>gi|26553495|ref|NP_757429.1| competence protein [Mycoplasma penetrans HF-2] >gi|26453501|dbj|BAC43833.1| predicted competence protein [Mycoplasma penetrans HF-2] (364 aa)
Score = 1449, Expect = 1.3e-158, Identities = 364/364 (100%), Positives = 364/364 (100%)
  Q:     1 MKITNTIILWMLACCFYMNSETVSSTFLFLFFFGSCLVNHVNKFKVLLISGLGFIFLFYVLSFETPSSFNFLNDYLNKIMGINLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLELFNLYIFRKRSSMKWKLNKLERVY 364
           MKITNTIILWMLACCFYMNSETVSSTFLFLFFFGSCLVNHVNKFKVLLISGLGFIFLFYVLSFETPSSFNFLNDYLNKIMGINLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLELFNLYIFRKRSSMKWKLNKLERVY
  S:     1 MKITNTIILWMLACCFYMNSETVSSTFLFLFFFGSCLVNHVNKFKVLLISGLGFIFLFYVLSFETPSSFNFLNDYLNKIMGINLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLELFNLYIFRKRSSMKWKLNKLERVY 364
>gi|46907710|ref|YP_014099.1| comEC/Rec2 family protein [Listeria monocytogenes str. 4b F2365] >gi|46880979|gb|AAT04276.1| comEC/Rec2 family protein [Listeria monocytogenes str. 4b F2365] (719 aa)
Score = 136, Expect = 2.3e-06, Identities = 59/218 (27%), Positives = 100/218 (45%)
  Q:    68 SFNFLNDYLNKIMGINLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYK---THNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           S  F   +L K+  I L+ I  ++  +    T+  +   ++   KN ++  +Y     + +VHL+ IS  H+N+  G +  +  KF  T  R I+ LL F   Y  L G +P  IR        +       K +      LSFI   L+ P ++   GF +S+  S G+ L  +   T       ++   S  +TI     +     S S  G+F +L+Y PIF ++ +
  S:   137 SSQFSPSFLMKLQNIRLKII--THLTEKISPTISPYCLALISGEKNGFSPEMYEVYQQMGVVHLLAISGLHVNLLIGAIYFLLLKFGITRDRAITCLLVFLPFYVILTGANPPVIRAATMTALLLLSEKYTTKWSSFSAICLSFILFFLLQPYIIREVGFQLSYAVSFGIILSSRQIVTRQQNAFTKSLAISFISTIMSSAVMMYHFYSFSWVGIFFNLIYVPIFTMIIL 364
>gi|47094096|ref|ZP_00231821.1| comE operon protein 3, putative [Listeria monocytogenes str. 4b H7858] >gi|47017526|gb|EAL08334.1| comE operon protein 3, putative [Listeria monocytogenes str. 4b H7858] (719 aa)
Score = 136, Expect = 2.3e-06, Identities = 59/218 (27%), Positives = 100/218 (45%)
  Q:    68 SFNFLNDYLNKIMGINLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYK---THNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           S  F   +L K+  I L+ I  ++  +    T+  +   ++   KN ++  +Y     + +VHL+ IS  H+N+  G +  +  KF  T  R I+ LL F   Y  L G +P  IR        +       K +      LSFI   L+ P ++   GF +S+  S G+ L  +   T       ++   S  +TI     +     S S  G+F +L+Y PIF ++ +
  S:   137 SSQFSPSFLMKLQNIRLKII--THLTEKISPTISPYCLALISGEKNGFSPEMYEVYQQMGVVHLLAISGLHVNLLIGAIYFLLLKFGITRDRAITCLLVFLPFYVILTGANPPVIRAATMTALLLLSEKYTTKWSSFSAICLSFILFFLLQPYIIREVGFQLSYAVSFGIILSSRQILTRQQNAFTKSLAISFISTIMSSAVMMYHFYSFSWVGIFFNLIYVPIFTMIIL 364
>gi|116872911|ref|YP_849692.1| comEC/Rec2 family protein [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116741789|emb|CAK20913.1| unnamed protein product [Listeria welshimeri serovar 6b str. SLCC5334] (719 aa)
Score = 131, Expect = 9.1e-06, Identities = 61/235 (25%), Positives = 111/235 (47%)
  Q:    83 NLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYK---THNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF-ILVYIFLFIFSWVNWLDPVFI-VAYNLIFEVSKVLEHI 317
           N+R  I  Y        +  +   ++    N ++  +Y     + +VHL+ IS  H+N+  G +  +  KF  T  R I  LL F   Y  L G +P  IR        +     + K +      LSFI   ++ P V+   GF +S+  S G+ L  +   T       ++F  S+ +T+     +     S S  G+F +LLY PIF +++    F+  +++ + P F+ +  +L+  + +++E I
  S:   150 NIRLTIIKYLSNNISPIVSPYFLALITGENNGFSPEMYEAYQQMGVVHLLAISGLHVNLLIGAIYFLLLKFGMTRERAIIFLLVFLPFYAILTGANPPVIRAATMTALLLLSEKYSTKFSAFSVICLSFILFFILQPYVIYEVGFQLSYAVSFGIILSSRQILTKQQNPFAKSFAISLISTMMSSVVMMYHFYSFSWAGIFFNLLYVPIFTVIILPSCFVVFFISLIFPAFLNMPESLLIFIIQLMEKI 398
>gi|47095435|ref|ZP_00233045.1| comE operon protein 3, putative [Listeria monocytogenes str. 1/2a F6854] >gi|47016256|gb|EAL07179.1| comE operon protein 3, putative [Listeria monocytogenes str. 1/2a F6854] (740 aa)
Score = 130, Expect = 1.2e-05, Identities = 55/203 (27%), Positives = 98/203 (48%)
  Q:    83 NLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSF-------LGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           N+R  I ++  +    T+  +   ++   KN ++  +Y     + +VHL+ IS  H+N+  G +  +  KF  T  R I+ LL F   Y  L G +P  IR        +       K +      LSFI   L+ P V+   GF +S+       L SR +    +   +  L  +F ++I +++ ++        S S  G+F +L+Y PIF ++ +
  S:   171 NIRLKIITHLTEKISSTISPYCLALISGEKNGFSPEMYEVYQQMGVVHLLAISGLHVNLLIGAIYFLLLKFGITRERAITCLLVFLPFYVILTGANPPVIRAATMTALLLLSEKYTTKWSSFSAICLSFILFFLLQPYVMKEVGFQLSYTVSFGIILSSRQILAQQQNAFTKSLSISFISTIMSSVVMMYHF----YSFSWVGIFFNLIYVPIFTIIIL 385
