   L+ V+     VG  ER ++ VEP++S+QWFVK+ + +K  ++  K  ++I+F P +FEK  +NW+ N+ DWCISRQLWWGH++PV+Y  ++ E+ V  + P  ++ Y +D D LDTWFSS LWP +T       + L   FPTNVLVTG+DIIFFWV RM+F SLY   EVPFK  Y+TGL++D    KMSKSLGNG+DP +VI++YGADALR  L++ ++PG D  +  EKV++   F NKLWN+ R+V MN  D   + D+    +E  DKWI++  N    E     NKY   ++ +KI DFTW+ FC+ YIEL K R     +KL      VL Y +  ++ L HP  P++T  +Y       K+ +L+        E   FKK   + +  +E V+ I N  +  N   K  ++  I   D  LE    +L  +    ++I N  K+N   +DI       +  +    I+   DL+  + E   +E+++KE+   KSE+ R    L N+ F++ AP+
  S:     3 NLEKNYNPKEFEDKIYKIWENEGYF-KGIIDKDKKPFTIVMPPPNVTGNLHLGHALNNTIQDILIRKNRMDGYSALWVPGTDHASIATEAKVVNKLKEEGKSKESLGRDGFLEASWDWTREYGGNIKNQLKKLGVSCDWSREAFTLDDNLTEAVEEVFIKMYNDDLIYQGDRIVNWCPNCHTAISDIEVVHEDESGHFWNIRYKFKDSEDYIVIATTRPETLLGDLAVAVNPDDERYTDIVGKTLILPLVNREIKVIADSYVDMEFGTGIVKITPSHDPNDFEVGARHNLGQCIVIDEDAKIVEGYGKYSGLDRYEARKLIIEDLEKIGQLDSVKDHEHAVGHCERCHSTVEPLISKQWFVKMDKLAKLALDAYK-KEEIRFIPKRFEKVYVNWLENIRDWCISRQLWWGHRLPVYYHNETGEVVVARENPDPQK-YTQDPDTLDTWFSSALWPFSTLGWPNETEDLKYFFPTNVLVTGYDIIFFWVIRMVFSSLYNLGEVPFKDVYLTGLVKDSQGRKMSKSLGNGIDPIEVIDQYGADALRFALITGNTPGNDSRFYMEKVEANRNFCNKLWNASRFVFMNVEDNVKNIDEVELQIE--DKWIISSLNNVIDEVSTNLNKYEIGIAAEKIYDFTWNVFCDWYIELVKPRLYGDNAKLKDSAISVLIYTLTNVIKLLHPFMPYITEEIYS--YLPNKNDMLINETWPKYSESNSFKKEEEIIDKLVESVISIRNSRQEMNIAPKKQSDVYILTSDKSLEDDFKQLESLFRSSVSI-NEYKVN---EDISEENNIVIVKDSYKIIIPLNDLIDYSKE---LERLEKELNSAKSELKRAESKLKNEGFLKGAPE 841
>gi|166031702|ref|ZP_02234531.1| hypothetical protein DORFOR_01402 [Dorea formicigenerans ATCC 27755] >gi|166028679|gb|EDR47436.1| hypothetical protein DORFOR_01402 [Dorea formicigenerans ATCC 27755] (884 aa)
Score = 1496, Expect = 1.4e-163, Identities = 321/860 (37%), Positives = 519/860 (60%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVL----QIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFK---ISDEVINILNTAKINIVKQDIKSLKPDYVE---NNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           + +L K Y+ K  E + +  W   K  + + +  +K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  ++G +A WI G DHA I+T+ K    L++  I  K+  R++ +   ++W +  G  I +Q K MG   D++ E FT+++  +E V +VF+ ++  G IYR   ++NW    ++++S+ EV  +E +   ++I+Y +  +  +L +ATTRPET+  D  + V+P D+RYK+ + K    PLT++EI I+AD YVD +FGTG +K TPAHD ND+E+GK++ L  ++  N+D T N  Y   +  +   +AR   VE L++   L KV     NVG  +R +  VEPM+ +QWFVK+ E +K  IE  K+  +++F P +F+K  ++W+ N+ DWCISRQ+WWGH+IP +Y +D  E+ V ++ P+         + +D D LDTWFSS LWP +T       +  D  +PTNVLVTG+DIIFFWV RM+F       + PF    I GL+RD    KMSKSLGNG+DP D+I++YGADALR+ L++ ++PG D+ +  E+V++   F NK+WN+ RY+ MN       E +  ++L   D+WIL+  N    +  +  +K+   +++ KI DF WD+FC+ YIELSK           +  + LW L  ++   L L HP  PFVT  +Y     + +  ++     +++  N  E+  E++L    +I+  +R    E  +PN++   I++   + KL K   +  E   ++ +A   IV+ D   +  D V     +  +++   E+L+    E    E++ KE   +  EI+R NGML+N+ F+ KAP  K++ E+ K EK+E  L ++++ L+
  S:     2 SQNLEKTYNPKEIEDKLYQKWCENKYFHAE-VDRSKKPFTIVMPPPNITGKLHMGHALDNTMQDILIRYKRMQGYNALWIPGTDHAAISTEVKVTNQLKDEGIDKKELGREKFLERTWQWKEEYGGTITSQLKKMGVSCDWDRERFTMDEGCSEAVEKVFLNLHKKGFIYRGSRIINWCPVCKTSLSDAEVEHEEQDGFFWHIKYPIVGTDRFLEIATTRPETLLGDTAIAVHPDDERYKDIVGKMCKLPLTDREIPIVADYYVDKEFGTGAVKITPAHDPNDFEVGKRHNLPELNIMNDDATINEKYGGKYAGMDRYEARKAMVEDLKEQGYLVKVVPHSHNVGTHDRCHTTVEPMIKQQWFVKMEELAKPAIEAIKNG-ELKFVPERFDKIYLHWLENIRDWCISRQIWWGHRIPAYYCQDCGEVVVASEAPEKCPHCGCTHFKQDEDTLDTWFSSALWPFSTLGWPHETEDLDYFYPTNVLVTGYDIIFFWVIRMVFSGYAHTGKAPFNTVLIHGLVRDSQGRKMSKSLGNGIDPLDIIDQYGADALRMTLITGNAPGNDMRFYNERVEASRNFANKVWNASRYILMNMEGKEITEPQA-EDLGPADRWILSACNNVVKDVTENLDKFELGIALSKIYDFIWDEFCDWYIELSKYAIYHADENPKSANAALWTLKKVLGDALKLLHPYMPFVTEEIYSKLVPEEESLMMSSWPVYEEKWNDAEN--ENILNHYKEIVRGVRNVRSEMNVPNSRKATIYVVCEDEKLAKGLAVLKESAMMMASAGDFIVQADKSGIADDAVSVVVPDATVYV-PLEELIDFEQEK---ERLTKEETRLNKEIARSNGMLNNEKFVSKAPAAKVQEEREKLEKYEQMLAQVKERLA 879
>gi|168208620|ref|ZP_02634245.1| valyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] >gi|170713145|gb|EDT25327.1| valyl-tRNA synthetase [Clostridium perfringens B str. ATCC 3626] (880 aa)
Score = 1495, Expect = 1.7e-163, Identities = 331/859 (38%), Positives = 510/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S ++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y +D  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  K     DKWIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + ++ N +  E  +  +++ I  +R    E  +P ++      +V+     +  D  IN     +      ++  L   D ++NN +  ++   +    LL   +    +E++ KE   ++ EI R    LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYPVVGSDEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCQDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCKEYSLADKWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEVLNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEEAKDAFINGGAYLEKLASASEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|110801210|ref|YP_696599.1| valyl-tRNA synthetase [Clostridium perfringens ATCC 13124] >gi|110675857|gb|ABG84844.1| valyl-tRNA synthetase [Clostridium perfringens ATCC 13124] (880 aa)
Score = 1495, Expect = 2.0e-163, Identities = 332/859 (38%), Positives = 510/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S+++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y KD  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  K     DKWIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + +  N +  E  +  +++ I  +R    E  +P ++      +V+     +  D  IN     +      ++  L   D ++NN +  ++   +    LL   +    +E++ KE   ++ EI R    LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYQVVGSEEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCKDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCKEYSLADKWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEEAKDAFINGGAYLEKLASASEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|109649187|ref|ZP_01373079.1| valyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] >gi|109639585|gb|EAT49142.1| valyl-tRNA synthetase [Desulfitobacterium hafniense DCB-2] (875 aa)
Score = 1495, Expect = 2.1e-163, Identities = 323/860 (37%), Positives = 512/860 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKD-SKEIYVGTKPPKNEEL----YVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE------SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIE----DVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISD---EVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + K YD    E ++  +  +K     ++   K  +SI++PPPNVTG LHLGHA++ TIQD L RF  ++G +  W+ G DHAGIATQ K E+ L +   + +   R++ +  +++W +  G  I  Q + +G   D+  E FT+++  +E V +VFV +Y+ GLIYR   +VNW     + IS+IEV   + E +L+++RY + +S + L+VATTRPET+  D  + V+P+D+RY++ + K  I PLTN+EI IIAD+YVD +FGTG +K TPAHD ND+E+G +++L  I+  + +   N  A  ++ ++   AR + V+ LE   LL KV+     VG   R + VVEPM+S+QWFVK+   +K  +E+ +    ++F P +F K  + W+ N+ DWCISRQLWWGH+IPVWY +D   EI     P    E      V+D DVLDTWFSSGLWP +T      T  LK     +PT+VLVTG DIIFFWV RM+F  L   K+VPF+   I GL+ D    KMSKSLGNGVDP +VI++YGAD LR  L++ ++PG DL +  E++++   F NK+WN+ R+V +N  D+   E+     L+  D+WIL+++ K   E  +   +++   + + + +F W++FC+ YIEL+K    ++E      +   +L  +++  + L HP  PF+T  ++ N    + +SI+++   + K++  ++  +E     ++ +I  +R    E  +   K  +I L       F++ +   E I +L       V  +++ +KP    +  L  +     L G  +    I +++KEI   + E SR  G L+N+ F+ KAP++ +  E+ K E    ++  L+  L+  K
  S:     1 MEKVYDPSQVEGKWYPYWEEKGYFHADVDDAKEPFSIVMPPPNVTGALHLGHAIDSTIQDILTRFKRMQGYNTLWLPGTDHAGIATQAKVEEQLAKEGTNRQALGREKFLDRVWDWKKEYGGRITQQLRRLGASCDWSRERFTMDEGCSEAVREVFVDLYHKGLIYRGNYIVNWCPHCHTTISDIEVEHVDREGHLWHLRYPVKDSDEVLVVATTRPETMLGDTAVAVHPEDERYRHLLGKTIILPLTNREIPIIADDYVDREFGTGAVKITPAHDPNDFEMGLRHQLPSITVMDREAKMNEQAGKYQGMERYAARKEIVKDLEAQGLLVKVDNHQHAVGECYRCSTVVEPMVSKQWFVKMEPLAKPAMEVVREG-IMEFVPERFAKIYLGWLENIRDWCISRQLWWGHRIPVWYCEDCGAEICAKEDPETCPECGSKHIVQDPDVLDTWFSSGLWPFSTMGWPEETPELKQ---FYPTSVLVTGRDIIFFWVARMVFMGLEFMKDVPFQKVMIHGLVLDAQGRKMSKSLGNGVDPLEVIDQYGADTLRFMLITGNTPGNDLRFHPERLEATRNFANKIWNASRFVLLNLQDY---EEGPRGQLKLEDRWILSRYEKTAGEVTEALEQFDLGEAARLLYEFIWNEFCDWYIELAKGCLYDKEHPEARHTVQSILLEVLEGTMRLLHPYMPFITEEIWHNLPI-SGESIMIQ--SWPKVNGYRKDDLEKQMNQIMDVIKAVRNIRAEMNVQPGKKAEIILVAPEKAAFEVLESGRESIRLLAGGSAVDVVSNLE-VKPAQAASAVLEGVEVYLPLRGLLDLDKEIARVEKEIAQAQLEQSRLAGKLNNQGFVAKAPEQVVAKEREKLEGINGRIAALKVRLAELK 873
>gi|168215545|ref|ZP_02641170.1| valyl-tRNA synthetase [Clostridium perfringens NCTC 8239] >gi|182624398|ref|ZP_02952182.1| valyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] >gi|177910401|gb|EDT72778.1| valyl-tRNA synthetase [Clostridium perfringens D str. JGS1721] >gi|182382320|gb|EDT79799.1| valyl-tRNA synthetase [Clostridium perfringens NCTC 8239] (880 aa)
Score = 1494, Expect = 2.3e-163, Identities = 332/859 (38%), Positives = 510/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S+++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y KD  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  K     DKWIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + +  N +  E  +  +++ I  +R    E  +P ++      +V+     +  D  IN     +      ++  L   D ++NN +  ++   +    LL   +    +E++ KE   ++ EI R    LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYPVVGSEEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCKDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCKEYSLADKWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEEAKDAFINGGAYLEKLASASEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|153940722|ref|YP_001392440.1| valyl-tRNA synthetase [Clostridium botulinum F str. Langeland] >gi|152936618|gb|ABS42116.1| valyl-tRNA synthetase [Clostridium botulinum F str. Langeland] (881 aa)
Score = 1493, Expect = 2.8e-163, Identities = 342/866 (39%), Positives = 518/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKI--SNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL---EVLNPKLFKISDEVINILNTA-KINIVKQDIKSLKP-DYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K YD K  E++      +K      +  NK  Y+I+LPPPN+TG LHLGHAL+ T+QD L+R   ++G S  W+ G DHA IAT+ K E  L +  I  K+  R+  +  ++EW+    N IRNQ K +G  LD+  E FT++++ ++ V   FVK+YN+GLIY+   + NW  K ++A+S+ E+   E E + ++++Y +  S +YL +ATTRPET+  D  + VNPKD+RY + + K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDY++GK++ L  I+   +DG  N     +  +   +AR   VE L+    L K+++   NV   +R N V+EP++S+QWFVK+ E +K  I++ K+ K     P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V T+ PK     N E   +DNDVLDTWFSS LWP +T    D        +P N LVTG+DIIFFWV RM+F  LY   ++PF    I G++RD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y  E+V++   F NK+WN+ R+V MN      D+ K  KN    DKWIL++ N    E  +   K+   ++ +KI DF W +FC+ YIEL K      +++SK     VL+ +++  L L HP+ PF+T  +Y +   + +  ++ +  ++ +I      E  +E +++ I  IR    E  +P ++   + +   E    + FK  +     L +A +++ ++    S K    V     IFI     LL   +    +E++ KE E ++ EI R    L+N+ F+ KAP+  +  E+ K EK++  LK + + L S K
  S:     1 MSETREMAKTYDPKEFEERLYKNWEEKSYFTPEVDENKKPYTIVLPPPNITGKLHLGHALDDTLQDILMRTKRMQGYSTLWLPGQDHASIATEVKVENELLKEGIVKKEIGREAFLEKVWEWTDEYRNKIRNQIKKLGCSLDFTRERFTMDEQLDKAVKHFFVKLYNEGLIYQGNRITNWCPKCKTALSDAEIEYSEHEGHFWHVKYPVVGSDEYLEIATTRPETMLGDTAVAVNPKDERYAHLVGKTLMLPLVNREIPIVADDYVDMEFGTGAVKITPAHDPNDYQVGKRHNLPEINVMFDDGRINYKETRYHEMDRYEARKAIVEDLKNEGFLVKIKEHNHNVSCHDRCNTVIEPIISKQWFVKMEELAKPAIDVVKNKKVKF-VPERFDKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVVTEEPKKCPKCNSEKLQQDNDVLDTWFSSALWPFSTLGWPDKTPDLKYFYPNNTLVTGYDIIFFWVARMVFSGLYCMDDIPFDTVLIHGIVRDSEGKKMSKSLGNGVDPIEVIDEYGADALRFTLVTGNAPGNDIRYYPERVEAARNFANKIWNASRFVLMNLDKDLMDKYKDNKNYTIADKWILSRLNTVVKEVTENIEKFELGIASQKIYDFIWGEFCDWYIELVKPVLYGEDEQSKGIAFNVLHKVLETSLQLLHPIMPFITEEIYTHLYTEYESIVISKWPEYDEILKDEKSEKDMEYIIEAIKSIRNVRTEMNVPPSRKAKLMIYLTEKEAERSFKEGEVYFQKLASASEVSFLENKETSDKNVSVVTRGAEIFI----PLLELVDIEKELERLNKEKEKLEKEIDRVEKKLANEKFVSKAPESVVNEEREKGEKYKAMLKSVRESLESLK 881
>gi|168204897|ref|ZP_02630902.1| valyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] >gi|170663625|gb|EDT16308.1| valyl-tRNA synthetase [Clostridium perfringens E str. JGS1987] (880 aa)
Score = 1492, Expect = 3.6e-163, Identities = 331/859 (38%), Positives = 510/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S+++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y KD  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  K     D+WIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + +  N +  E  +  +++ I  +R    E  +P ++      +V+     +  D  IN     +      ++  L   D ++NN +  ++   +    LL   +    +E++ KE   ++ EI R    LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYPVVGSEEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCKDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCKEYSLADQWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEEAKDAFINGGAYLEKLASASEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|169343619|ref|ZP_02864618.1| valyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] >gi|169298179|gb|EDS80269.1| valyl-tRNA synthetase [Clostridium perfringens C str. JGS1495] (880 aa)
Score = 1492, Expect = 3.6e-163, Identities = 331/859 (38%), Positives = 510/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S+++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y +D  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  K     DKWIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + +  N +  E  +  +++ I  +R    E  +P ++      +V+     +  D  IN     +      ++  L   D ++NN +  ++   +    LL   +    +E++ KE   ++ EI R    LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYPVVGSEEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCQDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCKEYSLADKWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEEAKDAFINGGAYLEKLASASEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|168214160|ref|ZP_02639785.1| valyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] >gi|170714391|gb|EDT26573.1| valyl-tRNA synthetase [Clostridium perfringens CPE str. F4969] (880 aa)
Score = 1491, Expect = 5.5e-163, Identities = 331/859 (38%), Positives = 509/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S ++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y KD  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  K     D+WIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + +  N +  E  +  +++ I  +R    E  +P ++      +V+     +  D  IN     +      ++  L   D ++NN +  ++   +    LL   +    +E++ KE   ++ EI R    LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYPVVGSDEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCKDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCKEYSLADQWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEEAKDAFINGGAYLEKLASASEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|148381112|ref|YP_001255653.1| valyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|153934142|ref|YP_001385486.1| valyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153935830|ref|YP_001388892.1| valyl-tRNA synthetase [Clostridium botulinum A str. Hall] >gi|148290596|emb|CAL84725.1| valyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502] >gi|152930186|gb|ABS35686.1| valyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397] >gi|152931744|gb|ABS37243.1| valyl-tRNA synthetase [Clostridium botulinum A str. Hall] (881 aa)
Score = 1491, Expect = 5.8e-163, Identities = 342/866 (39%), Positives = 518/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKI--SNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL---EVLNPKLFKISDEVINILNTA-KINIVKQDIKSLKP-DYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K YD K  E++      +K      +  NK  Y+I+LPPPN+TG LHLGHAL+ T+QD L+R   ++G S  W+ G DHA IAT+ K E  L +  I  K+  R+  +  ++EW+    N IRNQ K +G  LD+  E FT++++ ++ V   FVK+YN+GLIY+   + NW  K ++A+S+ E+   E E + ++++Y +  S +YL +ATTRPET+  D  + VNPKD+RY + + K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDY++GK++ L  I+   +DG  N     +  +   +AR   VE L+    L K+++   NV   +R N V+EP++S+QWFVK+ E +K  I++ K+ K     P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V T+ PK     N E   +DNDVLDTWFSS LWP +T    D        +P N LVTG+DIIFFWV RM+F  LY   ++PF    I G++RD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y  E+V++   F NK+WN+ R+V MN      D+ K  KN    DKWIL++ N    E  +   K+   ++ +KI DF W +FC+ YIEL K      +++SK     VL+ +++  L L HP+ PF+T  +Y +   + +  ++ +  ++ +I      E  +E +++ I  IR    E  +P ++   + +   E    + FK  +     L +A +++ ++    S K    V     IFI     LL   +    +E++ KE E ++ EI R    L+N+ F+ KAP+  +  E+ K EK++  LK + + L S K
  S:     1 MSETREMAKTYDPKEFEERLYKNWEEKSYFTPEVDENKKPYTIVLPPPNITGKLHLGHALDDTLQDILMRTKRMQGYSTLWLPGQDHASIATEVKVENELLKEGIVKKEIGREAFLEKVWEWTDEYRNKIRNQIKKLGCSLDFTRERFTMDEQLDKAVKHFFVKLYNEGLIYQGNRITNWCPKCKTALSDAEIEYSEHEGHFWHVKYPVVGSDEYLEIATTRPETMLGDTAVAVNPKDERYAHLVGKTLMLPLVNREIPIVADDYVDMEFGTGAVKITPAHDPNDYQVGKRHNLPEINVMFDDGRINYKETRYHEMDRYEARKAIVEDLKNEGFLVKIKEHNHNVSCHDRCNTVIEPIISKQWFVKMEELAKPAIDVVKNKKVKF-VPERFDKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVVTEEPKKCPKCNSEKLQQDNDVLDTWFSSALWPFSTLGWPDKTPDLKYFYPNNTLVTGYDIIFFWVARMVFSGLYCMDDIPFDTVLIHGIVRDSEGKKMSKSLGNGVDPIEVIDEYGADALRFTLVTGNAPGNDIRYYPERVEAARNFANKIWNASRFVLMNLDKDLMDKYKDNKNYTIADKWILSRLNTVVKEVTENIEKFELGIASQKIYDFIWGEFCDWYIELVKPVLYGEDEQSKGIAFNVLHKVLETSLQLLHPIMPFITEEIYTHLYTEYESIVISKWPEYDEILKDEKSEKDMEYIIEAIKSIRNVRTEMNVPPSRKAKLMIYLTEKEAERSFKEGEVYFQKLASASEVSFLENKETSDKNVSVVTRGAEIFI----PLLELVDIEKELERLNKEKEKLEKEIDRVEKKLANEKFVSKAPESVVNEEREKGEKYKAMLKSVLESLESLK 881
>gi|168179187|ref|ZP_02613851.1| valyl-tRNA synthetase [Clostridium botulinum NCTC 2916] >gi|182670164|gb|EDT82140.1| valyl-tRNA synthetase [Clostridium botulinum NCTC 2916] (881 aa)
Score = 1489, Expect = 1.0e-162, Identities = 340/866 (39%), Positives = 519/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISN--LKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTA-KINIVK-QDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K YD K  E++      +K      +  NK  Y+I+LPPPN+TG LHLGHAL+ T+QD L+R   ++G S  W+ G DHA IAT+ K E  L +  I  K+  R+  +  ++EW+    N IRNQ K +G  LD+  E FT++++ ++ V   FVK+YN+GLIY+   + NW  K ++A+S+ E+   E E + ++++Y +  S +YL +ATTRPET+  D  + VNPKD+RY + + K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDY++GK++ L  I+   +DG  N     +  +   +AR   VE L+    L K+++   NV   +R N V+EP++S+QWFVK+ E +K  IE+ K+ K     P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V T+ P      N E   +DNDVLDTWFSS LWP +T    D        +P N LVTG+DIIFFWV RM+F  LY   ++PF    I G++RD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y  E+V++   F NK+WN+ R+V MN      D+ K  KN    DKWIL++ N    E  +   K+   ++ +KI DF W +FC+ YIEL K      +++SK     VL+ +++  L L HP+ PF+T  +Y +   + +  ++ +  ++++  N    E  +E +++ I  IR    E  +P ++   + + +   +    FK  +     L +A +++ ++ ++I       V     IFI     LL   +    +E++ KE E ++ EI R    L+N+ F+ KAP+  +  E+ K EK++  LK + + L S K
  S:     1 MSETREMAKTYDPKEFEERLYKNWEEKSYFTPEVDENKKPYTIVLPPPNITGKLHLGHALDDTLQDILMRTKRMQGYSTLWLPGQDHASIATEVKVENELLKEGIVKKEIGREAFLEKVWEWTDEYRNKIRNQIKKLGCSLDFTRERFTMDEQLDKAVKHFFVKLYNEGLIYQGNRITNWCPKCKTALSDAEIEYSEHEGHFWHVKYPVVGSDEYLEIATTRPETMLGDTAVAVNPKDERYAHLVGKTLMLPLVNREIPIVADDYVDMEFGTGAVKITPAHDPNDYQVGKRHNLPEINVMFDDGRINYKETRYHEMDRYEARKAIVEDLKNEGFLVKIKEHNHNVSCHDRCNTVIEPIISKQWFVKMEELAKPAIEVVKNKKVKF-VPERFDKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVVTEEPTKCPKCNSEKLQQDNDVLDTWFSSALWPFSTLGWPDKTPDLKYFYPNNTLVTGYDIIFFWVARMVFSGLYCMDDIPFDTVLIHGIVRDSEGKKMSKSLGNGVDPIEVIDEYGADALRFTLVTGNAPGNDIRYYPERVEAARNFANKIWNASRFVLMNLDKDLMDKYKDNKNYTIADKWILSRLNTVVKEVTENIEKFELGIASQKIYDFIWGEFCDWYIELVKPVLYGEDEQSKGIAFNVLHKVLETSLQLLHPIMPFITEEIYTHLYTEYESIVISKWPEYEESLNDEKSEKDMEYIIEAIKSIRNVRTEMNVPPSRKAKLMIYLTENEAEGSFKEGEVYFQKLASASEVSFLENKEISDKNVSVVTRGAEIFI----PLLELVDIEKELERLNKEKEKLEKEIDRVEKKLANEKFVSKAPESVVNEEREKGEKYKAMLKSVLESLESLK 881
>gi|167745430|ref|ZP_02417557.1| hypothetical protein ANACAC_00121 [Anaerostipes caccae DSM 14662] >gi|167655151|gb|EDR99280.1| hypothetical protein ANACAC_00121 [Anaerostipes caccae DSM 14662] (879 aa)
Score = 1488, Expect = 1.3e-162, Identities = 325/859 (37%), Positives = 518/859 (60%)
  Q:    10 NNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE-----SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL-------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE---VINILNTAKINIVKQDIKSLKPDYVEN---NYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           + +L K Y+  +I ++ +  W   K  + + +  +K  ++I++PPPN+TG LH+GHAL+ T+QD LIRF  ++G +  W  G DHA IAT+ K  + L+E  I  +D  R++ +   +EW +  G  I +Q K +G   D++ E FT+++  ++ V +VF+K+Y  G IY+   ++NW    Q++IS+ EV   +   + ++I+Y ++ + DYL +ATTRPET+  D  + V+P D+RY + + K    PL  ++I I+ADEYVD +FGTG +K TPAHD ND+E+G+++ L +I+  N+D T N     +E ++  +AR   V+ LE+   L K+++   NVG  +R  A +EPM+  QWFVK+ E +K  IE  K+   I+F P ++ K  ++W+ N+ DWCISRQLWWGH+IP +Y  +  E  V  + P+         + +D D LDTWFSS LWP +T    +  +  D  +PTNVLVTG+DIIFFWV RM+F       + PF    I GL+RD+   KMSKSLGNG+DP +VI +YGADALR  L++ ++PG D+ +  E+V++   F NK+WN+ R++ MN    +F   +   +L   D+WIL+KFN    +     +KY   ++++K+ DF W++FC+ YIE+ K R  N E     + LW L  ++ + L L HP  PF+T  +Y N     ++SI+L       E   F +    +E+++E + + +  IR    E  +   K   + +   N  +  I ++       L  A    V+ D + +  D V     + +I++   E L+    E   IE++KKE + +  EI RC GML+N+ F+ KAP++K+E EK K  K+   L+++E+ L
  S:     2 SKELEKTYNPSEIEDRLYQKWLDNKYFHAE-VDHSKKPFTIVIPPPNITGKLHMGHALDETLQDILIRFKKMQGYNTLWQPGTDHASIATEVKIIEALKEEGIEKEDLGREKFLERAWEWKEEYGGTIVSQLKKLGSACDWDRERFTMDEGCSKAVEEVFIKLYEKGYIYKGSRIINWCPVCQTSISDAEVEHVDQAGHFWHIKYPVAGTDDYLEIATTRPETMLGDTAVAVHPDDERYTHLVGKMLELPLCGRQIPIVADEYVDKEFGTGAVKITPAHDPNDFEVGRRHGLPVINVMNDDATINENGGRYEGMERYEARKAIVKDLEEQGYLVKIKEHEHNVGTHDRCKATIEPMVKPQWFVKMDELAKPAIEAVKNG-DIKFVPERYTKTYLHWLENIRDWCISRQLWWGHRIPAYYCDECGETVVAKEKPEVCPKCGCTHFTQDEDTLDTWFSSALWPFSTLGWPEQTEELDYFYPTNVLVTGYDIIFFWVVRMVFSGYEHTGKAPFDTVLIHGLVRDDKGRKMSKSLGNGIDPLEVISQYGADALRFTLVTGNAPGNDMRFYMERVEASRNFANKVWNASRFMMMNFEQADFSHVEL-SDLTSADRWILSKFNTLAKDVTDNMDKYELGIAVQKLNDFIWEEFCDWYIEMVKPRLYNDEDNTKAAALWTLKKVLSESLKLLHPFMPFITEEIYCN--LTGEESIMLASWPEYREEYSFAR----EEAAVELMKEAVRGIRNIRAEMNVSPKKKAKVFVVSENEDVRDIFEQGKVFFGTLGYASEVAVRADREGIAEDAVSTMVPDAVIYMPFAE-LVDIEKE---IERLKKEQKKLGGEIKRCEGMLNNERFLSKAPEQKVEEEKEKLSKYRQMLEKVEERL 874
>gi|18310901|ref|NP_562835.1| valyl-tRNA synthetase [Clostridium perfringens str. 13] >gi|81766834|sp|Q8XJ42|SYV_CLOPE Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|18145583|dbj|BAB81625.1| valine-tRNA ligase [Clostridium perfringens str. 13] (880 aa)
Score = 1487, Expect = 1.6e-162, Identities = 330/859 (38%), Positives = 510/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL-KPDYVENNYLIFILNKED----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S+++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y KD  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  +     D+WIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + +  N +  E  +  +++ I  +R    E  +P ++      +V+     +  D  IN     +      ++  L   D ++NN +  ++   +    LL   +    +E++ KE   ++ EI R    LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYPVVGSEEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCKDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCQEYSLADQWILSRTNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEEAKDAFINGGAYLEKLASASEVTFLDNKDNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVEKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|147677147|ref|YP_001211362.1| valyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] >gi|146273244|dbj|BAF58993.1| valyl-tRNA synthetase [Pelotomaculum thermopropionicum SI] (886 aa)
Score = 1487, Expect = 1.7e-162, Identities = 317/845 (37%), Positives = 481/845 (56%)
  Q:    12 DLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA-VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR------TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFK----TKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISD---EVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEK 856
           D+   YD H +  + ++ W      + + +   +  + I++PPPNVTG LH+GHAL+ T+QD L R+  +KG +  W+ G DHAGIATQ + E+ L +  +S  D  R+E +  ++ W +  GN I  Q + +G   D++ E FT+++  +E V +VF+K++  GLIYR   + NW  K  + IS+IEV   E   +LYY +Y   +   ++++ATTRPET+  D  + V+P D RYK  + K  I PL  +E+ +IADEYVD  FGTG +K TPAHD ND+E+G ++ L  +   + +G  +  A   ++ L   + R K V  LE    L K E  +  VG   R N V+EPM+S+QWFV++   ++  IE  K   +I+F P +F K  +NWM N+ DWCISRQLWWGH+IPVWY  D  E+ V  K   +          +D DVLDTWFSS LWP +T    K    L   +P +VLVTG DIIFFWV RM+F  L    +VPF+  +I GL+ D    KMSKSLGNGVDP DVIE +GAD+LR  L++ ++PG DL +  E++     F NKLWN+ R+V MN  DF+ +    P +L   D+WI+++   A +   +    Y    + + + DF W +FC+ YIEL+K R        ++ +   VL+ ++K  L L HP  PF+T  ++ +   +     K      R +   +    E  +E ++++   IR    E  +   +  D  L V +  +  + +   E I  L  A++ I    +    P+   +  +  I     L G  +    I +++KE+   + E++R  G L+N  F+ KAP E IE EK+++E+
  S:     7 DIPTTYDPHSVENKWYAFWEKNGFFHTE-VNPEQEPFCIVMPPPNVTGQLHMGHALDNTLQDILTRWKRMKGYNTLWLPGTDHAGIATQARVEEQLAKEGLSRHDLGREEFLKRVWAWKEKYGNRITTQLRRLGASCDWQRERFTMDEGCSEAVLEVFIKLFQRGLIYRDYYITNWCPKCHTTISDIEVEHLERPGHLYYFKYPFKDGSGHVVIATTRPETMLGDVAVAVHPDDGRYKEMVGKTLILPLVGREMPVIADEYVDPSFGTGAVKITPAHDPNDFEVGARHNLPQVKVIDREGRMSEEAGPRYQGLDRYECRKKIVRDLEAGGYLLKTEDHVHAVGHCYRCNTVIEPMLSKQWFVRMKPLAEPAIEAVKEG-RIRFIPERFAKIYLNWMENIRDWCISRQLWWGHRIPVWYCGDCGEMTVSKKAVTHCAKCGSAEVEQDPDVLDTWFSSALWPFSTLGWPKKTLDLAYYYPNSVLVTGRDIIFFWVARMIFSGLAFMNDVPFREVFIHGLVLDALGRKMSKSLGNGVDPIDVIESHGADSLRFMLITGNTPGNDLRFHFERLDGARNFANKLWNASRFVLMNLEDFDPEGRPGPYSLA--DRWIISRLQAAIAGVSRYLEAYELGEAARVLYDFIWSEFCDWYIELAKPRLYGKTTPEDRYTAQHVLSSVLKCTLELLHPFMPFITEEIWQHLPGRGVTIMKAPWPAARSEL--VDTEAEKEMELLMEVTKAIRHIRSEMNVSPGRKADALLSVPDGAVRAVLEKGREYIQGLANARLKIFP--VLDEAPEQAAHAVIRGIELFVPLKGLIDVEKEIARLQKELAVTEKELARVRGKLANPGFLAKAPAEVIEKEKAREEE 866
>gi|188587843|ref|YP_001921655.1| valyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] >gi|188498124|gb|ACD51260.1| valyl-tRNA synthetase [Clostridium botulinum E3 str. Alaska E43] (880 aa)
Score = 1486, Expect = 2.1e-162, Identities = 332/854 (38%), Positives = 496/854 (58%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW-----VLNYLIKKILILFHPMCPFVTSNLYDNFK-FKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNN---KVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH 857
           MS  KN   ++  YD K  E +      +K      +  NK  ++I++PPPN+TG LHLGHA + T+QD LIRF  ++G +A W+ G DHA IAT+ K    L +   + K+  R+  +  ++EWS +    IRNQ K +G   D+  E FT+++  +  V  VFVK+YN+GLIY+   + NW    Q+A+S+ E+  +E   + ++I Y L++    L +ATTRPET+  D  + VNP D+RYK+ I K  I PL N+EI I+ D YVD++FGTG +K TPAHD ND+E+GK++ L II   ++ G  N     ++ L   +AR   V+ LE+  LL K++    NVG  +R    VEP++S+QW+VK+   +K  IE+ K+ K  +F P +F+K   NWM N+ DWCISRQLWWGH+IPV+Y KD  E+ V  + P            +DNDVLDTWFSS LWP +T    +  +  +  +P NVLVTG DIIFFWV RM+F  L+   E PF    I GLIRD    KMSKSLGNGV+P DVI +YGADALR  + + ++PG D+ Y  E+V++   F NK+WN+ R+V MN      ++ K  K     DKWIL+K N    E  +  +KY   ++++K+ DF W +FC+ YIEL K     ++ K       VLN ++   L L HP  PF+T  ++ +    +T  + +    D   +S   E+ +  +++ I  +R    E  +P +   KVI    E            +  + + +++  +    KS+ P   EN   + +   E    LL   ++   +E++ KE++ ++ EI R +  L N  F+ KAP   ++ EK+K+EK+
  S:     1 MSETKN---IATTYDPKEFEDRIYKTWEEKGYFTPVVDKNKKPFTIIMPPPNITGELHLGHAFDDTLQDMLIRFKRMQGYAALWLPGEDHASIATEVKVANELAKQGYNKKEMGREAFLEKVWEWSDDYRARIRNQVKKLGVSADFTREAFTMDENLSAAVKHVFVKLYNEGLIYQGNRITNWCTHCQTALSDAEIEYEEQAGHFWHINYPLADGSGVLEIATTRPETLLGDSGVAVNPNDERYKHLIGKTVILPLVNREIPIVGDGYVDLEFGTGAVKMTPAHDPNDFEVGKRHNLEIIRVMDDKGIINEKGGKYKGLDRYEARKAIVKDLEELGLLVKIKDHAHNVGTHDRCGTTVEPIISKQWYVKMEGLAKPAIEVVKNGKT-KFVPERFDKTYFNWMENIQDWCISRQLWWGHRIPVYYCKDCGEMMVLEEAPTKCCKCGSNNIEQDNDVLDTWFSSALWPFSTLGWPNKTEDLEYFYPNNVLVTGHDIIFFWVARMIFSGLHCMGETPFNTVLIHGLIRDSQGRKMSKSLGNGVNPLDVINEYGADALRFMIATGNAPGNDMRYYPERVEASRNFANKIWNASRFVMMNLDKEIMNKYKDCKEYSLADKWILSKMNTLVKEVTENMDKYELGIAMQKVYDFMWTEFCDWYIELVKPVFYGEDEKAKGVAYNVLNTVLVTGLKLLHPAMPFITEEIFTHLTDEETITTSVWPVFDEALVSAESENDMAYIIEAIKGLRNVRAEMNVPPSRKAKVICYIAEDAKVAFTAGKAYMEKLASASEVEFIAD--KSIVP---ENAVSLVVKGGELFMPLLDLVDKEKELERLNKELKKLEGEIERIDKKLGNAGFVAKAPAAVVDGEKAKREKY 865
>gi|167751126|ref|ZP_02423253.1| hypothetical protein EUBSIR_02111 [Eubacterium siraeum DSM 15702] >gi|167655841|gb|EDR99970.1| hypothetical protein EUBSIR_02111 [Eubacterium siraeum DSM 15702] (882 aa)
Score = 1485, Expect = 2.8e-162, Identities = 329/853 (38%), Positives = 503/853 (58%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVG-FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSK----EIYVG--TKPPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTS----NQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNF-----KFKTKDSILL-------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKP--DYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           +L+K Y  K  E +      +K+     +   K  Y+I++PPPN+TG LH+GHAL+ T+QD LIR+  ++G SA W+ G DHA IAT+ K    ++E  ++  D  RD  +   +EW +  G  I  Q K +G   D++ E FTL++  ++ V +VF+ +YN GLIY  + ++NW    +++IS+IE   +E ++  ++I Y LS+    + +ATTRPET+  D  L VNP D+RYK+ + K    PLT++EI +IADEYVDI+FGTGV+K TPAHD ND+E+GK++ L II   N+D T  +   G +  +   +AR   V  LE   LL KVE     VG  +R    VEP  S QWFV + + ++  I++ KS  ++++ P +FE   + WM N+ DWCISRQLWWGH+IP +Y ++ +    EI +      PK      +D D LDTWFSS LWP +T    +     +  +PTN LVTG+DII FWV RM+F  L    + PFK   I GL+RDE   KMSKSLGNGVDP +VI+KYGADALRL L++ ++PG D+ + E KV +   F NKLWN+ RY+ MN  + +      P+NL   DKWIL+ +N          + Y   V+++ + DF WD +C+ YIEL+K R +       +   VL Y+++ IL L HP  PF+T  ++ +      K    +SI++       E+L F      +++    V+  I  IR+   E  +P +K + +++E     LF+ +      L  A    V +  ++       V  N  +F+   E +    ++   + +++KE +  + +I   +G LSN+ F+ KAP+++IE E+ K  K + K++++
  S:     4 ELAKTYSPKDFEDRLYHEWEEKKYFHAEIDPKKKPYTIVIPPPNITGQLHMGHALDNTLQDILIRYKRMQGYSALWLPGTDHASIATEAKIVNAMKEEGLTKDDVGRDGFLERAWEWKKVYGGRIVQQLKKLGSSCDWDRERFTLDEGCSKAVQKVFIDLYNKGLIYHGERIINWCPNCKTSISDIECEYEEQDSFFWHINYPLSDGSGSVEIATTRPETLLGDSALAVNPDDERYKSIVGKTVKLPLTDREIPVIADEYVDIEFGTGVVKITPAHDPNDFEVGKRHNLPIIHMMNDDATIMDGIGGKYAGMDRYEARKAMVADLEAQGLLVKVEPHKHKVGCCQRCGTTVEPRASYQWFVSMKQLAQPAIDVVKSG-ELRYIPQRFENGYLYWMENIRDWCISRQLWWGHRIPAYYCQNKECGHTEITLDGIDTCPKCGAPMKQDEDTLDTWFSSALWPFSTLGWPEKTADLEYFYPTNTLVTGYDIIPFWVARMIFSGLEHTGQKPFKDVLIHGLVRDELGRKMSKSLGNGVDPLEVIDKYGADALRLTLVTGNAPGNDMRWTETKVTNSRNFANKLWNASRYILMNLPE-DMQGAVLPENLPIEDKWILSLYNDLIKNVTSNLDSYELGVAVQNLFDFIWDVYCDWYIELTKPRIAEGGETARAAQNVLVYVMQGILKLLHPFMPFITEEIWQSMPIVADKDNNPESIMISAWPVYDEKLHFAA----EQTDFTKVVDAIRAIRVQRNELNVPPSKKVTMYIETAETALFEGAKAFFERLAGAGELTVSEKAETSDDMVTIVTANARVFMPMGELV----DKEKELARLEKERKAAQKDIDFLSGKLSNQGFLSKAPEQQIENERVKLAKAQEKMEKI 874
>gi|154499847|ref|ZP_02037885.1| hypothetical protein BACCAP_03504 [Bacteroides capillosus ATCC 29799] >gi|150271445|gb|EDM98702.1| hypothetical protein BACCAP_03504 [Bacteroides capillosus ATCC 29799] (896 aa)
Score = 1485, Expect = 2.9e-162, Identities = 322/822 (39%), Positives = 497/822 (60%)
  Q:    43 NKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENK-ISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKD-YLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYVR----DNDVLDTWFSSGLWPITT----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTS--NQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNF-----------------KFKTKDSILLER-------LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAK------INIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           +K  ++I++PPPNVTG LH+GHA++ T+QD LIRF  ++G +A W+ G DHAGIATQ K E+ LR+N+ ++  D  RD+ +  +++W    G+ I  Q K +G   D+    FT+++  +  V  VFV +Y  GLIY+   ++NW     +A+S+ EV  K+   NL++++Y +   +  Y++VATTRPET+  D  + VNP D RYK+ I K  I PL ++EI I+ADEYVD++FGTG +K TPAHD ND+E+G ++ L  I   +++G  N     +E +   +AR   V  LE   LLEKVE    NVG   R    VEP++S QWFVK+   +++ + +     +++F P +F K   NWM N++DWCISRQLWWGH+IP W  ++   I V  T P + E  + +    ++DVLDTWFSS LWP +T     +  +     +PT+VLVTG+DIIFFWV RM+F +     + PF   +I GL+RD+   KMSKSLGNG+DP ++ EKYGADALR  L++ +SPG D+ +  E+ ++   F NK+WN+ R++ MN      D+ + P+ LE  D+WIL+K N    E  +  +KY   V+ +KI DF WD +C+ YIEL+K R    ++E+K+    VL Y++ +IL L HP  PF+T  ++                      K+ D ++L++       LDF      +E ++E ++  I  IR    E  +P +K   + +  L+  +F++    +  L  A       +    QD K +         +   L   +L+    E   +E   KE++  ++E+ + +  L+N  F+ KAP   +E E+ +     +KL+EL
  S:    35 DKKPFTIVMPPPNVTGQLHMGHAMDSTLQDILIRFKRMEGYAALWVPGTDHAGIATQIKVEEELRKNEGLTRYDLGRDKFLERVWDWKHKYGDRIVQQQKKLGASCDWSRARFTMDEGLSNAVRHVFVSLYKKGLIYKGSRIINWCPHCVTALSDAEVEYKDKPGNLWHLKYPIKGEEGRYVIVATTRPETMMGDTGVAVNPNDDRYKDLIGKTCILPLMDREIPIVADEYVDMEFGTGCVKMTPAHDPNDFEVGLRHNLESIRVLDDEGKVNANGGKYEGMDRYEARKAVVADLEALGLLEKVEPHAHNVGTCYRCGTDVEPIISAQWFVKMGPLAEEALRVVNDG-EVKFVPDRFSKTYTNWMENVHDWCISRQLWWGHRIPAWTCEECGHITVSETDPTECEHCHSKHIKQEDDVLDTWFSSALWPFSTLGWPDENSEDYKYFYPTDVLVTGYDIIFFWVARMIFSACEHTGKPPFHTVFIHGLVRDDKGRKMSKSLGNGIDPLEIAEKYGADALRFNLVTGNSPGNDMRFYTERCEAMRNFANKIWNASRFLMMN---LTIDKCELPEKLEMEDRWILSKLNSLIPEMTENMDKYELGVAAQKIYDFIWDSYCDWYIELTKARLQGDDEEAKVNAQKVLCYVLTQILKLLHPFMPFITEEIWQALPHVEVSGGHFDGEQAKQPHKSGDYLMLQKWPEHSVALDFPD----EERAMEMIMDAIGAIRTRRSEMNVPPSKKAHVTVSTLHRDVFELGIPFLKRLGYASDVTITGVTDADQDTKGMVTVITHAARISIPL--AELVDMEKEKARME---KELKKNQAELDKLDTKLNNPGFVNKAPANVVEAERERA----VKLREL 885