>gi|13508190|ref|NP_110139.1| competence protein [Mycoplasma pneumoniae M129] >gi|2496382|sp|Q50361|Y451_MYCPN Uncharacterized protein MG316 homolog >gi|639786|gb|AAA61693.1| ORF6 [Mycoplasma pneumoniae] >gi|1674071|gb|AAB96038.1| competence locus operon protein 3-like protein [Mycoplasma pneumoniae M129] (369 aa)
Score = 124, Expect = 5.5e-05, Identities = 62/234 (26%), Positives = 110/234 (47%)
  Q:   106 LVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIF--KSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSW-----VNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSL 339
           L L  I       +Y   I L+IVHL VIS +H++   G++ +  +K   + +I   ++     +L GF+ S++RVF + +      K        L+ + + L++P  L +FGF  SFL    +    K     K  +A  TS    I + P    +N  ++   VF +LL++PI     +F F  SW     + W+    +  Y  +  +S+    +N  + +++ K  W+F + Y  L
  S:    99 LKLFLINETTKNTLYQSAIQLNIVHLFVISGFHLSFLFGVMERWLYKRFYINKITGFVMLLLYLFLVGFAFSALRVFVSKLLRQMFPKQLPENNLGLTALLIILMSPGALHNFGFNFSFLACFVLFAINKV-KLWKPLQAVLTSTLILIVVSPITLHLNRKLNALSVFHNLLFTPI----ALFYFCASWLLLPLIPWMGNSLVGFYWPLPWLSQWA--LNTTVFLNLPKPNWVFYLVYYGL 332
>gi|153174609|ref|ZP_01930110.1| hypothetical protein LMIG_01292 [Listeria monocytogenes FSL N3-165] >gi|133730213|gb|EBA31911.1| hypothetical protein LMIG_01292 [Listeria monocytogenes FSL N3-165] (740 aa)
Score = 122, Expect = 1.0e-04, Identities = 54/203 (26%), Positives = 98/203 (48%)
  Q:    83 NLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSF-------LGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           N+R  I ++  +    T+  +   ++   K+ ++  +Y     + +VHL+ IS  H+N+  G +  +  KF  T  R I+ LL F   Y  L G +P  IR        +       K +      LSFI   L+ P V+   GF +S+       L SR +    +   +  L  +F ++I +++ ++        S S  G+F +L+Y PIF ++ +
  S:   171 NIRLKIITHLTEKISPTISPYCLALISGEKSGFSPEMYEVYQQMGVVHLLAISGLHVNLLIGAIYFLLLKFGVTRERAITFLLVFLPFYVILTGANPPVIRAATMTALLLLSEKYTTKWSSFSAICLSFILFFLLQPYVMKEVGFQLSYTVSFGIILSSRQILAQQQNAFTKSLSISFISTIMSSVVMMYHF----YSFSWVGIFFNLIYVPIFTIIIL 385
>gi|16803522|ref|NP_465007.1| hypothetical protein lmo1482 [Listeria monocytogenes EGD-e] >gi|16410911|emb|CAC99560.1| comEC [Listeria monocytogenes] (740 aa)
Score = 122, Expect = 1.0e-04, Identities = 54/203 (26%), Positives = 98/203 (48%)
  Q:    83 NLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSF-------LGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           N+R  I ++  +    T+  +   ++   K+ ++  +Y     + +VHL+ IS  H+N+  G +  +  KF  T  R I+ LL F   Y  L G +P  IR        +       K +      LSFI   L+ P V+   GF +S+       L SR +    +   +  L  +F ++I +++ ++        S S  G+F +L+Y PIF ++ +
  S:   171 NIRLKIITHLTEKISPTISPYCLALISGEKSGFSPEMYEVYQQMGVVHLLAISGLHVNLLIGAIYFLLLKFGVTRERAITFLLVFLPFYVILTGANPPVIRAATMTALLLLSEKYTTKWSSFSAICLSFILFFLLQPYVMKEVGFQLSYTVSFGIILSSRQILAQQQNAFTKSLSISFISTIMSSVVMMYHF----YSFSWVGIFFNLIYVPIFTIIIL 385
>gi|15828932|ref|NP_326292.1| hypothetical protein MYPU_4610 [Mycoplasma pulmonis UAB CTIP] >gi|14089875|emb|CAC13634.1| conserved hypothetical protein [Mycoplasma pulmonis] (423 aa)
Score = 120, Expect = 1.7e-04, Identities = 62/205 (30%), Positives = 102/205 (49%)
  Q:   103 FISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKF---PTLGRIISALLSFTISYLNGFSPSSIRVFCANVFG------IFKSTRNCKANLSFIFLGLVA-----PKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWV-NWLDPVFIVAYNLI 307
           ++ L+LLN K+  N   Y  + +L IVHL+VIS +HIN+   L+N  F+K    P      S  L  ++  L G S    RV     F       I+K  +   + +  + + LVA     P V+ S   + ++  +  +    K     K+ +A F S  A       L I  N I  +  F S+++SPI   V+I   +F W+ N++D ++++   LI
  S:   190 YVPLILLNHKSQINQKEYKSIENLGIVHLVVISGFHINLIFWLLNFAFNKVKIKPFYSNFFSIFLISSLVILLGISMPIYRVLFFYYFKFFYESFIYKKGKVKISKIQILLISLVAIFTINPNVIFSLSTIFTYSITFVILWSSKFKFKNKILKALFISFLAYATSALILIIFQNKIYPFAFFYSIIFSPIISFVFIVSVLFFWLKNFIDFIYLIFDKLI 409
>gi|171326583|ref|ZP_02915048.1| DNA internalization-related competence protein ComEC/Rec2 [Geobacillus sp. WCH70] >gi|171087435|gb|EDT33821.1| DNA internalization-related competence protein ComEC/Rec2 [Geobacillus sp. WCH70] (759 aa)
Score = 117, Expect = 3.7e-04, Identities = 49/155 (31%), Positives = 82/155 (52%)
  Q:   126 LSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISY--LNGFSPSSIRV-FCANVFGI---FKSTRNCKANLS--FIFLGLVAPKVLISFGFLMSFLGSRGVKLFYK---THNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF 280
           L ++HL+ IS  H+ +  G +  I  +F T       LL F   Y  L G SPS IR  F A +F +   +KS  +    LS   + + L  P +L   GF +SF+ +  + L  +   +H+S   +  FFT+  A +  +P L      +SLW + L++++ P++
  S:   226 LGLIHLLAISGLHVTLLVGAMFSILIRFITKETATIILLIFLPIYIVLTGASPSVIRASFTAMIFLVSDYWKSKLSPLDALSITLVMMLLFDPYMLWDVGFQLSFIVTFALILSSQMILSHDS-VFWRLFFTAFIAQLSALPFLLYYFFEVSLWSIPLNIIFVPLY 390
>gi|16800585|ref|NP_470853.1| hypothetical protein lin1517 [Listeria innocua Clip11262] >gi|16413990|emb|CAC96748.1| comEC [Listeria innocua] (746 aa)
Score = 114, Expect = 8.8e-04, Identities = 49/203 (24%), Positives = 92/203 (45%)
  Q:    83 NLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYK---THNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           N R +I ++  +     +  ++  ++   KN ++  +Y     + +VHL+ IS  H+N+  G +  +  K   T  R+  +LL     Y  L G SP  IR        +       K +      +SFI   ++ P V+   GF +S++ S G+ L  +           ++   S  +T+     +     S S  G+F +LLY P+F ++ +
  S:   177 NTRLLIMNHLTENISPKITPYLLALITGEKNGFSPEMYEVYQQMGVVHLLAISGLHVNLLIGSIYFLLLKLGITRERVTISLLVLLPFYVILTGASPPVIRAATMTALLLLSEKYATKWSSFSVICISFILFFIIQPHVIYEVGFQLSYVVSFGIILSSRQILVRQQSPFVKSLTISFISTMMSSVVMMYHFYSFSWVGIFFNLLYVPLFTIIVL 391
>gi|163762986|ref|ZP_02170050.1| Nitric-oxide synthase [Bacillus selenitireducens MLS10] >gi|160356919|gb|EDP83568.1| Nitric-oxide synthase [Bacillus selenitireducens MLS10] (769 aa)
Score = 110, Expect = 2.6e-03, Identities = 56/177 (31%), Positives = 88/177 (49%)
  Q:   126 LSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIR--VFCANVFGIFKSTRNCKA--NLSFIFLGL--VAPKVLISFGFLMSFLGSRGVKLFYKTHNSG-KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP---IFILVYIFLFIFSWVNWLDPVFIV 302
           L ++HL+ +S  H+ +    +N +  +   T  R +  LL+    Y  L G +PS +R  +  A V    KS    KA   +S +F+ L  V P  L   GF +SFL S  + +     + G ++ +    ++ A I   P +  I    SL+ VF++LL  P   IF+L   FL +F    WL P   V
  S:   237 LGVIHLLAVSGLHVGLLTLAMNSLLLRLGITRERALWILLAMLPVYMILAGGAPSVMRASLTVAAVILAAKSGWKLKAVDGISIVFIALLTVNPYYLYHVGFQLSFLTSFALIMSSPLLSQGNRITQLMKVTLAAQIIAAPVMISIFFEWSLFAVFMNLLMVPAVTIFLLPGAFLTVFGL--WLWPSVTV 424
>gi|75763392|ref|ZP_00743125.1| COME operon protein 3 [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|74489121|gb|EAO52604.1| COME operon protein 3 [Bacillus thuringiensis serovar israelensis ATCC 35646] (748 aa)
Score = 109, Expect = 3.1e-03, Identities = 48/202 (23%), Positives = 94/202 (46%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISY---LNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKL---FYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           LR+   S   ++  +  G+F++ +L   +    + +  +     ++HL+ IS  HI +  G+V  I  +      + +  L   I     L G SPS IR   A V  +     + +       +++ I + +  P ++ + GF  SF+GS  + L   F    ++G +  + + SI + +   P L       S + +FL+LLY P   ++ +
  S:   159 LRQQAISKVTEMFPEQSGAFMNALLFGDRQQMTFEVEEQYQQFGLIHLLAISGSHIVLLMGIVYFILLRSGATREVATICLIVCIPLYMVLAGASPSVIRASIAGVLMLIAFMCSIRLSSLDALSVTAICMLIYDPYLVFNIGFQFSFVGSFALLLSAPFLLGSSNGVIRNSIYISIISQLVSTPILLYHFGYFSPYSIFLNLLYVPFLSIIVL 372
>gi|152976755|ref|YP_001376272.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152025507|gb|ABS23277.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus subsp. cytotoxis NVH 391-98] (780 aa)
Score = 109, Expect = 3.1e-03, Identities = 51/190 (26%), Positives = 93/190 (48%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISYL--NGFSPSSIRVFCAN---VFGIFKSTRNCKAN---LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKT---HNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF--------ILVYIFLFIF 290
           G+F++ +L   +   +Y +  +     ++HL+ IS  HI +   +V  +  +   T  R  +AL+     Y+   G SPS +R        + G+  S R    +   ++ IF+ +  P +L   GF  SF+GS  + L   T   HN G +  A   S+ + +  IP         S + + L+L+Y P          I++++ + IF
  S:   202 GAFMNALLFGDRQFMSYEVEQQYQQFGLIHLLAISGSHIVLLSAIVYFVLLRIGVTRERTTTALIICIPLYMFFAGASPSVMRASIMGTLLLIGVMHSFRLFSIDAISVTAIFMLIYDPYMLFDIGFQFSFIGSLALLLSANTLLQHNRGVIQNAIILSLISQLASIPITLYHFGYFSPYSIPLNLIYVPFLSCIVLPCSIIIFLCMMIF 411
>gi|124523364|ref|ZP_01697500.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus coagulans 36D1] >gi|124495581|gb|EAY43262.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus coagulans 36D1] (760 aa)
Score = 108, Expect = 3.6e-03, Identities = 49/196 (25%), Positives = 87/196 (44%)
  Q:   107 VLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNC------KANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAF--------FTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWVN-WLDPVFIV 302
           +L   + D++  +Y     L +VHL+ IS  H+ +  G    +F +   T  R    LL     Y  L G +P  +R     +  +    +          ++ FI  GL    ++ + GF +SF     + L      SG L E F          S  + +  +P L     + S+ G+  +L Y P++  V + L   ++V+ W  P+F +
  S:   207 LLFGEQTDFDDDVYQLYQRLGVVHLLAISGLHVQLVAGFCYYLFIRLGMTRERAAVCLLGVMPVYAVLCGMNPPVVRSAAMTMLLVLAGQKKLPIGPLDALSICFILYGLKNANIVYNIGFQLSFAVCAALLL------SGPLLERFRGPLQKGLAISFISQLAALPILSYSFYAFSIAGLVANLFYVPLYTYVLLPLAALAFVSEWAPPLFSI 414
>gi|11991259|gb|AAG42267.1|AF320590_1 competence protein 3 [Listeria monocytogenes] (267 aa)
Score = 108, Expect = 3.6e-03, Identities = 53/198 (26%), Positives = 90/198 (45%)
  Q:    83 NLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYK---THNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF 280