>gi|153955828|ref|YP_001396593.1| valyl-tRNA synthetase [Clostridium kluyveri DSM 555] >gi|146348686|gb|EDK35222.1| ValS [Clostridium kluyveri DSM 555] (882 aa)
Score = 1482, Expect = 5.9e-162, Identities = 339/866 (39%), Positives = 518/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDF-KKISNLK-ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK---LFKISDEVINILNTA-KINIV--KQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++  Y+ K  E++ +++W  +     K     K SY+I++PPPN+TG LHLGHAL+ TIQD +IR   ++G +  W+ G DHA IAT+ K EK L ++ +  K+  R+  +   +EW+      IR Q K +G  +D+  E FT+++  N+ V + FVK+Y +G IY+   ++NW  K  +AIS+ E+   E + + ++I+Y + +S +YL +ATTRPET+F D  + VNP+D+RYK+ I K A+ P+ N+EI I++D+YVD++FGTG +K TPAHD NDY +GK++ L  I   NE+GT       ++ L   +AR   V+ LE+   L KV++ + NVG  +R    +EPM+S+QWFVK+   +K  ++    +KK++F P +FEK   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V  + P      N     +D DVLDTWFSS LWP +T    ++ + L   +P N LVTG+DIIFFWV RM+F  LY   ++PF++  I G++RD    KMSKSLGNGVDP +VI +YGADALR  L++ ++PG D+ Y  E+V+S   F NK+WN+ R+V MN  +   D+ K  +   D DKWIL++ N    E      K+   ++ +K+ DF W +FC+ YIEL K        K       VLN ++   L LFHP+ PF+T  +Y +     +   +    ++ +K  + K E  +E +++ I  IR    E  +P +K   + + +        FK  +E    L +A +I  +  K  +       V     +FI     LL   ++   IE++ KE E ++ EI R +  LSN+ F+ KAPK  ++ E+ K +K+   L+ + + L S K
  S:     1 MSEKKEMATTYNPKAFEERLYNIWQEKGYFTPK-ADHTKKSYTIVIPPPNITGKLHLGHALDDTIQDIIIRTKRMQGYNTLWVPGEDHASIATEVKVEKELLKDGVVKKEIGREAFLKRTWEWTDEYRARIREQIKKLGCSVDFTRERFTMDEGLNKAVRKFFVKLYEEGFIYQGNRIINWCPKCHTAISDAEIEYGEQQGHFWHIKYKVIDSDEYLEIATTRPETMFGDTAIAVNPEDERYKHLIGKTALLPILNREIPIVSDDYVDMEFGTGAVKITPAHDPNDYYVGKRHNLPEIIVLNENGTVKLPGTKYDGLDRYEARKLLVKDLEEQGFLVKVKEHVHNVGCHDRCETTIEPMLSKQWFVKMESLAKPAVD-VVKNKKVKFIPERFEKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVSDRDPSKCSKCNSSNIEQDKDVLDTWFSSALWPFSTLGWPENTEDLKCFYPNNTLVTGYDIIFFWVARMIFSGLYCMDDIPFENVLIHGIVRDSEGRKMSKSLGNGVDPIEVIGEYGADALRFALITGNAPGNDIRYYPERVESARNFANKIWNASRFVLMNLDENIMDKYKACREYSDADKWILSRLNTLAKEVTDNIEKFELGIAAQKMYDFIWGEFCDWYIELVKPVMYGGSEKEKGVAYNVLNNVLVTSLQLFHPIMPFITEEIYSHLYTDCESITVSSWPEYNEKFKDSKVEKDMEYIIEAIKAIRNVRAEMNVPFSKKAKLLIYITEKNALDTFKNGEEYFKKLASASEIEFLDDKSKVSENAVSAVTTGAELFI----PLLEIVDKDKEIERLSKEKEKLEKEIKRVDSKLSNEKFLSKAPKSVVDGEREKGDKYREMLETVIERLESLK 882
>gi|187933633|ref|YP_001886694.1| valyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] >gi|187721786|gb|ACD23007.1| valyl-tRNA synthetase [Clostridium botulinum B str. Eklund 17B] (880 aa)
Score = 1482, Expect = 6.1e-162, Identities = 331/854 (38%), Positives = 496/854 (58%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW-----VLNYLIKKILILFHPMCPFVTSNLYDNFK-FKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNN---KVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH 857
           MS  KN   ++  YD K  E +      +K      +   K  ++I++PPPN+TG LHLGHA + T+QD LIRF  ++G +A W+ G DHA IAT+ K    L +   + K+  R+  +  ++EWS +    IRNQ K +G   D+  E FT+++  +  V  VFVK+YN+GLIY+   + NW    Q+A+S+ E+  +E   + ++I Y L++    L +ATTRPET+  D  + VNP D+RYK+ I K  I PL N+EI I+ D+YVD++FGTG +K TPAHD ND+E+GK++ L II   ++ G  N     ++ L   +AR   V+ LE+  LL K++    NVG  +R    VEP++S+QW+VK+   +K  IE+ K+ K  +F P +F+K   NWM N+ DWCISRQLWWGH+IPV+Y KD  E+ V  + P            +DNDVLDTWFSS LWP +T    +  +  +  +P NVLVTG DIIFFWV RM+F  L+   E PF    I GLIRD    KMSKSLGNGV+P DVI +YGADALR  + + ++PG D+ Y  E+V++   F NK+WN+ R+V MN      ++ K  K     DKWIL+K N    E  +  +KY   ++++K+ DF W +FC+ YIEL K     ++ K       VLN ++   L L HP  PF+T  ++ +    +T  + +    D   +S   E+ +  +++ I  +R    E  +P +   KVI    E            +  + + +++  +    KS+ P   EN   + +   E    LL   ++   +E++ KE++ ++ EI R +  L N  F+ KAP   ++ EK+K+EK+
  S:     1 MSETKN---IATTYDPKEFEDRIYKTWEEKGYFTPVVDKKKKPFTIIMPPPNITGELHLGHAFDDTLQDMLIRFKRMQGYAALWLPGEDHASIATEVKVANELAKQGYNKKEMGREAFLEKVWEWSDDYRARIRNQVKKLGVSADFTREAFTMDENLSAAVKHVFVKLYNEGLIYQGNRITNWCTHCQTALSDAEIEYEEQAGHFWHINYPLADGSGVLEIATTRPETLLGDSGVAVNPNDERYKHLIGKTVILPLVNREIPIVGDDYVDLEFGTGAVKMTPAHDPNDFEVGKRHNLEIIRVMDDKGIINEKGGKYKGLDRYEARKAIVKDLEELGLLVKIKDHAHNVGTHDRCGTTVEPIISKQWYVKMEGLAKPAIEVVKNGKT-KFVPERFDKTYFNWMENIQDWCISRQLWWGHRIPVYYCKDCGEMMVLEEAPTKCCKCGSNNIEQDNDVLDTWFSSALWPFSTLGWPNKTEDLEYFYPNNVLVTGHDIIFFWVARMIFSGLHCMGETPFNTVLIHGLIRDSQGRKMSKSLGNGVNPLDVINEYGADALRFMIATGNAPGNDMRYYPERVEASRNFANKIWNASRFVMMNLDKEIMNKYKDCKEYSLADKWILSKMNTLVKEVTENMDKYELGIAMQKVYDFMWTEFCDWYIELVKPVFYGEDEKAKGVAYNVLNTVLVTGLKLLHPAMPFITEEIFTHLTDEETITTSVWPVFDEALVSAESENDMAYIIEAIKGLRNVRAEMNVPPSRKAKVICYIAEDAKVAFTAGKAYMEKLASASEVEFIAD--KSIVP---ENAVSLVVKGGELFMPLLDLVDKEKELERLNKELKKLEGEIERIDKKLGNAGFVAKAPAAVVDGEKAKREKY 865
>gi|169831629|ref|YP_001717611.1| valyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] >gi|169638473|gb|ACA59979.1| valyl-tRNA synthetase [Candidatus Desulforudis audaxviator MP104C] (881 aa)
Score = 1480, Expect = 1.0e-161, Identities = 313/860 (36%), Positives = 487/860 (56%)
  Q:    10 NNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKE-IYVGTK----PPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRT---SNQESKL--WVLNYLIKKILILFHPMCPFVTSNLYDNFKF--KTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVIN-ILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +N +   YD H++ E+++  W  +    +      +  YSI++PPPNVTG LH+GHALN T+QD L R+  ++G    W+ G DHAGIATQ + E  L +  ++  D  R++ +  ++EW  N G+ I  Q + +G   D+  E FT+++  +  V +VF+++Y +GLIYR   +VNW  +  + IS+IEV   EV  +LY+++Y L +    +++ATTRPET+  D  + V+P+D RY + + +  + PL  +EI IIAD YVD  FG+G +K TPAHD ND+E+G+++ L  +     DG     A  ++ L   D R + +  L+K  LL +VE     VG   R   +VEP +S QWFV++   ++  I+  +   +I+F P +F K  ++W+ N+ DWCISRQLWWGH+IPVWY  D  E +  GT     P    E   +D DVLDTWFSS LWP +T          D  +PT+VLVTG DIIFFWV RM+F  L      PF   +I GL+ D    KMSKSLGNGVDP +VIEKYGAD+LR  L++ ++PG DL +  EK++S   F NKLWN+ R+V +N  D+  D+   P  LE  D+WIL++F  A +        Y    + + + +F WD+FC+ YIEL K R    +++E  +  +VL  +++  L L HP  PF+T  L+ +     +T         +        E  +  +++    +R    E  +P +   +  L V +  +  + +     I N A ++++       +P+   +  +  +     L+G  +      ++ +E++ V+ + SR  G L N +F+EKAP E +E E+ K+ +   K + L   L+
  S:     3 HNSIPSVYDPHQVEERRYRYWE-EHGFFRPLPGTGREPYSIVMPPPNVTGELHMGHALNNTLQDVLTRWRRMQGFETLWLPGTDHAGIATQARVEGQLAQEGLTKYDLGREKFLERVWEWKANYGHRITTQLRRLGASCDWSRERFTMDEGCSAAVREVFLRLYEEGLIYRDYYIVNWCPRCSTTISDIEVEHLEVPAHLYHLKYPLKDGAGAVVIATTRPETMLGDTAVAVHPEDDRYLHLVGETVLLPLVEREIPIIADPYVDPAFGSGALKITPAHDPNDFEIGRRHGLPQVQVIGTDGRMTAEAGRYQGLDRMDCRQQVLADLKKRGLLVRVEDLDHAVGHCYRCQTMVEPTLSRQWFVRMKPLAEPAIKAVREG-RIRFVPERFTKIYLDWLENIRDWCISRQLWWGHRIPVWYCDDCGETVASGTDLSACPACGRENIEQDPDVLDTWFSSALWPFSTLGWPGKTADLDRFYPTSVLVTGRDIIFFWVARMIFSGLKFMDREPFAEVFIHGLVLDALGRKMSKSLGNGVDPIEVIEKYGADSLRFMLVTGNTPGNDLRFHFEKLESSRNFANKLWNASRFVLLNLGDYRPDK-AAPGTLELADRWILSRFGAALARTTAGLEAYELGEAARALYEFIWDEFCDWYIELVKPRLYQGTDEERAVAQYVLVRVLRSTLELLHPFMPFITEELWQHLPHEGETIMRTAWPTAEHGLADPDAERDMAFIVEATRAVRHLRSEMNVPPSARAEAVLVVPDESVRAVVERWRGYIENLANVHVLVTGALETRPETAAHAVVRGMEVFVPLVGLIDIDREARRLARELQQVEKDFSRVEGKLGNPAFLEKAPPEVVEKERGKRAELAEKREALAARLA 876
>gi|110802251|ref|YP_699196.1| valyl-tRNA synthetase [Clostridium perfringens SM101] >gi|110682752|gb|ABG86122.1| valyl-tRNA synthetase [Clostridium perfringens SM101] (880 aa)
Score = 1480, Expect = 1.1e-161, Identities = 332/859 (38%), Positives = 507/859 (59%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLK--ESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKED-----LLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +N ++S  Y+ K  E++ +S W  +K      +  +K  Y+I++PPPN+TG LHLGHAL+ T+QD LIRF  ++G    W+ G DHA IAT+ K E  L +  +  K+  R+  +  ++EW+      IR Q K MG   D+  E FT+++  ++ V  VFVK+Y +GLIY+   + NW  K Q+A+S+ E+  +E E N ++I+Y +  S ++L +ATTRPET+  D  + VNP D+RY + + K    PLT++EI +IAD+YVD++FGTG +K TPAHD ND+E+GK++ L  I   ++ G  N+    ++ L   +AR + V  LE+  LL K++    NVG  +R   VVEP++S+QW+VK+   +   IE+ + +K  +F P +FEK   NWM N+ DWCISRQLWWGH+IPV+Y KD  EI V  + P        E   +D DVLDTWFSS LWP +T    D     +  +PT+ LVTG+DIIFFWV RM+F  ++   E PF    I G+IRD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y+ E+V++   F NK+WN+ R+V MN      D+ K  K     DKWIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K      ++++K  V N L   +   L L HP+ PF+T  +Y +   +T+   +     + +  N +  E  +  +++ I  +R    E  +P ++      +V+        D  IN     +      ++  L      +N L+ ++ K       LL   +    +E++ KE   ++ EI R +  LSN+ F+ KAP+  +  E++K    KE  E  L+ +E L
  S:     2 DNKNISTTYNPKEFEERLYSNWQEKKYFTPV-IDKSKKPYTIIMPPPNITGKLHLGHALDNTLQDMLIRFKRMQGYCTLWLPGQDHASIATEVKVENELLKEGLYKKEMGREAFLEKVWEWTDEYRERIREQLKKMGCSADFTREAFTMDENLSKAVRHVFVKLYKEGLIYQGNRITNWCPKCQTALSDAEIEYEEKEGNFWHIKYPVVGSDEFLEIATTRPETLLGDSAVAVNPSDERYAHLVGKMLKLPLTDREIPVIADDYVDVEFGTGAVKITPAHDPNDFEVGKRHNLPQIRVMDDSGVINHLGGKYKGLDRYEARKQMVADLEELGLLVKIKPHTHNVGTHDRCGTVVEPIISKQWYVKMQSLADPAIEVVR-NKGTKFVPERFEKTYFNWMENIQDWCISRQLWWGHRIPVFYCKDCGEIMVELEDPTKCCKCGSENIEQDKDVLDTWFSSALWPFSTLGWPDRTDDLEFFYPTSTLVTGYDIIFFWVARMIFSGIHNMGETPFDTVLIHGIIRDAQGRKMSKSLGNGVDPLEVIDEYGADALRFMLVTGNAPGNDIRYIPERVEAARNFANKIWNASRFVMMNLDRELMDKYKDCKEYSLADKWILSRMNSLIKEVTENMEKYELGIALQKVHDFLWTEFCDYYIELVKPVLYGDDEKAKGVVFNVLYTVLNTGLKLLHPVMPFITEEIYTHLSTETESITIATWPTYDEALNNEKAEKDMTFIMEAIRSLRNLRAEMNVPPSR----KAKVMAYASEDAKDAFINGGAYLEKLASASEVTFLDNKNNLDNNLVSVVVKGGELFLPLLDLVDREKELERLNKEKTKLEGEILRVDKKLSNERFVSKAPEAVVNEERAKGVKYKEMLEAVLERIEAL 879
>gi|118580003|ref|YP_901253.1| valyl-tRNA synthetase [Pelobacter propionicus DSM 2379] >gi|118502713|gb|ABK99195.1| valyl-tRNA synthetase [Pelobacter propionicus DSM 2379] (886 aa)
Score = 1473, Expect = 6.1e-161, Identities = 316/857 (36%), Positives = 496/857 (57%)
  Q:    12 DLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY-YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK-NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKE-----SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVIN-ILNTAKINIVKQDIKSLKPD----YVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +L+K Y+ H + ++ ++ W  +   +      NK  YSI++PPPNVTG LH+GHALN T+QD L R+  ++G +  W+ G DHAGIATQ   E+ L    +   D  RD  +  +++W    G  I  Q K +G   D+E E FT++   ++ V  VFVK++ DGLIYR   L+NW  +  +A+S+IEV  +E + + ++IRY  +     +++VATTRPET+  D  + V+P+D+RY + + K  + PL N+EI ++AD+YVD +FGTGV+K TPAHDFND+E+G ++ L+ I+ F+E G  N     +E +    AR + V  LE+  LL+++E    +VG   R   VVEP +S QW+VKV   +++ ++  K  K  +  P ++E    +WM N+ DWCISRQ+WWGH+IP W+      + V  + P       ++E++ ++ DVLDTWFSS LWP +T    D     +  +PT+ LVTGFDI+FFWV RMM   L+   +VPF   YI  L+RD H  KMSKS GN +DP  +I++YG DA R  L + ++ G D+   EE++     F NK+WN+ R+  MN   F+ D     + +L   DKWIL++ N+      +    Y +  S   +  FTW +FC+ Y+ELSK    N     +++  +VL Y +  +L L HP  PF+T  ++      +K S  + +  F   ++ +      +++E V+++I  IR    E  +P +K I   L   N    ++  +  + I+N A+I+ +       KP+     V  +  IF+     L G  N     +++ KEI  ++ EI   +  L N SF+++AP E +  E+ K  +   K + LE+ L
  S:     4 ELAKGYEPHDVEKKWYAEWEEKHYFHADATSDNK-PYSIVIPPPNVTGALHMGHALNNTMQDILCRWKRMQGHNVLWMPGTDHAGIATQNVVERQLAAEGMDRHDLGRDAFIQRVWKWKAESGGQIIGQLKRLGASCDWERERFTMDAGLSKAVRTVFVKLHQDGLIYRDNRLINWCPRCHTALSDIEVEHEEQKGHFWHIRYPVVGEPGRFVIVATTRPETMLGDTAVAVHPEDERYSDLVGKKVLLPLVNREIPVVADDYVDREFGTGVVKITPAHDFNDFEVGLRHGLDKINVFDESGVINAAGHQYEGMDRFAARERIVADLEQAGLLDRIEDHAMSVGGCYRCKTVVEPYLSLQWYVKVGPLAERALQAVKEGKT-RILPKQWENTYYDWMENIRDWCISRQIWWGHRIPAWFCDHCGGVTVAMEDPTSCSACGSDEIH-QETDVLDTWFSSALWPFSTMGWPDKTPELERFYPTSCLVTGFDILFFWVARMMMMGLHFMDQVPFTDVYIHALVRDAHGQKMSKSKGNVIDPLTIIDQYGTDAFRFTLAAFAAQGRDIKLAEERIAGYRNFCNKVWNAARFTLMNLDGFDPDGITLGELSLSAGDKWILHRLNETARLVDESLTGYRYNESASALYQFTWSEFCDWYLELSKQDLYNGTPERKKTSQYVLWYTLDHLLRLLHPFMPFITEEIWQALP-GSKASPTIMQAPFPMPADERSFAQEAAAMERVMEVIGSIRNIRGEMDVPPSKQIATILSCANAASLELMQQSQSAIVNLARISDLTIGQGLEKPEDASIQVAGDVQIFV----PLKGLVNVEEEEKRLSKEIAKIEKEIDMFSKKLQNPSFVDRAPAEVVAKEREKLAEVTGKKRVLEESL 879
>gi|182416784|ref|ZP_02948179.1| valyl-tRNA synthetase [Clostridium butyricum 5521] >gi|182379364|gb|EDT76861.1| valyl-tRNA synthetase [Clostridium butyricum 5521] (880 aa)
Score = 1473, Expect = 6.5e-161, Identities = 325/854 (38%), Positives = 492/854 (57%)
  Q:     4 MSNIKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW-----VLNYLIKKILILFHPMCPFVTSNLYDNF-KFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNN---KVIDIHLEVLNPKLFKISDEVINILNTAKINIV--KQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH 857
           MS IKN   +S  YD K  E +      +K+     +  +K  ++I++PPPN+TG LHLGHA + T+QD LIRF  ++G    W+ G DHA IAT+ K    L +     K+  R+  +  ++EWS      IRNQ K +G   D+  E FT+++  +  V  VFVK+YN+ LIY+   + NW    Q+A+S+ E+  +E   + ++I Y L++   YL +ATTRPET+  D  + VNP D+RYK+ I K  I PL N+EI I+ D+YVD++FGTG +K TPAHD ND+E+GK++ L II   ++ G  N     ++ L   +AR   V+ LE+  LL K++    NVG  +R    VEP++S+QW+VK+ + +K  +E+ K+ +  +F P +F+K   NWM N+ DWCISRQLWWGH+IPV+Y +D  E+ V    P            +DNDVLDTWFSS LWP +T    +  +  D  +P +VLVTG DIIFFWV RM+F  L+   E PF    I GLIRD    KMSKSLGNGVDP +VI++YGADALR  + + ++PG D+ Y  E+V+S   F NK+WN+ R+V MN      ++ K  K     DKWIL++ N    E  +   KY   +++ K+ DF W +FC+ YIEL K     ++ K       VLN ++   L L HP  PF+T  +Y +  + +T  +      D   ++   E ++  V++ I  +R    E  +P +   KVI    E         +  +  + + +++  +  K  + +     V     +F+     LL   ++   ++++ KE++ ++ EI R +  L N+ F+ KAP+  +  EK K+ K+
  S:     1 MSEIKN---ISTTYDPKEFEDRIYKTWEEKKYFTPEVDKSKKPFTIVMPPPNITGQLHLGHAFDDTLQDILIRFKRMQGYCTLWLPGEDHASIATEVKVANMLSDQGYDKKEMGREAFLEKVWEWSDKYRATIRNQVKKLGVSADFTREAFTMDENLSAAVKHVFVKLYNEDLIYQGNRITNWCTHCQTALSDAEIEYEEQAGHFWHINYPLADGSGYLEIATTRPETLLGDSGVAVNPNDERYKHLIGKTVILPLVNREIPIVGDDYVDLEFGTGAVKMTPAHDPNDFEVGKRHNLEIIRVMDDKGIINEKGGKYKGLDRYEARKAIVKDLEEAGLLVKIKDHAHNVGTHDRCGTTVEPIISKQWYVKMDQLAKPAVEVVKNGET-KFVPERFDKTYFNWMENIQDWCISRQLWWGHRIPVYYCQDCGEMMVLEDAPSKCTKCGSTNVEQDNDVLDTWFSSALWPFSTLGWPNKTEDLDYFYPNSVLVTGHDIIFFWVARMIFSGLHCMGETPFHTVLIHGLIRDSQGRKMSKSLGNGVDPLEVIDQYGADALRFMIATGNAPGNDMRYYPERVESSRNFANKIWNASRFVMMNLDKEIMNKYKDCKEYSLADKWILSEMNTLVKEVTENMEKYELGIAMSKVYDFMWTEFCDWYIELIKPVFYGEDEKAKGVAYNVLNTVLVTGLKLLHPAMPFITEEIYTHLTEEETIVNAAWPEFDEALVNKEAEDNMAYVIEAIKGLRNVRAEMNVPPSRKAKVIAYIAEDAKEAFTNGAAYMEKLASASEVEFITDKSSVPANAVSLVVKGGELFM----PLLDLVDKEKELDRLNKEVKKLEGEIERIDKKLGNQGFVAKAPESVVNAEKEKRVKY 865
>gi|187776915|ref|ZP_02993388.1| hypothetical protein CLOSPO_00454 [Clostridium sporogenes ATCC 15579] >gi|187775574|gb|EDU39376.1| hypothetical protein CLOSPO_00454 [Clostridium sporogenes ATCC 15579] (881 aa)
Score = 1473, Expect = 6.6e-161, Identities = 348/866 (40%), Positives = 513/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPD--YVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K YD K  E++      +K      +  NK  Y+I+LPPPN+TG LHLGHAL+ T+QD L+R   ++G S  W+ G DHA IAT+ K E  L +  I  K+  R+  +  ++EW+      IRNQ K +G  LD+  E FT++++ ++ V   FVK+YN+GLIY+   + NW  K ++A+S+ E+   E E + ++++Y +  S +YL +ATTRPET+  D  + VNPKD+RY + + K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDY++GK++ L  I+   +DG  N     +  +   +AR   VE L+    L K+++   NV   +R N V+EP++S+QWFVK+   +K  IE+ K  K     P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V TK P      N E   +DNDVLDTWFSS LWP +T    D        +P N LVTG+DIIFFWV RM+F  LY   ++PF    I G++RD    KMSKSLGNGVDP +VIE+YGADALR  L++ ++PG D+ Y  E+V++   F NK+WN+ R+V MN      D+ K  KN    DKWIL++ N    E  +   K+   ++ +KI DF W +FC+ YIEL K      N+E+K     VL+ +++  L L HP+ PF+T  +Y +  +   +SI++ +    K S   E S +D   +++ I  IR    E  +P ++   + + +   K    FK  +     L +A      +D ++   +   V     IFI     LL   +    +E++ KE E ++ EI R    LSN+ F+ KAP+  +  EK K EK++  LK + + L S K
  S:     1 MSETREMAKTYDPKEFEERLYKNWEEKSYFTPEVDENKTPYTIVLPPPNITGKLHLGHALDDTLQDILMRTKRMQGFSTLWLPGQDHASIATEVKVENELLKEGIVKKEIGREAFLEKVWEWTDEYRGKIRNQIKKLGCSLDFTRERFTMDEQLDKAVKHFFVKLYNEGLIYQGNRITNWCPKCKTALSDAEIEYSEHEGHFWHVKYPVVGSDEYLEIATTRPETMLGDTAVAVNPKDERYAHLVGKTLMLPLVNREIPIVADDYVDMEFGTGAVKITPAHDPNDYQVGKRHNLPQINVMFDDGRINYEETRYHGMDRYEARKAIVEDLKNEGFLVKIKEHNHNVSCHDRCNTVIEPIISKQWFVKMEPLAKPAIEVVKEKKVKF-VPERFDKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVVTKEPTKCPKCNSEKLEQDNDVLDTWFSSALWPFSTLGWPDKTPDLKYFYPNNTLVTGYDIIFFWVARMVFSGLYCMDDIPFDTVLIHGIVRDSEGKKMSKSLGNGVDPIEVIEEYGADALRFTLVTGNAPGNDIRYYPERVEAARNFANKIWNASRFVLMNLDKDLMDKYKDNKNYTIADKWILSRLNTVVKEVTENIEKFELGIASQKIYDFIWGEFCDWYIELVKPVLYGENEEAKGIAFNVLHKVLETSLQLLHPIMPFITEEIYTHL-YTEYESIVISKWPQYKESLKDEKSEKDMEYIIEAIKSIRNVRTEMNVPPSRKAKLMIYLTENKAEGSFKEGEVYFQKLASASEVSFLEDKETSDKNVSVVTRGAEIFI----PLLELVDIEKELERLNKEKEKLEKEIDRVEKKLSNEKFVSKAPEAVVNEEKEKGEKYKAMLKSVLESLESLK 881
>gi|150016655|ref|YP_001308909.1| valyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] >gi|149903120|gb|ABR33953.1| valyl-tRNA synthetase [Clostridium beijerinckii NCIMB 8052] (881 aa)
Score = 1472, Expect = 9.6e-161, Identities = 325/846 (38%), Positives = 482/846 (56%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW-----VLNYLIKKILILFHPMCPFVTSNLYDNFK-FKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH 857
           ++S  YD K  E +      +K      +  NK  Y+I++PPPN+TG LHLGHA + T+QD LIRF  ++G    W+ G DHA IAT+ K    L E     K+  R+  +  ++EWS      IRNQ K +G   D+  E FT+++  +  V  VFVK+YN+GLIY+   + NW    Q+A+S+ E+  +E   + ++I Y L++    + +ATTRPET+  D  + VNP D+RYK+ I K  I PL N+EI I+ DEYVD++FGTG +K TPAHD ND+E+GK++ L II   ++ G  N     ++ L   +AR   V+ LE+  LL K++    NVG  +R    VEP++S+QW+VK+   +K  +E+ K+ K  +F P +F+K   NWM N+ DWCISRQLWWGH+IPV+Y +D  E+ V    PK           +DNDVLDTWFSS LWP +T    +  +  +  +PT+ LVTG DIIFFWV RM+F  L+   E PF    I GLIRD    KMSKSLGNGVDP +VIE YGADALR  + + ++PG D+ Y  E+V+S   F NK+WN+ R+V MN      ++ K  K     DKWIL++ N    E  +   KY   ++++K+ DF W +FC+ YIEL K     ++ K       VLN ++   L L HP  PF+T  ++ +    +T  +      D   ++   E  +  V++ I  +R    E  +P ++   +   +        +  V  I   A  + V  +  S K +   N   + +   E    LL   ++   ++++ KE + ++ EI R +  L N+ F+ KAP   ++ EK K+ K+
  S:     7 NISTTYDPKEFEDRIYKNWEEKGYFTPVIDKNKKPYTIIMPPPNITGQLHLGHAFDDTLQDMLIRFKRMQGYCTLWLPGEDHASIATEVKVANQLAEQGYDKKEMGREAFLEKVWEWSDKYRATIRNQVKKLGVSADFTREAFTMDENLSAAVKHVFVKLYNEGLIYQGNRITNWCTHCQTALSDAEIEYEEQAGHFWHINYPLADGSGVIEIATTRPETLLGDSGVAVNPNDERYKHLIGKTVILPLVNREIPIVGDEYVDLEFGTGAVKMTPAHDPNDFEVGKRHNLEIIRVMDDKGIINEKGGKYKGLDRYEARKAIVKDLEEAGLLVKIKDHAHNVGTHDRCGTTVEPIISKQWYVKMESLAKPAVEVVKNGKT-KFVPERFDKIYFNWMENIQDWCISRQLWWGHRIPVYYCQDCGEMMVLEDAPKACTKCGSSNIKQDNDVLDTWFSSALWPFSTLGWPNKTEDLEYFYPTSTLVTGHDIIFFWVARMIFSGLHCMGETPFNTVLIHGLIRDSQGRKMSKSLGNGVDPLEVIETYGADALRFMIATGNAPGNDMRYYPERVESSRNFANKIWNASRFVMMNLDKEVMNKYKDCKEYSLADKWILSEMNTLIKEVTENMEKYELGIAMQKVYDFMWTEFCDWYIELVKPVFYGEDEKAKGIVYNVLNTVLITGLKLLHPAMPFITEEIFTHLSDEETITTSAWPEFDEALVNKEAEDDMAFVIEAIKGLRNVRAEMNVPPSRKAKVICYIAEDAKKAFNSGVAYIEKLASASEV--EFISDKANVPANAVSLVVKGGELFMPLLDLVDKDKELDRLNKEAKKLEGEIDRIDKKLGNQGFVAKAPAAVVDAEKEKRVKY 866
>gi|125972845|ref|YP_001036755.1| valyl-tRNA synthetase [Clostridium thermocellum ATCC 27405] >gi|125713070|gb|ABN51562.1| valyl-tRNA synthetase [Clostridium thermocellum ATCC 27405] (884 aa)
Score = 1471, Expect = 9.9e-161, Identities = 321/836 (38%), Positives = 499/836 (59%)
  Q:     9 NNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKT-PKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR--TSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL--KESSIEDVLQIINKIRIFNFENKIPNN---KVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVE---NNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPK 844
           +  +++K YD K  E +      +K      +   K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  ++G    W+ G DHA IAT+ K  + + +  I+ +D  R++ +   +EW ++ G  I  Q K +G   D++ E FT+++  +  V +VFV++Y  GLI+R + ++NW  K  ++IS+ EV  +E   + ++I+Y + +S ++++VATTRPET+  D  + V+P+D+RYK+ I K  + PL N+EI +IADEYV+  FGTGV+K TPAHD ND+ELG ++ L  I   N+D T N  A  ++ +   +AR + V+ LE+  LL KVE    NVG   R   V+EP++S+QWFVK+   ++  IE+ K+   I+F P +F K   NWM N+ DWCISRQLWWGH+IP +Y ++   + V  + P            +D D LDTWFSS LWP +T    D  +     +PT+VLVTG+DIIFFWV RM+F +L    + PFK+ +I G++RD    KMSKSLGNG+DP ++I+KYG DALR  L   +SPG DL + EEK +S   F NK+WN+ R+V MN  D N D  K  P      DKWIL++ N    E  +   K+   ++++KI +F W++FC+ YIEL K R    + E++L   +VLNY++   + L HP  PF+T  +Y +     +  ++ +   +++  N   +E  +  ++  I  IR    E  +P++   K I +        + K        L +    +++ D   +  + V        IF L  EDL+    E   IE+++KE+  ++ E+ R N  L+N+ F+ KAP+
  S:     2 SEKNIAKTYDPKQVEDRLYAEWMEKGYFHAEIDKEKTPFTIVIPPPNITGQLHMGHALDETLQDILIRWKRMQGYCTLWLPGTDHASIATEAKIVEAMAKEGITKEDIGREKFLERAWEWKRHYGGRIVEQLKKLGCSCDWQRERFTMDEGLSRAVIEVFVRLYKKGLIHRGERIINWCPKCNTSISDAEVEYEEKAGHFWHIKYPVKDSDEFVVVATTRPETMLGDTAVAVHPEDERYKHLIGKTVVLPLMNREIPVIADEYVEKDFGTGVVKITPAHDPNDFELGLRHNLPQIRVMNDDATMNELAGKYQGMDRYEARKQIVKDLEELGLLLKVEDHTHNVGTCYRCATVIEPLISKQWFVKMKPLAEPAIEVVKNG-TIKFVPERFSKIYFNWMENIQDWCISRQLWWGHRIPAYYCQECGYMMVENEMPDVCPKCGSSRIEQDPDTLDTWFSSALWPFSTLGWPDETEDLKYFYPTDVLVTGYDIIFFWVARMIFSALEHTGKEPFKYVFIHGIVRDALGRKMSKSLGNGIDPLEIIDKYGTDALRFALTIGTSPGNDLRFSEEKAESSRNFANKIWNASRFVLMNFDD-NLDFSKVDPNKFTTSDKWILSRVNNLTREVTENMEKFELGIALQKIYEFIWEEFCDWYIELVKPRLYDKDDETRLEAQYVLNYVLGTAMKLLHPYMPFITEEIYRHLVVDDESIMISKWPVYREDYNFPEEEKKMSLIMDAIKSIRNIRAEMNVPHSRKAKAIFVAPGGSEQDILKEGTVFFERLASCSEVVIQPDKSGIPSNAVAAILAGVEIF-LPLEDLIDIEKE---IERLEKELSNLQKELDRVNSKLANEGFVSKAPQ 853
>gi|118727338|ref|ZP_01575942.1| valyl-tRNA synthetase [Clostridium cellulolyticum H10] >gi|118663283|gb|EAV69940.1| valyl-tRNA synthetase [Clostridium cellulolyticum H10] (883 aa)
Score = 1471, Expect = 1.1e-160, Identities = 329/866 (37%), Positives = 515/866 (59%)
  Q:     7 IKNNNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYV-GTKPPK----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKT-PKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL--KESSIEDVLQIINKIRIFNFENKIPNN---KVIDIHLEVLNPKLFKISDEVINILNTAK---INIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K+YD  ++ ++ +  W  +   +    K NK  ++I++PPPN+TG LH+GHAL+ T+QD LIR   ++G SA W+ G DHA IAT+ K    + +  IS     R++ +   +EW +  G  I  Q K +G   D+E E FT+++  +  V +VF+K+Y+ GLIY+ + + NW  K  ++IS+IEV  +E   N ++I+Y + +S +++++ATTRPET+  D  + VNP+D+RY + + K  I PL NKEI +IAD YVD +FGTG +K TPAHD NDYE+G ++ L  I   +++   N+ A  ++ +   +AR K VE LEK  LL K+E    NVG  +R   VVEP++S+QW+V++   ++  I++ ++   I+F P +F K   NWM N+ DWCISRQLWWGH+IP +Y ++   + V GT P            +D D LDTWFSS LWP +T    +  +  +  +PT+VLVTG+DIIFFWV RM+F  +   K+ PFK+ +I G++RD    KMSKSLGNG+DP +VI +YG DALR  L   +SPG DL +  EKV+S   F NK+WN+ R+V MN  D N D  K   K     DKWI+++ N    E  +   K+   + ++K+ DF W++FC+ YIE+ K +  ++ES+      +VLN++++  + L HP  PFVT  +Y +     +  ++ +  ++ +  N    E+ +  ++  I  IR    E  +P +   K+I +                   L +A    + + K  I S     V +   IFI   ++L+    E   +EK KK +E    E+ R  G LSN+ F+ KAP++ I+ EK+K+ K++    ++ + L S K
  S:     1 MDEQQNIAKQYDPGQVEDRLYKKWMDEGYFHAVPDK-NKKPFTIVIPPPNITGQLHMGHALDNTLQDILIRTKRMQGYSALWLPGTDHASIATEAKIVDAMAKEGISKDMLGREKFLEKAWEWKKVYGGRIVEQLKKLGSSCDWERERFTMDEGLSRAVQEVFLKLYDKGLIYKGERITNWCPKCNTSISDIEVEYEEQAGNFWHIKYPVKDSDEFVIIATTRPETLLGDTAVAVNPEDERYTHLVGKTLILPLVNKEIPVIADSYVDKEFGTGCVKITPAHDPNDYEVGLRHNLPQIRIMDDNAIMNDNAGQYKGMDRYEARKKMVEDLEKLGLLVKIEPHSHNVGTCQRCRTVVEPLISKQWYVRMKPLAEPAIDVVRNG-TIKFVPERFSKIYFNWMENIQDWCISRQLWWGHRIPAYYCQECGHMMVQGTAPDTCSKCGSNRIEQDPDTLDTWFSSALWPFSTLGWPEKTEDLEYFYPTDVLVTGYDIIFFWVARMIFSGVEHMKQEPFKYVFIHGIVRDSQGRKMSKSLGNGIDPLEVIAQYGTDALRFALTIGNSPGNDLRFSPEKVESARNFANKVWNASRFVLMN-FDENLDFSKVDKKKFSIADKWIMSRINTVTKEVSENIEKFELGLGLQKVYDFIWEEFCDWYIEMVKPKLYDRESEGRLEAQYVLNFVLRNAMKLLHPYMPFVTEEIYTHLINDGRSIMISQWPEYSEELNFAEDEAKMTIIMDAIRSIRNTRAEMNVPPSRKAKIIFVAAGEEEKATLAEGTSFFQRLASASDVTVQLNKDGILSDAVGGVVHGAEIFI-PLDELIDIEKEIERLEKEKKNLE---GELKRVKGKLSNEGFVAKAPQKVIDEEKAKQAKYQDMYDKVAERLESLK 882
>gi|168183482|ref|ZP_02618146.1| valyl-tRNA synthetase [Clostridium botulinum Bf] >gi|182673388|gb|EDT85349.1| valyl-tRNA synthetase [Clostridium botulinum Bf] (881 aa)
Score = 1471, Expect = 1.1e-160, Identities = 345/866 (39%), Positives = 514/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL---FKISDEVINILNTAKINIVKQDIKSLKPD--YVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K YD K  E++      +K      +  NK  Y+I+LPPPN+TG LHLGHAL+ T+QD L+R   ++G S  W+ G DHA IAT+ K E  L +  I  K+  R+  +  ++EW+    N IRNQ K +G  LD+  E FT++++ ++ V   FVK+YN+GLIY+   + NW  K ++A+S+ E+   E E + ++++Y +  S +YL +ATTRPET+  D  + VNPKD+RY + + K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDY++GK++ L  I+   +DG  N     +  +   +AR   VE L+    L K+++   NV   +R N V+EP++S+QWFVK+ E +K  IE+ K+ K     P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V T+ P      N E   +DNDVLDTWFSS LWP +T    D        +P N LVTG+DIIFFWV RM+F  LY   ++PF    I G++RD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y  E+V++   F NK+WN+ R+V MN      D+ K  KN    DKWIL++ N    E  +   K+   ++ +KI DF W +FC+ YIEL K      N+E+K     VL+ +++  L L HP+ PF+T  +Y +  +   +SI++ +    D        E  +E +++ I  IR    E  +P ++   + + +   +    FK  +     L +A      +D ++   +   V     IFI     LL   +    +E++ KE E ++ EI R    LSN+ F+ KAP+  +  EK K EK++  LK + + L S K
  S:     1 MSETREMAKTYDPKEFEERLYKNWKEKSYFTPEVDENKKPYTIVLPPPNITGKLHLGHALDDTLQDILMRTKRMQGYSTLWLPGQDHASIATEVKVENELLKEGIVKKEIGREAFLEKVWEWTDEYRNKIRNQIKKLGCSLDFTRERFTMDEQLDKAVKHFFVKLYNEGLIYQGNRITNWCPKCKTALSDAEIEYSEHEGHFWHVKYPVVGSDEYLEIATTRPETMLGDTAVAVNPKDERYAHLVGKTLMLPLVNREIPIVADDYVDMEFGTGAVKITPAHDPNDYQVGKRHNLPEINVMFDDGRINYKETRYHEMDRYEARKAIVEDLKNEGFLVKIKEHNHNVSCHDRCNTVIEPIISKQWFVKMEELAKPAIEVVKNKKVKF-VPERFDKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVVTEEPTKCPKCNSEKLQQDNDVLDTWFSSALWPFSTLGWPDKTPDLKYFYPNNTLVTGYDIIFFWVARMVFAGLYCMDDIPFDTVLIHGIVRDSEGKKMSKSLGNGVDPIEVIDEYGADALRFTLVTGNAPGNDIRYYPERVEAARNFANKIWNASRFVLMNLDKDLMDKYKDNKNYTIADKWILSRLNTVVKEVTENIEKFELGIASQKIYDFIWGEFCDWYIELVKPVLYGENEEAKGIAFNVLHKVLETSLQLLHPIMPFITEEIYTHL-YTEYESIVISKWPEYDETLKDEKSEKDMEYIIEAIKSIRNVRTEMNVPPSRKAKLMIYLTENEAEGSFKEGEVYFQKLASASEVSFLEDKETSDKNVSVVTRGAEIFI----PLLELVDIEKELERLNKEKEKLEKEIDRVEKKLSNEKFVSKAPEAVVNEEKEKGEKYKAMLKSVLESLESLK 881
>gi|150383932|ref|ZP_01922643.1| valyl-tRNA synthetase [Victivallis vadensis ATCC BAA-548] >gi|150259690|gb|EDM96921.1| valyl-tRNA synthetase [Victivallis vadensis ATCC BAA-548] (886 aa)
Score = 1469, Expect = 2.0e-160, Identities = 322/830 (38%), Positives = 479/830 (57%)
  Q:    43 NKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDK-SRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN---SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTK-DSILLE---RLDFKKISNLKE-SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK----LFKISDEVINILNTAKINIVKQDIKSLK----PDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +K  YSI++PPPNVTG L LGH LN T+QD L R++ +KG    W  G DHAGIAT+ + EKYLR+ + + +D+  R+E +  +++W    G  I  Q + +G   D+E E FT+++  +E V +VFV++YN G IYR + ++NW    +SA+S+ EVI K+V  + ++ RY L++   YL+VATTRPET+F D  + VNP D+RYK+ I +    PLT++EI II DE+ D   GTG +K TPAHD ND+E+GK++ L +I+  N D + N      FE L   +AR  CV+ +E+  LLEKVE+    VG+SER +  +E ++S QWF  + E +K  IE  KS  +I+F+P ++ K   +WM N+ DWCISRQ+WWGH+IP WY  ++ E+YVG + P     + ++ DVLDTWFSS LWP +     K    L   +PT  LVTG DIIFFWV RM+       KE+PF++ Y T +IRDE   K+SKSLGN  DP DVI  YGADALR  ++  +  G D+ Y  EK +    F NKLWN+ R+ +M    S +F         NL   ++W+L + +           ++ F  +  ++ +  W  FC+ +IE  K       + +E  L VL+Y + +IL L HP  PF+T  L     F  + DSI+ E     D    ++  E   I+   +++   R       +P+ + +  H++ ++      L +    + ++LN   I     +    K    P  +     ++ L   DL+    E   +EK KK++E     I+     LSN+ F+ KAP + +   K K  + E KL     LL+S K
  S:    37 DKKPYSIVIPPPNVTGILTLGHVLNNTLQDILCRYHRMKGEEVCWFPGTDHAGIATEARVEKYLRKEENTGRDELGREEFIRRVWQWKGEFGGKIIRQLRTLGCSCDWERERFTMDEGLSEAVKKVFVELYNKGYIYRGQRMINWCPVAKSALSDEEVIYKDVAGHFWHFRYPLADGSGYLVVATTRPETMFGDTAVAVNPADERYKHLIGRMVKLPLTDREIPIIGDEHADPAKGTGCVKITPAHDPNDFEVGKRHNLEVINVMNPDASLNARCGAAFEGLDRFEARKLCVKMMEEQGLLEKVEEIRHAVGYSERGDVPIETLVSYQWFCNMKELAKPAIEAVKSG-RIKFYPERWSKTYFHWMENIQDWCISRQIWWGHRIPAWYNDENGEVYVGLEAPTAPGKWRQEEDVLDTWFSSWLWPFSIMGWPKETPELKYFYPTCDLVTGPDIIFFWVARMIMAGCEFMKEIPFRNVYFTSIIRDEQGRKLSKSLGNSPDPLDVIATYGADALRFTIVYIAPVGMDIRYSNEKCEIGKTFANKLWNACRFRQMQGEVSKEFRELPADVAANLSGDERWMLARLDATIESINAALAEFRFHSAAHELYELVWTSFCDWFIEAEKVPMRAGGAEKERALTVLDYALFRILRLLHPFMPFITEELAHQMGFVAEGDSIMYEPYPESDSCAAADPAELERIDGKFELVKGGRFLKASYNLPDGRKVKFHIKAVDAAALEFLSREEASLKSLLNAEAIEFSLDEFDFAKHGAAPSQICKLGTVY-LPLADLIDVAAERVKLEKQKKDLE---GWIAGSKAKLSNERFVSKAPAQVVADAKLKLAEMEEKLARTLDLLNSLK 886
>gi|170755423|ref|YP_001782798.1| valyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] >gi|169120635|gb|ACA44471.1| valyl-tRNA synthetase [Clostridium botulinum B1 str. Okra] (881 aa)
Score = 1468, Expect = 2.3e-160, Identities = 343/866 (39%), Positives = 517/866 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKI--SNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL---EVLNPKLFKISDEVINILNTA-KINIVKQDIKSLKP-DYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +    +++K YD K  E++      +K      +  NK  Y+I+LPPPN+TG LHLGHAL+ T+QD L+R   ++G S  W+ G DHA IAT+ K E  L +  I  K+  R+  +  ++EW+    N IRNQ K +G  LD+  E FT++++ ++ V   FVK+YN+GLIY+   + NW  K ++A+S+ E+   E E + ++++Y +  S +YL +ATTRPET+  D  + VNPKD+RY + + K  + PL N+EI I+AD+YVD++FGTG +K TPAHD NDY++GK++ L  I+   +DG  N     +  +   +AR   VE L+    L K+++   NV   +R N V+EP++S+QWFVK+ E +K  IE+ K+ K     P +F+K   NWM N+ DWCISRQLWWGH+IPVWY KD  E+ V T+ P      N E   +DNDVLDTWFSS LWP +T    D        +P N LVTG+DIIFFWV RM+F  LY   ++PF    I G++RD    KMSKSLGNGVDP +VI++YGADALR  L++ ++PG D+ Y  E+V++   F NK+WN+ R+V MN      D+ K  KN    DKWIL++ N    E  +   K+   ++ +KI DF W +FC+ YIEL K      +++SK     VL+ +++  L L HP+ PF+T  +Y +   + +  ++ +  ++ +I      E  +E +++ I  IR    E  +P ++   + +   E    + FK  +     L +A +++ ++    S K    V     IFI     LL   +    +E++ KE E ++ EI R    L+N+ F+ KAP+  +  EK K EK++  LK + + L S K
  S:     1 MSETREMAKTYDPKEFEERLYKNWEEKSYFTPEVDENKKPYTIVLPPPNITGKLHLGHALDDTLQDILMRTKRMQGYSTLWLPGQDHASIATEVKVENELLKEGIVKKEIGREAFLEKVWEWTDEYRNKIRNQIKKLGCSLDFTRERFTMDEQLDKAVKHFFVKLYNEGLIYQGNRITNWCPKCKTALSDAEIEYSEHEGHFWHVKYPVVGSDEYLEIATTRPETMLGDTAVAVNPKDERYAHLVGKTLMLPLVNREIPIVADDYVDMEFGTGAVKITPAHDPNDYQVGKRHNLPEINVMFDDGRINYKETRYHEMDRYEARKAIVEDLKNEGFLVKIKEHNHNVSCHDRCNTVIEPIISKQWFVKMEELAKPAIEVVKNKKVKF-VPERFDKTYFNWMENIQDWCISRQLWWGHRIPVWYCKDCGEVIVVTEEPTKCPKCNSEKLQQDNDVLDTWFSSALWPFSTLGWPDKTPDLKYFYPNNTLVTGYDIIFFWVARMVFSGLYCMDDIPFDTVLIHGIVRDSEGKKMSKSLGNGVDPIEVIDEYGADALRFTLVTGNAPGNDIRYYPERVEAARNFANKIWNASRFVLMNLDKDLMDKYKDNKNYTIADKWILSRLNTVVKEVTENIEKFELGIASQKIYDFIWGEFCDWYIELVKPVLYGEDEQSKGIAFNVLHKVLETSLQLLHPIMPFITEEIYTHLYTEYESIVISKWPEYDEILKDEKSEKDMEYIIEAIKSIRNVRTEMNVPPSRKAKLMIYLTENEADRSFKEGEVYFQKLASASEVSFLENKETSDKNVSVVTRGAEIFI----PLLELVDIEKELERLNKEKEKLEKEIDRVEKKLANEKFVSKAPESVVNEEKEKGEKYKAMLKSVRESLESLK 881
>gi|78357880|ref|YP_389329.1| valyl-tRNA synthetase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78220285|gb|ABB39634.1| valyl-tRNA synthetase [Desulfovibrio desulfuricans G20] (883 aa)
Score = 1468, Expect = 2.5e-160, Identities = 318/857 (37%), Positives = 488/857 (56%)
  Q:    11 NDLSKKYDHKICEQQFSLWTTQKELNKK---NLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGT-TNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNL----EDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKK---ISNLKESSIEDVLQIINKIRIFNFE-NKIPNNKVIDIHLEVLNPKL--FKISDEVINILNTAKINIVKQDIKSLKPD-----YVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKL 867
           N L K Y+ +  E +   W T  E NK    +  A    YSI++PPPNVTG LH+GHALN T+QD L RF+  KG    W+ G DHAGIATQ   E+ L        D  R++ +  +++W +  GN I +Q + MG  +D+  E FT+++  +  V QVFVK+Y DGLIY+   ++NW  +  +A+++ EV     +  L+Y+RY L +   +L +ATTRPET+  D  + V+P+D+R+ + I K+AI PL  +++ II D+YVD +FGTG +K TPAHD ND+ELG+K+ L +++   +DG  + +    F  L  A AR K +  LE+   L+++E    NVG   R   VVEP +S QWFV +++ + +         + Q +P  +EK   NW+ N+ DWCISRQ+WWGH+IP W  +D  E+ V    P+          +D DVLDTWFSS LWP +T    D+ +     +PT+VLVTGFDI+FFWV RMM   L    E+PF H YI  L+RDEH  KMSKS GN +DP ++I+KYG D+LR  L + ++ G D+   E +++    FINK+WN+ R+  MN      +E   P +L    E   +WIL++  +  S     F  Y F  + + +  F W++ C+ Y+ELSK        R +  +  LW    ++K++L+L HP+ PFVT+ +++         I        +   +S   E  +  V  +I+ IR    E N  P  ++  +   V +  L   + S EVI++L  A++  +     +  P       VE N +I       L G  +    + ++ KE+  V  E  +    L+N+SF+ +AP + +  E+++ ++     ++LE L
  S:     4 NALPKGYEPQDIENR---WRTHWEENKTFTPDPDAPGEPYSIVIPPPNVTGALHMGHALNLTLQDILCRFHRQKGRKVLWVPGTDHAGIATQNVVERQLAREGKGRHDLGREKFIERVWQWREEYGNRILSQIRKMGASVDWTRERFTMDEGLSRAVRQVFVKLYEDGLIYKGNYIINWCPRCHTALADDEVDHSAEKGALHYVRYPLEDGSGHLTIATTRPETMLADTAIAVHPEDERFSHLIGKYAILPLVGRKLIIIGDKYVDREFGTGCLKVTPAHDHNDWELGRKHGLEVLNILTDDGVLSEDAGPDFAGLDCAAARKKILVMLEEKGFLDRIEPHEHNVGHCYRCKTVVEPYVSTQWFVAMTKLAPR--ARAAVPAQTQIYPENWEKTYYNWLDNIRDWCISRQIWWGHRIPAWTCEDCGELIVAMDAPQACKCGSTRLTQDEDVLDTWFSSALWPFSTLGWPDSTEELKQFYPTSVLVTGFDILFFWVARMMMMGLQFMDEIPFHHVYIHALVRDEHGKKMSKSTGNVIDPVEMIDKYGTDSLRFTLTAFAAMGRDIKLSEARIEGYRHFINKIWNAARFALMNLP----EEQPAPCDLAAVQELHHRWILHRLEEVKSSVDSAFTGYRFNEAAQTLYKFFWNELCDWYLELSKPDMQAGGERRARAQFVLWT---VLKEVLVLMHPVMPFVTAEIWNVLPGVAGTDIACASYPETRPACVSPDAEKRMALVQGVISAIRTIKAELNIAPTTRLNALVRTVSDAALEELEASREVISVL--ARLEGLTMGADAAGPRASASAVVEGNEVIV-----PLAGLVDFEAELARLDKELGKVGKEKEKLEAKLANESFVSRAPADIVAKERARSQELAETQEKLESL 874