           N+R  I ++  +    T+  +   ++   KN ++  +Y     + +VHL+ IS  H+N+  G +  +  KF  T  R I+ LL F   Y  L G +P  IR        +       K +      LSFI   L+ P ++   GF +S+  S G+ L  +   T       ++   S  +TI     +     S S  G+F +L+Y P +
  S:     5 NIRLKIITHLTEKISPTISPYCLALISGEKNGFSPEMYEVYQQMGVVHLLAISGLHVNLLIGAIYFLLLKFGITRDRAITCLLVFLPFYVILTGANPPVIRAATMTALLLLSEKYTTKWSSFSAICLSFILFFLLQPYIIREVGFQLSYAVSFGIILLSRQILTRQQNAFTKSLAISFISTIMSSAVMMYHFYSFSWVGIFFNLIYVPFY 214
>gi|168140317|ref|ZP_02583546.1| ComE operon protein 3 [Bacillus cereus G9842] (773 aa)
Score = 108, Expect = 4.1e-03, Identities = 48/202 (23%), Positives = 94/202 (46%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISY---LNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKL---FYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           LR+   S   ++  +  G+F++ +L   +    + +  +     ++HL+ IS  HI +  G+V  I  +      + +  L   I     L G SPS IR   A V  +     + +       +++ I + +  P ++ + GF  SF+GS  + L   F    ++G +  + + SI + +   P L       S + +FL+LLY P   ++ +
  S:   184 LRQQAISKVTEMFPEQSGAFMNALLFGDRQQMTFEVEEQYQQFGLIHLLAISGSHIVLLMGIVYFILLRSGATREVATICLIVCIPLYMVLAGASPSVIRASIAGVLMLIAFMCSIRLSSLDALSVTAICMLIYDPYLVFNIGFQFSFVGSFALLLSAPFLLGSSNGVIRNSIYISIISQLVSTPILLYHFGYFSPYSIFLNLLYVPFLSIIVL 397
>gi|158335299|ref|YP_001516471.1| competence protein, putative [Acaryochloris marina MBIC11017] >gi|158305540|gb|ABW27157.1| competence protein, putative [Acaryochloris marina MBIC11017] (757 aa)
Score = 107, Expect = 5.1e-03, Identities = 37/148 (25%), Positives = 75/148 (50%)
  Q:    81 GINLREIINSYFIKIHGQTLGSFIS-LVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS-YLNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGV 228
           G  +R+ I     +  G   G+ +S +VL + + D  + +  + + + + H +  S +H++I    + K+  +  +  ++IS L+   I  +L+GF PS  R     + G+   T N K N      +  + L ++ P+ +   GF +SFL + G+
  S:   208 GWAVRQRIVRSHARFLGPEKGALVSAMVLGHRRVDLPFNLRNRFVKVGLAHTLAASGFHVSIILAGLLKVTGRLSSRTQLISGLIGLIIFIFLSGFEPSVSRAVLMGMAGLAAVTANRKLNPVGVLLVVAVGLLVIQPQWIWDLGFQLSFLATLGL 363
>gi|12045172|ref|NP_072983.1| ComEC/Rec2-related protein [Mycoplasma genitalium G37] >gi|1723148|sp|P47558|Y316_MYCGE Uncharacterized protein MG316 >gi|3844893|gb|AAC71538.1| ComEC/Rec2-related protein [Mycoplasma genitalium G37] >gi|166078717|gb|ABY79335.1| ComEC/Rec2-related protein [synthetic Mycoplasma genitalium JCVI-1.0] (369 aa)
Score = 106, Expect = 7.7e-03, Identities = 55/194 (28%), Positives = 93/194 (47%)
  Q:   100 LGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSF--IFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWV 293
           L  ++ L L+N     N  +Y   + L+IVHL VIS +H++    L+ +   K   L ++    +     +L GF+ S++RVF + +       +  + NLS   + + L++   L +FGF  SFL    V LF       K  +   +S    I I P    +N+ ++ + V  +LL+SPI     +F F  SW+
  S:    95 LNQYLKLFLINETTKNN--LYQNALKLNIVHLFVISGFHLSFLFNLMERFLWKRWYLNKLSGFAVLLIYLFLVGFAFSALRVFISTLLKQVFKKQLPEDNLSLTALLIILISNHALNNFGFNFSFLACF-VLLFVNKLKLLKALKPLVSSSLILIVISPLSLYLNSRLNAFSVLFNLLFSPI----ALFYFCVSWI 283
>gi|31544771|ref|NP_853349.1| hypothetical protein MGA_0337 [Mycoplasma gallisepticum R] >gi|31541617|gb|AAP56917.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (376 aa)
Score = 105, Expect = 1.0e-02, Identities = 60/238 (25%), Positives = 107/238 (44%)
  Q:    54 FIFLFYVLSFETPSSFNFLNDYLNKIMGINLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFS----PSSIRVFCANVFGIFKSTRNCK---ANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVY---IFLFIFS 291
           F+  ++V  +      +F N         +LR +I  Y      +     + L L NIKN+ N  +Y  +++LSI HL+VIS  H+++   L+ +IF  +   G  +S       SYL  FS       + +    +F  F   +N K      S I L  + P    ++ +++S+L    +   ++        ++   S+     +   +      I+L  +F S++ SPI I +Y   +FLF FS
  S:    72 FVVYYFVYGYFQLEGISFKNLLDKIPKQYDLRMVIIDYLNTNPNKQSRGLLLLTLFNIKNNDNRLLYNHILNLSIAHLLVISGLHLSLINLLILRIFKNYKITGNFVSFSCLLFYSYLLNFSYGVLRVLLCLVLNLIFKRFFKNKNYKLISIASSGIILLFLNPYAFNNYSYILSYLSILVIYAIFQIKKLNNFVKSILASVVINFVLSGLIINGYGRINLLTIFWSIILSPIIIGMYFINLFLFPFS 319
>gi|78044560|ref|YP_359264.1| DNA internalization-related competence protein ComEC/Rec2 [Carboxydothermus hydrogenoformans Z-2901] >gi|77996675|gb|ABB15574.1| DNA internalization-related competence protein ComEC/Rec2 [Carboxydothermus hydrogenoformans Z-2901] (725 aa)
Score = 104, Expect = 1.3e-02, Identities = 52/157 (33%), Positives = 87/157 (55%)
  Q:   119 IYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGR----IISALLSFTISYLNGFSPSSIRVFCANVF--GIFKSTRNCKAN----LSFIFLGLVAPKVLISFGFLMSFLGSRGV-----------KLFYKTHNSGKL-----------------YEAFFT-SIFATIYIIPSLGIINNSISLWGVFLSLL 275
           +Y       +VH++ +S  H+ +  G +     K   L R    + + +  F  + L GF+P+++R F   VF  G F   R+ +      LS  F  L+ P+ L S GFL+S+L + G+           KL+  ++ +  +                 Y  F T SI A + ++P  GII  S  ++G+FLS L
  S:   210 VYDSFAKTGVVHILSVSGLHLGLVAGAI-YFLGKGLRLSRQWQNLFTIIFCFFYTALTGFNPATVRAFLMLVFLVGAFFLGRDYQPVYHLFLSAFFYLLIKPQELFSAGFLLSYLATLGIFLIGLPLAEKLKLYLPSYLADTIGVTVGAQILTEPIVFYHYSLFATLSIIANLLVVPLTGIIMAS-GIFGLFLSPL 403
>gi|18311026|ref|NP_562960.1| hypothetical protein CPE2044 [Clostridium perfringens str. 13] >gi|18145708|dbj|BAB81750.1| conserved hypothetical protein [Clostridium perfringens str. 13] (536 aa)
Score = 102, Expect = 2.2e-02, Identities = 65/207 (31%), Positives = 101/207 (48%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPI-----------------FILVYIFLFIFSWVN-WLDPVFIVAYNLIF 308
           + ++ VL   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  + L +  P  L S GFL+SF G+ G+ L YK    G      KL E     + A  +I P L I     S+  +  + L +PI                  I + +FL    WV  +L PVF +AY  +F
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAVILLIYKPYNLFSMGFLLSFGGTLGIILLYKKLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVIAFGKFSINFLISTFLVTPIIVILLQILLISILIGGNLIGIIVFLDKVVWVTPYLSPVFAIAYMTMF 409
>gi|113477315|ref|YP_723376.1| ComEC/Rec2-related protein [Trichodesmium erythraeum IMS101] >gi|110168363|gb|ABG52903.1| ComEC/Rec2-related protein [Trichodesmium erythraeum IMS101] (816 aa)
Score = 100, Expect = 3.2e-02, Identities = 54/222 (24%), Positives = 112/222 (50%)
  Q:    77 NKIMGI-NLREIINSYFIKIHGQTLGSFISLVLLNIKN-DYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISY-LNGFSPSSIRVF---CANVFGIFKSTRNCKANLS----FIFLGLVAPKVLISFGFLMSFLGSRGVKL----FYKTHNSGKLYEAFFTSIF--ATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWVNWLDP 298
           N + G+  +R+ I    +K  G   G  +S ++L  K  D++Y +  + I + + H++  S +H+++  G V  +  K  +  R    +L  +I     GF PS +R      A + GI    R  K  +S       L L+ P  + + GF +SFL + G+ +      K  N      A+  +I+  A+++++P L  +   +S + + ++++ +P+  ++ +  FI + +  + P
  S:   243 NNVWGLYKIRQRIIRAQVKFLGVPEGPLVSAMVLGRKAVDFSYQLRDQFIQVGLAHILAASGFHVSLILGAVLTLTKKMSSGKRFSFGILLLSIYVAFTGFVPSVLRAALMGLATLLGIV-FQRMVKPLVSLLLAATLLLLINPLWIWNLGFQLSFLATLGLLVTLPPLTKRLNMLPSGIAYLAAIYISASVWVLPLLLSVFYVVSPYAILVNIIVAPLVTVITVGGFISAMLALIYP 479
>gi|168161104|ref|ZP_02596337.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus H3081.97] (773 aa)
Score = 100, Expect = 3.4e-02, Identities = 47/202 (23%), Positives = 89/202 (44%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISY---LNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           LR+   S   ++  +  G+F++ ++   +    + +  +     +VHL+ IS  HI +   +V  I  K      + +  L F I     L G SPS IR     VF +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S  + +   P L       S + +FL++LY P   LV +
  S:   184 LRQQAISEVTEMFPEQSGAFMNALVFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIVLLMVIVYFILLKSGVTREVATVCLIFCIPLYMILAGASPSVIRASLTGVFMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISFISQLVSTPILLYHFGYFSPYSIFLNILYVPFLSLVVL 397
>gi|166983247|ref|ZP_02254665.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus AH187] (773 aa)
Score = 100, Expect = 3.5e-02, Identities = 47/202 (23%), Positives = 89/202 (44%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISY---LNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           LR+   S   ++  +  G+F++ ++   +    + +  +     +VHL+ IS  HI +   +V  I  K      + +  L F I     L G SPS IR     VF +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S  + +   P L       S + +FL++LY P   LV +
  S:   184 LRQQAISEVTEMFPEQSGAFMNALVFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIVLLMVIVYFILLKSGVTREVATVCLIFCIPLYMILAGASPSVIRASLTGVFMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISFISQLVSTPILLYHFGYFSPYSIFLNILYVPFLSLVVL 397
>gi|22299245|ref|NP_682492.1| competence protein [Thermosynechococcus elongatus BP-1] >gi|22295427|dbj|BAC09254.1| competence protein [Thermosynechococcus elongatus BP-1] (761 aa)
Score = 97, Expect = 7.5e-02, Identities = 48/206 (23%), Positives = 97/206 (47%)
  Q:    93 IKIHGQTLG----SFIS-LVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGR--IISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVA------PKVLISFGFLMSFLGSRGVKLFYKTHNS------GKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWVNWLDP 298
           +++H Q LG    + +S +VL N      + +        + H +  S +H  I   +V       P   R  + + +L F  ++L GF+PS++R     + G+       K     I L +        P  +   GF +SFL + G+ +  +  +         L      ++ AT++++P    I  +I ++G+  +++ +P  IL+ +  FI + V ++ P
  S:   226 VQVHAQGLGDRHGAVVSGMVLGNRAVAIPFEVRDSFRRAGLSHALAASGFHTAILLAVVLTATRPLPQRWRSGLGAGVLVF-FAFLTGFAPSAMRAALMGLAGLVALVNGQKGQPLVILLAIATAMLIYNPLWIEDIGFQLSFLATLGLIVSAQPISDRLHWLPTPLRSPLAVALAATLWVLPLSLAIFGTIPVYGLPANVIANPFLILLTVGGFISATVGFILP 449