>gi|15828728|ref|NP_326088.1| valyl-tRNA synthetase [Mycoplasma pulmonis UAB CTIP] >gi|81533027|sp|Q98QV4|SYV_MYCPU Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|14089670|emb|CAC13430.1| VALYL-TRNA SYNTHETASE (VALINE--TRNA LIGASE) (VALRS) [Mycoplasma pulmonis] (827 aa)
Score = 1467, Expect = 3.0e-160, Identities = 338/852 (39%), Positives = 514/852 (60%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKK---NLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           +  KY+H   E+       QK ++KK   N   +K  +SI+LPPPNVTG LHLGHALNG +QD +IR+  L+G    ++  MDHAGIATQ K E+ L +  +  +D  R++ +   ++W     N I++QW  +G  LDY +E FTL++ S + VN+VF+ +YN G+IY+    +NWD   ++A+SN+EVI KE    +YYI+Y+L NS +++ +AT R ET++ D  + +NP D R KNY+NKF I+PLT K + II D+Y+D  F +G MK + AH   D ++  K  L I+   +E G   N    FE ++  +AR K  + L+K NL+ +VE   SN+G+S+RT   +E ++ +QWFVK+  +SK V++  +S  K+ F+P +F+KNL  WM    DW ISRQLWWGHQIP WYK +  ++ + +  P     + +D DVLDTWFSS + P +     +  K     +PT++LVTG DIIFFWV RM F  LY  K+ PF    + GLIRDE   KM+KSLGNG+DP  +I++YG+D+LR FL+++++PG D+ Y EEK+KS W F+NKLWN  R++       N  E+    ++  +D WI +KFNK  S   +   KY F +  K+I  F  +DF + Y+E SK   +    K+     + K++L+L HP  PF+T +L   FK      +L    + KK+   K ++++ ++ +I  IR F  + +I   + I   ++  + +  +   + IN L  ++++   +++       VEN  +  IL K      N E N  ++  ++IEF+K EI R   +L N+ FI KAP  K+E EK+K EK++++LKEL
  S:     1 MDSKYNHYEIEKD----KNQKWIDKKYFINHDLDKKPFSIILPPPNVTGQLHLGHALNGYLQDSVIRYKKLEGYDVLFLPAMDHAGIATQIKVEESLAKENLLKQDIGREKFLKFSYQWKDKYANIIKSQWNKLGLALDYSSERFTLDQDSKDTVNKVFIDLYNAGIIYQGVKGINWDPLQKTALSNVEVINKETPQKMYYIKYFLENSDEFVEIATVRTETLYSDRAIGINPNDLRAKNYVNKFVIHPLTKKRLPIITDDYIDQSFASGFMKIS-AHSLADIDILNKNNLEIVESIDESGFLTNICDEFEGMERFEAREKIAQKLQKENLISRVENYSSNIGYSDRTKVPIEILVKKQWFVKMDLFSKMVLDSLESKNKVNFYPSRFKKNLEGWMNKTYDWTISRQLWWGHQIPAWYKDEQTKVQLNSPGPD----WTQDPDVLDTWFSSAIAPFSFFGWPNTYKKLKRYYPTSLLVTGHDIIFFWVSRMYFSGLYFMKDKPFNDVLLHGLIRDEQRRKMTKSLGNGIDPMVLIDQYGSDSLRWFLITNTTPGLDITYNEEKIKSSWNFMNKLWNIARFI-------NLQENTKKVSMSKYDYWISDKFNKVESYVKKFMKKYEFTLIGKEIYKFIINDFSSWYLEFSKITKNIDFQKV-----IFKRLLLLLHPFIPFLTDHL---FKIIYDQELLEHTFENKKLKTQK-NNVDQLILVIRAIREFREKYQISKKEKIKYWIQ--DCQFLQEDIDAINFLTFSELSQNSENMT-----IVENIKIFMILPK------NIEENLSKEKAQKIEFLKFEIKRAQSLLLNEKFISKAPTLKVEEEKAKLEKYQLQLKEL 820
>gi|134300393|ref|YP_001113889.1| valyl-tRNA synthetase [Desulfotomaculum reducens MI-1] >gi|134053093|gb|ABO51064.1| valyl-tRNA synthetase [Desulfotomaculum reducens MI-1] (879 aa)
Score = 1466, Expect = 4.1e-160, Identities = 316/859 (36%), Positives = 500/859 (58%)
  Q:    11 NDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS-KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG----TKPPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR------TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE---VINILNTAKINIVKQDIKSLKPDY----VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           N++   Y+ K  E + +  W   K    K ++ +K  + I++PPPNVTG LH+GHAL+ T+QD L R+  ++G +A WI G DHAGIATQ K E+ L +   S  D  R++ +  ++ W +  GN I  Q +++G   D++ E FT+++  ++ V +VFVK++  GLIYR   + NW    Q+ IS+IEV  ++    LYYI+Y    + ++Y+++ATTRPET+  D  + VNP+D RY + + K  + P+  +E+ +IAD Y D  FGTG +K TPAHD ND+E+G+++ L  +   ++ G  N +A  ++ L   + R + V  LE    L KVE     VG   R N  +EP +S+QWFVK+   ++  I+  K   +I+F P +F K  +NWM N+ DWCISRQLWWGH+IPV+Y +D +E+       TK  K      +DNDVLDTWFSS LWP +T    +  +  +  +PT+VLVTG DIIFFWV RM+F  L   +E PFK  +I GL+ D    KMSKSLGNGVDP D+IE +GAD+LR  L++ ++PG DL +  E++     F NKLWN+ R+V MN  D++         L   D+WIL++      +      +Y    + + + +F W +FC+ YIEL+K R        ++ +   VL  +++++L + HP  PF+T  ++     + +  +L +  + D   + +  E+ +  ++++I  +R    E  +P ++  +  L         I +     I     A+  I+ +    +KPD     V     IF+     L G  +    I ++ KE++ ++ +++R  G L+N+ F+ KAP E IE EK+K+++  +K   L+  LS
  S:     4 NNIPTVYNPKEVESKWYRHWEESKYFYAK-VEKDKTPFCIVMPPPNVTGQLHMGHALDNTLQDILTRWRRMQGYNALWIPGTDHAGIATQAKVEEQLAKECQSKYDLGREKFLERVWAWKEQYGNRITTQLRHLGASCDWDRERFTMDEGCSKAVLEVFVKLFEQGLIYRDYYITNWCPHCQTTISDIEVEHQDKPGQLYYIKYPAKETPEEYIIIATTRPETMLGDVAVAVNPEDDRYLHLVGKSLVLPIVGRELPVIADAYCDPTFGTGAVKMTPAHDPNDFEIGRRHGLPEVIVIDKYGKMNEHAGKYQGLDRFECRKQIVRDLEAMGYLVKVEDISHAVGHCYRCNTAIEPALSKQWFVKMKPLAEPAIQAAKDG-RIKFIPERFTKIYLNWMENIRDWCISRQLWWGHRIPVYYCQDCEEMVASITPITKCSKCGGKVEQDNDVLDTWFSSALWPFSTLGWPEKTEELEHFYPTSVLVTGRDIIFFWVARMIFSGLRFMEEEPFKEVFIHGLVLDSLGRKMSKSLGNGVDPLDIIESHGADSLRFMLITGNTPGNDLRFHFERLDGARNFANKLWNASRFVMMNLGDYDPTSQGGQYTLA--DRWILSRLQGTAKDVTDFLERYELGEAARVLYEFIWSEFCDWYIELAKPRLFGKTTPEDRVTAQHVLVQVLRQVLEMLHPFMPFITEEIWQKLPHQGETIMLAQWPKADENLLDDTAEAEMAVLIEVITAVRRIRGEMNVPPSRKAEALLVAAEESFRGILERNAAYIQGSANAEAKILSE--LPVKPDQSATAVTRGVEIFV----PLKGLIDLDKEIARLNKELKTIQGDLARVQGKLNNQGFLAKAPAEVIEKEKAKEQELSVKADALKDRLS 876
>gi|90101538|sp|Q6YRJ6|SYV_ONYPE Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (882 aa)
Score = 1464, Expect = 7.4e-160, Identities = 357/858 (41%), Positives = 514/858 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYL------SNSKD------YLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKIL-DFTWDDFCNTYIELSKNRTSNQESKLWVLN-------YLIKKILILFHPMCPFVTSNLYDNFKFKTK-DSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINI-------LNTAKINIVKQDIKSLKPDY-VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           +  KYD K  E Q      +K+    N  ANK ++++++PPPNVTG LHLGHA N TIQD +IRF  ++G    ++ GMDHAGIATQ K ++ L++  +  K  S++  +   ++W +    NIR QW+ +G  LDY  E FTL+   ++ V +VF K++   LIYR   ++NWD + ++A+SN+EV   E E  LYYI+Y+L      SN  D      +L +ATTRPET+F D+ L+VNP D RY+++I K    P TN +I +I+D YVDI FGTGV+K TP HD ND+E+ K+++L  + C NEDGT N+ A+ ++ L     R K V+ L++     K E  +  VG+S  ++A++EP +S QW +K    +K + ++   + KI FFP++FE    NW+ N+ DWCISRQLWWGHQIP W+K   +EI V  + P  E  +  D DVLDTWFSS LWP +T         L    FPT+VLVTG+DI+ FWV +M+F S+ L  + PFK   + GL+RD    KMSKS GNGVDP +V+ KYG DALR FL ++++PG DL Y E KV S W FINKLWN  R+V++N+S  + D D     L    K +L + +    +    + KY  L  I KIL  F W+DF N ++E +K+      S L  L+       Y++K IL L HP  PFVT  LY+NF  KT      L++  +  +  L  +  E++  +I K R    E+ I  N  +++ LEV + +   I  + +N+         T +I I  +   S K  + +E N  ++I  K   L   NE        ++   +  EI R   +L+N SF++KA   KIE+EK K E +    K+ +KLL S
  S:     1 MQTKYDFKKVEHQRYQQWLEKKYFCANPNANKKTFTVVIPPPNVTGKLHLGHAWNNTIQDIIIRFKKMQGFDVLFLPGMDHAGIATQNKVKEQLKQEGLLTKTLSKEIFLKYAWQWKEEHAQNIRQQWQVLGLHLDYNFEKFTLDPDLSQQVQEVFGKLFQKKLIYRDYKIINWDPETKTALSNVEVNYHETEGKLYYIKYFLVDFPTNSNLSDASLVPSFLEIATTRPETMFADQALMVNPNDPRYQSFIGKKVFIPDTNIQIPVISDNYVDINFGTGVVKVTPGHDINDFEVAKRHQLKALLCMNEDGTMNDLALQYQGLDRFVCRQKLVQTLKQKGFFTKTENHLHKVGYSSISDAIIEPRLSLQWVLK----TKAIAQIALKTNKINFFPLRFENIFNNWLQNIEDWCISRQLWWGHQIPAWHK--GQEIKVQIESPGPE--WSLDCDVLDTWFSSALWPFSTLGWPNCNAPLFQNRFPTDVLVTGYDILTFWVSKMVFQSILLTHKDPFKDVLLHGLVRDNKGQKMSKSKGNGVDPLEVVAKYGTDALRWFLTTNAAPGFDLFYDETKVASSWNFINKLWNISRFVKLNTSTLDTDFDINLLTLT--QKALLTQLHLTTQKVTTLYQKYE-LKEIGKILYHFVWEDFANWHLEFAKHDLDQNNSNLTNLHNSQKFLVYMMKHILQLLHPFIPFVTDALYENFDNKTNITQTTLQKTSYCNLDAL--ADFENLKNLIIKTRHLRQESNI--NCKLNLELEVAS-QFSTILQDFVNLQQALEKFFKTLQIKITNKVTNSKKTIWLIEKNLSLYIDRKT--LNELNETKFESNFLQQKNTLLKEIKRSETILNNPSFLQKAASAKIEIEKKKYESY---CKQYKKLLES 870
>gi|90101539|sp|Q3A253|SYV_PELCD Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (899 aa)
Score = 1463, Expect = 8.4e-160, Identities = 321/856 (37%), Positives = 495/856 (57%)
  Q:    13 LSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKE-----SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVIN----ILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           L K Y+ H +  + +  WT +  L   +  + KN +SI++PPPNVTG LH+GHALN T+QD L R+  + G    W  G DHAGIATQ   EK L     S  D  R+  V  +++W    G  I NQ K +G   D+E E FT+++  +  V +VFV +Y +GLIYR   L+NW  +  +A+S++EV  ++ + NL+++RY +  +  +L+VATTRPET+  D  + V+P+D+RY + I KF + PL +++I IIADEYVD +FG+G +K TPAHDFND+E+GK++ L  I+ F+E G  N     ++ L+  +AR + +  L+   LLE+ E+ ++ VG   R   V+EP MS QW+V V   ++K IE  ++ +  +  P ++EK    WM N+ DWCISRQ+WWGH+IP W+     E+ V  + P         EL  ++ DVLDTWFSS LWP +T    D   + +  +PT+ LVTGFDI+FFWV RMM   L    +VPFK  YI  L+RD    KMSKS GN +DP  VI++YG DA R  L + ++ G D+    +++     F+NKLWN+ R+  MN  DF    D +  +L+D      ++WIL +     +E  +   +Y F  +   +  FTW +FC+ YIELSK+       + + +   VL  +++++L L HP+ PFVT  ++     + + ++ +    F  +S L E     S +E ++ +I  +R    E  +P  K I     VL+ K  K ++ +      I + A+I+ +   +   +P          I     L G  +     +++ KEI  V+ ++   +  LSN+SF+ KAP   +E ++ K    E KL  L++ L
  S:    19 LPKGYEPHDVEAKWYEFWT-ENGLFHADENSPKNPFSIVIPPPNVTGVLHMGHALNNTLQDILARWKRMDGHEVLWQPGTDHAGIATQNVVEKQLAAEGSSRHDLGREGFVDRVWQWRTESGGQIINQLKRLGASCDWERERFTMDEGLSRAVREVFVTLYEEGLIYRDNRLINWCPRCHTALSDLEVEHQDQKGNLWHLRYPVVGTDRHLVVATTRPETMLGDTAVAVHPEDERYADLIGKFIMLPLMDRQIPIIADEYVDKEFGSGAVKITPAHDFNDFEIGKRHDLEFINIFDESGVVNGNGGRYQGLERFEARTRVLADLDAAGLLEQTEEHLNAVGECYRCKTVIEPYMSLQWYVNVQPLAEKAIEAVQTGQT-RIIPQQWEKTYFEWMFNIRDWCISRQIWWGHRIPAWFCAACNEVTVSREDPTACSHCGATELR-QETDVLDTWFSSALWPFSTMGWPDKTVALEKFYPTSCLVTGFDILFFWVARMMMMGLKFMGQVPFKDVYIHALVRDAQGQKMSKSKGNVIDPLTVIDEYGTDAFRFTLAAFAAQGRDVKLSVDRIAGYRNFVNKLWNASRFALMNLEDF----DPSGIDLDDCQLTLAERWILTRLIDVAAETGKALEEYKFNEAASVLYAFTWHEFCDWYIELSKDDLYGEDAARKATSQAVLYTVLEQLLRLLHPLMPFVTEEIWQALPGE-RPAVSIMSAAFSTVSELPEDRQGASHMERIMDVIKGVRNIRGEMNVPPGKRI---AAVLDCKTSKAAEVMAAGEGYIKSLARIDDLAFGVAVERPAQAATQVAGDIEILLPLAGLIDLDEEQKRLNKEIAKVEKDVLMFSKKLSNESFLAKAPAAVLEKDRQKLADAEEKLSILKQGL 892
>gi|116878593|ref|YP_357724.2| valyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] >gi|114843229|gb|ABA89554.2| valyl-tRNA synthetase [Pelobacter carbinolicus DSM 2380] (885 aa)
Score = 1462, Expect = 1.2e-159, Identities = 321/856 (37%), Positives = 495/856 (57%)
  Q:    13 LSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKE-----SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVIN----ILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           L K Y+ H +  + +  WT +  L   +  + KN +SI++PPPNVTG LH+GHALN T+QD L R+  + G    W  G DHAGIATQ   EK L     S  D  R+  V  +++W    G  I NQ K +G   D+E E FT+++  +  V +VFV +Y +GLIYR   L+NW  +  +A+S++EV  ++ + NL+++RY +  +  +L+VATTRPET+  D  + V+P+D+RY + I KF + PL +++I IIADEYVD +FG+G +K TPAHDFND+E+GK++ L  I+ F+E G  N     ++ L+  +AR + +  L+   LLE+ E+ ++ VG   R   V+EP MS QW+V V   ++K IE  ++ +  +  P ++EK    WM N+ DWCISRQ+WWGH+IP W+     E+ V  + P         EL  ++ DVLDTWFSS LWP +T    D   + +  +PT+ LVTGFDI+FFWV RMM   L    +VPFK  YI  L+RD    KMSKS GN +DP  VI++YG DA R  L + ++ G D+    +++     F+NKLWN+ R+  MN  DF    D +  +L+D      ++WIL +     +E  +   +Y F  +   +  FTW +FC+ YIELSK+       + + +   VL  +++++L L HP+ PFVT  ++     + + ++ +    F  +S L E     S +E ++ +I  +R    E  +P  K I     VL+ K  K ++ +      I + A+I+ +   +   +P          I     L G  +     +++ KEI  V+ ++   +  LSN+SF+ KAP   +E ++ K    E KL  L++ L
  S:     5 LPKGYEPHDVEAKWYEFWT-ENGLFHADENSPKNPFSIVIPPPNVTGVLHMGHALNNTLQDILARWKRMDGHEVLWQPGTDHAGIATQNVVEKQLAAEGSSRHDLGREGFVDRVWQWRTESGGQIINQLKRLGASCDWERERFTMDEGLSRAVREVFVTLYEEGLIYRDNRLINWCPRCHTALSDLEVEHQDQKGNLWHLRYPVVGTDRHLVVATTRPETMLGDTAVAVHPEDERYADLIGKFIMLPLMDRQIPIIADEYVDKEFGSGAVKITPAHDFNDFEIGKRHDLEFINIFDESGVVNGNGGRYQGLERFEARTRVLADLDAAGLLEQTEEHLNAVGECYRCKTVIEPYMSLQWYVNVQPLAEKAIEAVQTGQT-RIIPQQWEKTYFEWMFNIRDWCISRQIWWGHRIPAWFCAACNEVTVSREDPTACSHCGATELR-QETDVLDTWFSSALWPFSTMGWPDKTVALEKFYPTSCLVTGFDILFFWVARMMMMGLKFMGQVPFKDVYIHALVRDAQGQKMSKSKGNVIDPLTVIDEYGTDAFRFTLAAFAAQGRDVKLSVDRIAGYRNFVNKLWNASRFALMNLEDF----DPSGIDLDDCQLTLAERWILTRLIDVAAETGKALEEYKFNEAASVLYAFTWHEFCDWYIELSKDDLYGEDAARKATSQAVLYTVLEQLLRLLHPLMPFVTEEIWQALPGE-RPAVSIMSAAFSTVSELPEDRQGASHMERIMDVIKGVRNIRGEMNVPPGKRI---AAVLDCKTSKAAEVMAAGEGYIKSLARIDDLAFGVAVERPAQAATQVAGDIEILLPLAGLIDLDEEQKRLNKEIAKVEKDVLMFSKKLSNESFLAKAPAAVLEKDRQKLADAEEKLSILKQGL 878
>gi|148263856|ref|YP_001230562.1| valyl-tRNA synthetase [Geobacter uraniireducens Rf4] >gi|146397356|gb|ABQ25989.1| valyl-tRNA synthetase [Geobacter uraniireducens Rf4] (886 aa)
Score = 1460, Expect = 2.0e-159, Identities = 329/859 (38%), Positives = 495/859 (57%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE-DKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFK-FKTKDSILLERLDFKKIS-NLKESSIED--VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFK-ISDEVINILNTAKINIVKQDIKSLKPD----YVENNYLIFILNK---EDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           + +L+K Y+ K  E++ +  W +    + + + A K SYSI++PPPN+TG LH+GHALN T+QD L R+  + G +  W+ G DHAGIATQ   E+ L        D  R+  +  +++W    G  I  Q K +G   D+E E FT+++  +  V +VFV++Y++GLIYR   L+NW  +  +A+S+IEV  +E   +L+++RY +  ++ +L+VATTRPET+  D  + VNP D RY++ I      PL N++I IIADEYVD++FGTGV+K TPAHDFND+E+GK++ L+ I+ F+E G  N     +E L    AR + V  LE+  LLEK++     VG   R   VVEP MS QW+VKV   +++ +   +  K  +  P ++E     WM N+ DWCISRQ+WWGH+IP WY     EI V    P       +EE+  ++ DVLDTWFSS LWP +T    D  +   + +PT+ LVTGFDI+FFWV RMM   L+  +EVPF+  YI  L+RD    KMSKS GN +DP  VIE YG DA R  L + ++ G D+   EE++     F NK+WN+ R+  MN   F+ D  D     L + D+WIL + N+   E  +    Y F  +   +  FTW +FC+ YIEL K+      +  Q +  +VL  +++ +L L HP  PF+T  ++      K+  SI+L     +K   + +E + E   V+++I+ IR    E ++P +K I   L+  +    K +    + IL+ A+++ +       +P      V  +  I +  K               I KI K+IEF+  +       L N SF+E+AP + +E E+ K  +   K + LE+ L
  S:     3 DKELTKVYEPKSVEEKWYKEWESNGYFHGEAVSA-KPSYSIVIPPPNITGVLHMGHALNNTLQDILCRWKRMSGFNVLWMPGTDHAGIATQNVVERQLSAEGKDRHDVGREAFIERVWQWKAESGGQIIGQLKRLGASCDWERERFTMDEGLSRAVREVFVRLYDEGLIYRDNRLINWCPRCHTALSDIEVEHEEKAGHLWHLRYPVVGTERHLVVATTRPETMLGDTAVAVNPNDDRYRDLIGGMVTLPLVNRQIPIIADEYVDMEFGTGVVKITPAHDFNDFEMGKRHNLDRINIFDESGVINAAGHQYEGLDRFAARKRIVADLEEKGLLEKIQDHTLAVGGCYRCKTVVEPYMSLQWYVKVGPLAEEALAAVRDGKT-RIVPQQWENTYYEWMENIRDWCISRQIWWGHRIPAWYCDHCGEITVAKVDPTACAKCGSEEIR-QETDVLDTWFSSALWPFSTMGWPDKTQELASFYPTSCLVTGFDILFFWVARMMMMGLHFMEEVPFRDVYIHALVRDAQGQKMSKSKGNVIDPLTVIEAYGTDAFRFTLAAFAAQGRDIKLAEERIAGYRNFANKIWNASRFAMMNLEGFDPDAVDADSLELSNADRWILFRLNETAGEVDEALAAYRFNDAAAALYRFTWSEFCDWYIELVKDDLYKGDSRRQVTARYVLWLVLEHLLRLLHPFMPFITEEIWQTLAGKKSAPSIMLADYPQRKQEWDFREGAAEMALVMEVISAIRNIRGEMEVPPSKNIAAILDCKSADSLKLLKKNEVYILSLARLSDLAIGQGVDRPADAALQVAGDVEIVVPLKGLVNVEEEEKRLLKEIGKIDKDIEFLGKK-------LENPSFVERAPADVVEKEREKLAEFANKKQVLEESL 879
>gi|83589396|ref|YP_429405.1| valyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] >gi|83572310|gb|ABC18862.1| valyl-tRNA synthetase [Moorella thermoacetica ATCC 39073] (880 aa)
Score = 1460, Expect = 2.1e-159, Identities = 317/857 (36%), Positives = 493/857 (57%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKAN-KNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTP---KNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKI-SDEVINILNTAKINIVKQDIKSLKP-----DYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           L K Y+ K  E+++  + ++    + +L A  + ++SI++PPPNVTG+LHLGHAL+ T+QD L R++ ++G +  WI G DHAGIATQ + E+ L +  +S  D  RD  +  ++EW    G+ I  Q + +G   D+  E FT+++  +  V +VFV++Y  GLIYR   ++NW  + ++ IS+IEV   E   +L+YIRY   +    +++ATTRPET+  D  + VNP D+RY++ + K  + PL N+EI +IADEYVD  FGTG +K TPAHD ND+E+  ++ L  I+   +D      A  +  ++    R + V+ L+    L KVE+    VG   R    +EP++S QWFV+++  ++  I+  K   +++F P +F K  +NW+ N+ DWCISRQLWWGH+IPVWY +   E     + P+           +D DVLDTWFSS LWP +T    D     +A +PT+VLVTG DIIFFWV RM+F  L    EVPF+   I GL+ D    KMSKSLGNGVDP +VIEKYGAD LRL L++ ++PG DL +  E+++    F NK+WN+ R+  MN  D+    +  P   +NL   D+WIL++ NK   E       Y      + + +F W +FC+ YIEL K      NR   Q ++  VL  ++ K L L HP  PF+T  ++ +   + + SI+L    R   +      E+++  V+ +I  +R    E  +P  +  ++ L   +P+  +I   E + + N A  + V+      +P       V +   IF+     L G  +      +++KE++  ++E+ +    L+   F  KAP   +  E+++  + +  +  L K LS
  S:     4 LDKVYNPKAVEEKWYHYWSENGYFRGHLPAKGQPAFSIVMPPPNVTGSLHLGHALDNTLQDILTRWHRMRGDATLWIPGTDHAGIATQARVEEELAKEGLSKYDLGRDRFLERVWEWKHQYGDRITRQLRLLGSSCDWSRERFTMDEGCSRAVREVFVRLYEKGLIYRGSYIINWCPRCRTTISDIEVEHIEEAGHLWYIRYPFKDGSGSIVIATTRPETMLGDTAVAVNPSDERYRDVVGKTLVLPLINREIPVIADEYVDPAFGTGAVKITPAHDPNDFEVAARHNLPSITVIGKDAVMTEEAGPYAGMERYACRGQLVDDLKAQGFLVKVEEHTHAVGHCYRCGTTIEPLVSPQWFVRMAPLAEPAIQAAKEG-RVRFVPERFTKIYLNWLENIRDWCISRQLWWGHRIPVWYCQQCGEEICSREDPEECPACGSTALEQDPDVLDTWFSSALWPFSTLGWPDRTPELEAFYPTSVLVTGRDIIFFWVARMLFMGLEFMGEVPFREVLIHGLVLDAQGRKMSKSLGNGVDPMEVIEKYGADTLRLMLVTGNTPGNDLRFHPERLEGTRNFANKIWNAARFALMNLEDY----EPAPLERENLTLADRWILSRLNKLVLEVNACLEAYEIGEVARMLYEFFWGEFCDWYIELIKPRLYGENRRERQVAQ-EVLVTVLGKSLQLLHPFMPFITEEIWQHLPGE-RGSIMLSSWPRPVPQDEDEQAETAMGLVMAVIRAVRTLRSEMNVPPGRRAEVILVSGSPEDREILQRESVYLENLAAADRVQVVAALDRPPSRAATAVTSGVQIFL----PLAGLIDLEKEQARLEKELQKARAELEKVEKKLARPDFRAKAPAAIVAKEEARAAELKSTITALTKRLS 876
>gi|42522066|ref|NP_967446.1| hypothetical protein Bd0458 [Bdellovibrio bacteriovorus HD100] >gi|81618454|sp|Q6MQK8|SYV_BDEBA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|39574597|emb|CAE78439.1| valS [Bdellovibrio bacteriovorus HD100] (894 aa)
Score = 1459, Expect = 2.8e-159, Identities = 324/863 (37%), Positives = 514/863 (59%)
  Q:     7 IKNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEY---SKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYV------GTKPPKNEELYVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK-----NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKES----------SIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE------VINILNTAKINIVKQDIK-SLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +K +  LS +Y+    E +   W  +    K   ++ K  +SI+LPPPNVTG LH+GHAL+ TIQD +IR+  + G +  W+ G DHAGIATQ+  E+ L+++ ++  D  R++ V  +++W    GN I  Q + +G   D++   FTL++  ++ V +VFV ++  GLIYR + LVNW   L++AIS++EV  K+++ +LY+++Y L +   +L+VATTRPET+  D  + V+P+D+RYK+ I K  + PLTN++IKIIAD YVD +FG+GV+K TPAHDFNDY++GK + L  I+   +    N     +  LK+ +AR + +E L+  +LLEK E  + +VG   R+ AVVEP +SEQWFVK+      +K+V E    +  I+F P  + K  ++W+ N+ DWCISRQLWWGH+IPVWY +D     V        +   + +L+ +D+DVLDTWFSS LWP +T      T+ LK+    +PT+ LVTG DIIFFWV RM+   L  +++VPF+  YI GL+RD    KMSKSLGN +DP ++IEK+GADALR    +    G+D  + E++++    F+NK+WN+ R+   N SDF    +         ++  FD+WI+ K  +      +   +  F  +   +  F W+ FC+ YIE +K     N    + +   V+  ++ +I+ L HP  PF++  +Y     K    I+ +   +    N KE            I+ V ++I  IR    EN+I     +++ L V N +  KI          +  L   +I      +K ++ P  V++  +  I+  E L+  + E   +++I K IE +  +I   +G LSN+ F+  A +E +  +++   + +++L  L   L+
  S:     1 MKMSEQLSDRYNPADVESRTYEWWEKNGYFKAQDQSTKPPFSIILPPPNVTGFLHMGHALDHTIQDMMIRWKRMNGYNTMWLPGTDHAGIATQSVVERELKKDGVTRHDLGREKFVEKVWDWKHQYGNRIYGQMRRLGDSCDWDRAVFTLDEGVSKAVRKVFVSLHKKGLIYRGQRLVNWSGPLETAISDLEVEHKQIKGSLYHVKYPLEDGSGFLVVATTRPETMLGDSAVCVHPEDERYKHLIGKNVLLPLTNRKIKIIADTYVDKEFGSGVVKITPAHDFNDYKIGKTHNLEFINILTKKAEINENGGVYAGLKVQEARKRILEDLKAQDLLEKEEPHVHSVGHCSRSGAVVEPYLSEQWFVKMEALAVPAKRVAE----NGTIRFEPESWTKVYLHWLNNIEDWCISRQLWWGHRIPVWYCEDCNHQTVAETDVTACEKCGSTKLH-QDDDVLDTWFSSALWPFSTMGWPNETETLKT---FYPTSYLVTGHDIIFFWVARMIMMGLEFQRDVPFRTVYIHGLVRDSQGRKMSKSLGNSIDPVEMIEKHGADALRFTFAAHLYSGKDFKFSEQRLEGYRNFMNKVWNAARFALSNLSDFKAPTEGVKALPNKVHISVFDQWIITKLEEVTKTVEEAMEQERFSDASTALYQFIWNQFCDWYIEFTKPILNGNNAEEKAATQLVIAQVLNRIMRLLHPFAPFISEEIYQKLPIKGTACIVDQ---YPNARNDKEFLSLGSAQAALEIDIVKEVITAIRNIRGENRISPAVKLNVRLGVTNDQTQKILGNNRTALMTMGRLENMEIGPEGDMMKCAVAPVVVKDASVKVIIPLEGLVDFDEE---VKRINKSIEKLTRDIGMLSGKLSNEKFVANADEEVVAADRALLAQSKVQLDSLRDALT 891
>gi|169334634|ref|ZP_02861827.1| hypothetical protein ANASTE_01037 [Anaerofustis stercorihominis DSM 17244] >gi|169259351|gb|EDS73317.1| hypothetical protein ANASTE_01037 [Anaerofustis stercorihominis DSM 17244] (882 aa)
Score = 1459, Expect = 3.0e-159, Identities = 326/860 (37%), Positives = 513/860 (59%)
  Q:     9 NNNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKY-EKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEE-----LYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL--KESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK----QDIKSLKPDYVENNYLIFILNKEDLLGSNNE----ANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           + N L K+YD  KI  + +  W       K  +  +   ++I++PPPN+TG LH+GHA + T+QD LIR+  +KG +A W+ G DHA IAT+ K  +K   E   + +D  R++ + + + W++     I NQ + +G   D+  E FT+++  +E V + F+++Y  GLIYR   ++NW    ++A+S+ EV  +E   +L++I+Y + +S +++++ATTRPET+  D  + +NP D+RY +   K  I PL NKEI I+ DEYVD QFGTG +K TP HD ND+E+G ++ L  I  FN+DGT N     ++ L    AR + V+ LE+  LLEK+E  + NVG   R +A VEP+ S QWFVK+   +K  I+   + K++ F P +F+K   NWM N+ DWCISRQLWWGH+IP +Y ++  E+ V  + P   E      + +D D LDTWFSS LWP +T    K  + L   +P +VLVTGFDIIFFWV RM+F  +    E PF H YI GL+RD    KMSKSLGNG+DP +VI+KYGAD LR  L++ +  G D  + E KV++   F NK+ N+ R++ MN  DF+ ++      L + DKWI+++ N+   E      KY F ++ +K+  F W++FC+ YIE +K    + N+E +    + LN +   IL + HP  PF+T ++Y     +    I  E  ++K+  +   +E  I  +++ +  +R       IP +K  D +       +F  S E+  + +++K  ++K    +DI  +  +Y +   L  ++    +     E       IE++K E + +  EISR    LSNK+F +KAP++ +E E+ K +K++  ++E+++ L
  S:     3 SENILDKQYDPGKIEGKIYEKWEKGGYF-KPEINKDGKPFTIIMPPPNITGKLHIGHAFDDTLQDILIRYKRMKGYAALWVPGEDHASIATEVKVVDKIKEETGKTKQDLGREKFLKEAWNWAKTYRKEIANQVRKLGSSCDWSRERFTMDEGVSEAVKETFIRLYKKGLIYRGNRIINWCPSCKTALSDAEVEYEEQAGHLWHIKYPIKDSDEFVVIATTRPETMLGDTAVAINPDDERYFHLKGKSLILPLVNKEIPIVFDEYVDKQFGTGCVKITPCHDPNDFEVGLRHDLEQIRVFNDDGTINELGGKYQGLTTKQARKEIVKDLEELGLLEKIEDHMHNVGTCYRCHATVEPLTSLQWFVKMEPLAKPAID-AVNEKEVNFVPDRFKKIYFNWMENIKDWCISRQLWWGHRIPAYYCEECGEMVVSKEMPAKCEKCGCTSFKQDEDALDTWFSSALWPFSTLGWPKETEDLKKFYPNDVLVTGFDIIFFWVARMVFSGIEQMGEPPFHHVYIHGLVRDSQGRKMSKSLGNGIDPLEVIDKYGADVLRFSLVTGNKAGNDTRWQESKVEANRNFANKINNAARFILMNLEDFDENKKADLPKLHNTDKWIISRTNQMVKEVTANIEKYEFGIAAEKLYTFIWNEFCDLYIEFAKPSLNSDNKEDRFNTQYTLNLVFMNILKMLHPYMPFITEHIYSFMPGREDMLIAAEYPEYKEEYDFPKEEEDITIIVEALRTVRNARANMDIPPSKKADGY-------IFPSSKEMKEVFSSSKDILIKLASFKDINFIDGEYDKEESLCVVVEGGKIFIPMGELIDREKEIERLKNEEKKLNGEISRLEKKLSNKNFTDKAPEKVVEGEREKLKKYQSLMEEVKESL 878
>gi|110600251|ref|ZP_01388476.1| valyl-tRNA synthetase [Geobacter sp. FRC-32] >gi|110549032|gb|EAT62233.1| valyl-tRNA synthetase [Geobacter sp. FRC-32] (886 aa)
Score = 1458, Expect = 3.2e-159, Identities = 320/858 (37%), Positives = 494/858 (57%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPP------KNEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK-NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKT-KDSILLERLDFKKIS-NLKE--SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFK-ISDEVINILNTAKINIVKQDIKSLKPD----YVENNYLIFILNK---EDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           + +L+K YD +  EQ+ +  W  +   +     A K +YSI++PPPN+TG LH+GHALN T+QD L R+  ++G +  W+ G DHAGIATQ   E+ L        +  R+     +++W    G  I  Q K +G   D+  E FT+++  ++ V +VFV++Y +GLIYR   L+NW  +  +A+S+IEV  +E E +L+++RY +  S  +L+VATTRPET+  D  + VNP D+RY + I    + PL N++I IIADEYVD++FGTGV+K TPAHDFND+E+GK++ L+ I+ F+E G  N     +E ++   AR + +  LE   L++K++    +VG   R   VVEP MS QW+VKV   +++ +   K  K  +  P ++E     WM N+ DWCISRQ+WWGH+IP WY     EI V    P       ++E+  ++ DVLDTWFSS LWP +T    D        +PT+ L+TGFDI+FFWV RMM   L+  +EVPF   YI  L+RD    KMSKS GN +DP  VI+ YG DA R  L + ++ G D+   EE++     F NK+WN+ R+  MN   F+ D  K  +  L + D+WIL + N+   E  +  N Y F  +   +  FTW +FC+ YIEL K+      ++ Q +  ++L  +++ +L L HP  PF+T  ++     K    SI+L     +K   + ++  + +E V+ +I+ IR    E ++P +K I   L+  +P   K +    + I++ A+++ +       +P      V  +  I +  K               I KI K+I+F+  +       L N SF+++AP E +  E+ K      K ++  + LEK+
  S:     3 DKELTKVYDPENVEQKWYREWEAKGYFSAAATSA-KPAYSIVIPPPNITGVLHMGHALNNTLQDILCRWKRMQGFNVLWMPGTDHAGIATQNVVERQLAAEGKDRHELGREAFTERVWQWKSESGGQIIGQLKRLGASCDWGRERFTMDEGLSKAVREVFVRLYEEGLIYRDNRLINWCPRCHTALSDIEVEHEEKEGHLWHLRYPVVGSGRHLVVATTRPETMLGDTAVAVNPNDERYTDLIGGHVMLPLVNRKIPIIADEYVDMEFGTGVVKITPAHDFNDFEVGKRHNLDRINIFDESGVINAAGHQYEGMERFAARKQIIADLEAQGLMDKIQSHALSVGGCYRCKTVVEPYMSLQWYVKVGPLAERALAAVKEGKT-RIVPQQWENTYYEWMENIRDWCISRQIWWGHRIPAWYCDHCGEITVAKVDPVKCSKCGSDEIR-QETDVLDTWFSSALWPFSTMGWPDRTPELATFYPTSCLITGFDILFFWVARMMMMGLHFMEEVPFVDVYIHALVRDAQGQKMSKSKGNVIDPLTVIDSYGTDAFRFTLAAFAAQGRDIKLAEERIAGYRNFANKIWNASRFAMMNLEGFDPDAVKADELELSNADRWILYRLNETAGEVEESLNAYRFNDAAAALYRFTWSEFCDWYIELVKDDLYKGDSTRQTTARYILWMVLEHLLRLLHPFMPFITEEIWQALPGKKGPASIMLAEYPRRKAEWDFRDGATEMELVMAVISGIRNIRGEMEVPPSKSIAAMLDCKSPASLKLLKKNEVYIVSLARLSDLAIGTHIERPADAALQVAGDVEIVVPLKGLVNVEEEEKRLLKEIGKIDKDIDFLSKK-------LENPSFVDRAPAEVVAKEREKVAEFANKKQVLGESLEKI 882
>gi|160939307|ref|ZP_02086658.1| hypothetical protein CLOBOL_04201 [Clostridium bolteae ATCC BAA-613] >gi|158438270|gb|EDP16030.1| hypothetical protein CLOBOL_04201 [Clostridium bolteae ATCC BAA-613] (879 aa)
Score = 1457, Expect = 4.5e-159, Identities = 313/838 (37%), Positives = 492/838 (58%)
  Q:    32 QKELNKKNLKA----NKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY-YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE-----SKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL--KESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKI---SDEVINILNTAKINIVKQDIKSLKPDYVEN--NYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           QK L+ K   A    +K  ++I++PPPN+TG LH+GHAL+ T+QD LIR+  ++G  A W  G DHA IAT+ K    L++  +   D  RD  + + ++W    G  I NQ   +G   D++ E FT++   ++ V +VFVK+Y  G IY+   ++NW    Q++IS+ EV   E     ++I Y  +     ++ +ATTRPET+  D  + VNP+D+RY++ + K    PLT++EI +IAD YVD +FGTG +K TPAHD ND+E+GK++ L  I   N+D T N     F  +   +AR   V  LE   LL KV     NVG  +R    VEPM+ +QWFVK+ E +K  IE  K+   + F P  F K  ++W+  + DWCISRQLWWGH+IP +Y ++  EI V  + P            +D D LDTWFSS LWP +T    +  +  D  +PT+VLVTG+DIIFFWV RM+F  L    ++PF    I GL+RD    KMSKSLGNG+DP +VI+KYGADALR+ L++ ++PG D+ +  E+V++   F NK+WN+ R++ MN        +     L   DKWI++K N    E  +  +KY   ++++K+ DF W++FC+ YIE+ K R  N+E     + +W L +++ + L L HP  PF++  ++ N + + +  ++ +   ++   N   +E S E + + +  IR       +P +K   +++   +  L +I   S      L  A   I++++ + +  D V    +  +  +   DL+    E   IE+++ E + +  E++R  GML N+ F+ +AP+ KI  E++K EK+E  +++++  L+
  S:    19 QKWLDGKYFHAEVNRSKKPFTIVMPPPNITGQLHMGHALDNTMQDILIRYKRMQGYEALWQPGTDHAAIATEVKVIDKLKKEGVDKADLGRDGFLKECWKWRDEYGTRIVNQLHKLGSSADWDRERFTMDHGCSDAVLEVFVKLYEKGYIYKGSRIINWCPVCQTSISDAEVEHVEQNGFFWHINYPVVGEPGRFVEIATTRPETMLGDTAVAVNPEDERYQDIVGKMLKLPLTDREIPVIADPYVDKEFGTGCVKITPAHDPNDFEVGKRHNLEEIIILNDDATVNVPGPYF-GMDRYEARKAIVADLEAQGLLVKVVPHSHNVGTHDRCKTTVEPMVKQQWFVKMEEMAKPAIEALKNG-SLTFVPESFGKTYLHWLEGIRDWCISRQLWWGHRIPAYYCQECGEIVVSKEAPHACPKCGCTSLKQDEDTLDTWFSSALWPFSTLGWPEKTEDLDYFYPTDVLVTGYDIIFFWVIRMVFSGLEQTGKLPFHTVLIHGLVRDSEGRKMSKSLGNGIDPLEVIDKYGADALRMTLITGNAPGNDMRFYWERVENSRNFANKVWNASRFIMMNIEKAAQSGEVALDRLTMADKWIVSKVNTLTREVTENLDKYELGIALQKVYDFIWEEFCDWYIEMVKPRLYNEEDDTKAAAIWTLKHVLIQALKLLHPFMPFISEEIFCNLQEEEETIMISQWPVYRDDWNFAKEEQSTETIKEAVRAIRGVRSSMNVPPSKKATVYVVSEDAGLLQIFEHSKSFFAALGYAGEVILQENKEGIADDAVSAVIHKAVIYMPFADLVDIEKE---IERLRGEEKRLAGELARSRGMLGNEKFVNRAPEAKIAEERAKLEKYEQMMEQVKIRLA 876
>gi|189425595|ref|YP_001952772.1| valyl-tRNA synthetase [Geobacter lovleyi SZ] >gi|189421854|gb|ACD96252.1| valyl-tRNA synthetase [Geobacter lovleyi SZ] (897 aa)
Score = 1452, Expect = 1.8e-158, Identities = 327/860 (38%), Positives = 501/860 (58%)
  Q:     9 NNNDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY-YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFD----EDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE-----SKLWVLNYLIKKILILFHPMCPFVTSNLYD--------NFKFKTKD---SILL-------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLN------PKLFKISDEVINILNTAKI----NIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +N +L+K Y+ H++ ++ +  W  +K     +  + +  YSI++PPPNVTG LH+GHALN T+QD L R+  + G S  W+ G DHAGIATQ   E+ L        D  R+  +  +++W    G  I  Q K +G   D+E E FT++   ++ V  VFVK+Y DGLIYR   L+NW  +  +A+S+IEV  +E + +L++IRY  +     +L VATTRPET+  D  + V+P+D+RY +      + PL N+EI ++ADEYVD +FGTGV+K TPAHDFND+E+G ++ L+ I+ F+E G  N     +E L    AR + VE LE   LLEK++    +VG   R   VVEP +S QW+VKV   +++ ++  K  +  +  P ++E    +WM N+ DWCISRQ+WWGH+IP W+     +I V  + P       ++EL  ++ DVLDTWFSS LWP +T    D        +PT  LVTGFDI+FFWV RMM   L+   EVPFK  YI  L+RD H  KMSKS GN +DP  VI++YG DA R  L + ++ G D+   EE++     F NK+WN+ R+  MN   F  D    ED     L + D+WIL++ N+      Q  ++Y F  +   +  FTW +FC+ Y+ELSK      +     +  +VL  +++ +L L HP+ PF+T  ++         N +    D   SI+L       E   F+  +      +E V+++I+ IR    E ++P ++ I + L   +       +LF+   ++ ++   A +    N+ K +  S++P      + +F+     L G  + A   +++ KEI  +  EI + +  L N SF+++AP + +  EK+K      K   LE+ L
  S:     2 SNKELAKGYEPHEVEKKWYGEWA-EKGYFHADEASPRRPYSIVIPPPNVTGALHMGHALNNTLQDILCRWKRMTGHSVLWMPGTDHAGIATQNVVERQLAAEGKDRHDLGREAFIERVWQWKAESGGQIIGQLKRLGASCDWERERFTMDAGLSKAVRTVFVKLYEDGLIYRDNRLINWCPRCHTALSDIEVEHEEKKGHLWHIRYPVVGQPGRFLTVATTRPETMLGDTAVAVHPEDERYADLHGAKVLLPLVNREIPVVADEYVDREFGTGVVKITPAHDFNDFEVGARHGLDKINVFDESGIINAAGHQYEGLDRFKARTRIVEDLEVAGLLEKIDDHGLSVGGCYRCKTVVEPYLSLQWYVKVGPLAERALQAVKDGRT-RILPKQWENTYYDWMENIRDWCISRQIWWGHRIPAWFCDHCGKITVSMEDPTSCSQCGSDELR-QETDVLDTWFSSALWPFSTMGWPDQTAELKRFYPTATLVTGFDILFFWVARMMMMGLHFMDEVPFKDVYIHALVRDAHGQKMSKSKGNVIDPLTVIDQYGTDAFRFTLAAFAAQGRDIKLAEERISGYRNFCNKVWNAARFTMMNLEGFEPDQLVFED---LRLTESDEWILHRLNETARATNQALDEYRFNEAAMTLYQFTWSEFCDWYLELSKQELYGDDPLRRRTTQYVLWSVLEHLLRLLHPIMPFITEEIWQTLPKGDRCNLRGSGGDWPPSIMLAPYPQPREDWQFEDAA----GRMEQVMEVISAIRTIRGEMEVPPSREITVILSTGSQQAEDLARLFE--SKIRSMARVADLTIGRNLEKPEDASVQP---AGRFQVFV----PLKGLVDVAEEEKRLLKEIAKLDKEIEQFSKKLENPSFVDRAPADIVAKEKAKLADVTAKKAVLEESL 890
>gi|170288799|ref|YP_001739037.1| valyl-tRNA synthetase [Thermotoga sp. RQ2] >gi|170176302|gb|ACB09354.1| valyl-tRNA synthetase [Thermotoga sp. RQ2] (865 aa)
Score = 1450, Expect = 2.9e-158, Identities = 322/857 (37%), Positives = 506/857 (59%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADL-FEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL--WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +LS +Y+    E + +  W  +     K +      +SI++PPPN+TG +H+GHALN T+QD ++R+  +KG    W+ G DHAGIATQ   EK+L + +   +++   EK  ++ +EW+      IR Q K +G  +D+  E FTL++  +  V +VFV++Y  GLIYR K +VNW  + ++ +S+ EV  KE ++ LYY++Y + +S +Y++VATTRPET+  D  + V+P+D+RYKN++ K  I PL  +EI ++AD+YVD +FGTG +K TPAHD NDY + +++ L +I  F+++   N     ++ L   +AR K V+ LE+   L K+E    +VG   R + V+EP +S+QWFV     +K+ IE  ++  +I+FFP ++ K  +NWM  + DWCISRQLWWGH+IPVWY +D   + V  +  +  E        +D DVLDTWFSS LWP +T    +  + L   +PT++LVTGFDIIFFWV RM+        + PF H YI  L+RD++  KMSKSLGNG+DP +VI++YGAD +R  L   ++ G D+        +   F NK+WN+ R+V MN  D+   ++   +NL+  DKWIL + NK   E       Y+F ++ + I +F WDDFC+ YIE SK R   +E  L   VL  ++   L L HP  PF+T  L+        +SI + +   ++ + I    E     ++ ++  +R    E  +P ++ + +++     K +++++E   +L    N  +++ V +        YVE     ++    DL G  +     E++K+ +E ++ EI R    L+NK F+EKAP+E IE  K K   +  +L  LE +L
  S:     3 ELSTRYNPAEIETKWYRYWEEKGYFTPKGVG---EKFSIVIPPPNITGRIHMGHALNITLQDIVVRYKRMKGYDVLWVPGEDHAGIATQNAVEKFLLQTQGKTREEIGREKFLEITWEWANKYRREIREQIKALGASVDWTRERFTLDEGLSRAVRKVFVELYRKGLIYRGKYIVNWCPRCKTVLSDEEVEHKEHKSKLYYVKYPVKDSDEYIVVATTRPETMLGDTAVAVHPEDERYKNFVGKTLILPLVGREIPVVADKYVDPKFGTGAVKVTPAHDPNDYLIAQRHNLPMIEIFDDNARINENGGKYKGLDRYEAREKIVKDLEEQGFLVKIEDYTHSVGHCYRCDTVIEPKLSDQWFVSTKPLAKRAIEAVENG-EIRFFPERWTKVYLNWMYEIRDWCISRQLWWGHRIPVWYCQDCGHLNVSEEDVEKCEKCGSTNLKQDEDVLDTWFSSALWPFSTLGWPEETEDLKRYYPTDLLVTGFDIIFFWVARMIMMGYEFMNDKPFSHVYIHQLVRDKYGRKMSKSLGNGIDPLEVIDEYGADPMRFTLAILAAQGRDIKLDPRYFDAYKKFANKIWNATRFVLMNLEDY---KEVPLENLKTVDKWILTRLNKTVEEVTNALENYDFNIAARTIYNFFWDDFCDWYIEASKPRLKTEERNLVQTVLVKVLDASLRLLHPFMPFLTEELWQKLPV-AGESITIAKWPEVERELIDETAEKEFTRLMNMVRGVRNVRAEMNLPQSQKVKVYI-----KGYEVTEEEELLLKTLGNIEEVSFVNEKPPKTATAYVEEEIEAYV----DLGGLIDFEKEKERLKQIMEKIQKEIDRLEKKLANKDFVEKAPEEVIEETKEKLNTNRERLARLESIL 861
>gi|71894314|ref|YP_278422.1| valyl-tRNA synthetase [Mycoplasma synoviae 53] >gi|90101534|sp|Q4A6B0|SYV_MYCS5 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|71851102|gb|AAZ43711.1| valyl-tRNA synthetase [Mycoplasma synoviae 53] (832 aa)
Score = 1448, Expect = 5.9e-158, Identities = 352/850 (41%), Positives = 526/850 (61%)
  Q:    13 LSKKYDHKICEQQF-SLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYL-RENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALF----PTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDL---LGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLK 862
           + K Y+H+  E    S W  +K     NL  +K  +SILLPPPNVTG LHLGHAL+  I D +IRF  L G    W+ GMDHAGIATQ+K E  L ++NK++  D  +++ +A++++W +      R QW+ +G  LDY NE FTL K+ NE V ++FV++YN G IY+    V+WDI LQ+AISNIEVI KE    +YYI+Y+  NS +YL +ATTR ET+  D  ++ NPKDKRYKN   KF I+P+T K + +I DEYV I+FG+G+MK + AH   D E+ +K  L +I   +++G  N     +  ++  +AR K  ++LE+NN L K E +ISNV +S+R+N+V+E +M  QWF+K+  +   +++   S +KI+F P +++ NL  WM N+ DW ISRQLWWGHQIP WY KD K       P +    +V+D+DVLDTWFSSG+   +     ++ DA F    P++++V+G+D+IFFW+ RM+F SL    + PFK  ++ GLIRD+   KMSKSL NG+DP +V+EKYG+DALR FL+++++PG D+ Y +EK++S W   NKL+N   Y+  +S   N  E K+ K L +  KWILNK +    +  + F  Y+F +   +I  F + D  + YIEL K+     E+      Y+ KKILI+ HP  PF +  L++    K  +  LLE+  + K    K+SS I  ++  I KIR +  +N I   + + + L+       KIS + +NIL           +     +Y EN   + +L+   +   +    +    ++++K+I F +SEI+R   +LSN+SFI KAPKEKI+LE+ K ++++ +L+