>gi|42783452|ref|NP_980699.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus ATCC 10987] >gi|42739381|gb|AAS43307.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus ATCC 10987] (773 aa)
Score = 97, Expect = 8.5e-02, Identities = 47/202 (23%), Positives = 91/202 (45%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISY---LNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKT---HNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           LR+   S   ++  +  G+F++ ++   +    + +  +     +VHL+ IS  HI +   +V  I  +      + +  L F I     L G SPS IR     VF +     + +       +++ I + +  P ++ + GF  SF+GS  + L         +G +  + + S  + +   P L       S + +FL++LY P   LV +
  S:   184 LRQQAISEVAEMFPEQSGAFMNALVFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREVATVCLIFCIPLYMILAGASPSVIRASITGVFMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSTPLLLESGNGVIRNSIYISFISQLVSTPILLYHFGYFSPYSIFLNILYVPFLSLVVL 397
>gi|28211663|ref|NP_782607.1| putative integral membrane protein comE [Clostridium tetani E88] >gi|28204105|gb|AAO36544.1| putative integral membrane protein comE [Clostridium tetani E88] (558 aa)
Score = 95, Expect = 1.2e-01, Identities = 52/198 (26%), Positives = 93/198 (46%)
  Q:    83 NLREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCA--------NVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNS------GKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF 280
           NL+  IN+ FI   G+  GS +  +     +  +      +  L ++H + +S +H+     LV KIF    T+   I A  S+      GF  S+IR F            +G + S  +   +L+F+ +  + P   +  GF++SFL + G+ +F K  +        KL  A   S+ + I++IP        +S+  +  ++   PIF
  S:   151 NLKRNINNKFINSLGKKRGSIVVSLCFGDSSYLDKEDKDNIKKLGVIHALSVSGFHL----ALVYKIFEIIFTMKFAIIA--SYLYLAFTGFKYSTIRAFIMILVLKLSDKFYGEYDSLSSI--SLAFLIILFLKPYAFMEIGFMLSFLSTLGILMFDKKISKYIYFLPSKLNSAISLSLSSQIFLIPYSSFTLKELSIGFLLGNIFLMPIF 354
>gi|192812011|ref|ZP_03040680.1| DNA internalization-related competence protein ComEC/Rec2 [Geobacillus sp. Y412MC10] >gi|192799158|gb|EDV75669.1| DNA internalization-related competence protein ComEC/Rec2 [Geobacillus sp. Y412MC10] (924 aa)
Score = 95, Expect = 1.3e-01, Identities = 63/260 (24%), Positives = 123/260 (47%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFP-TLGRIISALLSFTISY--LNGFSPSSIRVFCANVFGIFKSTRN-CKANLSFIFLGLVA-----PKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYE--AFF---------TSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWV-NWLDPVFIVAYNLIFEVSKVLEHINVVI-----PISIFKNEW----------IFSIYYSSLELFN 343
           LR+ + S   +++G     ++  +++  ++D +   + +   L + H++ IS  H+ +  G +  +      T    ++A++     Y  L G SPS +R     + G++ + R   K  L  + +  +A     P  L++  F +SF+ + G+ +F       KL    AF           ++ A +   P      N +SL  VF +L+  P+  LV + L + S +  W   V++     +  V++ L HI   I       S+F   W           F + Y+ L + N
  S:   253 LRDKLGSKLDQLYGGIHAGYMKGLVIGNQDDLDPDTFMEFSRLGLTHILAISGMHVAVVVGCLLFVCTTLRMTREASLTAVMWLIPVYVLLTGASPSIVRAGIMGMIGLYAARRRLLKDGLHILSVAALAMLVWNPYFLVNVSFQLSFIVTAGLMIFVP-----KLMPLLAFLPRWLGGTVGITVVAQLISFPLTIHYFNQVSLISVFANLILVPVISLVVLPLGMVSLLMGW---VWMRGAGWLAAVTEWLNHITFRIVEWMNGSSVFMTLWPSPSLAWILCYFVVLYALLSILN 540
>gi|182624013|ref|ZP_02951801.1| competence family protein [Clostridium perfringens D str. JGS1721] >gi|177910906|gb|EDT73260.1| competence family protein [Clostridium perfringens D str. JGS1721] (551 aa)
Score = 94, Expect = 1.6e-01, Identities = 55/177 (31%), Positives = 84/177 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP 278
           + ++ VL   K +  Y     L DL I+HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  I L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGIIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAIILLIYKPYNLFSMGFLLSFGGTLGIILFYKKLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVITFRKFSINFLISTFLVTP 361
>gi|168212919|ref|ZP_02638544.1| competence family protein [Clostridium perfringens CPE str. F4969] >gi|170715535|gb|EDT27717.1| competence family protein [Clostridium perfringens CPE str. F4969] (551 aa)
Score = 94, Expect = 1.6e-01, Identities = 54/177 (30%), Positives = 84/177 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP 278
           + ++ VL   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  I L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAIILLIYKPYNLFSMGFLLSFGGTLGIILFYKKLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVIAFGKFSINFLISTFLVTP 361
>gi|167755869|ref|ZP_02427996.1| hypothetical protein CLORAM_01386 [Clostridium ramosum DSM 1402] >gi|167704808|gb|EDS19387.1| hypothetical protein CLORAM_01386 [Clostridium ramosum DSM 1402] (668 aa)
Score = 94, Expect = 1.6e-01, Identities = 56/249 (22%), Positives = 122/249 (48%)
  Q:    94 KIHGQTL-GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIF------HKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFS-WVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLELF 342
           +I G+ L  S+ S+ +L I+++     Y++L +LSIVHL  +S  HI+I   L+ K+       +    L  II  +  + I Y   F  + + +    +F  + +  +C + ++  F+  + P ++ +  F+ S+     + L    ++   L E  + +       +P +  I   I++  +FL ++ +P+  ++Y  L+++  + N+  PV          +S V+E ++ ++   +F  ++ F I +S   LF
  S:   162 RIDGKELVNSYASMFILGIRDEMINDYYHQLTELSIVHLFALSGLHIHILRRLIKKVLIFLLPEYLINYLSLIIIGVYMYIIPYNISFMRAYLVMLLMTLFKKYLNQLDCFSLVAMFFV-FMNPYIIYNLSFVFSYFMYLIIILI---NHHRYLNEIVYGA------SVPIVISIQYRINILSLFLGIILTPLISVLYQLLWLYVIFGNFFKPV----------ISLVIEVLDNIV---VFSTDFSFFINFSKPSLF 395
>gi|169350129|ref|ZP_02867067.1| hypothetical protein CLOSPI_00871 [Clostridium spiroforme DSM 1552] >gi|169293342|gb|EDS75475.1| hypothetical protein CLOSPI_00871 [Clostridium spiroforme DSM 1552] (665 aa)
Score = 94, Expect = 1.9e-01, Identities = 53/223 (23%), Positives = 114/223 (51%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFH-----KFPT-LGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKL-------------YEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVY------IFLFIFS-WVNWLDPVFIVAYNLIFEVSKVLEHINVVIPIS 324
           ++ S+ +L I++D     Y +L +LSI+HL  +S  HI++   ++ K+       KF   LG ++  +  + I +   F  + + +  + +F  + +  +C A ++ + L ++ P V+ S  F+ S+     + L  K      L             Y     S+   I ++P + ++  SI L+ +F ++    + I++Y      +F   FS ++N+L P      +  F   K++  +NV + ++
  S:   171 NYASMFVLGIRDDLAQDEYEQLTNLSIIHLFALSGLHIHMLMDMIKKVLRFIMPIKFCNYLGIVLIGIYVYIIPFNISFVRAYLIMVLSVLFKNYLNKLDCLAIVTVLML-VINPYVIYSLSFIFSYFIYFVILLINKNKYFNLLVYFGSLPIILMVQYRINILSLLLGIILVPLITVLYQSIWLYVIFGNMFNGIVAIIIYFLNNIVVFCNDFSIYLNFLKPTLFFILSYYFIYFKIILKLNVKLKVT 418
>gi|169343716|ref|ZP_02864715.1| competence family protein [Clostridium perfringens C str. JGS1495] >gi|169298276|gb|EDS80366.1| competence family protein [Clostridium perfringens C str. JGS1495] (551 aa)
Score = 93, Expect = 2.0e-01, Identities = 77/246 (31%), Positives = 118/246 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP-------------------IFILVYIFLFIFS-------------WVN-WLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLELFNLYIF 347
           + ++ VL   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  + L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P                   I I+V++   IF              WV  +L PVF +AY  +F        + V + I  FK   I       + L NLY+F
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAVILLIYKPYNLFSMGFLLSFGGTLGIILFYKKLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVIAFGKFSINFLISTFLVTPIIVILLQILLISILIGGNLIGIIVFLINIIFMVFRGILVFLDKVVWVTPYLSPVFAIAYMTMF--------LWVYMSIKGFKKFKIGVYLVIPVLLLNLYVF 455
>gi|168205852|ref|ZP_02631857.1| competence family protein [Clostridium perfringens E str. JGS1987] >gi|170662632|gb|EDT15315.1| competence family protein [Clostridium perfringens E str. JGS1987] (551 aa)
Score = 93, Expect = 2.2e-01, Identities = 53/177 (29%), Positives = 84/177 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP 278
           + ++ VL   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  + L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAVILLIYKPYNLFSMGFLLSFGGTLGIILFYKKLLEGFYMLPPKLNEYLSLGVSAQAFIYPILVIAFGKFSINFLISTFLVTP 361
>gi|52081107|ref|YP_079898.1| hypothetical protein BL02087 [Bacillus licheniformis ATCC 14580] >gi|52786485|ref|YP_092314.1| hypothetical protein BLi02750 [Bacillus licheniformis ATCC 14580] >gi|18266366|gb|AAL67526.1|AF459916_3 late competence protein ComEC [Bacillus licheniformis] >gi|52004318|gb|AAU24260.1| ComEC [Bacillus licheniformis ATCC 14580] >gi|52348987|gb|AAU41621.1| ComEC [Bacillus licheniformis DSM 13] (795 aa)
Score = 93, Expect = 2.2e-01, Identities = 49/164 (29%), Positives = 79/164 (48%)
  Q:   126 LSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTI---SYLNGFSPSSIR-VFCANVFGIFK-STRNCKAN--LSFIFLGLVA--PKVLISFGFLMSFLGSRGVKLFYK--THNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFI 289
           L I+HL+ IS  H+ +    +  IF +F         LL   +   + L G +PS +R VF + ++ +   S +N K+   +S   LGL+   P +L   GF +SF  S    L  +  T    ++ +    S  A +  +P L       S    FLS L +  FI +YIF+ +
  S:   228 LGIIHLLAISGLHVGLLSAALFYIFIRFGVTRECAKWLLVIGLPVAAVLTGGAPSVMRAVFMSEIYLLASLSKKNFKSADVISIACLGLLLYHPYLLFQAGFQLSFAVSFVFILSKEILTRPKSRISQLLLGSFLAQLASLPILLFHFQEFS----FLSTLMNLFFIPLYIFIIM 398
>gi|196044739|ref|ZP_03111973.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus 03BB108] >gi|196024227|gb|EDX62900.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus 03BB108] (693 aa)