  S:     1 MQKIYNHQNVEDGIESKWREKKYFIDHNL--DKKPFSILLPPPNVTGKLHLGHALDSYIPDTIIRFKKLSGYDVLWLPGMDHAGIATQSKVESELYKQNKLTRHDLGKEKFLAEVWKWKEIHEKLFRQQWQTLGLALDYSNEAFTLSKEVNEKVIKIFVELYNRGYIYKKNRAVSWDINLQTAISNIEVINKETPQKMYYIKYFFENSSEYLTIATTRVETMLSDVAVIANPKDKRYKNLKIKFLIHPITKKRLPLIFDEYVKIKFGSGLMKLS-AHAEADIEIIEKLGLEVIETIDKNGYINAPDYQWHKMERFEAREKMAQFLEENNYLIKAEDSISNVSYSDRSNSVIETLMLPQWFIKMDHFRDLILKNLSSKEKIKFLPNRYKNNLKRWMNNVYDWNISRQLWWGHQIPAWY-KDGKMKVQAESPGQG---WVQDSDVLDTWFSSGIAAFSFFK-WENDDAFFKRYYPSSLMVSGYDLIFFWISRMIFLSLEFTNQRPFKEVFMHGLIRDKDGRKMSKSLNNGIDPIEVVEKYGSDALRWFLITNTAPGMDIRYNQEKIESAWKISNKLYNVALYI--SSMPDNNLEAKSSK-LSEQSKWILNKLSALNKQIQKVFKTYDFSIIGVEIYQFIFTDLSSWYIELIKSLNIKNEAM-----YVFKKILIMLHPFLPFTSDYLFN----KLYNEELLEQ-SWPKFKRFKDSSEINLLIDAITKIRKYRDDNNISKKEKLYLCLKE------KISKKNLNIL-----------LSLTNSEYKENKDFLIVLDNNSIFIEISQEQKQKQKQELEKKIAFCQSEITRAQNILSNQSFIAKAPKEKIKLEEDKLQRYKQELQ 822
>gi|160878630|ref|YP_001557598.1| valyl-tRNA synthetase [Clostridium phytofermentans ISDg] >gi|160427296|gb|ABX40859.1| valyl-tRNA synthetase [Clostridium phytofermentans ISDg] (892 aa)
Score = 1445, Expect = 1.2e-157, Identities = 320/861 (37%), Positives = 498/861 (57%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL----YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSS-------DFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR-----TSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFK-----FKTKDSILLERL-DFKKISNL--KESSIEDVLQIINKIRIFNFENKIPNN---KVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVE------NNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +L+K YD K  E +      +K+     +   K  ++I++PPPN+TG LH+GHAL+ T+QD LIRF  ++G +A W  G DHA IAT+ K  + L++  I      R+  +   +EW    G  I  Q K +G   D++ E FT+++  ++ V +VFVKMY  G+IY+   ++NW     ++IS+ EV  ++   + ++I+Y +  + +YL  ATTRPET+  D  + V+P+D RY + I K    P  ++EI II D YV+  FGTGV+K TPAHD ND+E+GK+  L  I+  N+D T N     FE +    AR + V+ L++  LL KVE    NVG  +R N  +EP++ +QWFVK+ E  K  +E  K +K I+  P + EK   NW  N+ DWCISRQLWWGH+IP +Y     ++ V    P   E     + +D D LDTWFSS LWP +T    +  +  +  +PT+VLVTG+DIIFFWV RM+F       E PFK     GL+RD    KMSKSLGNG+DP ++IE+YGADALR  L++ ++ G D+ +  E+V++   F NK+WN+ R++ MN         D   D       L D DKWI++K N    +  +   K++  ++ +K+ DF W++FC+ YIE+ K R      + + + ++ L  ++   L L HP  PF+T  ++   K         +S+++ +  ++K+  N   +E ++E + + +  IR    E  +P +   KVI +       ++F  S      L  A   +++ D   +  D V         Y+ F     DL+    E   IE++ KE + +  E+ R NGML+N +F+ KAP+ K+  E++K EK+   + ++E+ L+  K
  S:     4 ELAKTYDPKDIEGRLYEKWLEKKYFHAEVDKTKKPFTIVIPPPNITGQLHMGHALDNTMQDILIRFKRMQGFNALWQPGTDHASIATEVKIIEALKKEGIDKDQLGREGFLKRAWEWKDEYGGRIIGQLKKLGSSCDWDRERFTMDEGCSKAVEEVFVKMYEKGMIYKGSRIINWCPVCHTSISDAEVEYEDQAGHFWHIKYPVVGTDEYLCFATTRPETMLGDTAVAVHPEDGRYMHLIGKKVKLPFVDREIPIIGDSYVEKDFGTGVVKITPAHDPNDFEVGKRNNLPEINIMNDDATINANGGKFEGMDRYAARKQIVKELDEMGLLVKVEDYSHNVGTHDRCNTTIEPLIKQQWFVKMDELIKPAVEAVK-NKDIELVPERMEKVYFNWTDNIRDWCISRQLWWGHRIPAYYCDKCGKVVVSKTTPTTCECGHDHFTQDPDTLDTWFSSALWPFSTLGWPEKTEDLEYFYPTDVLVTGYDIIFFWVIRMIFSGYEQMNEKPFKTVLFHGLVRDSQGRKMSKSLGNGIDPLEIIEQYGADALRFMLITGNATGNDMRFYMERVEAARNFANKVWNASRFIMMNMQQMEEAGMDAKVDSVDM-STLTDADKWIISKVNTLTKDVTEHLEKFDLGIAAQKVYDFIWEEFCDWYIEMVKPRLYGDDQATKTAAIYTLRTVLDSALKLLHPYMPFITEEIFCTLKEMEGRLSADESVMISKWPEYKEEFNFAKEEEAVEIIKEAVKAIRNARTEMNVPPSRKAKVIVVSDSEKVREIFANSKVFFASLGYASEIVIQSDKNGIDSDAVSIVTATATIYIPF----ADLVDIEKE---IERLSKEKDRLAGELKRVNGMLANPNFVSKAPEAKLAEERAKLEKYASMMAQVEERLAHFK 891
>gi|183219675|ref|YP_001837671.1| valyl-tRNA synthetase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189909811|ref|YP_001961366.1| Valine--tRNA ligase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167774487|gb|ABZ92788.1| Valine--tRNA ligase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167778097|gb|ABZ96395.1| Valyl-tRNA synthetase (Valine--tRNA ligase; ValRS) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (896 aa)
Score = 1443, Expect = 1.8e-157, Identities = 347/858 (40%), Positives = 515/858 (60%)
  Q:    13 LSKKYDHKICEQQFS-LWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS----------NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYK-----------KDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTP-----KNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRT------SNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKL-FKISDEVINILNTAKINIVK-QDIKSLKPDYVENNYLI--FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKLLSS 870
           L  +YD +  E +++ +W  +K        + K ++SI++PPPNVTGNLH+GHALN TIQD +IR    KG +  W+ GMDHAGIATQ   E+ L +   S  D +R+E +  ++EW ++ G  I  Q + +G  +D+  E FT ++  ++ V +VF  ++++GLIYR + ++NW    ++AIS+IEV  KE +  LY+I+Y  S          N  +Y++VATTRPET+F D  +  +P DKRY N  +KF   P+  KEI ++ D +VD +FG+G++K TPAHD NDYE G++ KL  I+  N DGT N +   +  L   +AR + VE LE    +EK+E  + +VG ++R  AV+EP++S QWFVK+   +K  IE+ KS  K+QF P  +EK    WM N+ DWCISRQLWWGH+IP +Y            +++  ++        ++   +D DVLDTWFSSGLWP +       T+ LK     +PT+VLVTGFDIIFFWV RM+   L    +VPF+   I GL+RD+   K SKSLGN VDP D++ KYG D+ R FL +    G+D+ + E ++     F NK+WNS R++ M     N  ED +P      +LED D WIL++F++    + + ++ Y F      I DF W  FC+ Y+EL+K R        + E    VL  ++KK L L HP  PF+T  ++  F  ++K+   L + +F K   + E+S     +E V +II KIR    E  +   K   + L+  N +L   +  E  +IL  +K   ++  D   LK       + I   IL  E +     E   +EK KK+I+   SE+ +    ++N SF+EKA  + +E E+ K    KEK E  ++ LEK+  S
  S:     5 LPDRYDPETVEPKWNQIWDEKKTFAPDT--SRKETFSIVIPPPNVTGNLHIGHALNHTIQDIIIRIERKKGKNVVWVPGMDHAGIATQVVVERELAKEGKSRTDFTREEFIEKVWEWKKHSGGMISKQQRLLGESVDWSKERFTFDEGLSKAVIKVFRTLFDEGLIYRGERIINWCPVTKTAISDIEVEYKEKQGKLYHIKYPKSEFKSKDPKTLNQGEYIVVATTRPETMFGDVAVCAHPDDKRYTNLKDKFVFLPIAEKEIPVLFDSFVDQEFGSGLVKITPAHDPNDYEAGQRLKLTPINIMNLDGTLNEFTGKYNGLDRFEARKRVVEELESKGYIEKIETHVHSVGHNQRGGAVIEPLLSTQWFVKIESLAKPAIEVVKSG-KVQFQPKMWEKTYFEWMENIRDWCISRQLWWGHRIPAYYAPNGDMVVAESLEEAISLFEKKGISVTKDTIKQDEDVLDTWFSSGLWPFSVFGWPEKTEELKQ---YYPTSVLVTGFDIIFFWVARMIMNGLKFMGDVPFQKVLIHGLVRDKDGKKFSKSLGNVVDPLDMMSKYGTDSFRFFLAAVLPEGKDILFDESRLDGYRSFCNKIWNSSRFIFM-----NLPEDFSPIEPNLDSLEDTDLWILHEFDQMLGRYEKAYSGYLFFEMANAIYDFVWGSFCDWYLELTKARVYGNVTPESAEKARQVLVSVLKKSLGLLHPFMPFITEEIH--FLLESKE---LAKTEFPKAYGVSETSPAVVRMELVREIITKIRNMRAELGVKPEKKCKVILKCSNKELKVMMERESKSILQLSKAESLEFLDSYELKNTDSVGAFSIGEIILPLEGIFDFEKEKQRLEKEKKQIQ---SEMEKLENKINNPSFLEKAKPDVVEKEREKYNTWKEKLESTVRALEKIGQS 895
>gi|30350185|gb|AAP31493.1| putative valyl-tRNA synthetase [Western X phytoplasma] (860 aa)
Score = 1443, Expect = 1.8e-157, Identities = 335/858 (39%), Positives = 518/858 (60%)
  Q:    13 LSKKYDHKICE-QQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYL-SNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPD-----YVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           + +KY+ K+ E ++++ W  +     +N   +K  ++I++PPPN+TG LHLGHA N T+QD +IR   + G    ++ GMDHAGIATQ+K ++ L+E   + ++ +++  +     W      NI  QW+ +   LDY+ E FTL+K  +++V +VF+++Y+  LIYR   ++NWD   QS IS +EV  +EVE  LYY+RYYL  ++ +Y+ VATTRPETIF D+ L V+P D+RY++ I +  + P TN +I IIAD YV+  FGTGV+K TPAHD ND+++ +++ L I+SC N +GT N  A  ++ +   D R + ++ L    L+ K+E    +VGFS  +  V+EP +S QWF+K    S+ V++      +I FFP +F K   NW+ NL DWCISRQLWWGH +PVWYK D  EI V ++ P +   + RD DVLDTWFSS LWP+ T     +   L    FP + LVTG+DI+ FWV +M   S+ L +++PFK   + GLIRD   +KMSKS GNGVDP D+I+KYG DALR FL ++SSPG DL Y E K+ S W FINK+WN  R++++     N + D+T    E     +K++L++ ++        ++KY F +    + +F W+D  N ++E  K      +R  +  S+ + L Y++K  L L HP  PFVT  +Y+ F F     I+ E+L      N           +I K+R F    KI    ++ +++E    KL +I + +  +L +  +    + I  LK +     + + +  +F+  K+      N+++N  +  + ++ + SEI R   +L+N SF+EKA K KI+ E+ K +K+   L + EKL+ +
  S:     1 MEQKYNFKLVENKRYAKWLEKGYFKTQN-NPDKTPFTIVIPPPNITGKLHLGHAWNNTLQDIIIRRKKMLGFDVLFLPGMDHAGIATQSKIKQKLKEEGFAEQNLTKELFLKYAALWKDEYTKNIHTQWERLSLHLDYDYEKFTLDKDFSQVVEKVFIQLYDKKLIYRDYKIINWDPFTQSTISELEVNYQEVEGKLYYLRYYLVDDNANYVEVATTRPETIFADQTLTVHPDDERYQHLIGQKVVVPGTNAKIPIIADNYVEKGFGTGVLKVTPAHDLNDFQIAQRHDLQIVSCMNPNGTMNELAQEYDKMDRFDCREQLIQKLTAKKLVAKIEDYTHSVGFSSISGVVIEPRLSLQWFLKTKAISQSVLQ----EHQINFFPKRFLKTFNNWLENLEDWCISRQLWWGHPLPVWYKGD--EINVQSQDPGDG--FQRDPDVLDTWFSSALWPLCTLGWPNNNVELFQRRFPVDTLVTGYDILTFWVSKMALQSMNLIEKIPFKDVLLHGLIRDSQGHKMSKSKGNGVDPIDIIDKYGTDALRWFLTTNSSPGADLLYNETKIASSWNFINKIWNISRFIKL-----NINTDQTNFQAETLLLPEKFLLSQLSRLMEATNHLYDKYEFNIVGSLLYNFVWEDLANWHLEFLKIVLKEYDREVSLNSQKFAL-YILKITLQLLHPFIPFVTDAIYEEFAF--TQPIINEQLPQINAVNSSSDDFLTFKNLIVKMRQFRQNYKITKTTLLSLYIEAPIEKLSEI-NTIKPVLKSFLMAFEIKTIHKLKQEQYEWLFFDKDTYVFMFKKDLQALKKNQSDN--QSPQLLKKLLSEIKRSEKILNNPSFLEKASKVKIQEEQEKYKKY---LSQYEKLIKN 855
>gi|146297043|ref|YP_001180814.1| valyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410619|gb|ABP67623.1| valyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] (874 aa)
Score = 1443, Expect = 2.0e-157, Identities = 328/854 (38%), Positives = 518/854 (60%)
  Q:    19 HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESK-----LWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKE--SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE-------------VINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
            ++ ++ + +W  +K  + K +  +K  ++I++PPPN+TG LH+GHALN TIQD LIRF  ++G  A W+ G DHA IAT+ K  + ++E  ++ +   R++ +   +EW +  G  I  Q K +G   D++ E FT+++  +  V +VFV++Y  GLIY+ + ++NW    ++ IS+ EV  +E +  L+YI+Y   ++  Y++VATTRPET+  D  + VNP D+RYK+ I K  + P+ N+EI IIADEYVD++FGTGV+K TPAHD ND+E+G+++ L +I   +  G  N  A  +      +AR   V  L+   LL K E    NVG   R + V+EP++S+QWFVK+   ++  I + K   KI+F   +FEK   NWM N+ DWCISRQLWWGH+IP +Y KD   + V  +  K      +  +Y +D D LDTWFSS LWP +T    +  + L   +PT+VLVT +DIIFFWV RM+F ++    + PFK+  I G++RD    KMSKSLGNG+DP ++IEKYGADALR  L++  SPG D  +  EKV++   F NK+WN+ R+V MN   D N+  D++       ++WIL++ +    E  +   K+   ++ +K+ DF WD+FC+ YIE+SK    N+E++      +VL  ++  IL L HP  PFVT  +Y N    +++S+++ +       N  +  S +E ++++I  IR    E  IP N         + PK++  SD+             V  + N  ++ +V QD+       V +  + +I  KE ++  + E   ++++ +E E +  E+ R   +L N++F++KAP++ +  EK K E+++  LK +E  L   K
  S:     8 QEVEDRLYKMWLEKKYFHAK-IDYSKKPFTIVIPPPNITGQLHMGHALNNTIQDILIRFKRMQGYCALWVPGTDHASIATEAKIVEKMKEEGLTKEMIGREKFLERAWEWKRVYGGRIIEQLKKLGASCDWDRERFTMDEGLSNAVKEVFVRLYEKGLIYKGERMINWCPTCKTTISDAEVEYEEKKGKLWYIKYPAKDNSFYVVVATTRPETMLGDTAVAVNPNDERYKHLIGKTVVLPIVNREIPIIADEYVDMEFGTGVVKITPAHDPNDFEIGQRHNLPMIQVIDTKGYMNENAGKYVGQDRFEARKNIVNDLKDLGLLVKEEDYTHNVGHCYRCSTVIEPLVSKQWFVKMKPLAEPAIRVVKEG-KIKFILERFEKIYFNWMENIKDWCISRQLWWGHRIPAYYCKDCDNMMVSRQEVKVCSKCGSTNVY-QDEDTLDTWFSSALWPFSTLGWPEETEDLKYFYPTDVLVTAYDIIFFWVARMIFSAVEHMGKEPFKYVLIHGIVRDAQGRKMSKSLGNGIDPLEIIEKYGADALRFTLVTGISPGNDTRFHMEKVEANRNFANKIWNAARFVIMNLDIDTNYKPDESKFTFT--ERWILSRLDTLIKEVTENLEKFEIGIAAQKLYDFIWDEFCDWYIEMSKPILYNKEAENNKEVQYVLLTVLTNILKLLHPFMPFVTEEIYLNLP-HSEESLVIAKWPEPMGYNYAQDISMVEKLIELIRSIRNLRVERNIPAN---------IKPKVYVKSDDECMLQQRQVWEIYVKRLANIEEV-VVAQDVPQDSVSLVLSWGVAYIKLKE-IIDIDAE---LKRLTEERERLLREVERSEKLLGNQNFLQKAPQKVVNEEKEKYERYKQMLKSVEDQLERIK 871
>gi|119773927|ref|YP_926667.1| valyl-tRNA synthetase [Shewanella amazonensis SB2B] >gi|119766427|gb|ABL98997.1| valyl-tRNA synthetase [Shewanella amazonensis SB2B] (953 aa)
Score = 1442, Expect = 2.3e-157, Identities = 347/841 (41%), Positives = 513/841 (60%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS------NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNN---------YAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPP---KNEEL-----YVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKT---KDSILL---ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIF-----------ILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K Y+ +  EQ       +K   K +  A++ +Y I++PPPNVTG+LH+GHA   TI D LIR+  +KG +  W  G DHAGIATQ   E+ L  E   S  D  RD  +  ++EW    G  I +Q + MG  +D++ E FT+++  +  V +VFV++Y+D LIYR K LVNWD KL +AIS++EV  KE   ++++ RY L+      + KDYL+VATTRPET+  D  + V+P+D+RY + I K  I P+ N+ I IIADEYVD  FGTG +K TPAHDFNDYE+GK++ L   NI++            N DG+ N+         YA G +  K  DA V   E L    LLEK+E     V + +R+  V+EP++++QW+V V + ++  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY +  K +YVG       +N  L       +D+DVLDTWFSS LW  +T      T  LK+     PT+VLVTGFDIIFFWV RM+  ++Y       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+ + +  +      L   D+W++ KF +    F +  N Y F ++   + +FTW+ FC+ Y+EL+K    N     Q      L  +++++L L HPM P++T  ++D  K       D+++L      D  K+     + +E V Q+I  +R    E  I  +K        L+  L  +SDE     + A+I   +    +L    +E+  ++            ++ + +LL    G  + A  + +I K++E +  E++R  G LSN+ F+ KAP E IE E++K
  S:     1 MEKTYNPQSIEQALYRVWEEKGYFKPHGDASQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLIRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEQGKSRHDLGRDAFMEKVWEWKAQSGGTITSQLRRMGASVDWDRERFTMDEGLSNAVQEVFVRLYDDKLIYRGKRLVNWDPKLHTAISDLEVENKEKAGHMWHFRYPLAGTELTADGKDYLVVATTRPETMLGDSAVAVHPEDERYASLIGKEIILPIVNRRIPIIADEYVDKDFGTGCVKITPAHDFNDYEVGKRHSLPMFNILTQDATIRALAEVLNTDGSHNSELDASLPERYA-GLDRFKARDAIVAEFETL---GLLEKIEPHALKVPYGDRSGVVIEPLLTDQWYVAVQKLAQPAIEAVENG-DIKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDEAGK-VYVGRSEDEVRQNHNLGSDVKLRQDDDVLDTWFSSALWTFSTLGWPEQTPELKT---FHPTDVLVTGFDIIFFWVARMIMMTMYFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIDLESLVQKRTGNMMQPQLAAKIEKSTRKEFENGIEPHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTEEQDCGQGGGDMKLSLADRWVIGKFQETVKAFDEHINAYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGSEAEQRGTRHTLVTVLEQLLRLMHPMMPYITETIWDRVKPLAGVEGDTLMLMSFPEFDAAKVDAKAMADLEWVKQVIVAVRNIRAELNIAPSK-------PLSALLRGVSDE-----DKARIEANQAFFGTLAK--LESMTILAEGEAAPMATTQLIGEMELLIPMAGLIDVAAEMARIDKQLEKLTGEVARIEGKLSNQGFVAKAPAEVIEKERAK 930
>gi|91774447|ref|YP_544203.1| valyl-tRNA synthetase [Methylobacillus flagellatus KT] >gi|91708434|gb|ABE48362.1| valyl-tRNA synthetase [Methylobacillus flagellatus KT] (943 aa)
Score = 1440, Expect = 4.7e-157, Identities = 323/868 (37%), Positives = 515/868 (59%)
  Q:     5 SNIKNNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA-VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSE-------YSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYV---------RDNDVLDTWFSSGLWPITTTD--ALKSKDA-------LFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSS--DFNFDEDKT-PKNLEDF---DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYD---NFKFKTKDSILLERLDFKKISNLKESS---IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           ++I  +  L K ++ K  E + +  W  +         + ++++ ILLPPPNVTG LH+GH  N TI D L R++ ++G +  W  G DHAGIATQ   E+ L    IS  D  R++ +  ++EW +  G +I  Q + +G   D+  E FT+++  +  V + FV++YN+GLIYR K LVNWD KL +A+S++EVI +E + +L++IRY L++    L VATTRPET+  D  ++V+P+D+RY + I K    PL ++EI +IAD+YVD +FGTGV+K TPAHDFNDY +G+++KL +IS    DG  N+ A V ++ L+   AR + V  LE    L KV+K    V   +RT  V+EPM+++QWFV +S+        ++K +E+  ++ +I+F P  +      W+ N+ DWCISRQLWWGHQIP WY  D K +YV     + ++L           RD DVLDTW+SS LWP +T D    + KD          P++VLVTGFDIIFFWV RM+  + ++  ++PFK  Y+ GLIRD    KMSKS GN +DP D+I+                                      +G DALR    S +SPG D+ +  ++ +    F NKLWN+ R+V MN+   D   ++ KT P+   DF   D+WI++   +  ++  + F +Y F    + I  F WD++C+ Y+EL+K +  N     Q +    L  +++ IL L HP+ PF+T  ++        +T  SI+LE+    + + L E +   +  + + ++  R    E  +     + +     + KL   +  +  +   + + I+ +  ++  P  +  ++ + +  + D+          E++ KEI  ++ E+S+    L N+SF+ +AP   +E EK++       L +L+  L+  K
  S:     3 TDISASQTLDKSFEPKNIESRWYQFWEARGYYAAGLDSSKQDNFCILLPPPNVTGTLHMGHGFNQTIMDALTRYHRMRGANTLWQPGTDHAGIATQIVVERQLDAQGISRHDLGREKFLEKVWEWKEYSGGSITKQMRRLGTSPDWSRERFTMDEGLSRTVTETFVRLYNEGLIYRGKRLVNWDPKLHTAVSDLEVISEEEDGHLWHIRYTLADGDGELTVATTRPETMLGDVAVMVHPEDERYAHLIGKHVKLPLCDREIPVIADDYVDREFGTGVVKVTPAHDFNDYAVGQRHKLPLISILTLDGHINDAAPVQYQGLERFAARKQIVADLEAQGYLVKVDKHKLKVPRGDRTGVVIEPMLTDQWFVAMSKPGADGKSITQKALEVV-ANGEIRFVPENWVNTYNQWLNNIQDWCISRQLWWGHQIPAWYSDDGK-VYVAHDEAEAKQLAANDGYQGHLKRDEDVLDTWYSSALWPFSTLDWTGDEEKDKANLALQQFLPSSVLVTGFDIIFFWVARMVMMTKHITGKIPFKDVYVHGLIRDAEGQKMSKSKGNVLDPIDLIDGIGIEELVKKRTTGLMNPKQAEQIEKRTRKEFPEGIPAFGTDALRFTFASLASPGRDIKFDLQRCEGYRNFCNKLWNAARFVLMNTQGKDCGLEDCKTQPEGYLDFSQADRWIVSLLQRTEADIERGFAEYRFDNVAQAIYKFVWDEYCDWYLELAKVQLQNGGEAQQRATRRTLLRVLETILRLAHPLMPFITEEIWQIVGPLSGRTGPSIMLEQYPVSQPAKLDEQAEAWVALLKESVDACRSLRGEMNVSPAARVPLIAAGDDEKLAAYAPYLKALAKLSDVEIMAELPEAEAPVALAGDFKLMLKIEIDVTAER------ERLGKEISRLEGEVSKAQAKLGNESFVARAPAAVVEQEKARLAAFSDTLSKLQAQLAKLK 943
>gi|71911105|ref|YP_282655.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] >gi|71853887|gb|AAZ51910.1| valyl-tRNA synthetase [Streptococcus pyogenes MGAS5005] (801 aa)
Score = 1435, Expect = 1.6e-156, Identities = 320/782 (40%), Positives = 474/782 (60%)
  Q:    91 MDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITT-----TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN--RTSNQESKLW---VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-----IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKS--LKPDYVENNYLI---FILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           MDHAGIATQ K E+ LRE  IS  D  RD+ +  ++EW       I+ QW  MG  +DY  E FTL++  ++ V +VFV +Y  G IYR + ++NWD   ++A+S+IEVI K+VE   Y++ Y L +    L VATTRPET+F D  + VNP+D RYK+ I K  I P+ NK I I+ DE+ D +FGTGV+K TPAHD ND+E+G+++ L  ++  N+DGT N  A  F  +   +AR   V  LE+   L  +EK + +VG SER+ AVVEP +S QWFVK+ E +K+ ++ Q++  ++ F+P +F    + WM N++DW ISRQLWWGHQIP WY  +  EIYVG + P+ ++ + +D DVLDTWFSS LWP +T     TD    K   FPT+ LVTG+DIIFFWV RM+F SL      PF++  I GLIRDE   KMSKSLGNG+DP DVIEKYGAD+LR FL + S+PG+D+ +  EK+ + W FINK+WN  RY+ MN+     ++ ++  N+            D+WIL+  N+  ++  + F+K+ F V+   + +F W++F N Y+EL+K    + N+  K+    VL Y + KIL L HP+ PFVT  +Y  +    + SI+   +D+  +    E+      +E +  +I  +R    E  +  +K I I ++  + +L    +  IN +     N  K +I S    P+    + +      L   DLL    E   + ++ KE+   + E+      L N+ F+  A  E ++ EK K+  ++ K    ++ ++  K
  S:     1 MDHAGIATQAKVEERLREQGISRYDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALQVATTRPETMFGDVAVAVNPEDPRYKDLIGKNVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPNDFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVHSVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENVHDWVISRQLWWGHQIPAWYNAEG-EIYVGEEAPEGDD-WTQDEDVLDTWFSSALWPFSTMGWPDTDVEDFK-RYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEGRKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNISRYILMNNEGLTLEDAES--NVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTEEIYAQY---AQGSIV--TVDYPVVRPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITILVKTADSELEDFFNSNINYIKCFT-NPEKLEISSAIAAPELAMTSIITGAEIYLPLADLLNVEEE---LARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQERIAEMK 797
>gi|114567165|ref|YP_754319.1| valyl-tRNA synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338100|gb|ABI68948.1| valyl-tRNA synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (883 aa)
Score = 1433, Expect = 2.8e-156, Identities = 315/808 (38%), Positives = 486/808 (60%)
  Q:    46 SYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPP------KNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQES---KLWVLNYL---IKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIF-NFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSL----------KPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           ++SI++PPPNVTG+LHLGHAL+ T+QD L R+  ++G +A W+ G DHAGIATQ + E+ L    ++  +  R++ +  ++EW    GN I  Q   MG   D+  E FT+++  +  V +VFV +Y  GLIY+   ++NW  +  +AIS+IEV  ++ + +L++IRY L    ++++VATTRPET+  D  + V+P D+RY++ I K  + PL N+ I + AD+YVD +FGTG +K TPAHD ND+++G ++ +  I+  ++ G  N  A  ++ L     R++ V+ LE    L KVE+    VG  +R + V+EP++S QWFVK+   ++  I+ +    +I+F P +F +  INWM N+ DWCISRQLWWGH+IPVWY ++  EI    + P      ++ EL  +D DVLDTWFSS LWP +T    D  +  D  +PT VLVTG DIIFFWV RM+F  +    EVPF    I GLI D    KMSKSL NG+DP +VIEK+GAD LR  L++  +PG D+ +  +KV++   F NK+WN+ R+V MN   F    +     LE+    D+WIL++     +E     +KY+   + +++ +F WD+FC+ YIEL+K R  NQ++   +L V N L   +  IL L HP  PF+T  +Y  F      +I+L+     K   +  + +E + Q++  IR   N  ++       +I+  +L   +  + DEV   +      I+KQ  +            KP+   +  L        L G  +    I++++KE++  +S++ +    L+N+ F+ KAP E IE E+SK
  S:    40 AFSIVMPPPNVTGSLHLGHALDNTLQDILTRWRRMQGYNALWLPGTDHAGIATQARVEEALAREGLNKYELGREKFLERVWEWKHLYGNRITQQLSLMGSSCDWSRERFTMDEGCSRAVREVFVNLYEKGLIYQGDYIINWCPRCHTAISDIEVEHEDSDGHLWHIRYPLEGEDEFIVVATTRPETMLGDTGVAVHPDDERYQHLIGKKILLPLMNRVIPVFADDYVDKEFGTGAVKVTPAHDPNDFDMGLRHGVEQIAVIDKYGFMNENAGPYQGLDRYACRLQVVKDLEAQGYLLKVEEHRHAVGHCQRCDTVIEPLVSTQWFVKMKPLAEPAIQ-KVLDGEIKFIPERFTRIYINWMENIRDWCISRQLWWGHRIPVWYCQECGEIICSKEDPNHCPNCESAELK-QDEDVLDTWFSSALWPFSTLGWPDKTRDLDFFYPTTVLVTGRDIIFFWVARMIFSGIEHMGEVPFYDVNIHGLILDAQGRKMSKSLNNGIDPIEVIEKFGADTLRFSLITGVTPGNDVRFHWDKVENTRNFANKIWNASRFVLMNMEGF----EAIKPGLEELSLADRWILSRLQLTIAEVTNLLDKYDLGEAARRLYEFIWDEFCDWYIELAKPRLVNQDNPRERLVVQNVLRDVLVDILRLLHPFMPFITEEIY-QFLPAHSATIMLDPWPESKEELIWLAEVEQMQQLMQAIRALRNIRSE------FNINPSILIKAIMVVPDEVRRQVFMDNQAIIKQMARLEQLELLYELEKKPEQAVSALLSLAEIYVPLEGIIDVEKEIQRLQKELKAAESDLQKAENKLNNQKFLSKAPPEVIEKERSK 863
>gi|15644561|ref|NP_229614.1| valyl-tRNA synthetase [Thermotoga maritima MSB8] >gi|148270232|ref|YP_001244692.1| valyl-tRNA synthetase [Thermotoga petrophila RKU-1] >gi|12585357|sp|Q9X2D7|SYV_THEMA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|4982399|gb|AAD36880.1|AE001819_3 valyl-tRNA synthetase [Thermotoga maritima MSB8] >gi|147735776|gb|ABQ47116.1| Isoleucyl-tRNA synthetase [Thermotoga petrophila RKU-1] (865 aa)
Score = 1431, Expect = 4.7e-156, Identities = 321/857 (37%), Positives = 506/857 (59%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADL-FEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL--WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINIL----NTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +LS +Y+    E + +  W  +     K +      +SI++PPPN+TG +H+GHALN T+QD ++R+  +KG    W+ G DHAGIATQ   EK+L + +   +++   EK  ++ +EW+      IR Q K +G  +D+  E FTL++  +  V +VFV++Y  GLIYR K +VNW  + ++ +S+ EV  KE ++ LYY++Y + +S +Y++VATTRPET+  D  + V+P+D+RYKN++ K  I PL  +EI ++AD+YVD +FGTG +K TPAHD NDY + +++ L +I  F+++   N     ++ L   +AR K V+ LE+   L K+E    +VG   R + V+EP +S+QWFV     +K+ IE  ++  +I+FFP ++ K  +NWM  + DWCISRQLWWGH+IPVWY +D   + V  +  +  E        +D DVLDTWFSS LWP +T    +  + L   +PT++LVTGFDIIFFWV RM+        + PF H YI  L+RD++  KMSKSLGNG+DP +VI++YGAD +R  L   ++ G D+        +   F NK+WN+ R+V MN  D+   ++   +NL+  DKWIL + NK   E       Y+F ++ + I +F WDDFC+ YIE SK R   +E  L   VL  ++   L L HP  PF+T  L+        +SI + +   ++ + I    E     ++ ++  +R    E  +P ++ + +++     K +++++E   +L    N  +++ V +        YVE     ++    DL G  +     E++K+ +E ++ EI R    L+NK F+EKAP+E +E  K K   +  +L  LE +L
  S:     3 ELSTRYNPAEIETKWYRYWEEKGYFTPKGVG---EKFSIVIPPPNITGRIHMGHALNITLQDIVVRYKRMKGYDVLWVPGEDHAGIATQNAVEKFLLQTQGKTREEIGREKFLEITWEWANKYRREIREQIKALGASVDWTRERFTLDEGLSRAVRKVFVELYRKGLIYRGKYIVNWCPRCKTVLSDEEVEHKEHKSKLYYVKYPVKDSDEYIVVATTRPETMLGDTAVAVHPEDERYKNFVGKTLILPLVGREIPVVADKYVDPKFGTGAVKVTPAHDPNDYLIAQRHNLPMIEIFDDNARINENGGKYKGLDRYEAREKIVKDLEEQGFLVKIEDYTHSVGHCYRCDTVIEPKLSDQWFVSTKPLAKRAIEAVENG-EIRFFPERWTKVYLNWMYEIRDWCISRQLWWGHRIPVWYCQDCGHLNVSEEDVEKCEKCGSTNLKQDEDVLDTWFSSALWPFSTLGWPEETEDLKRYYPTDLLVTGFDIIFFWVARMIMMGYEFMNDKPFSHVYIHQLVRDKYGRKMSKSLGNGIDPLEVIDEYGADPMRFTLAILAAQGRDIKLDPRYFDAYKKFANKIWNATRFVLMNLEDY---KEVPLENLKTVDKWILTRLNKTVEEVTNALENYDFNIAARTIYNFFWDDFCDWYIEASKPRLKTEERNLVQTVLVKVLDASLRLLHPFMPFLTEELWQKLPV-AGESITIAKWPEIERELIDETAEKEFTRLMNMVRGVRNVRAEMNLPQSQRVKVYI-----KGYEVTEEEELLLKTLGNIEEVSFVNEKPPKTATAYVEEEIEAYV----DLGGLIDFEKEKERLKQIMEKIQKEIDRLEKKLANKDFVEKAPEEVVEETKEKLNTNRERLARLESIL 861
>gi|71908698|ref|YP_286285.1| valyl-tRNA synthetase [Dechloromonas aromatica RCB] >gi|90103535|sp|Q47BG6|SYV_DECAR Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|71848319|gb|AAZ47815.1| Valyl-tRNA synthetase, class Ia [Dechloromonas aromatica RCB] (943 aa)
Score = 1429, Expect = 9.1e-156, Identities = 330/858 (38%), Positives = 505/858 (58%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSE-------YSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYV---------RDNDVLDTWFSSGLWPITTTD-----ALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN--SSDFNFDEDK--------TPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFK----FKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIK--KEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +L+K ++    E++ +  W TQ         +  +++ ILLPPPNVTG LH+GH  N TI D L R+  ++G +  W  G DHAGIATQ   E+ L    IS  D  R++ +  ++EW +  GN I  Q + MG   D++ E FT++   N++V + FV+++N+GLIYR K LVNWD KL +A+S++EV+++E +  +++IRY L++  D L+VATTRPET+  D  ++V+P+D+RYK+ I +    PLT++EI IIAD YVD++FGTG +K TPAHDFNDY +G+++ L +IS    D   N N    +  L   DAR   V  LE   +LEK +K    V   +RTN V+EPM+++QWFV +S+        ++K +++  S  +I+F+P  +      W+ N+ DWCISRQLWWGHQIP WY  D+ +I+V     + +             RD DVLDTWFSS LWP +T D     A+ + + L     P++VLVTGFDIIFFWV RM+  +  +  ++PFKH Y+ GLIRD    KMSKS GN +DP D+I+                                      +G DALR    S +SPG D+ +   +      F NKLWN+ R+V MN    D   +  +         P      D+WI+++  +   E  Q F  Y F +  + I  F WD+FC+ Y+E++K        + Q      L   ++ +L L HP+ PF+T  L+         KT DSI+L    R +  KI    E+ +E +  +    R  N   ++  +  + + L V      +IS+    +    K++ V Q +  +  D +     + ++ +  L+         E+I+  KEIE ++ +IS   G L+N+ F+ +AP   I+ EK +       L++L+  L+
  S:     2 ELAKAFEPADIERRWYPEWETQNYFAAGVDASKADNFCILLPPPNVTGTLHMGHGFNQTIMDALTRYYRMRGHNTLWQPGTDHAGIATQIVVERQLDAQGISRHDLGREKFLEKVWEWKEYSGNTITKQMRRMGTSPDWKRERFTMDAGLNKVVTETFVRLFNEGLIYRGKRLVNWDPKLNTAVSDLEVVQEEEDGFMWHIRYPLADGSDSLVVATTRPETMLGDTAVMVHPEDERYKHMIGQMVKLPLTDREIPIIADSYVDLEFGTGCVKVTPAHDFNDYAVGQRHGLPMISILTLDAKVNENAPEKYRGLDRFDARKAVVADLEALGILEKTDKHKLKVPRGDRTNVVIEPMLTDQWFVAMSKPGDDGKSITEKALDVVHSG-EIKFYPENWVNTYNQWLNNIQDWCISRQLWWGHQIPAWY-GDNGQIFVAHSEAEAKAEAAKQGYTGTLKRDEDVLDTWFSSALWPFSTLDWTGDEAIDAANPLLKQYLPSSVLVTGFDIIFFWVARMVMMTKQITGQIPFKHVYVHGLIRDGEGQKMSKSKGNVLDPIDLIDGIGLEALIEKRTTGLMNPKQAESIAKKTKKEFPEGIASFGTDALRFTFASLASPGRDIKFDLNRCDGYRNFCNKLWNATRFVLMNVEGHDLALEHQQNGPACGGSAPLEFSFADRWIVSQLQRVEQEVEQHFTDYRFDLIAQAIYKFIWDEFCDWYLEIAKVEIQTGNDAQQRGARRTLVRTLEAVLRLAHPLIPFITEELWQTVAPIAGRKTHDSIMLAAYPRAEEYKIDAASEAKVERLKALAYACR--NLRGEMNVSPALRMPLLVAGGGA-EISEFAAILQALGKLSEV-QIVDDMPADAMAP---VAVVGETRLMLKVEIDVAAERIRLAKEIEKLEKQISIAQGKLANEGFVARAPAAVIDQEKQRVADFTATLEQLKPQLA 938
>gi|158521740|ref|YP_001529610.1| valyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] >gi|158510566|gb|ABW67533.1| valyl-tRNA synthetase [Desulfococcus oleovorans Hxd3] (884 aa)
Score = 1428, Expect = 1.2e-155, Identities = 315/844 (37%), Positives = 467/844 (55%)
  Q:     9 NNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDG-TTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-----NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELS------KNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNL-----KESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVKQDIKSLKPDY----VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKS 852
           + ++L K Y  +  EQ+ +  W  +K          +  YSI++PPPNVTG LH+GHALN T+QD L R+  L G +  W+ G DHAGIATQ   EK L           R   +  ++ W +  G  I  Q K +G   D++ E FT++   +  V +VFV+++ +GLIYR + L+NW  +  +AI++IEV   E +  LY+I Y   +    L+VATTRPET+  D  + VNP D+RY +   +  + PLT + I +I D YVD  FGTG +K TPAHD ND+ELG+ + L+ I   ++ G  T      F  L+    R   V  LE   LL KVE    +VG   R   V+EP +S+QWFV V   ++K IE   +  + +  P  + K    WM N+ DWC+SRQ+WWGHQIP WY +   E+ V  + P      N    V+++DVLDTWFSS LWP +T    D  +  +  +PT+VLVTGFDI+FFWV RM+   L+  KE+PF   YI  L+RDE   KMSKS GN +DP D+I  YGADALR  L + ++ G D+   E +++    FINKLWN+ R+  M+  D  + E+  P N    D+WIL++ + A        + Y F  +   +  F W + C+ Y+E +      KN    +E    VL ++++  L+L HP+ PFVT  ++      T+ SI+  +  F            ES +  V+ ++  IR    E  IP +K +D+ + V +  + +  +E    +IN+   A  +I        KP +    V    L+++L    L G  + A  + +I+KE+  V+ E+      LSN  F+EKAP   ++  K+
  S:     2 SGSELDKGYVAQGVEQRWYDFWEKEKLFAASEEGHGRPGYSIVIPPPNVTGMLHMGHALNITLQDILCRYRRLCGDNVLWVPGTDHAGIATQNVVEKKLMAEGTDRHALGRQAFIDRVWAWRKEYGGTIIRQLKRLGASCDWDRERFTMDDGLSRAVREVFVRLHREGLIYRGEYLINWCPRCHTAIADIEVTYDERQGALYHIHYPFEDGSQGLVVATTRPETMLGDTAVAVNPDDERYAHAKGRKVLLPLTGRTIPVIEDRYVDTAFGTGALKVTPAHDPNDFELGRVHGLDTIKVIDDRGFMTEAAGDRFAGLERFACRKAVVAALEAEGLLVKVEDYTHSVGTCYRCQTVIEPNLSKQWFVAVKPLAEKAIE-AVAQGRTRIVPDTWTKTYYEWMNNIRDWCVSRQIWWGHQIPAWYCQACGEVIVAEETPTACTACNSTDLVQESDVLDTWFSSALWPFSTLGWPDRTRLLETFYPTSVLVTGFDILFFWVARMLMMGLHFMKEIPFHDVYIHALVRDEEGKKMSKSTGNVIDPIDIINTYGADALRFTLTAFAAQGRDIKLSESRIEGYRHFINKLWNAARFAMMH-VDRGY-EEPPPANAGLADRWILSRLDNARKSTADALDTYRFNDAAGALYQFVWHELCDWYLEAAKPDLYGKNGEEQKEKTKQVLWHVLRDTLVLLHPIIPFVTEEIWHALP-GTQGSIM--KASFSGAGGTGSDVDAESRMALVIDVVTGIRNVRGEMNIPPSKNLDVVVHVADETVHRHLEEQQEMIINLARLASFSIAPS---GEKPGHAAVSVVGEALVYVL----LEGVIDFAAELARIEKELAKVEKELDGVTRKLSNSGFLEKAPASVVDAVKA 861
>gi|188585735|ref|YP_001917280.1| valyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350422|gb|ACB84692.1| valyl-tRNA synthetase [Natranaerobius thermophilus JW/NM-WN-LF] (885 aa)
Score = 1427, Expect = 1.4e-155, Identities = 319/862 (37%), Positives = 520/862 (60%)
  Q:     9 NNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKAN---KNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYL-RENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKN-----EELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKN--LEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNR--TSNQESKLWVLNYLIK---KILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIR-IFNFENK---IPNNK--VIDIHLEVLNPKLFKISDEVINIL-NTAKINIVKQDIKSLKPD----YVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           +  +LSK Y+ +  EQ++     QK L+  + KA+   ++ +S+++PPPNVTG+LH+GHAL+ T+QD ++RF  ++G    W+ G DHAGIATQTK E++L +E+ +S  D  R++ +  ++ W +   ++I NQ K +G  +D+  E FT+++  ++ V +VFV +Y  GLIY+   ++NW  +  +A+S+IEV   E +  L +I+Y L++    + VATTRPET+  D  + V+P D+RY + I K  + PL ++EI IIADE+VD +FG+G +K TP HD ND+E+G+++ L  I+   +DG   N A  +  +   + R   ++ L+    L ++E    ++G   R + VVEP++S+QWFVK+   +   I++      ++F P +FEK   NWM N+ DWCISRQ+WWGH+IP WY +   EI V  K P +     E    +D DVLDTWFSS LWP +T    D        +PT+VLVTG+DIIFFWV RM+F  L   KE PF   +I GL+RD H  KMSKSLGNG+DP ++I++YGAD LR  L++  +PG D+ +  +KV++   F NK+WN+ R+  MN  ++   E  +P++  L   DKWIL++ N+   +  +  +KY    + K + +F W +FC+ YIE++K R    ++E K      L++    IL L HP  PF++  +  +    T + ++  +   K+ S   E+S + + QI+  +R + N   +   +P  K  +  +  +  +   F  + E    L N + + +V  D    KP      V     IF L  E L+  + E   IE+++ +   +  E++R  G L+N +F+ KAP+  ++ E+ K+  ++ +L ++++ L +
  S:     2 SKTNLSKVYEPEKVEQKW----YQKWLDADSFKASCDHRDKFSVVIPPPNVTGSLHMGHALDNTLQDVIVRFKRMQGYDTLWMPGTDHAGIATQTKVEEHLAQEDGVSKYDLGREKFLEKVWAWKETYHDSITNQLKKLGVSVDWSRERFTMDEGCSKAVREVFVSLYEKGLIYQGDYIINWCPRCYTALSDIEVEHMEDQGTLTHIKYPLTDGSGSISVATTRPETMLGDTAVAVHPDDERYSHLIGKTVMLPLMDREIPIIADEFVDPEFGSGAVKVTPGHDPNDFEMGERHTLESIAVIGKDGQMTNEARRYSGMDRYECRKSVIQDLKDQGYLLEIEDHNHSIGHCHRCDTVVEPLVSKQWFVKMKPLAGPAIDVVDKG-DVKFVPARFEKIYRNWMENIRDWCISRQIWWGHRIPAWYCQ-CGEIIVSRKDPDSCPSCGESGLEQDPDVLDTWFSSALWPFSTMGWPDETDDLQKFYPTDVLVTGYDIIFFWVARMIFMGLEFMKERPFDDVFIHGLVRDAHGRKMSKSLGNGIDPLEIIDEYGADTLRYTLVTGITPGNDMRFSYDKVEASRNFANKIWNASRFAIMNLDNYQPME-LSPEDDRLSLADKWILHRMNEVIDDVTRLMDKYELGEASKTLYEFIWSEFCDWYIEMAKIRLYQGSEEEKSLTQEILVRGLDTILRLLHPFMPFLSEEIRSHLP-HTDELLVTSKWPEKEESFSDETSKKAMEQIMEGVRAVRNLRRELDIVPQTKSAITILASDASDYDNFNSNQEYFRALANASPVEVV--DNLEEKPKKALTAVVRGAEIF-LPLEGLVDLDEE---IERLRGQKAELDKEVARVEGKLANDNFVNKAPQYVVDKEREKERDYKERLAKVQERLDT 879
>gi|191161269|ref|ZP_03023152.1| valyl-tRNA synthetase [Geobacter sp. M21] >gi|190998000|gb|EDV73445.1| valyl-tRNA synthetase [Geobacter sp. M21] (888 aa)
Score = 1425, Expect = 2.3e-155, Identities = 320/859 (37%), Positives = 488/859 (56%)
  Q:    10 NNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE-DKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFK--TKDSILLERLDFKKIS----NLKESSIEDVLQIINKIRIFNFENKIPNNK----VIDIHLEVLNPKLFKISDEVINILNTAKINI-------------VKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           N +L K Y+ K  E+++     QK      L ++K  YSI++PPPN+TG LH+GHALN T+QD L R+  + G +  W+ G DHAGIATQ   E+ L        +  R+  +  +++W    G  I  Q K +G   D+E E FT++   ++ V +VFV++Y + LIYR   L+NW  +  +A+S+IEV  +E   +L+++RY +  + DYL+VATTRPET+  D  + V+P+D+RY + I K  + PL N+EI IIAD+YVD +FGTGV+K TPAHDFND+E+G ++ L+ I+ F+E G  N     +E ++   AR + V  LE   LLEK++    +VG   R   VVEP MS QW+VKV+  +++ +   K  +  +  P ++E    +WM N+ DWCISRQ+WWGH+IP WY      I V    P       ++E+  ++ DVLDTWFSS LWP +T    +      + +PT+ LVTGFDI+FFWV RMM   L+   EVPF   YI  L+RD    KMSKS GN +DP  VI+ YG DA R  L + ++ G D+   EE++     F NK+WN+ R+  MN   F+ +  D     L + D+WIL + N+           + F  +   +  FTW +FC+ YIEL+K+         Q S  +VL  +++ +L L HP  PF+T  ++        + +SI++                 + ++ V+++I  IR    E ++P +K    ++D   E     L +    V+++   + + I             V  D++ + P       L+ +  +E  LG       I KI+K+IEF+  +       L N SF+E+AP + +E E+ K  +   K K LE+ L
  S:     3 NKELEKVYEPKSVEERWYQQWEQKGYFHATLPSDKPGYSIVIPPPNITGVLHMGHALNNTLQDILCRWKRMAGYNVLWMPGTDHAGIATQNVVERQLAAEGKDRFELGREAFIERVWQWKGESGGQIIGQLKRLGASCDWERERFTMDAGLSKAVREVFVRLYQEKLIYRDNRLINWCPRCHTALSDIEVEHEEKAGHLWHLRYPVVGTGDYLVVATTRPETMLGDTAVAVHPEDERYAHLIGKMVLLPLVNREIPIIADDYVDREFGTGVVKITPAHDFNDFEMGVRHNLDRINVFDESGVVNAAGKQYEGMERFAARKQVVADLEAAGLLEKIQDHALSVGGCYRCKTVVEPYMSLQWYVKVAPLAERALGAVKDGRT-KIVPQQWENTYYDWMENIRDWCISRQIWWGHRIPAWYCDHCGHITVAKDDPTCCDECGSDEIR-QETDVLDTWFSSALWPFSTMGWPEKTPELASFYPTSCLVTGFDILFFWVARMMMMGLHFMDEVPFTDVYIHALVRDAQGQKMSKSKGNVIDPLTVIDAYGTDAFRFTLAAFAAQGRDIKLAEERIAGYRNFANKIWNASRFAMMNLEGFDPNAVDPASLKLSNADRWILYRLNQTTVSVDAALASFRFNEAANDLYRFTWSEFCDWYIELAKDDLYKGDADRQASAKYVLWLVLENLLRLLHPFMPFITEEIWQALPKMDGSAESIMISSFPAACAEWEGYAAAAAEMDLVMEVIKGIRNIRGEMEVPPSKQIAAILDCKSEASLALLKRNEAYVMSLARLSDLGIGQGIERPAEASLQVAGDVEIIVP----LRGLVNVEEEEKRLG-----KEIAKIEKDIEFLSKK-------LENPSFVERAPADVVEKEREKIGEFANKKKLLEESL 881
>gi|116747642|ref|YP_844329.1| valyl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB] >gi|116696706|gb|ABK15894.1| valyl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB] (892 aa)
Score = 1423, Expect = 3.7e-155, Identities = 299/826 (36%), Positives = 469/826 (56%)
  Q:    41 KANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLN-----YLIKKILILFHPMCPFVTSNLYDNFKFKT----KDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISD-EVINILNTAKINIVKQDI--KSLKPDYVENNYL----IFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           +++K  + I++PPPNVTG LH+GHALN T+QD L R+  LKG    W+ G DHAGIATQ   E+ L    ++  +  RD     ++ W    G  I NQ K +G   D+E E FT+++  +  V +VFVK+Y +GLIYR K ++NW  +  +A++NIEV  +E +  LY+++Y L +    L+VATTRPET+  D  + V+P+D RY  Y+ +  + P+  +EI +IAD YVD +FGTG +K TPAHDFND+EL +K+ L ++    EDG     A  +  +   + R K ++ LE    L KVE     VG   R  +VVEPM S QWFV     + + ++  +        P K+EK+   W+ NL DWC+SRQ+WWGH+IP WY +D  E+ V  + P+   +       +D+DVLDTWFSSGLWP +T    D     D  +PT+VLVT FDI+FFWV RMM   ++   EVPF+  YI  L+RD    KMSKS GN +DP  ++E+YG DA R  L + +  G D+   EE+++    F+NK+WN+ R + MN       E+   K ++   +WIL++  +   E       Y+F      +  F W ++C+ Y+E+ K     ++     L       ++++IL+L HP+ PFVT  +Y      T    K S    R ++  I +  E ++E ++ +++ IR    E  +P    ++      N    ++ D   + +++  +++ +K  I  +  KP       +    + ++ K D+L   +E+   ++++KE+  ++ E       LSN+ F+ KAP E IE E+ K  +   K+++L +
  S:    34 RSSKPPFCIVIPPPNVTGQLHMGHALNNTLQDILSRYKRLKGFEVLWLPGTDHAGIATQNVVERQLAAEGLNRYELGRDAFQERVWTWKAKYGGIIINQLKRLGASCDWERERFTMDEGLSRAVREVFVKLYEEGLIYRGKRMINWCPRCMTALANIEVDGEETDGFLYHLKYPLLDGTGALVVATTRPETMLGDTAVAVHPEDSRYAAYVGRKVLLPVMKREIPVIADAYVDREFGTGALKVTPAHDFNDFELARKHGLQLVQVIAEDGRMTEEAGTYAGMDRYECRRKILKELEHGGFLVKVENYHHRVGHCYRCKSVVEPMQSLQWFVSTRPLADRAMKAVRDGST-AIVPAKWEKDYFIWLENLEDWCVSRQIWWGHRIPAWYCRDCGELIVAREEPRECSMCKGTRLEQDSDVLDTWFSSGLWPFSTLGWPDRTPELDKFYPTSVLVTAFDILFFWVARMMMMGIHAMHEVPFREVYIHALVRDAQGQKMSKSKGNVIDPLVMMERYGTDAFRFTLAAFAVQGRDVKLSEERIEGYKHFVNKIWNAARLLLMNLQGEASLEEIPSKPVQLMHRWILSRLQRVVGEVDSALENYHFNQYANVLYQFLWREYCDWYLEMIKPDLYGEDEAAGRLAKSISVRVLEQILVLLHPVMPFVTEEIYQKLPGITGSIMKASYPAVRPEW--IDSEAERAMEIIMGVVSGIRNIRGEMNVPPATRVEAVCLCENSAAKELLDAHAVTVIDLGRLSELKVGIAGEMQKPAQAAGAVIPGVEVHVVLK-DILDFESES---KRLRKELAKLEKEFGITRMKLSNEDFLGKAPPEVIEKEREKSGRLGEKIEKLSR 876
>gi|154249040|ref|YP_001409865.1| valyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] >gi|171769323|sp|A7HJX5|SYV_FERNB Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|154152976|gb|ABS60208.1| valyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] (867 aa)
Score = 1422, Expect = 5.2e-155, Identities = 323/858 (37%), Positives = 499/858 (58%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW--VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK--QDIKSL-----KPDYVENNYLIFILNKEDLLGS-NNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           ++  +YD K  E + +  W  +K    +        YSI++PPPN+TG +H+GHALN TIQD L R+  +KG    W+ G DHAGIATQT  E+YL     S +D SRDE +  ++ W+      I+NQ  ++G  +D+  E FTL++  ++ V +VFV MY  GLIY+ K +VNW  +  + +S+ EV   E E  LY+I+Y +    DY+++ATTRPET+  D  + V+P D+RY+ Y+ K AI PL  +EI +IAD YVD  FGTG +K TPAHD NDY +G+++ L  +  F+E+   N     F+ +    AR   VE LE    L K+EK   +VG   R + VVEP + +QWFV +   +K+ IE  ++  ++ F P +++K  +NWM  + DWCISRQLWWGH+IPVW  +D     V    P   E        +D DVLDTWFSS LWP +T    +     +  +PT+VLVTGFDIIFFWV RM+        E PFK  YI  L+RD++  KMSKSLGNG+DP +VI++YGAD +R  L   ++ G DL        +   F NK+WN+ R+V MN  DF   + K  K L+  DKWIL++  K   +  +  + Y+F ++  +I +F WD+ C+ YIE  KNR   +E K+   VL Y++   L L HP  PF+T  L+      + +SI++ +    + + + E+S +  +Q++N IR            + +I  EV  P+  K+   V   L   +   +K   +++S+     +P+     Y+         LG+  +  + +E+++K++E +KS++ +    L +++F++ AP++ +E  K K+   + ++  +E+++S
  S:     2 EIGTRYDPKNIEMKWYKHWLEKKYFTPRGAGPK---YSIVIPPPNITGKIHMGHALNITIQDILSRYKRMKGFDVLWLPGEDHAGIATQTAVERYLSTQGKSRRDFSRDEFLNIVWNWANKYRQEIKNQIMSIGASVDWTRERFTLDEGLSKAVRKVFVDMYKKGLIYKGKYIVNWCHRCGTVLSDEEVDYHEEEGALYHIKYPIKGEDDYIIIATTRPETMLGDTAVAVHPSDERYRKYVGKIAILPLVGREIPVIADNYVDPSFGTGALKVTPAHDTNDYLIGQRHNLPFVDIFDENIVINENGGKFKGMTAEQARKAVVEELEAQGYLVKIEKMKHSVGRCYRCDTVVEPRLMDQWFVSMKPLAKRAIEAVENG-EVTFIPDRWKKVYLNWMYEIRDWCISRQLWWGHRIPVWQCQDCGHYNVSENEPVKCEKCGSTNLKQDEDVLDTWFSSALWPFSTMGWPEKTPDLERYYPTDVLVTGFDIIFFWVARMIMMGYEFMDEKPFKEVYIHQLVRDKYGRKMSKSLGNGIDPLEVIDEYGADPMRFTLAILAAQGRDLKLDVRFFDTYKKFANKIWNATRFVLMNLEDFEKVDIKLSK-LKLSDKWILSRLQKTIQKISEALDSYDFNIAANEIYNFFWDELCDWYIEAVKNRLKTEERKVVQNVLVYVLDMSLRLLHPFMPFLTEELWTKLP-TSGESIVVAQWPEIEENFIDENSEKRFMQLMNIIR-----------GIRNIRAEVNVPQSTKVKTFVKGTLTDEEQEYIKFLGNVESIEFVEKRPELSATAYISLENEVYVSLGTLIDVKSEVERLRKKVEKLKSDMEKFAKKLEDENFLKNAPEDIVEETKEKQRLFQEQIARIEQIIS 861
>gi|157147738|ref|YP_001455057.1| valyl-tRNA synthetase [Citrobacter koseri ATCC BAA-895] >gi|157084943|gb|ABV14621.1| hypothetical protein CKO_03542 [Citrobacter koseri ATCC BAA-895] (951 aa)
Score = 1422, Expect = 5.7e-155, Identities = 325/854 (38%), Positives = 522/854 (61%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGT------------------TNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-------NEELYVR-DNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKLW----VLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ       Q+   K N   ++ S+ I++PPPNVTG+LH+GHA   TI D LIR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I KF + PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+G++++L +I+    DG                   +N     F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D+  +YVG    +       + ++ +R D+DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPFK  Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ D +   +     L   D+WIL +FN+    + +  + + F ++   + +FTW+ FC+ Y+EL+K       E++L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       S + E+++ D   + Q I  +R    E  I   K +++ L   + + + +++D    +LN A++    + I  L  D      +  I++  +LL    G  ++   + ++ KE+  V++EI R  G L+N+ F+ +AP+  I  E+ K E + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEQQGYFKPNGDESQESFCIMIPPPNVTGSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETLLGDTGVAVNPEDPRYKDLIGKFVVLPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGRRHQLPMINILTFDGDIRESAEVYDTKGEESDVYSNEIPAEFQKLERFAARKAVVAAIDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENGD-IQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYD-DAGNVYVGRSEDEVRQENNLSADVALRQDDDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFKTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPDLLEKRTGNMMQPQLAEKIAKRTEKQFPDGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEDQDCGFNGGEMTLSLADRWILAEFNQTIKAYREALDSFRFDIAAGILYEFTWNQFCDWYLELTKPVMNGGSEAELRGTRNTLVTVLEGLLRLAHPIIPFITETIWQRVKVISGITADTIMLQPFPQYDASQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAIRRVNDNRSFLLNLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLIDKEAELARLAKEVAKVEAEIGRIEGKLANEGFVARAPEAVIAKEREKLENYAEAKAKLIEQ 944
>gi|157364834|ref|YP_001471601.1| valyl-tRNA synthetase [Thermotoga lettingae TMO] >gi|166987328|sp|A8F8Q3|SYV_THELT Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|157315438|gb|ABV34537.1| valyl-tRNA synthetase [Thermotoga lettingae TMO] (861 aa)
Score = 1422, Expect = 5.8e-155, Identities = 317/822 (38%), Positives = 475/822 (57%)
  Q:    47 YSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTK-----PPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF---DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDNFKFKTKDSILLE--RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           + I++PPPN+TG +H+GHALN T+QD L+R+  ++G    W+ G DHAGIATQ   E+YL     S +   R++ +  ++EW++     IR Q + +G  +D+  E FTL+   ++ V +VFV +YN GLIYR K +VNW  + Q+ +S+ EV   E    LYY++Y  S S +Y+++ATTRPET+  D  + VNP+D+RYKN   K  + PL N+EI II D YVD +FGTG +K TPAHD ND+++ K++ L  I  F+ +   N     +  L    AR   +E LEK   L KVE     VG   R ++V+EP + +QWFV +   SK+ IE  + +++I+F P +++K  ++WM N+ DWCISRQLWWGH++PVWY K+  E  V        P    +   +D DVLDTWFSS LWP +T    +  +  +  +PT+VLVTGFDIIFFWV RM+       ++ PF   YI  LIRD+H  KMSKSLGNG+DP D+ EKYG D +R  L   ++ G D+   E    +   F NK+WN+ R+V +N  ++       P+ L +    D+WIL+K  K  S       KY F ++ + + +F W++FC+ YIE SK    N E K    N L+K +   L L HP  PF++  L+ N     +  ++ +   +D   I+   E + E ++QII  IR    E  IP  +   ++  +    L K     I  L+ A+I+ VK+        +V  N  +++    D+ G N ++  I+++ K IE ++ E       LS+  F+  AP+E I   + K  + E +LK L ++L
  S:    35 FVIVIPPPNITGRIHMGHALNITLQDILVRYKRMRGFDTLWVPGEDHAGIATQNAVERYLESQGKSREQLGREKFIEIVWEWAKKYRKEIRQQIETLGASVDWSRERFTLDDGLSKAVRKVFVDLYNRGLIYRGKYMVNWCPRCQTVLSDEEVEHIEESAKLYYVKYPFSGSNEYIVIATTRPETMLGDVAVAVNPEDERYKNISGKTVVLPLMNREIPIITDSYVDPEFGTGAVKITPAHDPNDFDIAKRHSLQFIEIFDNEAKINENGGKYAGLDRYQARKAVLEDLEKAGFLLKVENINHAVGHCYRCDSVIEPRIMDQWFVSMKSLSKRAIEAVE-NEEIRFVPERWKKVYLHWMYNIRDWCISRQLWWGHRVPVWYCKNCNETIVSEIDIEECPKCGSKSIEQDEDVLDTWFSSALWPFSTLGWPEKTEDLEKYYPTSVLVTGFDIIFFWVARMIIMGYQFMQKKPFTDVYIHQLIRDKHGRKMSKSLGNGIDPIDMSEKYGTDPVRFTLAIFAAQGSDIKLDERYFDTYRKFANKIWNAARFVLINLDNYK------PQPLNELSLADRWILSKLQKVISVVSDAIEKYEFNIAARSLYEFFWNEFCDWYIESSK-LVLNSEKKAITQNVLVKVLDTSLRLLHPFMPFLSEELWQNLPVHGESIVISDWPEVDVTLINEEAEKNFEKLVQIIRGIRNVKAEMNIPPKRNTKVY--IYGETLCKEESSYIEHLSGAQISYVKEKPACCATAFVSENQHVYV----DVAGLNLQS-EIKRLMKNIEKLQKEREWQLKKLSDDKFLSNAPEEAISEARQKLSEIEDRLKILNQIL 857
>gi|117919580|ref|YP_868772.1| valyl-tRNA synthetase [Shewanella sp. ANA-3] >gi|117611912|gb|ABK47366.1| valyl-tRNA synthetase [Shewanella sp. ANA-3] (958 aa)
Score = 1421, Expect = 6.4e-155, Identities = 342/841 (40%), Positives = 507/841 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF----------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKLWVLNYLIKKIL----ILFHPMCPFVTSNLYDNFKFKT---KDSILLERL---DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK--QDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +  A++ +Y I++PPPNVTG+LH+GHA   TI D LIR+  +KG +  W  G DHAGIATQ   E+ L  E   S  D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  I KF + P+ N+ I I+AD+YVD++FGTG +K TPAHDFNDYE+GK++KL   N+++            N DGT N    G     F  L    AR   V   E   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY  + K +YVG        K   ++ + +R D DVLDTWFSS LW  +T    D ++      PT+VLVTGFDIIFFWV RM+  +++L      K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+      +D  P N  D+          D+WI+  FN+    +      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++    + +  +L     L HPM P++T  ++   K  T    D+I+L      D  K+     + +E V Q+I  +R    E  I  +K ++  L  ++ +     D+     N A    +   + +  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP   I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEQGYF-KPHGDASQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLIRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKSRHDLGRDAFMEKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDDLIYRGKRLVNWDPKLHTAISDLEVENKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALIGKFILLPIVNRRIPIVADDYVDMEFGTGCVKITPAHDFNDYEVGKRHKLPMFNVLTLDAAIRASAEVVNTDGTINTSLDGSLPERFAGLDRFKARDAIVAEFETLGLLEKIAPHGLKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENG-DIKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDANGK-VYVGRNEAEVRAKHNIDDAIALRQDEDVLDTWFSSALWTFSTLGWPDNVEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHLIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIDLEALVEKRTGNMMQPQLAAKIEKSTRKEFENGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----GQDCGP-NSPDYQGGEMELSLADRWIIGLFNQTVKTYDDHMTNYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGNEAQMRGTRHTLVNVLEAMQRLMHPMMPYITETIWQRVKPLTGAQGDTIMLAPFPSYDAAKVDATAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-----DQARVEANQAFFTTLARLESMTILGEGETAPMSTTGLIGEMELLIPMAGLVDVAAEMARIDKQLEKLTQEIARIEGKLSNEGFVAKAPPAVIDKERAK 935
>gi|186899835|ref|ZP_02972796.1| valyl-tRNA synthetase [Cyanothece sp. PCC 7424] >gi|186693244|gb|EDU17859.1| valyl-tRNA synthetase [Cyanothece sp. PCC 7424] (909 aa)
Score = 1421, Expect = 6.9e-155, Identities = 335/851 (39%), Positives = 496/851 (58%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPP------KNEELYV------------RDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSS-SSPGEDLCY-------VEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK--NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQE---SKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSIEDVLQI----INKIRIFNFENKIPNNKVIDIHLEVLNPKLFKI-SDEVINILNTAKIN------IVKQDIKSLKPDYVENNYLIF----ILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEK---SKKEKHEMKLKE 863
           L+K+YD K  E+++  +  ++E+ K      K +YS+++PPPNVTG+LH+GHA N  + D L+R++ + G     + G+DHA IA QT  EK L+    +  D  R++ +   ++W Q  G  I NQ K +G   D+  + FTL++  ++ V   FV +Y  GLIYR   LVNW  + QSA+S++EV  KEV+ +L++ RY LS+   YL VATTRPET+  D  + VNP D+RYK+ I +    P+  +EI I+ADE VD +FGTG +K TPAHD+ND+E+G +++L  I+  N+DGT N  A  F   +   AR   V+ LE+   L K+E+    V +S+R    VEP++S QWFVK+   +KK +         QF P ++ K   +W+  L DWCISRQLWWGHQIP WY  +  +  +    P      + E L              +D DVLDTWFSSGLWP +T      T  LK+    +PT+ LVTGFDIIFFWV RM   + Y   ++PFK  YI GL+RDE+  KMSKS  NG+DP  +IEKYGADALR  L+   +  G+D+           E V++   F NKLWN+ R+V MN       E   P    LE  D+WIL++FN+   +     + Y    + K + +F W DFC+ YIEL K+R  N+E   S++     L +++  IL L HP  P +T  ++     KT D +L  +   +   NL +S +ED   +    I  IR    E +I       + L+  NP+  +I +   + I +  K+        +++D +      V    ++     +++ E L G         KI+K +  V+ +I+     L+N +F+ KAPKE +E  K   ++ +K    L+E
  S:     8 LAKQYDPKTTEEKWQQYWQEQEVFKAEPNPKKPAYSLVIPPPNVTGSLHMGHAFNTALIDTLVRYHRMCGYDTLCLPGIDHASIAVQTILEKQLKAEGKTRYDIGREKFLERAWQWKQQSGGTIINQLKRLGLSADWSRQRFTLDESLSKAVKTAFVTLYEAGLIYRGNYLVNWCPETQSAVSDLEVESKEVDGHLWHFRYPLSDGSGYLEVATTRPETMLGDTGVAVNPTDERYKHLIGQTVTLPIMEREIPIVADELVDPEFGTGCVKVTPAHDYNDFEMGNRHQLPFINIMNKDGTLNENAGPFAGEERFVARKNVVKRLEETGFLVKIEEYRHTVPYSDRGKVPVEPLLSTQWFVKIDPMAKKALAFLDEQNSPQFIPERWTKVYRDWLVKLKDWCISRQLWWGHQIPAWYVVNLTDGKITDDTPFVVAYSEEEALKTAKQQYGDNIQLSQDPDVLDTWFSSGLWPFSTMGWPEETTDLKT---YYPTSTLVTGFDIIFFWVARMTMMAGYFTGQMPFKDVYIHGLVRDENGKKMSKSANNGIDPLILIEKYGADALRYTLIREVAGAGQDISLQYDRTSDQSESVEASRNFANKLWNAARFVMMNLDGKTPQELGNPSLDELELCDRWILSRFNQVVQQTRNYIDHYGLGEAAKGLYEFIWGDFCDWYIELVKSRLFNKELSSSRIVAQQTLAFVLDGILKLLHPFMPHITEEIWQILTQKT-DQVLALQTYPEVNDNLIDSQLEDSFLLLFASIRTIRNLRAEAEIKPGVTAPVILQSDNPQERQILTQGQVYIQDLGKVEELTITPQLREDTRKAIAGVVGTIQVLIPLTGLIDIEVLRG---------KIQKNLSKVEGDITSLENRLNNPNFVNKAPKEVVEATKEALAEAQKQAEILRE 903
>gi|54020305|ref|YP_116201.1| valyl-tRNA synthetase [Mycoplasma hyopneumoniae 232] >gi|81823494|sp|Q5ZZL4|SYV_MYCH2 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|53987478|gb|AAV27679.1| valyl-tRNA synthetase [Mycoplasma hyopneumoniae 232] (822 aa)
Score = 1420, Expect = 9.3e-155, Identities = 351/854 (41%), Positives = 507/854 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNL----KANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGL-------WPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           +  KYD K+ E++       ++  KK      K  K  +SI+ PPPNVTG LHLGH+ N  IQD L+R++ L+G     +  +DHAGIATQ K E+ L +  I   D  R+E +   + W +     I+ QW  +G   D+  E FTL++ +   V+  F+K++   LIYR +  +NWDIKLQ+AISNIEVI K VE  +YY++Y+L NS ++L VATTR ETI  D  L +NPKDKRY + + K  ++PLT K IKIIAD  V   FG+G+MK + AH   D+E+ +K+ L    C +  G  N+    F+      AR    + LEK   L K+E  ISNVGFS+R++ +VE +   QWFVK+ E +K +I    S  KI+F+P  FEKNL  W   ++DW ISRQLWWGH+IPVWYK D  ++ + +      + +++D DVLDTWFSSG+       WP    D +KS    FPT++LVTG+DI+FFWV RM F SL++ K+ PF+   + GLIRDE   KMSKSLGNG+DP ++IEKYG+D LR  L+ +SSPG+D+ +  EK+ + W   NK+WN  +Y+         D D      +  D W+ NK      + ++   KYNF V   +I +F + DF + YIEL K R +   ++      L++K+LI+ HP  PF+T  L +   FK +  IL +++   +I   KE+  +E++L+II+ +R   +  K   +K I +   ++N K      ++IN L   K    K+ +   K      N+ I I   E+L     +     +  KEI+F+KSEI R   +L+NK F+EKAP+EKI+LE++K EK + KL   EK
  S:     1 MKNKYDFKLVEEK-----RNEKWQKKGFFIAPKQTKKPFSIISPPPNVTGQLHLGHSWNAFIQDSLVRYHKLQGFDVLLLPSVDHAGIATQVKVEEDLAKKGIKKSDLKREEFIKKCYHWKEKQYLKIKEQWDKLGICYDFSKERFTLDQDAQIAVSDFFIKLWEKNLIYRGQKAINWDIKLQTAISNIEVINKPVEQKMYYLKYFLENSNEFLTVATTRIETISSDVALAINPKDKRYLHLVGKKVVHPLTKKLIKIIADSNVGSDFGSGIMKVS-AHSILDFEIMEKHNLESKDCIDNYGNLNHEVPEFQGQNRFFARDLIAKKLEKEGFLAKIETVISNVGFSQRSDEIVEILKKPQWFVKMDELAKSLISHLNSKDKIKFYPKNFEKNLRKWFEKIHDWTISRQLWWGHRIPVWYKNDEFKVQIDSP----GQGWIQDEDVLDTWFSSGISVFAFLGWP-QNFDLIKS---YFPTSLLVTGWDILFFWVARMYFSSLFIMKQKPFEKVLLHGLIRDEIGRKMSKSLGNGLDPMEIIEKYGSDTLRQALIFNSSPGKDIKFNIEKLNTAWNLNNKIWNIAKYIA--------DLDTFFAKPDLIDLWMENKIYILKRQIVKNIKKYNFSVIGTEINNFIYGDFSSRYIELIKTRKNGFYAR-----KLLRKVLIILHPFLPFLTDFLMEKI-FKME--ILEQKM--PRIRQFKENQKVENILEIIDNLR--TYREKFQISKKIILEYCIINDKFSNAEIDIINKLTFGKWLENKELVIKTK------NFEIAIKVPEEL-----KKEQKGRELKEIQFLKSEILRAEKILTNKGFLEKAPREKIDLERTKLEKLKEKLAFYEK 821
>gi|114330617|ref|YP_746839.1| valyl-tRNA synthetase [Nitrosomonas eutropha C91] >gi|122314389|sp|Q0AIF2|SYV_NITEC Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|114307631|gb|ABI58874.1| valyl-tRNA synthetase [Nitrosomonas eutropha C91] (917 aa)
Score = 1419, Expect = 1.1e-154, Identities = 323/857 (37%), Positives = 499/857 (58%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYL----SNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA-VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYV-----GTKPPKNEELYVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN--SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDN---FKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLK-PDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +L+K +D K  E   +S+W T    +    +   N+Y I+LPPPNVTG LH+GHA   T+ D LIR++ + G +  W  G DHAGIATQ   E+ L +     +   R+  +  +++W +  G+ I  Q + MG   D+  E FT+++  +  V +VFV++Y +GLIYR K LVNWD  LQ+A+S++EV+  E + +L++I Y       N +  L+VATTRPET+  D  + V+P+D RY++ I      PL+ + I IIAD YVD  FGTG +K TPAHDFNDY++G ++KL  +S F  DG  N+ A V F+ L   DAR K +  L+   LL +       +   +RTN V+EPM+++QW++ +   +K+ +   +S  +++F P  +      W+ N+ DWCISRQLWWGH+IP WY +D   I         K    E L+ +D DVLDTWFSS LWP +T      T  LK+     P +VLVTGFDIIFFWV RM+  SL+   EVPF+  YITGLIRD    KMSKS GN +DP D+I+                                      +GADALR    S +S G D+ +  ++ +    F NKLWN+ R+V MN    D   DE   P N    DKWI+ +  +A    +Q FN+Y F ++ +++ +F WD++C+ Y+EL+K + ++     Q +    L  +++ +L   HP+ PF+T  L+        KT  SI+ +   + D  +I     + I+ + +++N  R    E K+     I + +E    +L      +  +   ++++I+   +     P  V  ++ + +  + D+          E++ KEI  V++EIS+    L N  FI++AP++ ++ EK +       LK+L++ L
  S:     2 ELAKSFDPKDIENHWYSVWETAGYFSPAK-REEVNAYCIMLPPPNVTGTLHMGHAFQHTLMDALIRYHRMLGDNTLWQPGTDHAGIATQIVVERQLDQEGKDRRQMGREAFLERVWQWKEESGSTITRQMRRMGTSCDWSRERFTMDEVLSRAVTEVFVRLYREGLIYRGKRLVNWDPVLQTAVSDLEVVSVEEQGSLWHILYPFEHRAENGEKGLIVATTRPETMLGDVAVAVHPEDVRYRHLIGHHVRLPLSERTIPIIADSYVDPAFGTGCVKITPAHDFNDYQVGLRHKLIPLSIFTLDGKINDNAPVEFQGLDRFDARKKVITDLQAQELLVETRPHKLMIPRGDRTNTVIEPMLTDQWYLAMEGLAKQGLAAVESG-QVRFVPENWAHVYNQWLENIQDWCISRQLWWGHRIPAWYDEDGNVIVAYDLEEARKLSGKENLH-QDEDVLDTWFSSALWPFSTLGWPEQTPELKT---FLPGSVLVTGFDIIFFWVARMVMMSLHFTGEVPFREVYITGLIRDAEGQKMSKSKGNVLDPLDLIDGVALTELIRKRTTGLMNPKQAESIEKATRKQFPQGIPAFGADALRFTFASLASHGRDIKFDLQRCEGYRNFCNKLWNATRFVLMNCEGKDTGLDEG-LPLNFSPADKWIIGRLQQAEQSVIQAFNEYRFDLAAREMYEFIWDEYCDWYVELAKVQLNSEDEARQRATRRTLVRVLETVLRQAHPIIPFITEELWQAVAPLAGKTGASIMCQPYPQPDQLRIDEQAAADIQLLKEVVNACRTLRGEMKLSPADRIPLLIEGDRARLINFFPHLQALARLSEVDILPGGLPDTDAPVAVVGDFRLMLKIEIDVKAER------ERLNKEILRVEAEISKARVKLDNPDFIQRAPEKVVQQEKGRLVTFSTTLKKLDEQL 913
>gi|196156387|ref|YP_002125876.1| valyl-tRNA synthetase [Alteromonas macleodii 'Deep ecotype'] >gi|88775308|gb|EAR06558.1| valyl-tRNA synthetase [Alteromonas macleodii 'Deep ecotype'] >gi|196112166|gb|ACG65882.1| valyl-tRNA synthetase [Alteromonas macleodii 'Deep ecotype'] (924 aa)
Score = 1419, Expect = 1.2e-154, Identities = 326/860 (37%), Positives = 502/860 (58%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAV-GFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELY--------VRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQES-------KLWVLNYLIKKILILFHPMCPFVTSNLYDN------FKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK----QDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + K ++ +  EQQ   + + +E        + + Y ILLPPPNVTG+LH+GH    TI D L R++ +KG +  W  G DHAGIATQ   E+ L     +  D  R++ +  ++EW ++ G  I  Q + +G   D+  E FT+++  ++ V +VFVK++ +GLIYR K LVNWD  L +A+S++EV+ +E + +++++RY L++    L+VATTRPET+  D  + V+P D+RY+ +I K    P+T + I +IAD+YVD +FGTG +K TPAHDFNDY++GK++ L +I+   +D   N+ A   +  L   DAR + V  LE    L K+E     V   +RT AV+EP +++QW+V V   +K  IE  +S  +I+F P  + K    WM N+ DWCISRQLWWGH+IP WY ++ K ++VG    +  E +         +D+DVLDTWFSS LWP  T    +     +   P++VLVTGFDIIFFWV RM+  +     ++PFK  YITGLIRDE+ +KMSKS GN +DP D+                                     I+ YG DALR    + +S   D+ +   +V+    F NK+WN+ R+V MN+ + +   D     L   D+WI  KF +   EF +    Y F ++ + + +FTW+ FC+ Y+EL+K   SN  S           L  +++ +L L HP+ PF+T  ++         K +   SI+++    +D  K  +   + IE V + I  IR    E  I  NK        LN  L  +SDE    L+ AK  + K    + +  LK           ++ + ++L    G  ++   + +I K +E ++ ++SR  G L N+ F+  AP+  IE E+ K E+ E  L +L++   + K
  S:     1 MDKTFEPQSIEQQ--CYKSWEEAGLFKASGSGDPYCILLPPPNVTGSLHMGHGFQQTIMDALTRYHRMKGDNTLWQVGTDHAGIATQMVVERQLNAEGKTRHDLGREDFIKKVWEWKEHSGGTITGQMRRLGTSPDWSREVFTMDEDLSKAVTEVFVKLHEEGLIYRGKRLVNWDPVLHTAVSDLEVLNEEEDGHMWHMRYPLADGSGELVVATTRPETMLGDTAVAVHPDDERYQRFIGKEIKLPITGRLIPVIADDYVDQEFGTGCVKITPAHDFNDYDMGKRHNLPMINILTDDAKINDDAPEAYRGLDRFDARKQIVADLEAQGSLVKIEPHELKVPRGDRTGAVIEPYLTDQWYVAVESLAKPAIEAVESG-EIRFVPENWNKTYYQWMHNIQDWCISRQLWWGHRIPAWYDENGK-VFVGRTEEEVREKHGLGSEVTLSQDDDVLDTWFSSALWPFATMGWPEETPDLETFVPSSVLVTGFDIIFFWVARMIMMTKKFTGKIPFKDIYITGLIRDENGDKMSKSKGNVLDPIDLIDGIDIESLVTKRTAGMMQPQLAEKIAKRTRKQFPDGIQAYGTDALRFTFAAMASTSRDINFDMARVEGYRNFCNKIWNASRFVLMNTEEHDTGRDGGEMVLSMADRWIWAKFQQTLVEFEKALEDYRFDIAAQTVYEFTWNQFCDWYLELTKPVLSNDASTDAEKRGTRHTLINVLESLLRLLHPLMPFITDTIWQRVVPQSALKVEEGASIMVQAFPEVDAAKQDDKVLADIEWVKKFIVGIRNIRGEMDISPNK-------PLNALLKNVSDEDARRLDAAKAFLDKLSKLETVTILKDGEEAPASATALVGEMEILIPMAGLIDKDAELARITKAMEKIEKDVSRTRGKLGNEKFVSNAPEAVIEKERGKLEEGEKALAKLKEQFDTIK 922
>gi|187734802|ref|YP_001876914.1| valyl-tRNA synthetase [Akkermansia muciniphila ATCC BAA-835] >gi|187424854|gb|ACD04133.1| valyl-tRNA synthetase [Akkermansia muciniphila ATCC BAA-835] (890 aa)
Score = 1419, Expect = 1.2e-154, Identities = 324/860 (37%), Positives = 488/860 (56%)
  Q:    11 NDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENK-ISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAV-GFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVK---VSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKE-----------------IYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN------QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKD-------------SILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVIN---ILNTAKINIVKQDIKSLK--PDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSS 870
           +DL K YD  + E+++     ++   K +  + K +YS+++PPPNVTG LHLGH LN TIQD L+R    KG  A W+ G DHAGIATQ + EK L++    S  D  R+  +  ++EW +  G  I NQ   +G   D++ E FT++++  + V QVF++++ +GLIYR + +VNW     +A+S+ EVI  E ++ LY + Y L +    L VATTRPETI  D  + VNPKD RY + I K  + PL    I II DEYV+I+FGTG +K TPAHD  D+E+G+K+ L II     DG  N   V     +   DAR K VE LE + L+  VE   + VGFSER N  +EP +S QWF+K   V E +  V     +   I F P ++ K   +W+ N+ DWCISRQLWWGH+IPVWY+KD  E                 +YVGT+PP++ + +++DNDV+DTWFSS LWP +T D  +++   +PT  LVTG DIIFFWV RM+      + + PF + + T +IRD+   KMSKSLGN  DP D+I  YGAD LR  L+  +  G D+ + E ++     F NKL+N+ R+  M          +T  +       I++K  + +++  +    Y F   I+ +  F W+++C+ ++E  K    +      Q + L  ++ +++  L L HP+ P +T  L+ +  F   +               LL  LD  +I+ L  +    + +  NK R    E  + NNK +   L+  +     +  ++++   IL  AK  I      S K  P  +     +F L  E L+    E    E++ +E++ +  EI++    L N  F+E+AP E +  EK++    E K  +L+ +L S
  S:     2 SDLPKAYDPSLVEEKWQSRWIEEGCFKADPASEKPAYSVVIPPPNVTGVLHLGHVLNNTIQDILVRRARQKGYEALWLPGTDHAGIATQVRVEKDLKQTTGRSRHDLGREAFLEKVWEWKEKHGGIIINQLHKLGCSCDWDRERFTMDEEYTKAVGQVFIELFKEGLIYRGRRMVNWCPVSLTALSDEEVIMTEQKSKLYTVLYKLEDGSGALHVATTRPETIMADVAVAVNPKDPRYAHLIGKNVMRPLNPTPIPIIGDEYVEIEFGTGALKITPAHDKADFEIGRKFNLEIIDILTPDGHINCPEVPELHGMDRFDARRKSVEMLEASGLMVNVEDYDNKVGFSERANVPIEPRLSMQWFLKYPCVKEAADAV-----AGGDITFRPTRWAKTYAHWLENIQDWCISRQLWWGHRIPVWYRKDKAEELRNAPALDASALEQGFLYVGTEPPQDPDNWIQDNDVMDTWFSSWLWPFSTMDE-ETRAKFYPTTDLVTGPDIIFFWVARMIMAGYRFQHDKPFSNVFFTSIIRDKIGRKMSKSLGNSPDPLDLIANYGADGLRFGLMRIAPTGTDVRFDENQISEGRNFANKLYNATRFRLMQGD----ARGETAPHYSSVHISIISKLKQLHADVEKALADYEFNALIQTLYQFFWNEYCDRFLEAVKGDLKDGADPAAQAATLTTMDTVLRHYLALLHPVMPHITEELWASLGFAESNGGLPLMRTPLPSAENLLAGLDESRIT-LANTQAAALYETANKARNLKAEYDLSNNKNVSFILKTPH----DVPQDILSRLAILANAKSVIRDAAYSSPKGTPAALTPLGELF-LPLEGLIDVEAEK---ERLGRELDKIAREIAKSAAKLGNAGFVERAPAEVVNQEKARLADWEAKQSQLKGMLDS 888
>gi|163848199|ref|YP_001636243.1| valyl-tRNA synthetase [Chloroflexus aurantiacus J-10-fl] >gi|187602879|ref|ZP_02989101.1| valyl-tRNA synthetase [Chloroflexus sp. Y-400-fl] >gi|163669488|gb|ABY35854.1| valyl-tRNA synthetase [Chloroflexus aurantiacus J-10-fl] >gi|187485066|gb|EDU23045.1| valyl-tRNA synthetase [Chloroflexus sp. Y-400-fl] (923 aa)
Score = 1419, Expect = 1.4e-154, Identities = 281/681 (41%), Positives = 411/681 (60%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY------------------YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDK--TPKNLED-----FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILI--------LFHPMCPFVTSNLY 692
           ++ K Y+H++ EQ+   W  +  L      A +  + I +PPPNVTG LHLGHA+   I+D LIR+  ++G    W+ G DHAGIATQT+ EK L     S +   R+E +   +EW +  G  I  Q + +G   D+  E FTL+   +  V+  F ++Y+DGLIYR   LVNW  KLQ+A+S++EV  +E   +++Y+RY                  + + + +++ VATTRPETI  D  + V P D RY + + K AI P   + + IIADEYVD +FG+G +K TPAHD NDYE+GK++ L +I+  N D T N     +  L   + R   +  LE+  LL K E    NVG S+R   ++EP++SEQWFV+    +   I   +   +++  P +FEK   +W+ N+ DWCISRQLWWGH+IPVWY  D   +  G  +PP  E   V+D DVLDTWFSSGLWP +T    D        +PT+V+ TG+DI+FFWV RMM    Y   + PF   Y+ GL+RDEH  KMSKS GN V+P D+IE+YGADALR  L++S +PG+D+    ++++S   F NK+WN  R+V     +    E    T ++L+       D+WIL+++    +E  +    YNF  + ++I DF W +F + Y+E++K +    E +    N L +++L         L HP  PFVT  ++
  S:    11 EMDKAYEHRLVEQRLYEWWERNGLFAPRDDAPRPPFVISIPPPNVTGELHLGHAMFVAIEDLLIRWRRMQGYQTLWVPGTDHAGIATQTQVEKLLEREGTSRQAVGREEFLRRTWEWKEKYGGEITRQLRRLGASCDWSRERFTLDPGLSRAVHTAFKRLYDDGLIYRGTYLVNWSPKLQTAVSDLEVEYEERNVSIWYVRYPVRTADWAGPTAPWGSGQWAAGATEFITVATTRPETILGDTAVAVAPGDPRYAHLVGKEAILPALARPLPIIADEYVDPEFGSGAVKITPAHDKNDYEIGKRHHLPMINILNPDATINEAGGPYVGLDRFECRKAILADLEREGLLVKTEPHKMNVGISQRGGEIIEPLLSEQWFVRTRPLADLAIAAVRDG-RVRIVPERFEKVYFHWLENIEDWCISRQLWWGHRIPVWYMPDGSIVVPGPDEPPPAEG--VQDPDVLDTWFSSGLWPFSTLGWPDETDDYRRFYPTSVMETGYDILFFWVARMMMMGCYFTGQPPFHTVYLHGLVRDEHGRKMSKSFGNVVNPLDIIEQYGADALRYTLVTSGTPGQDVNLNPQRIESARNFANKIWNITRFVISKLGNLPRTESSKVTAESLQTAGYTLADRWILSRYAHLVAEVDRLMEGYNFGEAGRQIHDFLWGEFADWYVEIAKVQLEGDEQR----NELTRRVLFTVLDGSLRLLHPFMPFVTEEVW 721
>gi|78222176|ref|YP_383923.1| valyl-tRNA synthetase [Geobacter metallireducens GS-15] >gi|78193431|gb|ABB31198.1| valyl-tRNA synthetase [Geobacter metallireducens GS-15] (887 aa)
Score = 1416, Expect = 2.4e-154, Identities = 312/858 (36%), Positives = 489/858 (56%)
  Q:    10 NNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKD-YLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE-DKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLE--------RLDFKKISNLKESSIEDVLQIINKIRIFNFENKI-PNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLG-------SNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           + +L+K Y+ +  E++ +  W  +     + + ++K SYSI++PPPNVTG LH+GHALN T+QD L R+  + G +  W+ G DHAGIATQ   E+ L     S  +  RD  +  +++W    G  I  Q K +G   D+E E FT+++  +  V +VFV++Y +GLIYR   L+NW  +  +A+S+IEV  +E   NL+++RY +++    +++VATTRPET+  D  + V+P+D+RY   + K  I PL N++I ++AD+YVD +FGTGV+K TPAHDFND+E+G+++ L++I+ F+E G  N     +E +    AR K VE LE   LLEK++     VG   R   VVEP +S QW+VKV   +++ +   K  +  +  P ++E    +WM N+ DWCISRQ+WWGH+IP WY     E  V    P       ++E+  ++ DVLDTWFSS LWP +T    D        +PT+ LVTGFDI+FFWV RMM   L+   EVPF+  YI  L+RD    KMSKS GN +DP  VI++YG DA R  L + ++ G D+   EE++     F NK+WN+ R+  MN   F+ D  D       + D+WIL +FN A ++  +    Y +  +   +  FTW +FC+ YIEL K+       + Q +  +VL  +++ +L L HP  PF+T  ++     +   + ++           DF        + +E V+++I  IR    E  + P+ ++  I        L  +    + I++ A+++ +       +P     +    +     L G              I K+ K+IEF+  +       L+N SF+E+AP + +  E+ K     +K E+ L  L+K+
  S:     3 DKELAKVYEPQAVEEKWYRTWEREGYFRAEAV-SDKPSYSIVIPPPNVTGALHMGHALNNTLQDVLCRWKRMSGHNVLWMPGTDHAGIATQNVVERQLAAEGKSRHELGRDAFIERVWKWKAESGGQIIGQLKRLGASCDWERERFTMDEGLSRAVREVFVRLYEEGLIYRDNRLINWCPRCHTALSDIEVEHEEKAGNLWHLRYPVADEPGRFVVVATTRPETMLGDTAVAVHPEDERYAGLVGKTVILPLLNRQIPVVADDYVDREFGTGVVKITPAHDFNDFEVGRRHNLDVINVFDESGVINAAGHQYEGMDRFAARKKIVEDLEAQGLLEKIDDHALAVGGCYRCKTVVEPYLSLQWYVKVGPLAEEALAAVKDGRT-RIVPQQWENTYYDWMENIRDWCISRQIWWGHRIPAWYCDHCGETTVAKVDPTKCSKCGSDEIR-QETDVLDTWFSSALWPFSTLGWPDQTSELKTFYPTSCLVTGFDILFFWVARMMMMGLHFMGEVPFRDVYIHALVRDAQGQKMSKSKGNVIDPLVVIDQYGTDAFRFTLAAFAAQGRDIKLAEERIAGYRNFANKIWNASRFALMNLEGFDPDAVDPAGLEFSNADRWILYRFNAAAADVQEALEAYRYNDAATALYRFTWSEFCDWYIELVKDDLYRGDETRQRTARYVLWLVLEHLLRLLHPFMPFITEEIWQALPGRRPTATIMTASWPTPDPAWDFAA----GAAEMELVMEVIRGIRNIRGEMDVAPSREIAAILNCGSEASLDLLKKNEVYIMSLARVSDLAIGTGLERPADAAISVAGDVEVAVPLRGLVDVEEEEKRLLKEIGKLDKDIEFLAKK-------LANPSFVERAPADVVAKEREKLTEFSQKKEVLLASLDKI 883
>gi|145618147|ref|ZP_01774208.1| valyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|144945607|gb|EDJ80671.1| valyl-tRNA synthetase [Geobacter bemidjiensis Bem] >gi|197087278|gb|ACH38549.1| valyl-tRNA synthetase [Geobacter bemidjiensis Bem] (888 aa)
Score = 1415, Expect = 3.1e-154, Identities = 318/859 (37%), Positives = 489/859 (56%)
  Q:    10 NNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE-DKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFK--TKDSILLERLDFKKIS----NLKESSIEDVLQIINKIRIFNFENKIPNNK----VIDIHLEVLNPKLFKISDEVINILNTAKINI-------------VKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           N +L K Y+ K  E+++     QK     N+ ++K  YSI++PPPN+TG LH+GHALN T+QD L R+  + G +  W+ G DHAGIATQ   E+ L        +  R+  +  +++W    G  I  Q K +G   D+E E FT++   ++ V +VFV++Y + LIYR   L+NW  +  +A+S+IEV  +E   +L+++RY +  + D+L+VATTRPET+  D  + V+P+D+RY + I K  + PL N+EI IIAD+YVD +FGTGV+K TPAHDFND+E+G ++ L+ I+ F+E G  N     +E ++   AR + V  LE   LLEK++    +VG   R   VVEP MS QW+VKV+  +++ +   K  +  +  P ++E    +WM N+ DWCISRQ+WWGH+IP WY      I V  + P       ++E+  ++ DVLDTWFSS LWP +T    +      + +PT+ L+TGFDI+FFWV RMM   L+   EVPF   YI  L+RD    KMSKS GN +DP  VI+ YG DA R  L + ++ G D+   EE++     F NK+WN+ R+  MN   F+ +  D     L + D+WIL + N+           + F  +   +  FTW +FC+ YIEL+K+         Q S  +VL  +++ +L L HP  PF+T  ++     K    +SI++                 + ++ V+++I  IR    E ++  +K    ++D   E     L +    V+++   + + I             V  D++ + P       L+ +  +E  LG       I KI+K+IEF+  +       L N SF+E+AP + +E E+ K  +   K K LE+ L
  S:     3 NKELEKVYEPKSVEERWYQQWEQKGYFHANVPSDKPGYSIVIPPPNITGVLHMGHALNNTLQDILCRWKRMAGYNVLWMPGTDHAGIATQNVVERQLAAEGKDRFELGREAFIERVWQWKGESGGQIIGQLKRLGASCDWERERFTMDAGLSKAVREVFVRLYQEKLIYRDNRLINWCPRCHTALSDIEVEHEEKAGHLWHLRYPVVGTNDFLVVATTRPETMLGDTAVAVHPEDERYAHLIGKMVMLPLVNREIPIIADDYVDREFGTGVVKITPAHDFNDFEMGVRHNLDRINVFDESGVVNAAGKQYEGMERFAARKQVVADLEAAGLLEKIQDHALSVGGCYRCKTVVEPYMSLQWYVKVAPLAERALGAVKDGRT-KIVPQQWENTYYDWMENIRDWCISRQIWWGHRIPAWYCDHCGHITVAKEDPTCCDECGSDEIR-QETDVLDTWFSSALWPFSTMGWPEKTPELASFYPTSCLITGFDILFFWVARMMMMGLHFMDEVPFTDVYIHALVRDAQGQKMSKSKGNVIDPLTVIDAYGTDAFRFTLAAFAAQGRDIKLAEERIAGYRNFANKIWNASRFAMMNLEGFDPNRVDPASLKLSNADRWILYRLNQTAVSVDAALGSFRFNEAANDLYRFTWSEFCDWYIELAKDDLYKGDADRQASAKYVLWLVLENLLRLLHPFMPFITEEIWQALPKKDGAAESIMISSFPTPCAEWEGYAAAATEMDLVMEVIKGIRNIRGEMEVAPSKQIAAILDCKSEASLALLKRNEAYVMSLARLSDLGIGQGIERPAEASLQVAGDVEIIVP----LRGLVNVEEEEKRLG-----KEIAKIEKDIEFLSKK-------LENPSFVERAPADVVEKEREKIGEFANKKKLLEESL 881
>gi|153001634|ref|YP_001367315.1| valyl-tRNA synthetase [Shewanella baltica OS185] >gi|151366252|gb|ABS09252.1| valyl-tRNA synthetase [Shewanella baltica OS185] (958 aa)
Score = 1415, Expect = 3.4e-154, Identities = 336/841 (39%), Positives = 505/841 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVI-------------------------------------EKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED---------FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFK---FKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK--QDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +   ++ +Y I++PPPNVTG+LH+GHA   TI D L R+  +KG +  W  G DHAGIATQ   E+ L   +  N+ D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  + KF + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++ L   N+++            N DGT N    G     F  L    AR   V   +   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY ++ K +YVG        K    + + +R D DVLDTWFSS LW  +T    D L+      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+I                                     E +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+     D+D  P + E           D+WI+  FN+    F      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++      L  +++ +  L HPM P++T  ++   K       D+I+L      D  K+ +   + +E V Q+I  +R    E  I  +K ++  L  ++     + D+     N      +   + +  L            ++ + +LL    G  + A  + +I K++E ++ EI+R  G LSN+ F+ KAP E I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEQGYF-KPHGDESQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLTRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKNRHDLGRDAFMDKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDELIYRGKRLVNWDPKLHTAISDLEVESKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALVGKFILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHNLPMFNVLTLDAAIRASAEVVNSDGTFNKTLDGSLPERFAGLDRFKARDAIVAEFDTLGLLEKIAPHALKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENGS-IKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDENGK-VYVGRNEAAVRAKHNIADSMTLRQDEDVLDTWFSSALWTFSTLGWPDNLEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIGLEDLVEKRTGNMMQPQLAAKIEKSTRKEFADGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----DQDCGPGSPEHKGGEMELSLADRWIIGLFNQTVKTFDDHMTAYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGTEAQMRGTRHTLVTVLEAMQRLMHPMMPYITETIWQRVKPLAGVAGDTIMLAPFPTFDAAKVDSAAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVS-----VQDKARVEANQTFFTTLARLESMTILADGETAPMSTTGLIGEMELLIPMAGLIDVAAEMARIDKQLEKLRQEIARIEGKLSNQGFVAKAPAEVIDKERAK 935
>gi|120598093|ref|YP_962667.1| valyl-tRNA synthetase [Shewanella sp. W3-18-1] >gi|146293836|ref|YP_001184260.1| valyl-tRNA synthetase [Shewanella putrefaciens CN-32] >gi|120558186|gb|ABM24113.1| valyl-tRNA synthetase [Shewanella sp. W3-18-1] >gi|145565526|gb|ABP76461.1| valyl-tRNA synthetase [Shewanella putrefaciens CN-32] (958 aa)
Score = 1415, Expect = 3.5e-154, Identities = 340/841 (40%), Positives = 503/841 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK------NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFK---FKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +   +K +Y I++PPPNVTG+LH+GHA   TI D L R+  +KG +  W  G DHAGIATQ   E+ L   +  N+ D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  I K+ + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++ L   N+++            N DGT N    G     F  L    AR   V   E   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY ++ K +YVG        K    + + +R D DVLDTWFSS LW  +T    D L+      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+ D +     +PK       L   D+WI+  FN+    F      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++      L  +++ +  L HPM P++T  ++   K       D+I+L      D  K+ +   + +E V Q+I  +R    E  I  +K ++  L  ++ +  K   E      T    +    I  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP E I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEAQGYF-KPHGDESKGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLTRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKNRHDLGRDAFMDKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDELIYRGKRLVNWDPKLHTAISDLEVESKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALIGKYILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHNLPMFNVLTLDAAIRVSAEVVNSDGTFNKTLDGSLPERFAGLDRFKARDAIVAEFETLGLLEKIAPHALKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENG-SIKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDENGK-VYVGRNEAEVRAKHNIADSMTLRQDEDVLDTWFSSALWTFSTLGWPDNLEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIGLEDLVEKRTGNMMQPQLAAKIEKSTRKEFENGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTEDQDCGPG-SPKYKGGELELSLADRWIIGLFNQTVKTFDDHMAAYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGSETQMRGTRHTLVTVLEAMQRLMHPMMPYITETIWQRVKPLAGVAGDTIMLAPFPTFDAAKVDSAAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-DKARVEANQTFFTTLARLESMTI--LADGETAPMSTTGLIGEMELLIPMAGLIDVAAEMARIDKQLEKLGQEIARIEGKLSNQGFVAKAPAEVIDKERAK 935
>gi|16763276|ref|NP_458893.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144755|ref|NP_808097.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|81512137|sp|Q8Z118|SYV_SALTI Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|25293115|pir||AC1061 valine-tRNA ligase (EC 6.1.1.9) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505584|emb|CAD06936.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140394|gb|AAO71957.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (951 aa)
Score = 1414, Expect = 4.3e-154, Identities = 329/854 (38%), Positives = 523/854 (61%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDG--------------TTNNYA----VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG               +N Y+      F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    + +  + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + + + +++D    +LN A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K + + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESNVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEDEVRQENNLGADVQLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYREALDNFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRHTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLLNLARL----ESITVLPADDKGPVSMTKIIDGAELLIPMAGLINKEDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLDGYAEAKAKLIEQ 944
>gi|56416247|ref|YP_153322.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|81821504|sp|Q5PJB8|SYV_SALPA Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|56130504|gb|AAV80010.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (951 aa)
Score = 1414, Expect = 4.8e-154, Identities = 329/854 (38%), Positives = 523/854 (61%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDG--------------TTNNYA----VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG               +N Y+      F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    + +  + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + + + +++D    +LN A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K + + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESNVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYGNDGN-VYVGRTEDEVRQENNLGADVQLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYREALDNFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRHTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLLNLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKEDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLDGYAEAKAKLIEQ 944
>gi|160876370|ref|YP_001555686.1| valyl-tRNA synthetase [Shewanella baltica OS195] >gi|160861892|gb|ABX50426.1| valyl-tRNA synthetase [Shewanella baltica OS195] (958 aa)
Score = 1414, Expect = 5.0e-154, Identities = 337/841 (40%), Positives = 502/841 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCF-------------NEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVI-------------------------------------EKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED---------FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFK---FKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +   +K +Y I++PPPNVTG+LH+GHA   TI D L R+  +KG +  W  G DHAGIATQ   E+ L   +  N+ D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  + KF + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++ L + +               N DGT N    G     F  L    AR   V   +   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY ++ K +YVG        K    + + +R D DVLDTWFSS LW  +T    D L+      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+I                                     E +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+     D+D  P + E           D+WI+  FN+    F      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++      L  +++ +  L HPM P++T  ++   K       D+I+L      D  K+ +   + +E V Q+I  +R    E  I  +K ++  L  ++ +  K   E      T    +    I  L            ++ + +LL    G  + A  + +I K++E ++ EI+R  G LSN+ F+ KAP + I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEQGYF-KPHGDESKGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLTRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKNRHDLGRDAFMDKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDELIYRGKRLVNWDPKLHTAISDLEVESKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALVGKFILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHNLPMFNVLTLDAAIRASAEVVNSDGTFNKTLDGSLPERFAGLDRFKARDAIVAEFDTLGLLEKIAPHALKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENGS-IKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDENGK-VYVGRNEADVRAKHNIADSMTLRQDEDVLDTWFSSALWTFSTLGWPDNLEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIGLEDLVEKRTGNMMQPQLAAKIEKSTRKEFADGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----DQDCGPGSPEHKGGEMELSLADRWIIGLFNQTVKTFDDHMTAYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGTEAQMRGTRHTLVTVLEAMQRLMHPMMPYITETIWQRVKPLAGVAGDTIMLATFPTFDAAKVDSAAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-DKARVEANQTFFTTLARLESMTI--LADGETAPMSTTGLIGEMELLIPMAGLIDVAAEMARIDKQLEKLRQEIARIEGKLSNQGFVAKAPADVIDKERAK 935
>gi|114046707|ref|YP_737257.1| valyl-tRNA synthetase [Shewanella sp. MR-7] >gi|113888149|gb|ABI42200.1| valyl-tRNA synthetase [Shewanella sp. MR-7] (958 aa)
Score = 1414, Expect = 5.1e-154, Identities = 340/841 (40%), Positives = 506/841 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF----------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKLWVLNYLIKKIL----ILFHPMCPFVTSNLYDNFKFKT---KDSILLERL---DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK--QDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +  A++ +Y I++PPPNVTG+LH+GHA   TI D LIR+  +KG +  W  G DHAGIATQ   E+ L  E   S  D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  I KF + P+ N+ I I+AD+YVD++FGTG +K TPAHDFNDYE+GK++KL   N+++            N DGT N    G     F  L    AR   V   E   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY  + K +YVG        K   ++ + +R D DVLDTWFSS LW  +T    D ++      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+      +D  P N  D+          D+WI+  FN+    +      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++    + +  +L     L HPM P++T  ++   K  T    D+I+L      D  ++     + +E V Q+I  +R    E  I  +K ++  L  ++ +     D+     N A    +   + +  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP   I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEQGYF-KPHGDASQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLIRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKSRHDLGRDAFMEKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDDLIYRGKRLVNWDPKLHTAISDLEVENKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALIGKFILLPIVNRRIPIVADDYVDMEFGTGCVKITPAHDFNDYEVGKRHKLPMFNVLTLDAAIRASAEVVNTDGTINTSLDGSLPERFAGLDRFKARDAIVAEFETLGLLEKIAPHGLKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENG-DIKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDANGK-VYVGRNEAEVRAKHNIDDAIALRQDEDVLDTWFSSALWTFSTLGWPDNVEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIDLEALVEKRTGNMMQPQLAAKIEKSTRKEFENGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----GQDCGP-NSPDYQGGEMELSLADRWIIGLFNQTVKTYDDHMANYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGNEAQMRGTRHTLVNVLEAMQRLMHPMMPYITETIWQRVKPLTGAQGDTIMLAPFPSYDAAQVDATAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-----DQARVEANQAFFTTLARLESMTILGEGETAPMSTTGLIGEMELLIPMAGLVDVAAEMARIDKQLEKLTQEIARIEGKLSNEGFVAKAPPAVIDKERAK 935
>gi|85057292|ref|YP_456208.1| valyl-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789397|gb|ABC65129.1| valyl-tRNA synthetase [Aster yellows witches'-broom phytoplasma AYWB] (876 aa)
Score = 1413, Expect = 6.2e-154, Identities = 344/852 (40%), Positives = 507/852 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYL------------SNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLW-------VLNYLIKKILILFHPMCPFVTSNLYDNFKFKTK-DSILLERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVI------NILNTAKINIVKQDIKSLKPDY-VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           +  KYD K  E Q      +K+    NL   K ++++++PPPNVTG LHLGHA N TIQD +IRF  ++G    ++ GMDHAGIATQ K ++ L++  + NK  +++  +   ++W +    NIR QW+ +G  LDY  E FTL+   ++ V +VF+K+Y   LIYR   ++NWD K ++A+SN+EV   E +  LYYI+Y+L            S +  +L +ATTRPET+F D+ L+VNP D RY+++I K    P TN +I +I+D YVDI FGTGV+K TP HD ND+E+ K+++L ++ C NEDGT N+ A+ ++ L     R K V+ L+K     K E  +  VG+S  +++++EP +S QWF+K    ++  ++    + KI FFP++F+    NW+ N+ DWCISRQLWWGHQIP W+K   KEI V  + P  E  +  D DVLDTWFSS LWP +T         L    FPT+VLVTG+DI+ FWV +M+F S+ L ++ PFK   + GL+RD    KMSKS GNGVDP +V+ KYG DALR FL ++++PG DL Y E KV S W FINKLWN  R++++ ++  + D D    +L    K +L + +    +    + KY      K +  F W+ F N ++E +K+      S L         L Y+IK IL L HP  PFVT  LY+NF  KT     +L++  +  +  L  +  E++  +I K R    E+ I  N  +++ LE+++     + D V           T +I I  +   S K  + +E N  ++I  K   L   NE        ++   +  EI R   +L+N SF++KA   KIE+EK K E +  + K+L
  S:     1 MQSKYDFKKVEHQRYQKWLEKKYFCSNLNTTKKTFTVVIPPPNVTGKLHLGHAWNNTIQDIIIRFKKMQGFDVLFLPGMDHAGIATQNKVKEQLKQEGLLNKTLNKEIFLKYAWQWKEKHAQNIRQQWQVLGLHLDYNFEKFTLDPDLSQTVQEVFIKLYQQKLIYRDYKIINWDPKTKTALSNVEVNYHETKGKLYYIKYFLVDFTTNSNLSNGSFASSFLEIATTRPETMFADQALMVNPNDPRYQSFIGKKVFIPDTNIQISVISDNYVDINFGTGVVKVTPGHDINDFEVAKRHQLKVLLCMNEDGTMNDLALQYQGLDRFVCRQKLVQTLKKKGFFTKTEIHLYKVGYSSISDSIIEPRLSLQWFLKTKAIAQNALK----TNKINFFPLRFKNIFNNWLQNIEDWCISRQLWWGHQIPAWHK--GKEIKVQIESPGPE--WNLDCDVLDTWFSSALWPFSTLGWPNCNTPLFQNHFPTDVLVTGYDILTFWVSKMVFQSILLTQKDPFKDVLLHGLVRDNKGKKMSKSKGNGVDPLEVVAKYGTDALRWFLTTNAAPGFDLFYDETKVASSWNFINKLWNISRFIKLKTNTLDTDFDINLLSLP--QKALLTQLHLTTQKVTTLYQKYELKEIGKILYHFVWEYFANWHLEFAKHDLDQNNSNLTNLYNSQKFLVYMIKYILQLLHPFIPFVTDVLYENFDKKTNITQTILQKTSYCNLDAL--TDFENLKNLIIKTRHLRQESNI--NFKLNLELEIVSQSSTPLQDFVSLQQALEKFFKTFQIKITNKVTNSKKTIWLIEKNLSLYIDRKT--LDKLNETKFESNFLQQKNTLLKEIKRSETILNNPSFLQKAASSKIEIEKKKYESYCKQYKKL 867
>gi|149115945|ref|ZP_01842680.1| valyl-tRNA synthetase [Shewanella baltica OS223] >gi|146864117|gb|EDK49559.1| valyl-tRNA synthetase [Shewanella baltica OS223] (958 aa)
Score = 1413, Expect = 6.3e-154, Identities = 338/841 (40%), Positives = 503/841 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVI-------------------------------------EKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED---------FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFK---FKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +   ++ +Y I++PPPNVTG+LH+GHA   TI D L R+  +KG +  W  G DHAGIATQ   E+ L   +  N+ D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  + KF + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++ L   N+++            N DGT N    G     F  L    AR   V   +   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY ++ K +YVG        K    + + +R D DVLDTWFSS LW  +T    D L+      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+I                                     E +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+     D+D  P + E           D+WI+  FN+    F      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++      L  +++ +  L HPM P++T  ++   K       D+I+L      D  K+ +   + +E V Q+I  +R    E  I  +K ++  L  ++ +  K   E      T    +    I  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP E I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEQGYF-KPHGDESQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLTRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKNRHDLGRDAFMDKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDELIYRGKRLVNWDPKLHTAISDLEVESKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALVGKFILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHNLPMFNVLTLDAAIRASAEVVNSDGTFNKTLDGSLPERFAGLDRFKARDAIVAEFDTLGLLEKIAPHALKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENGS-IKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDENGK-VYVGRNEADVRAKHNIADSMTLRQDEDVLDTWFSSALWTFSTLGWPDNLEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIGLEDLVEKRTGNMMQPQLAAKIEKSTRKEFADGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----DQDCGPGSPEHKGGEMELSLADRWIIGLFNQTVKTFDDHMTAYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGSEAQMRGTRHTLVTVLEAMQRLMHPMMPYITETIWQRVKPLAGVAGDTIMLAPFPTFDAAKVDSAAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-DKARVEANQTFFTTLARLESMTI--LADGETAPMSTTGLIGEMELLIPMAGLIDVAAEMARIDKQLEKLGQEIARIEGKLSNQGFVAKAPAEVIDKERAK 935
>gi|24374934|ref|NP_718977.1| valyl-tRNA synthetase [Shewanella oneidensis MR-1] >gi|81460030|sp|Q8EBS5|SYV_SHEON Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|24349646|gb|AAN56421.1|AE015778_9 valyl-tRNA synthetase [Shewanella oneidensis MR-1] (958 aa)
Score = 1412, Expect = 7.1e-154, Identities = 337/841 (40%), Positives = 506/841 (60%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF----------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKLWVLNYLIKKIL----ILFHPMCPFVTSNLYDNFKFKT---KDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ       +K   K +  A++ +Y I++PPPNVTG+LH+GHA   TI D LIR+  +KG +  W  G DHAGIATQ   E+ L  E   S  D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  I K+ + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++KL   N+++            N DGT N    G     +  L    AR   V   E   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY  + K +YVG        K   ++ + +R D DVLDTWFSS LW  +T    D ++      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+      +D  P N  D+          D+WI++ FN+    + +    Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++    + +  +L     L HPM P++T  ++   K  T    D+I+L      D  K+     + +E V Q+I  +R    E  I  +K ++  L  ++ +   +I          A++    + +  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP   I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEKGYFKPHGDASQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLIRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKSRHDLGRDVFMEKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDDLIYRGKRLVNWDPKLHTAISDLEVENKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALIGKYILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHKLPMFNVLTLDAAIRSSAEVVNTDGTINTSLDGSLPERYAGLDRFKARDAIVAEFETLGLLEKIAPHGLKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENG-DIKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDTNGK-VYVGRTEAEVRAKHDIDDAIALRQDEDVLDTWFSSALWTFSTLGWPDNVEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIDLETLVEKRTGNMMQPQLAAKIEKSTRKEFENGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----GQDCGP-NSPDYQGGEMELSLADRWIIDLFNQTVKTYDEHMASYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGTEAQMRGTRHTLVNVLEAMQRLMHPMMPYITETIWQRVKPLTGVQGDTIMLAPFPAFDAAKVDATAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQDKARIEANQAFFATLARL----ESMTILGEGETAPMSTTGLIGEMELLIPMAGLVDVAAEMARIDKQLEKLTQEIARIEGKLSNEGFVAKAPPAVIDKERAK 935
>gi|82701875|ref|YP_411441.1| valyl-tRNA synthetase [Nitrosospira multiformis ATCC 25196] >gi|123740759|sp|Q2YB22|SYV_NITMU Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|82409940|gb|ABB74049.1| valyl-tRNA synthetase [Nitrosospira multiformis ATCC 25196] (926 aa)
Score = 1410, Expect = 1.4e-153, Identities = 317/823 (38%), Positives = 490/823 (59%)
  Q:    46 SYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSN---------SKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVG-FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN--SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDN---FKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFE------NKIPNNKVIDIH-LEVLNP---KLFKISDEVINILNTAKINIVKQDIKSLK-PDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           +Y I+LPPPNVTG LH+GHA   T+ D L R++ ++G +  W  G DHAGIATQ   E+ L +  I  +D  R+  +A ++EW +  G+ I  Q + MG   D+  E FT++   +  V +VFV++Y +GLIYR + LVNWD  LQ+A+S++EV+  E E +L++I Y   N           + L+VATTRPET+  D  + V+P D+RY++ I +    PL  + I IIAD YVD  FGTG +K TPAHDFNDY++G+++KL  +     DG  N+ A   ++ L    AR K V  LE+ NLL + +     V   +RT A+VEPM+++QW+V ++  +++ +E   +S +++F P  +      W+ N+ DWCISRQLWWGH+IP WY +D+  I+V     + + L      V+D DVLDTWFSS LWP +T    +     D   PT+VLVTGFDIIFFWV RM+  SL+   +VPF+  YITGLIRD   +KMSKS GN +DP D+I+                                      +GADALR    S +S G D+ +  ++ +    F NKLWN+ RYV MN    D    E   P    D D WI+ +  +A +   Q +  Y F ++ ++I +F WD++C+ Y+E +K + ++     Q +    L  +++  L L HP+ PF+T  L+ +      K   SI+L+   + D  K+ +    +I  + ++IN  R    E      +++P   V D+  L   +P    L K+SD  I           +QD+   + P  +   + + +  + D+      A   E++ KE++ V++E+ +    L+N +F+++AP + +E EK +       L +L++ L
  S:    40 AYCIMLPPPNVTGTLHMGHAFQHTLMDALTRYHRMRGDNTLWQPGTDHAGIATQIVVERQLDQQSIDRRDLGREAFLARVWEWKEESGSTISRQMRRMGASCDWSRERFTMDGGLSRAVTEVFVRLYREGLIYRGERLVNWDPVLQTAVSDLEVVSAEEEGSLWHILYPFENDLGGNQDGAKPEGLIVATTRPETMLGDMAVAVHPDDERYRHLIGRHVRLPLCERSIPIIADAYVDPAFGTGCVKITPAHDFNDYQIGQRHKLVPLGILTLDGKINDLAPAEYQGLDRFAARRKIVADLEEQNLLVETKPHKLMVPRGDRTQAIVEPMLTDQWYVTMNGLARRGLE-AVASGEVKFIPENWAHVYNQWLENIQDWCISRQLWWGHRIPAWYDEDNN-IFVAHNLEEAQRLAGGRKLVQDEDVLDTWFSSALWPFSTLGWPEKTPELDTFLPTSVLVTGFDIIFFWVARMVMMSLHFTGKVPFREVYITGLIRDAEGHKMSKSRGNVLDPLDLIDGIALPDLITKRTSGLMNPRQAESIEKITRKQFPEGIPAFGADALRFTFASLASHGRDIKFDMQRCEGYRNFCNKLWNAARYVLMNCEGKDTGLVE-SVPLEYSDADCWIIGRLQQAETAVAQAYQDYRFDMAAREIYEFVWDEYCDWYLEFAKVQLNSGNEVVQRTTRRTLARVLETALRLAHPLIPFITEELWQSVAPLAAKQGVSIMLQPYPQADPSKLDDTAIGNIAALKEMINACRTLRGEMNLSPASRVPLLAVGDVKTLAGFSPYLKALAKLSDIEI-----------EQDLPPAEAPVAIVGEFRLMLKIEIDI------AAERERLTKELDRVQTEMEKAQTKLANSNFVDRAPAKVVEQEKERLAGFSTTLGKLKEQL 921
>gi|126175313|ref|YP_001051462.1| valyl-tRNA synthetase [Shewanella baltica OS155] >gi|125998518|gb|ABN62593.1| valyl-tRNA synthetase [Shewanella baltica OS155] (958 aa)
Score = 1409, Expect = 1.6e-153, Identities = 338/841 (40%), Positives = 503/841 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVI-------------------------------------EKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLED---------FDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFK---FKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +   ++ +Y I++PPPNVTG+LH+GHA   TI D L R+  +KG +  W  G DHAGIATQ   E+ L   +  N+ D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  + KF + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++ L   N+++            N DGT N    G     F  L    AR   V   +   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY ++ K +YVG        K    + + +R D DVLDTWFSS LW  +T    D L+      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+I                                     E +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+     D+D  P + E           D+WI+  FN+    F      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++      L  +++ +  L HPM P++T  ++   K       D+I+L      D  K+ +   + +E V Q+I  +R    E  I  +K ++  L  ++ +  K   E      T    +    I  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP E I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEQGYF-KPHGDESQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLTRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKNRHDLGRDAFMDKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDELIYRGKRLVNWDPKLHTAISDLEVESKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALVGKFILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHNLPMFNVLTLDAAIRASAEVVNSDGTFNKTLDGSLPERFAGLDRFKARDAIVAEFDTLGLLEKIAPHALKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENGS-IKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDENGK-VYVGRNEADVRAKHNIADSMTLRQDEDVLDTWFSSALWTFSTLGWPDNLEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIGLEDLVEKRTGNMMQPQLAAKIEKSTRKEFADGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----DQDCGPGSPEHKGGEMELSLADRWIIGLFNQTVKTFDDHMIAYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGSEAQMRGTRHTLVTVLEAMQRLMHPMMPYITETIWQRVKPLAGVAGDTIMLAPFPTFDAAKVDSAAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-DKARVEANQTFFTTLARLESMTI--LADGETAPMSTTGLIGEMELLIPMAGLIDVAAEMARIDKQLEKLGQEIARIEGKLSNQGFVAKAPAEVIDKERAK 935
>gi|113969474|ref|YP_733267.1| valyl-tRNA synthetase [Shewanella sp. MR-4] >gi|113884158|gb|ABI38210.1| valyl-tRNA synthetase [Shewanella sp. MR-4] (958 aa)
Score = 1409, Expect = 1.6e-153, Identities = 341/841 (40%), Positives = 505/841 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKE------VPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDF----------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKLWVLNYLIKKIL----ILFHPMCPFVTSNLYDNFKFKT---KDSILLERL---DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK--QDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +  A++ +Y I++PPPNVTG+LH+GHA   TI D LIR+  +KG +  W  G DHAGIATQ   E+ L  E   S  D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  I KF + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++KL   N+++            N DGT N    G     F  L    AR   V   E   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY  + K +YVG        K   ++ + +R D DVLDTWFSS LW  +T    D ++      PT+VLVTGFDIIFFWV RM+  +++  K+      VPFK  Y+TGLIRDE  NKMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+      +D  P N  D+          D+WI+  FN+    +      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++    + +  +L     L HPM P++T  ++   K  T    D+I+L      D  K+     + +E V Q+I  +R    E  I  +K ++  L  ++ +     D+     N A    +   + +  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP   I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEEQGYF-KPHGDASQGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLIRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKSRHDLGRDAFMEKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDDLIYRGKRLVNWDPKLHTAISDLEVENKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALIGKFILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHKLPMFNVLTLDAAIRASAEVVNTDGTINTSLDGSLPERFAGLDRFKARDAIVAEFETLGLLEKIAPHGLKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENG-DIKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDANGK-VYVGRNEAEVRAKHNIDDSIALRQDEDVLDTWFSSALWTFSTLGWPDNVEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPLVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIDLESLVEKRTGNMMQPQLAAKIEKSTRKEFENGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----GQDCGP-NSPDYQGGEMELSLADRWIIGLFNQTVKTYDDHMANYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGNEAQMRGTRHTLVNVLEAMQRLMHPMMPYITETIWQRVKPLTGAQGDTIMLAPFPSYDAAKVDATAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-----DQGRVEANQAFFTTLARLESMTILGEGETAPMSTTGLIGEMELLIPMAGLVDVAAEMARIDKQLEKLTQEIARIEGKLSNEGFVAKAPPAVIDKERAK 935
>gi|124546585|ref|ZP_01705652.1| valyl-tRNA synthetase [Shewanella putrefaciens 200] >gi|124509853|gb|EAY53927.1| valyl-tRNA synthetase [Shewanella putrefaciens 200] (958 aa)
Score = 1409, Expect = 1.6e-153, Identities = 338/841 (40%), Positives = 504/841 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNK-DKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKN---------LEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-QESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFK---FKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           + K YD +  EQ  +  W  Q    K +   +K +Y I++PPPNVTG+LH+GHA   TI D L R+  +KG +  W  G DHAGIATQ   E+ L   +  N+ D  RD  +  ++EW    G  I  Q + MG  +D++ E FT+++  ++ V +VFV++Y D LIYR K LVNWD KL +AIS++EV  KE + +++++RY L++       KDYL VATTRPET+  D  + V+P D+RY+  I K+ + P+ N+ I I+AD+YVD+ FGTG +K TPAHDFNDYE+GK++ L   N+++            N DGT N    G     F  L    AR   V   +   LLEK+      V + +R+  V+EPM+++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY ++ K +YVG        K   ++ + +R D DVLDTWFSS LW  +T    D ++      PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  +++     F NKLWN+ RYV MN+     D+D  P +         L   D+WI+  FN+    F      Y F ++   + +FTW+ FC+ Y+EL+K    N  E+++      L  +++ +  L HPM P++T  ++   K       D+I+L      D  K+ +   + +E V Q+I  +R    E  I  +K ++  L  ++ +  K   E      T    +    I  L            ++ + +LL    G  + A  + +I K++E +  EI+R  G LSN+ F+ KAP E I+ E++K
  S:     1 MEKTYDPQSIEQTLYQNWEAQGYF-KPHGDESKGNYCIMIPPPNVTGSLHMGHAFQDTIMDTLTRYQRMKGKNTLWQVGTDHAGIATQMLVERKLEAEEGKNRHDLGRDAFMDKVWEWKAQSGGTITKQLRRMGASVDWDRERFTMDEGLSKAVQEVFVRLYEDELIYRGKRLVNWDPKLHTAISDLEVESKEKQGHMWHLRYPLADGELTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQALIGKYILLPIVNRRIPIVADDYVDMAFGTGCVKITPAHDFNDYEVGKRHNLPMFNVLTLDAAIRASAEVVNSDGTFNKTLDGSLPERFAGLDRFKARDAIVAEFDTLGLLEKIAPHALKVPYGDRSGVVIEPMLTDQWYVAVAPMAKTAIEAVENG-SIKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDENGK-VYVGRNEADVRAKHNISDSMTLRQDEDVLDTWFSSALWTFSTLGWPDNVEDLKTFHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEAGNKMSKSKGNVLDPLDMIDGIGLEDLVEKRTGNMMQPQLAAKIEKSTRKEFENGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKLWNASRYVLMNTE----DQDCGPGSPEYKGGELELSLADRWIIGLFNQTVKTFDDHMAAYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGSEAQMRGTRHTLVTVLEAMQRLMHPMMPYITETIWQRVKPLASVAGDTIMLAPFPTFDAAKVDSAAMADLEWVKQVIVAVRNIRAELNIAPSKPLNALLRGVSAQ-DKARVEANQTFFTTLARLESMTI--LADGETTPMSTTGLIGEMELLIPMAGLIDVAAEMARIDKQLEKLGQEIARIEGKLSNQGFVAKAPAEVIDKERAK 935
>gi|67153804|ref|ZP_00415549.1| Valyl-tRNA synthetase, class Ia [Azotobacter vinelandii AvOP] >gi|67087937|gb|EAM07403.1| Valyl-tRNA synthetase, class Ia [Azotobacter vinelandii AvOP] (944 aa)
Score = 1409, Expect = 1.6e-153, Identities = 321/852 (37%), Positives = 499/852 (58%)
  Q:    13 LSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNE-------------DGTTNNYAV-----GFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPP--------KNEELYVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK----NRTSNQESKLWVLNYLIKKI---LILFHPMCPFVTSNLYDN---FKFKTKDSILLER---LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDI-----------HLEVLNPKLFKISD-EVINILNTAK-----INIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           + K Y  H I  + ++ W ++   N    + +   Y+I++PPPNVTG+LH+GH  N  I D LIRF  ++G +  W  G DHAGIATQ   E+ L    +      R++ +  ++EW +  G  I  Q + +G  +D+  E FT+++  +E V + FV+++ DGLIYR K LVNWD KL +AIS++EV   + + +L+++RY L++       KDYL+VATTRPET+  D  + V+P+D+RY++ I +  + PL N+ I I+ADEYVD +FGTG +K TPAHDFNDYE+GK++ L +I+ F++             DGT N         G+  +   DAR   V   E   LLEK++     V   +R+  ++EP +++QW+V     ++K I   +    IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  ++   YVG            +N+E   +D DVLDTWFSSGLW  +T      T+ LK+     PT+VLVTGFDIIFFWV RM+  SL+L  ++PF+  Y+ GL+RD   +KMSKS GN +DP D+++                                      YG DALR    S +S G D+ +   +V+    F NKLWN+  +V  N+   +      P  L   D+WI++   +   E  +Q + + F ++ + + +F WD +C  Y+EL K    + T++ E +      L++ +   L L HP  PF++  ++        K+  +++L+     D  +I    E  IE V  ++  IR    E  I   K ID+            LE   P L K++  E I +L   +        +  +++ L P                + G  ++   + ++ KEI+ ++ E+ R  G L N SF++KAP E I  E+++  + E  L +L
  S:     1 MDKTYQPHAIESRWYAEWESK---NYFAPQGSGEPYTIMIPPPNVTGSLHMGHGFNNAIMDALIRFRRMQGRNTLWQPGTDHAGIATQMVVERQLAALGLDRHALGREKFLDKVWEWKEQSGGTITRQIRRLGSSVDWSRERFTMDEGLSEAVKEAFVRLHEDGLIYRGKRLVNWDTKLHTAISDLEVENHDEKGHLWHLRYPLADDACTAEGKDYLVVATTRPETMLGDAAVAVHPEDERYRDLIGRHVLLPLVNRLIPIVADEYVDREFGTGCVKITPAHDFNDYEVGKRHHLPLINIFDKNAGILAQAQVFDIDGTPNTRVAPSLPDGYAGMDRFDARKAIVADFEGMGLLEKIDDHALKVPRGDRSGTIIEPWLTDQWYVSTKPLAEKAIAAVEDG-SIQFVPRQYENMYFSWMRDIQDWCISRQLWWGHRIPAWY-DEAGNAYVGRDEAEVRSKYAIRNDEPLRQDEDVLDTWFSSGLWTFSTLGWPQQTEFLKT---FHPTDVLVTGFDIIFFWVARMIMLSLHLTGQIPFRTVYVHGLVRDSQGHKMSKSKGNVLDPLDIVDGIDLESLVTKRTSGMMQPKLAEKIAKQTRAEFPEGIASYGTDALRFTFCSLASTGRDIKFDMGRVEGYRNFCNKLWNAANFVFENTEGKDCGAADEPVELSPVDRWIVSALQRTEQEVTRQLDAFRFDLAAQALYEFIWDQYCAWYLELVKPVLWDETASVERQRGTRRTLVRVLETALRLAHPFMPFISEEIWQRLAPLAGKSGPTLMLQPWPLADEARIDAAAEEDIEWVKALMLGIRQIRGEMNISMAKRIDVALNNASDSDRRRLEENRPLLTKLAKLESIRVLEAGEEAPLAATALVGEMQVLVP----------------MAGLIDKDAELARLDKEIQRLEGEVKRVGGKLGNASFVDKAPAEVIAKERARLNEAEQALGKL 934
>gi|30248461|ref|NP_840531.1| valyl-tRNA synthetase [Nitrosomonas europaea ATCC 19718] >gi|75541052|sp|Q82X51|SYV_NITEU Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|30138347|emb|CAD84355.1| probable valyl-tRNA synthetase (valine--tRNA ligase) protein [Nitrosomonas europaea ATCC 19718] (918 aa)
Score = 1408, Expect = 2.0e-153, Identities = 315/861 (36%), Positives = 504/861 (58%)
  Q:    12 DLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY---YLSNSKDY--LLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVG-FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG----TKPPKNEELYVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKT-PKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDN---FKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLK-PDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           +L+K +D K  E + +S W T    +  + K   + Y I+LPPPNVTG LH+GHA   T+ D LIR++ + G +  W  G DHAGIATQ   E+ L +     +   R+  +  +++W +  G+ I  Q + MG   D+  E FT+++  +  V +VFV++Y +GLIYR K LVNWD  LQ+A+S++EV+  E + +L++I Y    L    ++  L+VATTRPET+  D  + V+P+D+RY++ I +    PL+ + I IIAD YVD  FGTG +K TPAHDFNDY++G ++KL  ++ F  DG  N+ A   F+ L   DAR K +  L+   LL +       V   +RTN V+EPM+++QW++ +   +K+ + +  +S K++F P  +      W+ N+ DWCISRQLWWGH+IP WY +D            +    +E+  +D+DVLDTWFSS LWP +T      T  LK+     P +VLVTGFDIIFFWV RM+  SL+   EVPF+  YITGLIRD    KMSKS GN +DP D+I+                                      +G DALR    S +S G D+ +  ++ +    F NKLWN+ R+V MN    +   D+T P N    DKWI+ +  +A    +Q F++Y F ++ +++ +F WD++C+ Y+EL+K + S+     Q +    L  +++  L L HP+ PF+T  L+        KT  SI+ +   + D  ++     ++++ + +I+N  R    E K+   + + + +E    +L   S  ++ +   +++ I+   +     P  +   + + +  + D+      A   E++ KE++ +  EI +    L N  F+++AP++ +  EK +       L++L++ L  HK
  S:     2 ELAKSFDPKEIETRWYSTWETAGYFSPTDHKG-ADPYCIMLPPPNVTGTLHMGHAFQHTLMDALIRYHRMLGDNTLWQPGTDHAGIATQIVVERQLDQEGKDRRQMGREAFLERVWQWKEESGSTITRQMRRMGASCDWSRERFTMDETLSRAVTEVFVRLYREGLIYRGKRLVNWDPVLQTAVSDLEVVSVEEQGSLWHILYPFEQLEGGSEHQGLVVATTRPETMLGDMAVAVHPEDERYRHLIGRHLRLPLSERTIPIIADSYVDPAFGTGCVKITPAHDFNDYQVGLRHKLIPLNVFTLDGKINDNAPAEFQGLDRFDARKKVIADLQAQGLLVETRPHKLMVPRGDRTNTVIEPMLTDQWYLAMEGLAKQGLAVV-ASGKVRFVPENWTHVYNQWLENIQDWCISRQLWWGHRIPAWYDEDGNVTVAHDLEEARKLSGKEILRQDDDVLDTWFSSALWPFSTLGWPEQTPELKT---FLPGSVLVTGFDIIFFWVARMVMMSLHFTGEVPFREVYITGLIRDAEGQKMSKSKGNVLDPLDLIDGVSLTELIRKRTTGLMNPKQAESIEKTTRKQFPQGIPAFGTDALRFTFASLASHGRDIKFDLQRCEGYRNFCNKLWNATRFVLMNCEGKDTGLDETLPLNFSQADKWIVGRLQQAEQGVVQAFDEYRFDLAAREMYEFVWDEYCDWYVELAKVQLSSADEAHQRATRRTLVRVLEAALRLAHPIIPFITEELWQAVAPLAGKTGTSIMHQPYPQADPARMDEHAAANVQLLKEIVNACRTLRGEMKLSPAERVPLLIEGDPSRLADFSPYLLALAKLSEVTILPDRLPDTDAPVAITGEFRLMLKIEVDV------AAERERLNKEMQRLTLEIGKARTKLDNPDFLQRAPEKVVLQEKERLATFSATLEKLDQQL--HK 916
>gi|77164601|ref|YP_343126.1| valyl-tRNA synthetase [Nitrosococcus oceani ATCC 19707] >gi|90101536|sp|Q3JC50|SYV_NITOC Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|76882915|gb|ABA57596.1| Valyl-tRNA synthetase, class Ia [Nitrosococcus oceani ATCC 19707] (929 aa)
Score = 1408, Expect = 2.3e-153, Identities = 313/854 (36%), Positives = 504/854 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELY--------VRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN-SSDFNFDEDKTPKNLEDF------DKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK----NRTSNQESK---LWVLNYLIKKILILFHPMCPFVTSNLYDN---FKFKTKDSILLERLDFKKISNLKE---SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNP-KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           + K Y+ +  EQ  + +W  +     +      +SY I++PPPNVTG+LH+GHA   TI D LIR++ ++G    W  G DHAGIATQ   E  L     +  D  R+  +  ++EW ++ G  I  Q + MG  +D+  E FT+++  ++ V +VFV++Y++GL+YR K LVNWD  L +AIS++EVI +E  ++L+++RY LS+   +L+VATTRPET+  D  + V+P+D RY++ I K    PLT++ I +IAD+YV+ +FG+G +K TPAHDFNDYE+G+++ L  I+ F  D + N N    + NL   +AR   V  LE   LLEK+E     V   +R+  V+EP +++QWFVK +  ++  I+  ++  +I+F P  + K    WM N+ DWCISRQ+WWGH+IP WY  + K IYV     +  + Y         +D DVLDTWFSS LWP +T      T  L+   A +PT+VLVTGFDIIFFWV RM+   L    EVPF   YI GL+RD    KMSKS GN +DP D+I+                                      +G DALR      ++ G D+ +   +++    F NKLWN+ RYV +N SS+ + +    P+  E+       ++WI+++F+    E ++    Y F    + I +FTW+++C+ Y+ELSK    N  S + +K      L ++++ +L L HP+ PF+T  ++        +   +I+L+     +I  + E   + IE V+  +  +R    +  I   K I + L+        ++      +   AK++ + Q +K   P       +  +     L G  ++   ++++ +E++ ++ +++R  G L+N +++E+AP E +  E+ + ++    L  LE+
  S:     1 MDKNYNPQAIEQYWYQIWEQKGYFTPQ---GKDSSYCIMIPPPNVTGHLHMGHAFQSTIMDALIRYHRMRGDDTLWQVGADHAGIATQMVVENQLNAEGKTRHDLGREAFIQRVWEWKEHSGGTITRQLRRMGTSVDWSRERFTMDEGLSQAVGEVFVRLYDEGLLYRGKRLVNWDSVLHTAISDLEVISEEENSHLWHMRYPLSDGSGHLVVATTRPETMLGDTAVAVHPEDPRYQHLIGKTVALPLTDRTIPVIADDYVEPEFGSGCVKITPAHDFNDYEVGQRHGLPFINIFTVDASLNENVPERYRNLDRFEARKLVVADLEAAGLLEKIEDHKLMVPRGDRSRTVIEPYLTDQWFVKTAPLAEPAIQAVENG-QIRFIPENWNKIYFEWMRNIQDWCISRQIWWGHRIPAWYDPEGK-IYVAPTETQARQKYNLPPDLPLEQDPDVLDTWFSSALWPFSTLGWPEDTSLLR---AFYPTSVLVTGFDIIFFWVARMIMMGLKFTGEVPFHEVYIHGLVRDAEGQKMSKSKGNVLDPLDLIDGIDLETLVTKRTGGLMQPAMAKRIEKATRKEFPQGIPSFGCDALRFTFAILATRGRDIRFDLGRIEGYRNFCNKLWNAARYVLINVSSEISVERQGKPEQAEENLMLGAPERWIISRFHSTTQEVIEGIENYRFDRVAQAIYNFTWNEYCDWYLELSKPVLNNPASPEAAKRRTRHTLVHVLEALLRLAHPIIPFITEEIWQQVGPLAGRQGKTIMLQPYPQPEIDKIDEDAVAEIEWVIAFVTGVRSIRSQMNIAPGKPIPLLLQAGKAHDRTRLESNQKFLAALAKLDSI-QWLKDETPPPAATALVDELKLLIPLAGLIDKEAELKRLDREMQRMRKDLARVQGKLANSNYVERAPAEIVAKERQRAQEVTAALSTLEQ 919
>gi|91763307|ref|ZP_01265271.1| valine-tRNA ligase [Candidatus Pelagibacter ubique HTCC1002] >gi|91717720|gb|EAS84371.1| valine-tRNA ligase [Candidatus Pelagibacter ubique HTCC1002] (875 aa)
Score = 1407, Expect = 2.8e-153, Identities = 331/837 (39%), Positives = 507/837 (60%)
  Q:    16 KYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSK--------EIYVGTKPPKNEEL-YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL-----WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKT--KDSILLERL---DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK---LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEF----VKSEISRCNGMLSNKSFIEKAPKEKIELEKS 852
           KY H   E +   +  +  L K     NK  +S+++PPPNVTG+LH+GHALN +IQD L+R++ +      W  G DHAGIATQ   EK L  + I   +  R++ +  ++EW +  G+ I NQ K +G   D+    FT+++  ++ V +VFV+++  GLIY+ K LVNWD  L++AIS++EV ++EV + +YYI+Y +  S D++ +ATTRPET+  D  + VNPKD R+K+ + KF   P+  K+IKII DEY D + GTG +K TPAHDFNDYE+G++  L II+ F E G  N N    +  L   +AR + ++ L++     K E   + V + +R+N+++EP ++EQWFV   + S K  ++  +SKK  FFP  + K    WM N+  WCISRQLWWGHQIP WY  D K        E  +  K   N+++  +RD DVLDTWFSSGLWP  T    D  +  D  +PT+VLVTGFDIIFFWV RM+ F +    + PFK  Y+  L++DE   KMSKS GN ++P D+IEKY ADALR  LLS +SPG D+   E++VK    F+NKLWN+  ++  N+ DF+   D+ P    + +KWI  +  +  ++  +    Y F  + K    FTW  +C+ Y+ELSK    +++ K       V  Y+ K+ILIL HP  PFVT  ++ N KF    KD ++L      +F++ +++ +  +E ++ I++++R F  E  +     IDI +E ++ K    F  ++ ++  L   K N+  +D+       + +  L  +   ED+        ++E IKK +       + E+++ +  L+NK F+++APK+ ++ EK+
  S:     5 KYIHTDVEDKIYSYWEKNNLFKPT--KNKKQFSVVIPPPNVTGSLHMGHALNNSIQDLLVRYHRMNNYETLWQPGTDHAGIATQALVEKKLTADGIDKNEIGREKFIEKVWEWKEEHGDIILNQLKKLGCSCDWSRNAFTMDENLSKSVLKVFVELHKKGLIYKDKKLVNWDTVLKTAISDLEVDQREVNSKIYYIQYPIEASSDFITIATTRPETMLGDTAIAVNPKDDRFKHLVGKFVTVPIVGKKIKIIEDEYADPEMGTGALKITPAHDFNDYEVGQRNNLEIINIFTEGGKVNENAPKEYIGLDRFEARKRIIKELKEKEFFVKEENIKNKVPYGDRSNSIIEPFLTEQWFVDAKKLSIKAKDIV-NSKKTNFFPANWSKTYFQWMNNIEPWCISRQLWWGHQIPAWYGPDKKIFVAINEEEAKLDAKKFYNKDVDLIRDPDVLDTWFSSGLWPFATLGWPDNKEYVDKFYPTSVLVTGFDIIFFWVARMIMFGMEFLDKEPFKDVYVHALVKDEKGQKMSKSKGNVINPLDLIEKYSADALRFTLLSMASPGTDVKLSEDRVKGYRNFLNKLWNANNFLITNNCDFS-KIDEKPILSININKWIYAELIETKNKIEKNLKDYRFDEAAKNAYQFTWHSYCDWYLELSKTILFSEDEKAKDEIRQVSAYVFKQILILLHPFIPFVTEEIWLNNKFDNTGKDFLMLANWPSGEFERDTSINQ--VEKIISIVSELRSFKNELSVSPGSFIDISIETVSKKEQSFFTENEIILKKLGRIK-NLYNKDLDKPTATLMVSGDLFKVYFDEDV--------DLELIKKNLTTRQNKYQEEMNKISQRLANKGFVDRAPKDIVDQEKT 856
>gi|71083652|ref|YP_266372.1| valine-tRNA ligase [Candidatus Pelagibacter ubique HTCC1062] >gi|90101540|sp|Q4FM20|SYV_PELUB Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|71062765|gb|AAZ21768.1| valine-tRNA ligase [Candidatus Pelagibacter ubique HTCC1062] (875 aa)
Score = 1407, Expect = 2.8e-153, Identities = 331/837 (39%), Positives = 507/837 (60%)
  Q:    16 KYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSK--------EIYVGTKPPKNEEL-YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKL-----WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKT--KDSILLERL---DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK---LFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEF----VKSEISRCNGMLSNKSFIEKAPKEKIELEKS 852
           KY H   E +   +  +  L K     NK  +S+++PPPNVTG+LH+GHALN +IQD L+R++ +      W  G DHAGIATQ   EK L  + I   +  R++ +  ++EW +  G+ I NQ K +G   D+    FT+++  ++ V +VFV+++  GLIY+ K LVNWD  L++AIS++EV ++EV + +YYI+Y +  S D++ +ATTRPET+  D  + VNPKD R+K+ + KF   P+  K+IKII DEY D + GTG +K TPAHDFNDYE+G++  L II+ F E G  N N    +  L   +AR + ++ L++     K E   + V + +R+N+++EP ++EQWFV   + S K  ++  +SKK  FFP  + K    WM N+  WCISRQLWWGHQIP WY  D K        E  +  K   N+++  +RD DVLDTWFSSGLWP  T    D  +  D  +PT+VLVTGFDIIFFWV RM+ F +    + PFK  Y+  L++DE   KMSKS GN ++P D+IEKY ADALR  LLS +SPG D+   E++VK    F+NKLWN+  ++  N+ DF+   D+ P    + +KWI  +  +  ++  +    Y F  + K    FTW  +C+ Y+ELSK    +++ K       V  Y+ K+ILIL HP  PFVT  ++ N KF    KD ++L      +F++ +++ +  +E ++ I++++R F  E  +     IDI +E ++ K    F  ++ ++  L   K N+  +D+       + +  L  +   ED+        ++E IKK +       + E+++ +  L+NK F+++APK+ ++ EK+
  S:     5 KYIHTDVEDKIYSYWEKNNLFKPT--KNKKQFSVVIPPPNVTGSLHMGHALNNSIQDLLVRYHRMNNYETLWQPGTDHAGIATQALVEKKLTADGIDKNEIGREKFIEKVWEWKEEHGDIILNQLKKLGCSCDWSRNAFTMDENLSKSVLKVFVELHKKGLIYKDKKLVNWDTVLKTAISDLEVDQREVNSKIYYIQYPIEASSDFITIATTRPETMLGDTAIAVNPKDDRFKHLVGKFVTVPIVGKKIKIIEDEYADPEMGTGALKITPAHDFNDYEVGQRNNLEIINIFTEGGKVNENAPKEYIGLDRFEARKRIIKELKEKEFFVKEENIKNKVPYGDRSNSIIEPFLTEQWFVDAKKLSIKAKDIV-NSKKTNFFPANWSKTYFQWMNNIEPWCISRQLWWGHQIPAWYGPDKKIFVAINEEEAKLDAKKFYNKDVDLIRDPDVLDTWFSSGLWPFATLGWPDNKEYVDKFYPTSVLVTGFDIIFFWVARMIMFGMEFLDKEPFKDVYVHALVKDEKGQKMSKSKGNVINPLDLIEKYSADALRFTLLSMASPGTDVKLSEDRVKGYRNFLNKLWNANNFLITNNCDFS-KIDEKPILSININKWIYAELIETKNKIEKNLKDYRFDEAAKNAYQFTWHSYCDWYLELSKTILFSEDEKAKDEVRQVSAYVFKQILILLHPFIPFVTEEIWLNNKFDNTGKDFLMLANWPSGEFERDTSINQ--VEKIISIVSELRSFKNELSVSPGSFIDISIETVSKKEQSFFTENEIILKKLGRIK-NLYNKDLDKPTATLMVSGDLFKVYFDEDV--------DLELIKKNLTTRQNKYQEEMNKISQRLANKGFVDRAPKDIVDQEKT 856
>gi|95930108|ref|ZP_01312847.1| valyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] >gi|95133802|gb|EAT15462.1| valyl-tRNA synthetase [Desulfuromonas acetoxidans DSM 684] (886 aa)
Score = 1407, Expect = 2.8e-153, Identities = 319/858 (37%), Positives = 485/858 (56%)
  Q:    11 NDLSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYV----GTKPPKNEELYV-RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDF------NFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-----NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFK-FKTKDSILLERLDFKKISNLKE-----SSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLN-PKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLL 868
           ++L+K Y+ H    + +  W      +     ++K  YSI++PPPNVTG LH+GHALN T+QD L R+  + G    W+ G DHAGIATQ   EK L        D  RD  +  +++W +  G  I NQ K +G   D++ E FT++   ++ V +VFV +Y +GLIYR   L+NW  +  +A+S++EV   + + NL+++RY +  +   L+VATTRPET+  D  + V+P D+RY + + K    PLT +EI IIAD+YVD +FG+G +K TPAHDFND+E+GK++ L  I+  +E G  N     ++ ++   AR K V  L+   LLEKV+  +++VG   R   V+EP MS QW+V V   +K+ I+  +S +  +  P ++EK    WM N+ DWCISRQ+WWGH+IP W+  D  EI V     T   K +   + ++ DVLDTWFSSGLWP +T    +  DAL   +PT+ L+TGFDI+FFWV RMM   L    EVPFK  YI  L+RD    KMSKS GN +DP  VI+++G DA R  L + ++ G D+    E++     F NKLWN+ R+  MN   F      N+DE     +L   D+WIL +  +   E  +   +Y F  +   +  FTW +FC+ YIEL K     +  + + S   V+  +++++L L HP+ PF+T  ++ N    +   SI+L   D+ +   L +     + +E V++++  IR    E  +   K I   L+  N   L  +SD    I   A+I  +   +   +P  V       +     L G  N     +++ KEI  V+ ++   +  L+N+ F+  AP   +E ++ K    + KL  L+  L
  S:     3 DELAKGYEPHDFETKWYQTWEENGYFHADE-NSDKPPYSIVIPPPNVTGVLHMGHALNNTMQDILARWKRMTGHEVLWMPGTDHAGIATQNVVEKQLASEDKDRHDVGRDAFIERVWQWREESGGQIINQLKRLGASCDWQRERFTMDDGLSKAVREVFVSLYEEGLIYRDNRLINWCPRCHTALSDLEVEHDDKKGNLWHLRYPVKGTDQVLVVATTRPETMLGDTAVAVHPDDERYADLVGKMIELPLTGREIPIIADDYVDKEFGSGAVKITPAHDFNDFEMGKRHNLENINILDESGFVNENGGAYQGMERYAAREKVVADLDALGLLEKVDDHLNSVGECYRCKTVIEPYMSLQWYVDVQPLAKEAIKAVESGQT-RIVPAQWEKTYYEWMYNIQDWCISRQIWWGHRIPAWFCDDCGEITVSRDDATCCAKCQSTNIHQETDVLDTWFSSGLWPFSTMGWPEKTDALNKFYPTSCLITGFDILFFWVARMMMMGLKFMGEVPFKDVYIHALVRDAQGQKMSKSKGNVIDPLTVIDEFGTDAFRFTLTAFAAQGRDVKLSTERIGGYRNFCNKLWNASRFTLMNLEGFEPVDTPNWDE----LSLSMADRWILTRLTEVEKEANKALEEYRFNEAASTLYTFTWHEFCDWYIELIKGALYGDDAAAKLSAQTVVYTVLERLLRLLHPITPFITEEIWQNLPGTRPVASIMLA--DYPQGQGLLQDEDATAKMEQVMEVVRSIRNIRGEMDVSPAKKISALLDCKNEASLAVMSDGEEYIKALARIEELTCGVALDQPAQVAKQVSGDVEILLPLAGLINVEEEEKRLTKEIAKVQKDVDMFSKKLANEKFVANAPAAVLEKDRGKLAAAQEKLTVLQASL 879
>gi|163793116|ref|ZP_02187092.1| Valyl-tRNA synthetase [alpha proteobacterium BAL199] >gi|159181762|gb|EDP66274.1| Valyl-tRNA synthetase [alpha proteobacterium BAL199] (888 aa)
Score = 1407, Expect = 2.9e-153, Identities = 307/828 (37%), Positives = 470/828 (56%)
  Q:    39 NLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKD-YLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPP-----------KNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMN--SSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQES---------KLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLER----LDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL----EVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           ++ +N   Y+I++PPPNVTG+LH+GHAL  T+QD L R+  + G  A W  G DHAGIATQ   E+ L    +  +D  RD  +  ++EW    G  I NQ + +G   D+  E FT+++  +  V +VFV++Y +GLIYR K LVNWD K Q+AIS++EV  KEV+ NL++ RY +   +  Y++VATTRPET+  D  + V+P D+RYK+ + + AI PL  + I I+ADEY D + G+G +K TPAHDFND+E+GK+  L II+ F+     N N    +  L+  +AR + +  LE   L+EK+E     V   +R+   VEP +++QW+   +  +K  IE  ++ K + F P  +EK    WM N+  WCISRQLWWGHQIP WY  D   ++V                K  EL  R+ DVLDTWFSS LWP +T    +    L   +P +VLVTGFDIIFFWV RMM   L+  K+VPF+  YI  L+RD    KMSKS  N +DP ++I++YG DALR  L + ++ G D+   E +V+    F+ K+WN+ R+ EMN  + D  FD       +   ++WI+ +  K      +    Y F  +   +  F W  FC+ Y+E +K      E                + + + L L HP+ P+VT  L+ +F  +  D++L+ R    L  + +    ES +  ++++I+++R    E  +P +  I + L         ++ +  D ++ +   ++  +  +         ++   L  +L   D++    E     ++ KE+  V  EI++ +  LSN++FI KAP+E IE      E  E +  ELE+
  S:    28 DVASNAAPYTIMMPPPNVTGSLHMGHALTFTVQDILTRYQRMTGRDALWQPGTDHAGIATQMVVERNLAAEGVDRRDLGRDAFIEKIWEWKAESGGTIVNQLRRLGASPDWARERFTMDEGLSAAVRRVFVQLYKEGLIYRDKRLVNWDPKFQTAISDLEVEAKEVDGNLWHFRYPVEGEEGRYIVVATTRPETMLGDTGVAVHPDDERYKDLVGRHAILPLVGRRIPIVADEYADPEQGSGAVKMTPAHDFNDFEVGKRQNLEIINIFDAHAHLNENVPDTYRGLERFEARKRVIADLEALELIEKIEPHKHTVPHGDRSGVPVEPWLTDQWYADAATLAKPAIEAVETGKTV-FVPKNWEKTYFEWMRNIQPWCISRQLWWGHQIPAWYGPDGT-VFVEETEEEAAAAAATHYGKTVEL-TREPDVLDTWFSSALWPFSTLGWPEETPELARYYPGDVLVTGFDIIFFWVARMMMMGLHFMKDVPFRTVYIHALVRDAKGQKMSKSKNNVIDPLELIDRYGTDALRFTLTAMAAQGRDIKLAEGRVEGYRNFVTKIWNAARFCEMNGCAVDPAFDPAACTATV---NRWIVGEVRKTSVAVAEAIEAYKFNEAAGALYQFFWGSFCDWYLEFTKPILQTPEGGTEHPAAAETRAATAWALNRALHLLHPIMPYVTEELWASFG-EEADTMLISRPWPALAAELVDPAVESEMNWLIRLISEVRSIRSEMNVPPSAQIPLILTGAGATTEARVERYRDLILRLARLSEARLGTEVPAGAVQGVLDEATL--VLPIADVIDVGQER---ARLTKEVGKVDGEIAKIDKKLSNEAFIAKAPEEVIE------ENRERRADELER 872
>gi|78485844|ref|YP_391769.1| valyl-tRNA synthetase [Thiomicrospira crunogena XCL-2] >gi|78364130|gb|ABB42095.1| valyl-tRNA synthetase [Thiomicrospira crunogena XCL-2] (924 aa)
Score = 1407, Expect = 3.2e-153, Identities = 317/819 (38%), Positives = 486/819 (59%)
  Q:    47 YSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTN-NYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELY--------VRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKT-PKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIEL------SKNRT-SNQESKLWVLNYLIKKILILFHPMCPFVTSNLYD---NFKFKTKDSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNP--KLFKISDEVI--NILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELE 865
           YSI++PPPNVTG+LH+GHA   TI D LIR++ ++G    W  G DHAGIATQ   E+ L    +S  D  RD     ++EW    G  I  Q + +G   D+  E FT++   ++ V +VFV+++ +GLIYR K LVNWD  L +A+S++EV+ +E   +L+++RY LS+   +L+VATTRPET+F D+ + V+P D+RY++ I +    PL  +EI IIAD+YV++ FGTG +K TPAHDFNDYE+GK++ L +++    D   N      ++ L   +AR + +  LE  +L+EK+      V   +R++AV+EP +++QW+V V+E +K  I+  K+   I+F P  +E     WM NL DWCISRQ+WWGH+IP WY  +   +YV     +    Y         +D+DVLDTWFSS LW  +T    +     +   PT+VLVTGFDIIFFWV RM+  +L    EVPFK  Y+ GL+RD    KMSKS GN +DP D+                                     IE YG DALR    S +S G D+ +   + +    F NKLWN+ RYV MN+ + +   D+T    L   DKWI++K      +  + F++Y F ++   + +FTW+++C+ Y+EL      SK  T + Q      L  +++ IL L HP+ P++T   +    +   KT D+I+L+   + +   I    E  +E V  +I  +R    E  I  +K + I L  L    K++  ++ V    +     I +++ + ++ +        +  ++    L+    E   + ++ KEI+ ++ E+ R  G LSN+SF+ KAP+  +E EK K +  E+ LK L+
  S:    35 YSIMIPPPNVTGSLHMGHAFQDTIMDTLIRYHRMRGDETLWQPGTDHAGIATQMVVERQLAAKGLSRHDLGRDAFTQKIWEWKAESGGTITQQLRRLGASPDWSRERFTMDDGLSDAVKEVFVQLHEEGLIYRGKRLVNWDPVLHTAVSDLEVLSEEEMGSLWHMRYPLSDGSGHLIVATTRPETMFGDQAVAVHPDDERYQHLIGQTITLPLVGREIPIIADDYVEMDFGTGCVKITPAHDFNDYEMGKRHNLPMLNVMTIDAAMNEEVPEKYQGLDRFEARKQVIADLEVQDLMEKIVPHKLMVPRGDRSHAVIEPFLTDQWYVAVNELAKPAIDAVKNG-DIEFVPKNWENTYFEWMNNLQDWCISRQIWWGHRIPAWY-DEGGNVYVARSEEEVRAKYNLDTSHSLQQDDDVLDTWFSSALWTFSTLGWPEKTPELEKFHPTSVLVTGFDIIFFWVARMIMMTLKFTGEVPFKQVYVHGLVRDSEGQKMSKSKGNVLDPIDLIDGIDLESLVAKRTTGMMQPEKAAQIEKTTRKHFGEGIESYGTDALRFTFASLASTGRDIRFDLNRCEGYRNFCNKLWNATRYVLMNTEEKDTGTDETLDTELSLADKWIISKLQNVEMDVAKHFDQYRFDLAAHTLYEFTWNEYCDWYLELVKPILNSKTATEAQQRGTRQTLVRVLETILRLLHPITPYITEEAWHSVASLAGKTGDTIMLQPYPQPNEALIDTASEKELEWVKHVIMGVRKIRSEMDIAPSKALPILLTNLQEQDKVWLENNRVFLQTLAKLDTITLLENETEAPESAVALVGEMKILIPMAGLIDKEAE---LSRLSKEIKRLEGEVKRFTGKLSNESFVSKAPEAVVEKEKQKLQDTEIALKNLK 915
>gi|110833353|ref|YP_692212.1| valyl-tRNA synthetase [Alcanivorax borkumensis SK2] >gi|122959655|sp|Q0VSA8|SYV_ALCBS Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|110646464|emb|CAL15940.1| valyl-tRNA synthetase [Alcanivorax borkumensis SK2] (931 aa)
Score = 1407, Expect = 3.2e-153, Identities = 324/828 (39%), Positives = 489/828 (59%)
  Q:    45 NSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNN-YAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-------NEELYVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNS--SDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-------RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNF-----------KFKTKDSILLERL---DFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVK----QDIKSLKP-DYVENNYLIFILNKEDLL---GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + + I++PPPNVTG+LH+GHA   TI D L+R+  ++G +  W  G DHAGIATQ   E+ L     +  +  R++ +  ++EW +  G  I  Q + MG  +D+  E FT++   +  V +VFV+++ +GLIYR K LVNWD  L +AIS++EV   E + ++++ RY LS+   +L+VATTRPET+  D  + V+P+D RYK+ I K    PL ++ I IIAD+YVD  FG+G +K TPAHDFNDYE+GK++ L +I+    D   N+    G+  L   +AR K V+ L+   LLEKV+     V   +R+  V+EP +++QWFV V E +K  I   ++   IQF P  +E    +WM +L DWCISRQLWWGH+IP WY  D   +YVG    +        +    +D+DVLDTWFSS LW  +T      TDAL++     PT+VLVTGFDIIFFWV RM+  +L    +VPFK  Y+ GL+RD    KMSKS GN +DP D+I+                                      YG DALR   LS +S G D+ +   +++    F NK+WN+ RYV MN+   D   D D +   L   D+WI++   +A  E  +  + + F V+     +F W+++C+ Y+ELSK          + +      L  +++ IL + HP  PF+T  ++              K +  D+I+L+     +  KI    E+  E V  +I+ +R    E  IP  K + I+L   N K     D    +L+  ++ + K    + I  L   D    +    + + E L+   G  ++   IE++ KEIE ++ E+ R  G L N  F++KAP+  ++ EK+K + +  +L +LE+ L   K
  S:    33 DPFCIMIPPPNVTGSLHMGHAFQDTIMDTLVRYRRMQGRNTLWQVGTDHAGIATQMVVERKLAGEGTNRHELGREKFLDKVWEWKRESGGTITRQLRRMGASVDWTRERFTMDDGLSNAVREVFVRLHKEGLIYRGKRLVNWDPALHTAISDLEVENVEEQGHMWHFRYPLSDGSGHLVVATTRPETMLGDTAVAVHPQDPRYKDMIGKSIRLPLADRNIPIIADDYVDPDFGSGCVKITPAHDFNDYEVGKRHDLPMINILTIDAALNDEVPEGYRGLDRVEARKKVVDDLDALGLLEKVDDHTLQVPRGDRSGVVIEPYLTDQWFVAVEELAKPAIAAVENG-DIQFVPKNYENMYFSWMRDLQDWCISRQLWWGHRIPAWYDADGN-VYVGRDEEEVRAENNLGDTPLSQDDDVLDTWFSSALWTFSTLGWPDDTDALRT---FHPTDVLVTGFDIIFFWVARMIMMTLKFTDQVPFKKVYVHGLVRDNDGQKMSKSKGNVLDPLDMIDGITLDALIDKRTKGLMQPQKEKQITKRTNKDFPDGINPYGTDALRFTFLSLASTGRDIKWDMGRIEGYRNFCNKIWNAARYVMMNTEGEDCGIDTD-SEVELSLADRWIISALQRAELEVSEALDSFRFDVASHAAYEFIWNEYCDWYLELSKPVLWGDEYSDAQKRGTRRTLVTVLEAILRMAHPFMPFITEEIWQKVGPLAGKASAAGKGEKTDTIMLQPFPASEPAKIDTNAETGAEWVKAVISAVRNIRGEMGIPLGKALPIYLH--NGK-----DSDKALLDANRVFLCKLAKLESITWLTAEDSAPASATALVGDMEILVPMAGLIDKEAEIERLSKEIEKLRKEVGRAEGKLKNPKFVDKAPQAVVDKEKAKLDDYRSQLAKLEEQLEKIK 929
>gi|72080999|ref|YP_288057.1| valyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] >gi|90101531|sp|Q4A755|SYV_MYCH7 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|71914123|gb|AAZ54034.1| valyl-tRNA synthetase [Mycoplasma hyopneumoniae 7448] (822 aa)
Score = 1406, Expect = 3.4e-153, Identities = 349/854 (40%), Positives = 505/854 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNL----KANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGL-------WPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           +  KYD K+ E++       ++  KK      K  K  +SI+ PPPNVTG LHLGH+ N  IQD L+R++ L+G     +  +DHAGIATQ K E+ L +  I   D  R+E +   + W +     I+ QW  +G   D+  E FTL++ +   V+  F+K++   LIYR +  +NWDIKLQ+AISNIEVI K VE  +YY++Y+L NS ++L VATTR ETI  D  L +NPKDKRY + + K  ++PLT K I IIAD  V   FG+G+MK + AH   D+E+ +K+ L    C +  G  N+    F+      AR    + LEK   L K+E  ISNVGFS+R++ +VE +   QWFVK+ E +K +I    S  KI+F+P  FEKNL  W   ++DW ISRQLWWGH+IPVW K D  ++ + +      + +++D DVLDTWFSSG+       WP    D +KS    FPT++LVTG+DI+FFWV RM F SL++ K+ PF+   + GLIRDE   KMSKSLGNG+DP ++IEKYG+D LR  L+ +SSPG+D+ +  EK+ + W   NK+WN  +Y+         D D      +  D W+ NK      + ++   KYNF V   +I +F + DF + YIEL K R +   ++      L++K+LI+ HP  PF+T  L +   FK +  IL +++   +I   KE+  +E++L+II+ +R   +  K   +K I +   ++N K      ++IN L   K    K+ +   K      N+ I I   E+L     +     +  KEI+F+KSEI R   +L+NK F+EKAP+EKI+LE++K EK + KL   EK
  S:     1 MKNKYDFKLVEEK-----RNEKWQKKGFFIAPKQTKKPFSIISPPPNVTGQLHLGHSWNAFIQDSLVRYHKLQGFDVLLLPSVDHAGIATQVKVEEDLAKKGIKKSDLKREEFIKKCYHWKEKQYLKIKEQWDKLGICYDFSKERFTLDQDAQIAVSDFFIKLWEKNLIYRGQKAINWDIKLQTAISNIEVINKPVEQKMYYLKYFLENSNEFLTVATTRIETISSDVALAINPKDKRYLHLVGKKVVHPLTKKLIIIIADSNVSSDFGSGIMKVS-AHSILDFEIMEKHNLESKDCIDNYGNLNHEVPEFQGQNRFFARDLIAKKLEKEGFLAKIETVISNVGFSQRSDEIVEILKKPQWFVKMDELAKSLISHLNSKDKIKFYPKNFEKNLRKWFEKIHDWTISRQLWWGHRIPVWCKNDEFKVQIDSP----GQGWIQDEDVLDTWFSSGISAFAFLGWP-QNFDLIKS---YFPTSLLVTGWDILFFWVARMYFSSLFIMKQKPFEKVLLHGLIRDEIGRKMSKSLGNGLDPMEIIEKYGSDTLRQALIFNSSPGKDIKFNIEKLNTAWNLNNKIWNIAKYIA--------DLDTFFAKPDLIDLWMENKIYILKRQIVKNIKKYNFSVIGTEINNFIYGDFSSRYIELIKTRKNGFYAR-----KLLRKVLIILHPFLPFLTDFLMEKI-FKME--ILEQKM--PRIRQFKENQKVENILEIIDNLR--TYREKFQISKKIILEYCIINDKFSNAEIDIINKLTFGKWLENKELVIKTK------NFEIAIKVPEEL-----KKEQKGRELKEIQFLKSEILRAEKILTNKGFLEKAPREKIDLERTKLEKLKEKLAFYEK 821
>gi|51891504|ref|YP_074195.1| valyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] >gi|81826240|sp|Q67SJ2|SYV_SYMTH Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|51855193|dbj|BAD39351.1| valyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863] (911 aa)
Score = 1406, Expect = 3.5e-153, Identities = 310/862 (35%), Positives = 486/862 (56%)
  Q:     8 KNNNDLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDK-SRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEEL----YVRDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESSI------------------EDVLQIINKIRIF---NFENKIPNNKVIDIHLEVLNPKLFKISDE----VINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKE---DLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +   +L+ +YD K+ E ++  +       +  +   K  Y+I++PPPNVTG LHLGHALN T+ D LIR+  ++G    ++ G DHAG+ATQ + E+ LR++    + +  R+  VA +++W +     I +Q + +G  +D+  E FT++++ +  V   FV++Y  GLIY+   + +W  K Q+A+S+IEV  +E + ++++ RY L++    +++ATTRPET+  D  + VNP+D+RYK+ + K   +P T +EI IIADEYVD  FGTG +K TP HD ND+E+G ++ L +       G     A  +  L   + R + V   E    L KVE+    VG   R   V+EP++S QW+VK+   ++  I   +S  +I+  P +F K  ++WM N+ DWCISRQ+WWGH+IPVWY  D   + V  T P + E+       +D D LDTWFSS LWP +T    D        FPT+VLVTG+DI+FFWV RM+F SL L  ++PF    + GL+RD    KMSKSLGNGVDP DVI++YG DALR  L++ SSPG D+ +  E+V++   F NKLWN+ R+V MN +D+    +      +  D+WI ++FN+A     +   +Y +  + + I DF W +FC+ YIEL K R  N     + +    L  +++  L L HP  P++T  ++     ++        +      +    SI                  E +  II+ IR       E ++  +  ID  +   + +   I +E    + N+  T ++ I  Q +   KP   +N     +   E    L G  +    IE++ KE+     E+++    LSN+ F+ KA  E +E  + +      K + LE  L+
  S:     7 QGGTELAPRYDAKLVEDEYYQYWMDGGFYRAPIVEGKQPYTIVIPPPNVTGTLHLGHALNNTMIDILIRWKRMQGHPTLYLPGTDHAGLATQIRVEEDLRKSGGPTRHELGREAFVAKVWDWKERYHATITSQLRKLGVSVDWSREAFTMDERLSRAVRAFFVQLYKKGLIYQGTRITHWCPKDQTALSDIEVEYEERQGHMWHFRYPLADGSGSIVIATTRPETMLGDTAVAVNPEDERYKHLVGKMLRHPATGREIPIIADEYVDPAFGTGCVKITPFHDPNDFEIGLRHGLEMPQVIGPKGEMTEAAGKYAGLDRYECRRRIVADAEAEGWLVKVEEHQHAVGCCARCGTVIEPLISRQWYVKMKPLAEPAIRAVESG-QIKIVPERFTKVYLHWMENIQDWCISRQIWWGHRIPVWYCDDCGHLTVSETDPTRCEKCGSANIRQDEDALDTWFSSALWPFSTLGWPDDTADLRYFFPTDVLVTGYDILFFWVARMIFSSLELTGKIPFHTVVLHGLVRDAQGRKMSKSLGNGVDPIDVIDQYGTDALRFMLVTGSSPGNDIRFHTERVENARNFANKLWNASRFVLMNLADWQPAAEGAALQYDVADRWIRHRFNEAARAVNELLGEYQYGEAARTIYDFIWSEFCDWYIELVKPRLYNPADPTRAAAQETLARVLEGTLRLLHPFMPYITEAIWQKLPLRSPQVETAPEIARAAGRDALPPSISVTAYPTPVEGWADAEANERMALIIDTIRALRSIRAEFRLGEHTRIDAVVMATSDQALAILNEGRAFIENLGKTGQLTI--QPVAEAKP---KNAAAAVVTGAEIYVPLGGLIDLPKEIERLTKELTTTGDELAKLEKKLSNEGFLTKAKPEVVEKTREEAAALAEKRQALENRLA 904
>gi|168262482|ref|ZP_02684455.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (951 aa)
Score = 1406, Expect = 3.9e-153, Identities = 328/854 (38%), Positives = 518/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPETI  D  + VNP+D RY++ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    + +  + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K E + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETILGDTGVAVNPEDPRYQSLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEEEVRQENNLGADVQLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYREALDNFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRHTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLEGYAEAKAKLIEQ 944
>gi|114777967|ref|ZP_01452881.1| Valyl-tRNA synthetase, class Ia [Mariprofundus ferrooxydans PV-1] >gi|114551754|gb|EAU54306.1| Valyl-tRNA synthetase, class Ia [Mariprofundus ferrooxydans PV-1] (882 aa)
Score = 1405, Expect = 4.6e-153, Identities = 281/684 (41%), Positives = 415/684 (60%)
  Q:     9 NNNDLSKKYDHKICEQQFS-LWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY-YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDG---TTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEE----LYVR-DNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLY 692
           + ++L+K YD +  E   +  W +      K      ++Y I++PPPNVTG+LH+GHA   TIQD LIR+  ++G S  W  G DHAGIATQ   E+ L +  +  +D  R+  +  ++EW ++ G  I NQ K +G   D+  E FT+++  +  V +VFV++Y +GLIYR K LVNWD  L++A+S++EV   E + + +++ Y Y  +   +++VATTRPET+F D  + V+P D+RY+  I K  I PLT + I +IAD+YVD +FGTG +K TPAHDFNDY++GK++ L +I+            +    +  ++  +AR   V  L+   LL KVE     VG  +R++AV+EP +++QW+V +   ++  I+  +   +I+F P  +EK    WM N+ DWCISRQLWWGH+IP WY  D   I V    P+  E      VR D DVLDTWFSSGLWP +T    D     D  +PTNVLVTGFDIIFFWV RM+   +    +VPF+  YI  LIRD    KMSKS GN +DP ++  KYGADALR  L   ++PG D+   E +++S   F+NK+WN+ R+V MN +D   D    P+   D ++WIL + +   +E  +   +Y F  +   +  F W  +C+ Y+E +K      + T   E++  +L  L +  L L HP+CP++T  L+
  S:     2 SQHELAKTYDPQAVEPAINDQWLSSDAFRPK--ADGDDAYCIVIPPPNVTGSLHMGHAFTFTIQDTLIRWQRMQGKSTLWQPGTDHAGIATQMVVERILDKEGVHRRDLGRERFLDRVWEWKEHSGGTIVNQLKQLGASCDWSRERFTMDEGLSHSVREVFVRLYEEGLIYRGKRLVNWDPVLETAVSDLEVEHVEEQGHFWHMCYPYADDPSKHVIVATTRPETMFGDAAVAVHPDDERYQALIGKELILPLTGRTIPVIADDYVDPEFGTGCVKITPAHDFNDYDVGKRHDLPLINILTAKAHMLDDEHVPEKYRGMERYEAREHVVADLDAEGLLHKVEDHTHQVGRGDRSHAVLEPYLTDQWYVDIKPLAEPAIKAVEDG-EIRFVPQYWEKTYFEWMRNIQDWCISRQLWWGHRIPAWYCSDCDHITVSRATPECCEGCGSASVRQDEDVLDTWFSSGLWPFSTLGWPDKTPEMDQFYPTNVLVTGFDIIFFWVARMIMMGMKFTGQVPFRDIYIHALIRDAEGQKMSKSKGNVIDPLEMTGKYGADALRFTLAHMATPGRDVKLDETRIESNRNFMNKIWNAARFVFMNRADAVPDASLRPQ--LDANRWILAELDTTAAEVHKALEEYRFNEAAGALYSFIWGTYCDWYVEAAKVALWSDDETMISETRTAMLTAL-EGWLKLLHPICPYITETLW 698
>gi|71894019|ref|YP_279465.1| valyl-tRNA synthetase [Mycoplasma hyopneumoniae J] >gi|90101532|sp|Q4A917|SYV_MYCHJ Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|71852146|gb|AAZ44754.1| valyl-tRNA synthetase [Mycoplasma hyopneumoniae J] (822 aa)
Score = 1405, Expect = 4.8e-153, Identities = 349/854 (40%), Positives = 505/854 (59%)
  Q:    13 LSKKYDHKICEQQFSLWTTQKELNKKNL----KANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGL-------WPITTTDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILLERLDFKKISNLKESS-IEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           +  KYD K+ E++       ++  KK      K  K  +SI+ PPPNVTG LHLGH+ N  IQD L+R++ L+G     +  +DHAGIATQ K E+ L +  I   D  R+E +   + W +     I+ QW  +G   D+  E FTL++ +   V+  F+K++   LIYR +  +NWDIKLQ+AISNIEVI K VE  +YY++Y+L NS ++L VATTR ETI  D  L +NPKDKRY + + K  ++PLT K I IIAD  V   FG+G+MK + AH   D+E+ +K+ L    C +  G  N+    F+      AR    + LEK   L K+E  ISNVGFS+R++ +VE +   QWFVK+ E +K +I    S  KI+F+P  FEKNL  W   ++DW ISRQLWWGH+IPVW K D  ++ + +      + +++D DVLDTWFSSG+       WP    D +KS    FPT++LVTG+DI+FFWV RM F SL++ K+ PF+   + GLIRDE   KMSKSLGNG+DP ++IEKYG+D LR  L+ +SSPG+D+ +  EK+ + W   NK+WN  +Y+         D D      +  D W+ NK      + ++   KYNF V   +I +F + DF + YIEL K R +   ++      L++K+LI+ HP  PF+T  L +   FK +  IL +++   +I   KE+  +E++L+II+ +R   +  K   +K I +   ++N K      ++IN L   K    K+ +   K      N+ I I   E+L     +     +  KEI+F+KSEI R   +L+NK F+EKAP+EKI+LE++K EK + KL   EK
  S:     1 MKNKYDFKLVEEK-----RNEKWQKKGFFIAPKQTKKPFSIISPPPNVTGQLHLGHSWNAFIQDSLVRYHKLQGFDVLLLPSVDHAGIATQVKVEEDLAKKGIKKSDLKREEFIKKCYHWKEKQYLKIKEQWDKLGICYDFSKERFTLDQDAQIAVSDFFIKLWEKNLIYRGQKAINWDIKLQTAISNIEVINKPVEQKMYYLKYFLENSNEFLTVATTRIETISSDVALAINPKDKRYLHLVGKKVVHPLTKKLIIIIADSNVSSDFGSGIMKVS-AHSILDFEIMEKHNLESKDCIDNYGNLNHEVPEFQGQNRFFARDLIAKKLEKEGFLAKIETVISNVGFSQRSDEIVEILKKPQWFVKMDELAKSLISHLNSKDKIKFYPKNFEKNLRKWFEKIHDWTISRQLWWGHRIPVWCKNDEFKVQIDSP----GQGWIQDEDVLDTWFSSGISAFAFLGWP-QNFDLIKS---YFPTSLLVTGWDILFFWVARMYFSSLFIMKQKPFEKVLLHGLIRDEIGRKMSKSLGNGLDPMEIIEKYGSDTLRQALIFNSSPGKDIKFNIEKLNTAWNLNNKIWNIAKYIA--------DLDTFFAKPDLIDLWMENKIYILKRQIVKNIKKYNFSVIGTEINNFIYGDFSSRYIELIKTRKNGFYAR-----KLLRKVLIILHPFLPFLTDFLMEKI-FKME--ILEQKM--PRIRQFKENQKVENILEIIDNLR--TYREKFQISKKIILEYCIINDKFSNAEIDIINKLTFGKWLENKELVIKTK------NFEIAIKVPEEL-----KKEQKGRELKEIQFLKSEILRAEKILTNKGFLEKAPREKIDLERTKLEKLKEKLVFYEK 821
>gi|194246730|ref|YP_002004369.1| Valyl-tRNA synthetase (ValRS) [Candidatus Phytoplasma mali] >gi|193807087|emb|CAP18525.1| Valyl-tRNA synthetase (ValRS) [Candidatus Phytoplasma mali] (863 aa)
Score = 1404, Expect = 5.8e-153, Identities = 357/860 (41%), Positives = 517/860 (60%)
  Q:    13 LSKKYDHKICEQ-QFSLWTTQKEL------NKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLL-VATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEELYVRDNDVLDTWFSSGLWPITTTDALKSKDAL-----FPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDF--NFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSILL---ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHL-------EVLNP------KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLSSHK 872
           + KKYD KI E+ ++  W  +K        N  N   NK  ++I+LPPPNVTG LHLGHALN  +QD +IR   + G    ++ GMDHAGIATQ K +K L+   + NK+ S++  +   ++W     N IR QW+ +G  LDY+NE FTL+   +  V   F+K+Y+  LIYRS  ++NWD + Q+A+SN+EV  +E  +N+YY++Y+L N   + L VATTRPET+FVD+ L+V+P D RYK++I      P TN  I +I+D YV  +FG+GV+K TPAHD ND+ +GKK+ L  + C N+DGT N  A  +ENL     R K +  LEK   + K+E  + ++G+S  +N  +E  +S QWF+K +E +K V+    +  KI F+P +++K  + W+ NL DWCISRQLWWGH IP W K    +I V  + P  E  +  D DVLDTWFSS LWP +      +KD       FPT+VLVTG+DI+ FWV RM   SL+L  + PFK   + GLIRD   NKMSKS  NG+DPN VIEKYG D LR FL ++SSPG D  Y E K+ + W F+NK+WN  R+ ++  + F  +FDE+K    L   +K IL +F +  ++    F KY F    K I  F W+DF N  +E  K+      ++ +++ Y+   IL L +P  PF+T  +Y   +    D+I+L    ++ ++ +  LK+   E +  +I K+R F  + +I N K+I I L       E+L P      K F+++D VI I    K +     ++     Y++ N  +F LNK+         NN++  K   EF+  EI R   +L+NK F+ KA   KI  EK+K + +  + K++   LS  K
  S:     1 MKKKYDFKIIEKDRYKNWINKKYFKDNLKNNITNSTINKKPFTIILPPPNVTGKLHLGHALNNVLQDVIIRRKKMLGFEVLFLPGMDHAGIATQIKVKKRLKSEGLFNKELSKETFLKYAWQWKAEYANKIRRQWEILGLHLDYDNEKFTLDSDLSSTVKYAFIKLYHQNLIYRSDRIINWDPQTQTALSNVEVYYQEKNSNMYYLKYFLQNDNSFFLEVATTRPETMFVDQALMVHPDDNRYKHFIGSKFFIPDTNIVIPLISDPYVKPEFGSGVVKVTPAHDENDFSIGKKHNLKAVLCMNKDGTMNKMAFNYENLDRFVCRQKLINVLEKKGFVSKIEPYVCSIGYSSISNVPIEQRLSLQWFLKTNELAKNVL----NKNKINFYPARYKKTFMRWLENLQDWCISRQLWWGHSIPAWQK--GSKIKVQIESPGKE--WKADPDVLDTWFSSSLWPFSVL-GWPNKDNFNFKHRFPTDVLVTGYDILTFWVSRMCLQSLHLTHKDPFKDVLLHGLIRDSKGNKMSKSKDNGIDPNLVIEKYGTDVLRWFLTTNSSPGMDFNYDEIKIDASWNFLNKIWNISRFFKLKFNIFTEDFDENK----LLFPEKAILTQFKQLLTKVDILFEKYEFHEVGKLIYKFLWEDFANWGLEFLKDHIQTTNTQKFLI-YIFNNILKLLNPFIPFLTDFIYA--EINKTDTIMLCNWPKIHYENLECLKD--FEILKNLIIKMRQFIKKYEINNFKLISIELELSIEKQEILLPFKSILKKFFQVND-VIFIKQVNKESKTLLFVERDMSVYLDKNIFLF-LNKQ------KSKNNLQSQK---EFIFKEIKRSENILNNKDFLTKANPNKIIEEKNKYQNYLSEYKKIMNFLSHEK 862
>gi|56750945|ref|YP_171646.1| valyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81299398|ref|YP_399606.1| valyl-tRNA synthetase [Synechococcus elongatus PCC 7942] >gi|81820674|sp|Q5N3J4|SYV_SYNP6 Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|56685904|dbj|BAD79126.1| valyl-tRNA synthetase [Synechococcus elongatus PCC 6301] >gi|81168279|gb|ABB56619.1| valyl-tRNA synthetase [Synechococcus elongatus PCC 7942] (909 aa)
Score = 1404, Expect = 6.0e-153, Identities = 311/820 (37%), Positives = 481/820 (58%)
  Q:    28 LWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYK--------KDSKEIYVGTKPPKNEELYV----------RDNDVLDTWFSSGLWPITT---TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSS-SSPGED--LCYVEE-----KVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPK--------NLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRT--SNQESKL---WVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTKDSIL----LERLDFKKISNLKESSIEDVLQIINKIRIFNFENKI-PNNKVIDI---HLEVLNPKLFKISDEVINILNTAKINIVK---QDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKI 847
           LW       + N +++   Y I++PPPNVTG+LH+GHA   ++ D LIRF  ++G +A W+ G DHA IA QT  ++ LRE  +S  D  R++ +   ++W    G  I  Q + +G  +D+  E FT+++  ++ V + F+++Y +GLIYR + LVNW    QSA+S++EV  KEV+ +L+Y RY L++   +L VATTRPET+  D  + VNP+DKRY++ I K    PL  +EI IIAD +V+ +FGTG +K TPAHD ND+ +G++++L +I+  N+DGT N  A  FE L   +AR   V  LE+   L KVE    ++  S+R    VEP++S QWFVK+   +++ +E     +  +F P ++ K   +W+ NL DWCISRQLWWGHQIP WY          DS    V     + ++  +          +D DVLDTWFSSGLWP +T    +  +  +  +PT+ LVTGFDIIFFWV RM   + +   ++PFK  YI GL+RDE+N KMSKS GNG+DP  +I++YG DALR  L+      G+D  L Y  +      V++   F NK+WN+ R+V +N       +DKTP+        +LE  D+WIL++++      + Q   Y+   + K++ +F W DFC+ YIEL K R    + +S+L     L  +++ IL L HP  P VT  ++       +D  L      +   + I    +   + ++ +I  +R    E  + P  K+  I     E     L +    + ++  T  + IV+   ++ ++L         L+ +    DL           K+ + +E V+ EI   +G L++ +F++KAP E +
  S:    24 LWEETSAF-QANSQSSAEPYCIVIPPPNVTGSLHMGHAFEASLIDVLIRFQRMRGKNALWLPGTDHASIAVQTILDRQLREEGLSRYDLGREKFLERAWQWKAESGGTIVGQLRRLGVSVDWSRERFTMDEGLSKAVLEAFIQLYEEGLIYRGQYLVNWCPASQSAVSDLEVEMKEVDGSLWYFRYPLTDGSGHLEVATTRPETMLGDTAVAVNPQDKRYQHLIGKTITLPLVQREIPIIADPWVEAEFGTGCVKVTPAHDPNDFAMGQRHQLPLITVMNKDGTMNENAGQFEGLDRFEARKAVVAALEEAGFLVKVEDYRHSIPISDRGKVPVEPLLSTQWFVKIEPLAQRALEALNGEEGPRFVPERWTKVYRDWLENLRDWCISRQLWWGHQIPAWYAVSETNGVVTDSTPFVVAKSAEEAQQQAIAQFGPDVVLQQDEDVLDTWFSSGLWPFSTLGWPNQTEDLETFYPTSTLVTGFDIIFFWVARMTMMAGHFTGKMPFKDVYIHGLVRDENNKKMSKSAGNGIDPLILIDRYGTDALRYALIREVVGAGQDIRLDYNRKTDESATVETSRNFANKVWNASRFVMLNL------DDKTPEQLGMAATADLELADRWILSRYHATTEALINQIEAYDLGAAAKQLYEFIWGDFCDWYIELVKPRLYGEDAQSRLVAQQTLAQILEGILRLLHPFMPHVTEEIWHTLNQVGEDQFLALQSFPQPQSEWIQPELDREFQLMIDVIRTLRNLRAEAGLKPGQKITAILQSDSESERCNLEQSQAYIRDLTKTEMLTIVESLTEEPQALVGVTATVQVLLPLAGLVDLAALQT------KLSRNLEKVEKEIKSLSGRLNSSNFVDKAPAEVV 883
>gi|194444143|ref|YP_002043715.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194402806|gb|ACF63028.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Newport str. SL254] (951 aa)
Score = 1404, Expect = 6.1e-153, Identities = 328/854 (38%), Positives = 517/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKLW----VLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    +    + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K E + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEEEVRQENNLGADVQLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYRDALDSFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRNTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLEGYAEAKAKLIEQ 944
>gi|168244036|ref|ZP_02668968.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194449603|ref|YP_002048499.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194407907|gb|ACF68126.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (951 aa)
Score = 1404, Expect = 7.4e-153, Identities = 327/854 (38%), Positives = 517/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    +    + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K + + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYEEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYKLADGAKTADGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEDEVRQENNLGADVALRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYRDALDSFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRHTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLDGYAEAKAKLIEQ 944
>gi|170025896|ref|YP_001722401.1| valyl-tRNA synthetase [Yersinia pseudotuberculosis YPIII] >gi|169752430|gb|ACA69948.1| valyl-tRNA synthetase [Yersinia pseudotuberculosis YPIII] (965 aa)
Score = 1403, Expect = 7.6e-153, Identities = 326/846 (38%), Positives = 509/846 (60%)
  Q:     8 KNNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGT------------------TNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-------NEELYVR-DNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYD---NFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNP----KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL---GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           K    L K Y  +  EQ  +  W  Q    K N   +K SY I++PPPNVTG+LH+GHA   TI D LIR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  ++EW    G  I  Q + +G  +D+E E FT+++  +  V +VFV+++ + LIYR K LVNWD KL++AIS++EV  +E + +++++RY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I K  I PL  + I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG                   +N     F+ L+   AR   V   EK  LLE+V+     V + +R   V+EPM+++QW+V+ +  +K  IE  ++  +IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY +    +YVG    +         E+ +R D DVLDTWFSSGLW  +T      TDALK+     PT+V+V+GFDIIFFW+ RM+  +++       K +VPFK  Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+   +  ++     L   D+WIL +FN+    + +  + Y F ++   + +FTW+ FC+ Y+EL+K    S  E++L      L  +++ +L L HP+ P++T  ++    N K  T D+I+L+       S + E ++ D   + Q I  +R    E  I   K +++ L   N     ++ +    + ++   + + ++ +  K   P  V       +   E L+   G  ++A  ++++ KE+  + +EI R  G L N+ F+ +AP+  +  E+ +
  S:    10 KTEPSLDKTYSPQEIEQPLYEHWEKQGYF-KPNGDTSKESYCIMIPPPNVTGSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWEWKGESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLHKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHLRYPLADGAKTAEGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKEVILPLVGRRIPILGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRSEAEVFDTHGEATDAFSNAIPAQFQGLERFAARKAVVAEFEKLGLLEEVKPHDLTVPYGDRGGVVIEPMLTDQWYVRTAPLAKVAIEAVENG-EIQFVPKQYENMYYSWMRDIQDWCISRQLWWGHRIPAWYDEQGN-VYVGRDEAEVRRDNNLGAEVALRQDEDVLDTWFSSGLWTFSTLGWPEQTDALKT---FHPTSVVVSGFDIIFFWIARMIMLTMHFMKDENGKPQVPFKTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEGQDCGQNGGEMVLSLADRWILAEFNQTIKAYREAMDTYRFDLAAGILYEFTWNQFCDWYLELTKPVMNSGSEAELRGTRHTLIQVLEALLRLAHPIIPYITETIWQRVKNLKGITADTIMLQPFPEYDASQVDEQALSDLEWIKQTIIAVRNIRAEMNIAPGKPLEVMLRGANAQAQRRVLENQSFIQSLARLSSLTLLAEGDKG--PVSVTK----LVEGAEVLIPMAGLIDKATELDRLAKEVAKLDAEIERIEGKLGNEGFVARAPEAVVAKERER 944
>gi|62182901|ref|YP_219318.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|81309503|sp|Q57GC5|SYV_SALCH Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|62130534|gb|AAX68237.1| valine tRNA synthetase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (951 aa)
Score = 1403, Expect = 8.6e-153, Identities = 327/854 (38%), Positives = 518/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPETI  D  + VNP+D RY++ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    + +  + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K + + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETILGDTGVAVNPEDPRYQSLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEDEVRQENNLGADVALRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYREALDNFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRHTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLDSYAEAKAKLIEQ 944
>gi|168232814|ref|ZP_02657872.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194472691|ref|ZP_03078675.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194459055|gb|EDX47894.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (951 aa)
Score = 1403, Expect = 8.9e-153, Identities = 327/854 (38%), Positives = 518/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPETI  D  + VNP+D RY++ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    + +  + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K + + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETILGDTGVAVNPEDPRYQSLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEDEVRQENSLGADVALRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYREALDNFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRHTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLDGYAEAKAKLIEQ 944
>gi|167551269|ref|ZP_02345024.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (951 aa)
Score = 1403, Expect = 9.1e-153, Identities = 328/854 (38%), Positives = 517/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKLW----VLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    +    + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K E + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYKLADGAKTADGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEEEVRQENNLGADVQLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYRDALDSFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRNTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLEGYAEAKAKLIEQ 944
>gi|146308545|ref|YP_001189010.1| valyl-tRNA synthetase [Pseudomonas mendocina ymp] >gi|145576746|gb|ABP86278.1| valyl-tRNA synthetase [Pseudomonas mendocina ymp] (943 aa)
Score = 1403, Expect = 9.3e-153, Identities = 323/852 (37%), Positives = 496/852 (58%)
  Q:    13 LSKKYD-HKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYL------SNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIIS-------------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-----TKPPKNEE--LYVRDNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK----NRTSNQESKLWVLNYLIK---KILILFHPMCPFVTSNLYDNFK-FKTKD--SILLERLDF---KKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDI-----------HLEVLNPKLFKISD-EVINILNTAK-----INIVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           + K Y  H I    +  W   ++ N    + +   Y+I++PPPNVTG+LH+GH  N  I D LIRF  ++G +  W  G DHAGIATQ   E+ L    I   D  R++ +  ++EW    G  I  Q + +G  +D+  E FT++   +E V + FV+++ DGLIYR K LVNWD K  +AIS++EV   + + +L+ +RY L      ++ KDYL+VATTRPET+  D  + V+P+D+RYK  I  F   PL  + I I+AD+Y D +FGTG +K TPAHDFNDYE+GK++ L +I+              FN DG+ N+   G     +  L   +AR + V   E   LLEK+E     V   +R+  V+EP +++QW+V     ++K I + +S  +IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  ++  +YVG      +   N E     +D DVLDTWFSSGLW  +T      TD LK+     PT+VLVTGFDIIFFWV RM+  S +L  ++PFK  Y+ GL+RD    KMSKS GN +DP D+++                                      YG DALR    S ++ G D+ +   +V+    F NKLWN+  +V  N+   +   +  P  L   D+WI++   +   +  +  + + F ++ + + +F WD++C  Y+EL K    + T++ E +      L++    IL L HP  PF+T  ++   K    KD  +++L+       ++I    E+ IE V Q++  +R    E KI   K IDI            L    P L K++  E + +L   +        +  +++ L P                + G  ++   + ++ KE+  ++ E+ R  G L+N+ F+ KAP E ++ E++K  + E  L +L
  S:     1 MDKTYQPHAIESNWYQTW---EQNNYFAPQGSGEPYTIMIPPPNVTGSLHMGHGFNNAIMDALIRFRRMQGRNTLWQPGTDHAGIATQMVVERQLAAQGIGRHDLGREKFLEKVWEWKNQSGGTITRQIRRLGSSVDWSRERFTMDDGLSEAVKEAFVRLHEDGLIYRGKRLVNWDTKFHTAISDLEVENHDEKGSLWNLRYPLADGKKTADGKDYLIVATTRPETMLGDSAVAVHPEDERYKALIGSFVELPLVGRRIPIVADDYCDPEFGTGCVKITPAHDFNDYEVGKRHNLPLINIFDADAAVLARAQVFNLDGSVNSEVDGSLPAEYAGLDRFEARKRIVAAFEAAGLLEKIEDHALKVPKGDRSGTVIEPWLTDQWYVSTKPLAEKAIAVVESG-EIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWY-DEAGNVYVGRDEAEVRAKHNLEGVALRQDEDVLDTWFSSGLWTFSTLGWPEQTDFLKT---FHPTDVLVTGFDIIFFWVARMIMLSTHLTGQIPFKTVYVHGLVRDGQGQKMSKSKGNVLDPLDIVDGITLDELLEKRTSGMMQPKLAEKIAKQTRAEFPEGIASYGTDALRFTFCSLATTGRDVKFDMGRVEGYRNFCNKLWNATNFVLENTEGKDCGVNGEPVELSAVDRWIISALQRCEQDVTRHLDAFRFDLATQALYEFVWDEYCAWYLELVKPVLWDETASAERQRGTRRTLVRVLEVILRLAHPFMPFITEEIWQRIKALAGKDGATLMLQPWPVAAEERIDAAAEADIEWVKQLMLGVRQIRGEMKISMAKRIDIIVANASDSDLRRLADFEPLLSKLAKLESVRVLGAGEEAPMSATALVGEMQVLVP----------------MAGLIDKDAELARLDKEVARLQGEVQRVGGKLANEGFVAKAPAEVLDKERAKLAEAEQALSKL 933
>gi|127511856|ref|YP_001093053.1| valyl-tRNA synthetase [Shewanella loihica PV-4] >gi|126637151|gb|ABO22794.1| valyl-tRNA synthetase [Shewanella loihica PV-4] (959 aa)
Score = 1403, Expect = 9.7e-153, Identities = 332/852 (38%), Positives = 510/852 (59%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKL---NIIS----------CFNEDGTTNNYAVG-----FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVI-------------------------------------EKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKN----------LEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSN-----QESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKT---KDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPK-LFKISDEVINILNTAKIN----IVKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           + K Y+ +  EQ  +  W  +        ++N N Y I++PPPNVTG+LH+GHA   TI D LIR+  +KG +  W  G DHAGIATQ   E+ +  E   S  D  R+  +  +++W    G  I  Q + +G  +D++ E FT+++  +  V +VFV++YND LIYR K LVNWD KL +AIS++EV  KE + ++++ RY L++       KDYL VATTRPET+  D  + V+P D+RY++ I KF + P+ N+ I I+AD+YVD++FGTG +K TPAHDFNDYE+GK++ L   NI++            N DGT N+   G     F  L    AR   V+  E   LL K++     V + +R+  V+EP++++QW+V V+  +K  IE  ++   I+F P ++E    +WM ++ DWCISRQLWWGH+IP WY +  K +YVG        K   ++ + +R D DVLDTWFSS LW  +T      T+ALK+     PT+VLVTGFDIIFFWV RM+  +++       K +VPFK  Y+TGLIRDE  NKMSKS GN +DP D+I                                     E +G DALR  L + +S G D+ +  +++     F NK+WN+ RYV MN+     ++D  P++          L   D+WI+  FN+    F +    Y F ++   + +FTW+ FC+ Y+EL+K    N     Q      L  +++ +  L HPM P++T  ++   K       D+++L      + S + E+++ D   V Q+I  +R    E  I  +K ++  L  ++ +   ++          AK+     +   D   +    +     + I     + G  + A  + +I K+ E +  E  R  G L+N+ F+ KAP+  IE E++K  + +  + +L
  S:     1 MEKTYNPQSIEQALYQNWEEKGYFKPHGDESNGN-YCIMIPPPNVTGSLHMGHAFQDTIMDTLIRYQRMKGKNTLWQVGTDHAGIATQMLVERKVEAEEGKSRHDLGRETFIDRIWDWKNQSGGTITKQLRRLGASVDWDRERFTMDEGMSAAVQEVFVRLYNDDLIYRGKRLVNWDPKLHTAISDLEVENKEKQGSMWHFRYPLADGALTADGKDYLEVATTRPETMLGDSAVAVHPDDERYQSLIGKFILLPIVNRRIPIVADDYVDMEFGTGCVKITPAHDFNDYEVGKRHNLPMFNILTIDAAIRSQAEVVNSDGTANDELDGSLPERFAGLDRFKARTAIVDEFESLGLLGKIDPHALKVPYGDRSGVVIEPLLTDQWYVAVAPMAKTAIEAVENGD-IKFVPQQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDEAGK-VYVGRDEAEVRAKHNLDDSVVLRQDPDVLDTWFSSALWTFSTLGWPDDTEALKT---FHPTDVLVTGFDIIFFWVARMIMMTMHFIKDEDGKPQVPFKTVYVTGLIRDEQGNKMSKSKGNVLDPLDMIDGIDLEALVEKRTGNMMQPQLAAKIEKSTRKEFADGIEAHGTDALRFTLAAMASTGRDINWDMKRLDGYRSFCNKIWNASRYVLMNTE----EQDCGPQSPNGKADGEMQLSLADRWIVGLFNQTVKAFDEHMENYRFDLAANTLYEFTWNQFCDWYLELTKPVLQNGTEAEQRGTRHTLVTVLEAMQRLLHPMMPYLTETIWQRVKPLAGVEGDTLMLAEFPVYQASKVDEAAMADLEWVKQVIVAVRNIRAELNIAPSKPLNAMLRSVSAQDKARVEANQTFFATLAKLESMTILADGDTAPMSTTQLVGEMELLI----PMAGLIDVAAEMARIDKQFEKLVGEAKRIEGKLNNQGFVAKAPEAVIEKERAKLAEFQRDMDKL 947
>gi|51594881|ref|YP_069072.1| valyl-tRNA synthetase [Yersinia pseudotuberculosis IP 32953] >gi|153948685|ref|YP_001402499.1| valyl-tRNA synthetase [Yersinia pseudotuberculosis IP 31758] >gi|186893891|ref|YP_001871003.1| valyl-tRNA synthetase [Yersinia pseudotuberculosis PB1/+] >gi|81825944|sp|Q66F11|SYV_YERPS Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|51588163|emb|CAH19769.1| valine tRNA synthetase [Yersinia pseudotuberculosis IP 32953] >gi|152960180|gb|ABS47641.1| valyl-tRNA synthetase [Yersinia pseudotuberculosis IP 31758] >gi|186696917|gb|ACC87546.1| valyl-tRNA synthetase [Yersinia pseudotuberculosis PB1/+] (965 aa)
Score = 1402, Expect = 1.0e-152, Identities = 326/846 (38%), Positives = 509/846 (60%)
  Q:     8 KNNNDLSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGT------------------TNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK-------NEELYVR-DNDVLDTWFSSGLWPITT------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYD---NFKFKTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNP----KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL---GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK 853
           K    L K Y  +  EQ  +  W  Q    K N   +K SY I++PPPNVTG+LH+GHA   TI D LIR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  ++EW    G  I  Q + +G  +D+E E FT+++  +  V +VFV+++ + LIYR K LVNWD KL++AIS++EV  +E + +++++RY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I K  I PL  + I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG                   +N     F+ L+   AR   V   EK  LLE+V+     V + +R   V+EPM+++QW+V+ +  +K  IE  ++  +IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY +    +YVG    +         E+ +R D DVLDTWFSSGLW  +T      TDALK+     PT+V+V+GFDIIFFW+ RM+  +++       K +VPFK  Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+   +  ++     L   D+WIL +FN+    + +  + Y F ++   + +FTW+ FC+ Y+EL+K    S  E++L      L  +++ +L L HP+ P++T  ++    N K  T D+I+L+       S + E ++ D   + Q I  +R    E  I   K +++ L   N     ++ +    + ++   + + ++ +  K   P  V       +   E L+   G  ++A  ++++ KE+  + +EI R  G L N+ F+ +AP+  +  E+ +
  S:    10 KTEPSLDKTYSPQEIEQPLYEHWEKQGYF-KPNGDTSKESYCIMIPPPNVTGSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWEWKGESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLHKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHLRYPLADGAKTAEGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKEVILPLVGRRIPILGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRSEAEVFDTHGEATDAFSNAIPAQFQGLERFAARKAVVAEFEKLGLLEEVKPHDLTVPYGDRGGVVIEPMLTDQWYVRTAPLAKVAIEAVENG-EIQFVPKQYENMYYSWMRDIQDWCISRQLWWGHRIPAWYDEQGN-VYVGRDEAEVRRDNNLGAEVALRQDEDVLDTWFSSGLWTFSTLGWPEQTDALKT---FHPTSVVVSGFDIIFFWIARMIMLTMHFMKDENGKPQVPFKTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEGQDCGQNGGEMVLSLADRWILAEFNQTIKAYREAMDTYRFDLAAGILYEFTWNQFCDWYLELTKPVMNSGSEAELRGTRHTLIQVLEALLRLAHPIIPYITETIWQRVKNLKGITADTIMLQPFPEYDASQVDEQALSDLEWIKQTIIAVRNIRAEMNIAPGKPLEVMLRGANAQAQRRVLENQSFIQSLARLSSLTLLAEGDKG--PVSVTK----LVEGAEVLIPMAGLIDKATELDRLAKEVAKLDAEIERIEGKLGNEGFVARAPEAVVAKERER 944
>gi|39997143|ref|NP_953094.1| valyl-tRNA synthetase [Geobacter sulfurreducens PCA] >gi|81702023|sp|Q74BJ6|SYV_GEOSL Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) >gi|39984033|gb|AAR35421.1| valyl-tRNA synthetase [Geobacter sulfurreducens PCA] (887 aa)
Score = 1402, Expect = 1.3e-152, Identities = 324/856 (37%), Positives = 493/856 (57%)
  Q:    12 DLSKKYDHKICEQQFSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRY-YLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPK------NEELYVRDNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDE-DKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-----RTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFK-FKTKDSILL--------ERLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVI----------DIHL----EVLNPKLFKISDEVI--NILNTAKINI-VKQDIKSLKPDYVENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSK----KEKHEMKLKELEKL 867
           +L+K Y+    E+++     Q+   + N  + K SYSI++PPPNVTG LH+GHALN T+QD L R+  + G    W+ G DHAGIATQ   E+ L     S  +  R+  +  +++W    G  I  Q K +G   D+  E FT+++  +  V +VFV++Y +GLIYR   L+NW  +  +A+S+IEV  ++   NL++IRY  +     +++VATTRPET+  D  + V+P+D+RY + + K  + PL N+EI ++AD YVD +FGTGV+K TPAHDFND+E+G+++ L++++ F+E    N+    +E ++   AR + VE LE   LLEK++     VG   R   VVEP +S QW+VKV   +++ +   K  +  +  P ++E    +WM N+ DWCISRQ+WWGH+IP WY     E  V    P       ++E+  ++ DVLDTWFSS LWP +T    D      A +PT+ LVTGFDI+FFWV RMM   L+   EVPF   YI  L+RD    KMSKS GN +DP  VI++YG DA R  L + ++ G D+   EE++     F+NK+WN+ R+  MN   F  D  D    +L + D+WIL++ N A +E  +    Y F  +   +  FTW +FC+ YIEL+K+       + +E+  +VL  +++ +L L HP  PF+T  ++      +   SI++        ER DF        + +E V+++I  IR    E  +  ++ I           +HL    EV    L ++SD  I   +   A   I V  D++   P       L  ++N E+          I K+ KEIE    +       L N SF+E+AP + +  E+ K     +K ++ L  LEK+
  S:     5 ELAKVYEPTAVERKWYETWEQEGYFRANPDSGKPSYSIVIPPPNVTGALHMGHALNNTLQDILCRWKRMNGYEVLWMPGTDHAGIATQNVVERQLAGEGTSRHELGREAFIERVWKWKAESGGQIIGQLKRLGASCDWGRERFTMDEGLSRAVREVFVRLYEEGLIYRDNRLINWCPRCHTALSDIEVEHEDKAGNLWHIRYPVVGEPGRFVVVATTRPETMLGDTAVAVHPEDERYADLVGKKVLLPLVNREIPVVADGYVDREFGTGVVKITPAHDFNDFEVGRRHNLDLLNVFDESAVVNSAGHQYEGMERFAARKRVVEDLEALGLLEKIDDHAHAVGGCYRCKTVVEPYLSLQWYVKVGPLAERALAAVKDGRT-RIVPQQWENTYYDWMENIKDWCISRQIWWGHRIPAWYCDHCGETTVAKIDPTVCAACGSDEIR-QETDVLDTWFSSALWPFSTMGWPDRTPELAAFYPTSCLVTGFDILFFWVARMMMMGLHFMNEVPFSDVYIHALVRDAQGQKMSKSKGNVIDPLVVIDQYGTDAFRFTLAAFAAQGRDIKLAEERIAGYRNFVNKIWNASRFALMNLEGFEPDTVDPATLDLSNADRWILHRLNSAAAETAEALEAYRFNDAAGTLYRFTWSEFCDWYIELAKDDLYRGDDARKETARYVLWLVLENLLRLLHPFMPFITEEIWQTLPGARPAPSIMVAGYPRSVPER-DFPD----GAAEMELVMEVIRGIRNIRGEMDVAPSREIAAILSCGSAESLHLLKRNEVYVMSLARLSDLAIGQQLERPADAAIQVAGDVEIAVP-------LKGLVNVEEE--EKRLLKEIGKLDKEIEMFGRK-------LENPSFVERAPADVVAKEREKLAEVTQKKDVLLASLEKI 883
>gi|168821100|ref|ZP_02833100.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (951 aa)
Score = 1401, Expect = 1.6e-152, Identities = 327/854 (38%), Positives = 518/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKLW----VLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPET+  D  + VNP+D RYK+ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    + +  + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K + + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHGLPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEDEVRQENNLGADVQLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYREALDNFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRNTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKEDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLDGYAEAKAKLIEQ 944
>gi|114770696|ref|ZP_01448186.1| valyl-tRNA synthetase [alpha proteobacterium HTCC2255] (923 aa)
Score = 1401, Expect = 1.6e-152, Identities = 318/820 (38%), Positives = 492/820 (60%)
  Q:    45 NSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAVG-FENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-------TKPPKNEELYVR-DNDVLDTWFSSGLWPITTT---DALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKNRTSNQES--------KLWVLNYLIKKILILFHPMCPFVTSNLYDNFKFKTK-----DSILLE---RLDFKKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKEL 864
           + Y ILLPPPNVTGNLH+GHA   TI D L R++ +KG +  W CG DHAGIATQ   E+ L     +  D  R+  V  ++EW +  G NI  Q + +G   D+  E FT++   +  V +VFVK++ +GLIYR K LVNWD  L +A+S++EV+ +E   +++++RY L++    L+VATTRPET+  D  + V+P D+RY+ +I K    P+T + I IIAD+YVD +FGTG +K TPAHDFNDY++GK++ L +I+   +D   N+ A   ++ L   DAR + V  L+ N +L K+++    V   +R+ AV+EP +++QW+V V   +K  IE  +S  +I+F P  + K    WM N+ DWCISRQLWWGH+IP WY  ++  +YVG        K    +++ +R D DVLDTWFSS LWP  T    +     +   P++VLVTGFDIIFFWV RM+  +     ++PFK  YITGLIRDE  +KMSKS GN +DP D+I+                                      YG DALR    + +S   D+ +   +V+    F NK+WN+ R+V MN+ +F+  +D     L   D+WI++ F +   +  +  N Y F ++ + + +FTW+ FC+ Y+ELSK   ++ ES        +  ++N L ++++ L HP  P++T  ++      T       SI+++   + D  K +      IE V Q I  IR    E  I  NK++ +  + ++ +  +  ++V  +L   A+I    +    L            ++ + +LL    G  ++A  + +I K  E ++ + +R  G L N++F+ KAP   IE E++K    +M+L +L
  S:    31 DPYCILLPPPNVTGNLHMGHAFQHTIMDALTRYHRMKGDNTLWQCGTDHAGIATQMVVERQLNAKGQTRHDLGREAFVDKIWEWKEESGGNISQQMRRLGTSPDWSREAFTMDDDLSNAVQEVFVKLHEEGLIYRGKRLVNWDPVLLTAVSDLEVLNEEENGHMWHMRYPLADGSGELVVATTRPETMLGDTAVAVHPDDERYQGFIGKEIKLPITGRLIPIIADDYVDPEFGTGCVKITPAHDFNDYDMGKRHALPMINILTDDAKINDVAPKQYQGLDRFDARKQIVADLDANGILVKIDEHKLKVPRGDRSGAVIEPYLTDQWYVAVESLAKPAIEAVESG-EIRFVPENYNKTYYQWMHNIQDWCISRQLWWGHRIPAWY-DEANNVYVGRDEAEVRAKHGLADDVALRQDEDVLDTWFSSALWPFATMGWPEETPELETFLPSSVLVTGFDIIFFWVARMIMMTKKFTGKIPFKDIYITGLIRDEKGDKMSKSKGNVLDPIDLIDGIELEPLVAKRTSGMMNPQDAKKIEKSTRKEFPEGINAYGTDALRFTFAAMASTSRDINFDMGRVEGYRNFCNKIWNASRFVLMNTEEFDTGKDGGELTLSLADEWIIDTFQQTIHDVEKAMNDYRFDLAAQSLYEFTWNQFCDWYLELSKPILNSDESTEAQKRGTRHTLINTL-EQLMRLAHPFMPYITEQIWQRVAPLTSVECTDTSIMVQPFVQYDETKRNAKAAGDIEWVKQCIVGIRNIRGEMDISPNKLLTVLAKNVSAEDQRRFNDVETVLTRLARI----ESFTVLAGGEEAPASATALVGEMELLIPMAGLIDKAAELARIAKAAEKIEKDRARTAGKLGNENFVSKAPPAVIEKEQAKLADMDMQLAKL 913
>gi|109899865|ref|YP_663120.1| valyl-tRNA synthetase [Pseudoalteromonas atlantica T6c] >gi|109702146|gb|ABG42066.1| valyl-tRNA synthetase [Pseudoalteromonas atlantica T6c] (921 aa)
Score = 1401, Expect = 1.7e-152, Identities = 322/854 (37%), Positives = 497/854 (58%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNS--YSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYAV-GFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEE--------LYVRDNDVLDTWFSSGLWPITTTDALKSK---DALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIE-------------------------------------KYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSK-------NRTSNQESKLWVLNYLIKKILILFHPMCPFVTSNLYDNFK---FKTKDSILLERLDFKKISNLKESSI---EDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNP---KLFKISDEVINILNTAKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEK 866
           + K +  +  EQQ +  W      +K   KA+     Y ILLPPPNVTG+LH+GH    TI D L R++ +KG +  W CG DHAGIATQ   E+ L     +  D  R+  V  +++W +  G NI  Q + +G   D++ E FT++   +E VN+VFV+++ +GLIYR K LVNWD  L +A+S++EV+ +E    ++++RY L++    L+VATTRPET+  D  + V+P D+RY+ +I K    P+T + I IIAD+YV+  FGTG +K TPAHDFNDY++GK++ L +I+   +D   N+ A   +  L   DAR + V  L+   +L K+E     V   +R+ +V+EP +++QW+V V E +K  I+  KS  +I+F P  ++K    WM N+ DWCISRQLWWGH+IP WY ++ K IYVG    +  E           +D DVLDTWFSS LWP  T    K     D   P+ VLVTGFDIIFFWV RM+  +     ++PFK  YITGLIRDE  +KMSKS GN +DP D+I+                                      YG DALR    + +S   D+ +  ++V+    F NKLWN+ R+V MN+ D +   +     L   DKWIL +F +   +F      Y F ++   + +FTW+ FC+ Y+ELSK       +  + +      L  +++ IL L HP+ PF+T  ++           DSI+ +    +  +   E ++   E +  +I  IR    E  I  NK +++ L   +    +  + S E +  L  AK+    + ++ L+P+         ++ + ++L    G  ++   + +I + +  ++++  R  G LSN+ F+  AP   I+ EK+K +   M++ +L++
  S:     1 MDKTFSPQNIEQQCYQAWE-----DKGYFKASGEGQPYCILLPPPNVTGSLHMGHGFQQTIMDTLTRYHRMKGDNTLWQCGTDHAGIATQMVVERQLNAQGKTRHDLGREAFVEKIWDWKKESGGNITQQMRRLGTSPDWDREVFTMDDDLSEAVNEVFVRLHEEGLIYRGKRLVNWDPVLHTAVSDLEVLSEEENGFMWHMRYPLADGTGELIVATTRPETMLGDTAVAVHPDDERYQGFIGKQIKLPITGRLIPIIADDYVEQDFGTGCVKITPAHDFNDYDMGKRHNLEMINILTDDAKINDVAPEQYRGLDRFDARKQIVADLDAAGVLVKIEDHKLKVPRGDRSGSVIEPYLTDQWYVAVQELAKPAIDAVKSG-EIKFVPENWDKTYYQWMNNIQDWCISRQLWWGHRIPAWYDENGK-IYVGRTEAEVREKNGLDASVTLRQDEDVLDTWFSSALWPFATMGWPKKTPELDTFVPSAVLVTGFDIIFFWVARMIMMTKKFTGQIPFKEIYITGLIRDEQGDKMSKSKGNVIDPIDLIDGISIDDLVAKRTSGMMQPKLAAKIEKNTRKSYPEGFAAYGTDALRFTFAAMASTSRDISFDVKRVEGYRNFCNKLWNASRFVMMNAEDQDTGANGGDMELSLADKWILARFQQTLKDFEDALTGYRFDIAANLVYEFTWNQFCDWYLELSKPVLNSEVSTDAQKRGTRHTLVNVLESILRLAHPIMPFITEEIWQRLAPLCGIQADSIMTQPFPAQSEALRDEDTLAEMEWIKSVIVGIRNIRGEMDISPNKPLNVLLRNASAQDWQRLQSSREFLGAL--AKL----ESVELLQPEEEAPASATALVGEMEILIPMAGLIDKDAELARINRALAKIEADFGRTQGKLSNEKFVSNAPPAVIDKEKAKLDDFTMQMTKLKE 913
>gi|145219257|ref|YP_001129966.1| valyl-tRNA synthetase [Prosthecochloris vibrioformis DSM 265] >gi|145205421|gb|ABP36464.1| valyl-tRNA synthetase [Prosthecochloris vibrioformis DSM 265] (902 aa)
Score = 1400, Expect = 1.8e-152, Identities = 315/858 (36%), Positives = 488/858 (56%)
  Q:    12 DLSKKYDHKICEQQF--SLWTTQKELNKKN---LKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLRENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLS-NSKDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDG-TTNNYAVGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVGTKPPKNEEL-----YVRDNDVLDTWFSSGLWPITT---------TDALKSKDALFPTNVLVTGFDIIFFWVFRMMFFSLYLKKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDVIEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNS-------SDFNFDEDKTPKNLEDFD---KWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIE-----LSKNRTSNQESKLWVLNY-LIKKILILFHPMCPFVTSNLYD-NFKFKTKDSILLERLDF-KKISNLKESSIEDVLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNTAKINIVKQDIKSLKPDY-----VENNYLIFILNKEDLLGSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKHEMKLKELEKLLS 869
           +L K Y+H   E+++  + W      + ++   L+  +  YS+L+PPPNVTG+L LGH LN T+QD  IR+  + G  A W+ G DHAGIATQT  E+ LR+  +S  D  R + +  +++W    G  I  Q K +G   D+    FT++++++E V   FV +Y DGLIYR K ++NW    Q+A+S+ EVI K     L Y+RY L+ +   ++ +AT RPETI  D  + VNP D+R+++ + + A+ P+  + I IIAD+YVDI+FGTG +K TPAHD NDY +  ++ L +IS    DG  T+ Y  G+  +   DAR K V  LE+   LE+VE+   NVG+SER + VVEP +SEQWFV +   ++K +++  +  +I+F P  +     +WM  + DWCISRQLWWGH+IP WY  +  +++V     +   L      V+D DVLDTWFSS LWP+TT          D L+   A +PTN LVTG DIIFFWV RM+   LY K +VPF+  Y T +IRD    K+SKSLGN  DP  VI+ YG DALR  ++  +  G+D+ + EEK +    F  K+WN+ R V M          DF    ++     E FD    WI + +N     +   F ++     +K + DF W D+C+ Y+E     L++ R+     K   L   +++  L   HP+ PF+T  ++       + +SI    +      ++L +     V +++ ++R       +P     ++ L+ ++ +  K+ +  +  +      +       ++P +     VE N L  +L  E L+  + E     +++KEI+ V   +++    LSN  F + AP E +E E+ K  +    L +LE  L+
  S:     9 NLEKTYNHSEVEERWRSAHWEALGSFHAEHSQVLEEGRAPYSVLMPPPNVTGSLTLGHVLNHTLQDIFIRYARMTGKEALWLPGTDHAGIATQTVVERKLRKEGVSRHDLGRKDFLGHVWQWRDEYGGLIVRQLKRLGISCDWRRNLFTMDERASEAVINSFVALYRDGLIYRGKRIINWCPVSQTALSDEEVIMKSRRDQLVYVRYALAKDPSRFISIATVRPETILADAAIAVNPADERFRDLVGQMAVVPIAGRHIPIIADDYVDIEFGTGALKITPAHDPNDYAVAGRHNLPVISVVGRDGRMTDEY--GYGGMDRFDARKKIVADLEELGNLERVEEYEHNVGYSERADVVVEPYLSEQWFVSMKPLAEKALDVVNNG-EIRFHPPHWINTYRHWMGGIRDWCISRQLWWGHRIPAWYDPEG-QVWVAASYEEACHLAGTDKLVQDEDVLDTWFSSWLWPLTTLGWTGPGSDNDDLR---AFYPTNTLVTGPDIIFFWVARMIMAGLYFKGDVPFRDVYFTSIIRDMKGRKLSKSLGNSPDPLKVIDTYGTDALRFTIIYIAPLGQDVLFGEEKCELGRNFATKIWNASRLVFMQREKYFEGPEDFAAYYEEFNPAAESFDLAGGWIWSAYNGMLEHYHAAFGQFRMNDIVKTVYDFFWGDYCDWYLESLKVSLAEGRSEADARKAVALAVSVLEGTLKALHPVMPFITDEIWHFVLPHSSHESIASSDMPVAASPASLDDDGFGLVQKLVTEVRSLKALFGVPPGLRAEVQLKAVDAEALKVMERGLPFIAALAQCVPSLISDGVRPPHAAGSVVEGNELFVLL--EGLISFDKER---ARLQKEIQNVSGYVAQLEKKLSNSGFADNAPPEVVEKEREKLAEARRNLLKLEGNLA 898
>gi|167542798|ref|ZP_02338374.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167557357|ref|ZP_02350370.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (951 aa)
Score = 1400, Expect = 2.1e-152, Identities = 327/854 (38%), Positives = 517/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPNVTGNLHLGHALNGTIQDCLIRFNNLKGLSAYWICGMDHAGIATQTKYEKYLR-ENKISNKDKSRDEKVADLFEWSQNVGNNIRNQWKNMGFFLDYENEHFTLEKKSNEMVNQVFVKMYNDGLIYRSKTLVNWDIKLQSAISNIEVIKKEVETNLYYIRYYLSNS------KDYLLVATTRPETIFVDECLVVNPKDKRYKNYINKFAINPLTNKEIKIIADEYVDIQFGTGVMKCTPAHDFNDYELGKKYKLNIISCFNEDGTTNNYA------------------VGFENLKIADARVKCVEYLEKNNLLEKVEKTISNVGFSERTNAVVEPMMSEQWFVKVSEYSKKVIELQKSSKKIQFFPIKFEKNLINWMTNLNDWCISRQLWWGHQIPVWYKKDSKEIYVG-TKPPKNEELYV-------RDNDVLDTWFSSGLWPITTTDALKSKDAL---FPTNVLVTGFDIIFFWVFRMMFFSLYL------KKEVPFKHCYITGLIRDEHNNKMSKSLGNGVDPNDV-------------------------------------IEKYGADALRLFLLSSSSPGEDLCYVEEKVKSCWGFINKLWNSFRYVEMNSSDFNFDEDKTPKNLEDFDKWILNKFNKAYSEFLQQFNKYNFLVSIKKILDFTWDDFCNTYIELSKN-RTSNQESKL----WVLNYLIKKILILFHPMCPFVTSNLYDNFKF---KTKDSILLERLDFKKISNLKESSIED---VLQIINKIRIFNFENKIPNNKVIDIHLEVLNPKLFKISDEVINILNT-AKINIVKQDIKSLKPDYVENNYLIFILNKEDLL----GSNNEANNIEKIKKEIEFVKSEISRCNGMLSNKSFIEKAPKEKIELEKSKKEKH-EMKLKELEK 866
           + K Y+ +  EQ  +  W  Q    K N   +K S+ I++PPPNVTG+LH+GHA   TI D +IR+  ++G +  W  G DHAGIATQ   E+ +  E   +  D  RD  +  +++W    G  I  Q + +G  +D+E E FT+++  +  V +VFV++Y + LIYR K LVNWD KL++AIS++EV  +E + ++++IRY L++       KDYL+VATTRPETI  D  + VNP+D RY++ I KF I PL N+ I I+ DE+ D++ GTG +K TPAHDFNDYE+GK++ L +I+    DG     A                    F+ L+   AR   V  ++   LLE+++     V + +R   V+EPM+++QW+V+    +K  +E  ++   IQF P ++E    +WM ++ DWCISRQLWWGH+IP WY  D   +YVG T+    +E  +       +D DVLDTWFSS LW  +T    ++ DAL    PT+V+V+GFDIIFFW+ RM+  +++       K +VPF   Y+TGLIRD+   KMSKS GN +DP D+                                     IE +G DALR  L + +S G D+ +  ++++    F NKLWN+ R+V MN+ + +   +     L   D+WIL +FN+    +    + + F ++   + +FTW+ FC+ Y+EL+K   T   ES+L      L  +++ +L L HP+ PF+T  ++   K     T D+I+L+       + + E+++ D   + Q I  +R    E  I   K +++ L   + +  +  ++  + L T A++    + I  L  D      +  I++  +LL    G  N+ + + ++ KE+  ++ EI+R  G LSN+ F+ +AP+  I  E+ K + + E K K +E+
  S:     1 MEKTYNPQDIEQPLYEHWEKQGYF-KPNGDESKESFCIMIPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHIRYPLADGAKTADGKDYLVVATTRPETILGDTGVAVNPEDPRYQSLIGKFVILPLVNRRIPIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRHALPMINILTFDGDIRESAEVFDTKGEESDVYSSEIPAEFQKLERFAARKAIVAAVDALGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRADVLAKPAVEAVENG-DIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDNDGN-VYVGRTEDEVRQENNLGADVQLRQDEDVLDTWFSSALWTFSTLGWPENTDALRQFHPTSVMVSGFDIIFFWIARMIMMTMHFIKDENGKPQVPFHTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLPELLEKRTGNMMQPQMAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEEQDCGFNGGEMTLSLADRWILAEFNQTVKAYRDALDSFRFDIAAGILYEFTWNQFCDWYLELTKPVMTGGSESELRGTRHTLVTVLEGLLRLAHPIIPFITETIWQRVKVICGITADTIMLQPFPEYNAAQVDEAALADTEWLKQAIVAVRNIRAEMNIAPGKPLELLLRGCSEEAVRRVNDNRSFLQTLARL----ESITVLPADDKGPVSVTKIIDGAELLIPMAGLINKDDELARLAKEVAKIEGEIARIEGKLSNEGFVARAPEAVIAKEREKLDGYAEAKAKLIEQ 944
>gi|168226834|ref|ZP_02652065.1| valyl-tRNA synthetase [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (951 aa)
Score = 1399, Expect = 2.3e-152, Identities = 327/854 (38%), Positives = 516/854 (60%)
  Q:    13 LSKKYDHKICEQQ-FSLWTTQKELNKKNLKANKNSYSILLPPPN