Score = 93, Expect = 2.3e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   121 GAFMNALLFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 317
>gi|166368608|ref|YP_001660881.1| competence protein [Microcystis aeruginosa NIES-843] >gi|166090981|dbj|BAG05689.1| competence protein [Microcystis aeruginosa NIES-843] (719 aa)
Score = 93, Expect = 2.4e-01, Identities = 53/200 (26%), Positives = 91/200 (45%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYP--IYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTI-SYLNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLY------EAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILV 283
           +R+ I    I+  GQ  G+ +S + L  +   N P  I    I   + H++  S +H+ I  G V  I        + I AL    I   L G  PS +R     +  +     N + N      L+   L L  P  +   GF +SFL + G+ +      +   Y      E    S+ AT++ +P L    NSI+L+ + ++++ +P+  L+
  S:   214 IRQRIVEAQIQGIGQEKGTLLSSITLG-RQAVNLPAKITDLFIKTGLAHILAASGFHVAILLGFVLTITRNLSPKKQFIIALTILIIYGTLTGLQPSVLRAILMGIGALIGLLYNRQVNSLGSLLLAATILLLWQPLWIWDLGFQLSFLATLGLIITVPLLKNKIDYFPNLIAEPIAISLAATLWTMPLLMFTFNSIALYNIPINIITTPLVTLI 427
>gi|110799672|ref|YP_696724.1| competence family protein [Clostridium perfringens ATCC 13124] >gi|110674319|gb|ABG83306.1| competence family protein [Clostridium perfringens ATCC 13124] (551 aa)
Score = 93, Expect = 2.5e-01, Identities = 53/177 (29%), Positives = 84/177 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP 278
           + ++ VL   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  + L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAVILLIYKPYNLFSMGFLLSFGGTLGIILFYKNLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVIAFGKFSINFLISTFLVTP 361
>gi|188569203|ref|ZP_03005719.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 2] (365 aa)
Score = 93, Expect = 2.5e-01, Identities = 90/348 (25%), Positives = 161/348 (46%)
  Q:     3 ITNTIILWMLACCFYMNSETVSSTFLFLFFFGSCLVNHVNKFKVLLISGLGFIFLFYVLSFETPSSFN--FLNDYLNKIMGINLREIINSYFIKIH-GQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKI-FHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF----ILVYIFLFIFSWVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLEL-FNLYIFRKR 350
           I+  I+   +ACCFY N+  +    +  F++    +  +     L+I  + F  L + L      +FN  +L   L K    +LR+ I  Y  K +  +     I L++ N K   N+     L DL+I HL ++S  H+NIF  ++NKI F K+P +  II         YL  FS   IRVF  ++  I    +  K +      GL+   + I    ++SF+ +          N      +   +I+  +YI+    II+ +++    FLS+++  +     + VY  LF F ++   + V     N++ +    +  I+  I I  +    I +I+Y+S+ L  +L+I+ K+
  S:    13 ISFLILATSIACCFYYNNFWILIVNVCQFYW----LYQIKFNYKLIILIIVFSILCFALCLLIHKNFNTHYLITNLEKECDWSLRKQIIVYLSKKYLNKNTLMLIKLMIFNEKVSGNFKQI--LYDLNIAHLFIVSGLHLNIFLLIINKIFFKKWPKISFIIGICFLIFYGYLLEFSIGFIRVFIMHILSIKFFQKISKMD-KLAISGLIIASLSIYNLSMLSFIFAYLALFCIYLLNLFIKDNSILKNIYINLYILSITFIISINLNEKINFLSIIFGYVMNLPILFVYQVLFWFMFIPHFEVVLDGVTNILVKAIYFINEIDANIYIKNYSE--IITIFYTSIWLTISLWIYYKK 360
>gi|65321697|ref|ZP_00394656.1| COG0658: Predicted membrane metal-binding protein [Bacillus anthracis str. A2012] (722 aa)
Score = 92, Expect = 2.7e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   151 GAFMNALLFGDRQQMTFEVEGQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 347
>gi|159026475|emb|CAO86447.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (719 aa)
Score = 92, Expect = 2.7e-01, Identities = 52/200 (26%), Positives = 91/200 (45%)
  Q:    84 LREIINSYFIKIHGQTLGSFISLVLLNIKNDYNYP--IYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKF-PTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLY------EAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILV 283
           +R+ I    I+  GQ  G+ +S + L  +   N P  I    I   + H++  S +H+ I  G V  I     P    II+  +      L G  PS +R     +  +     N + N      L+   L L  P  +   GF +SFL + G+ +      +   Y      E    S+ A+++ +P L    NSISL+ + ++++ +P+  L+
  S:   214 IRQRIVEAQIQGLGQEKGTLLSSITLG-RQAVNLPAKITDLFIKTGLAHILAASGFHVAILLGFVLTITRNLSPKKQFIIAVTILIIYGTLTGLQPSVMRAILMGIGALIGLLYNRQVNSLGSLLLAATILLLWQPLWIWDLGFQLSFLATLGLIITVPLLKNKIDYFPNLIAEPVAISLAASLWTMPLLMFTFNSISLYNIPINIITTPLITLI 427
>gi|188159721|ref|ZP_02998838.1| metallo-beta-lactamase superfamily protein, putative [Mycoplasma mycoides subsp. mycoides LC str. GM12] (688 aa)
Score = 92, Expect = 2.7e-01, Identities = 55/187 (29%), Positives = 90/187 (48%)
  Q:   125 DLSIVHLIVISSYHINIFCGLVNKIFHKFP--TLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGV-------KLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWV--NWLDPVFIVAYNLIFEVS 311
           DL++  LIVISSY+I+ F     K+  KF   T+   +  L+ F +SYL  FS +S+R+    V  ++   +N   N   +F   +   +LI F    SFL S            +Y+     K  +    S+  T Y IP       S S+    L ++  P+F  +Y  +FI+ W   N+L  + I  +  I +++
  S:   213 DLNLSFLIVISSYNIHFFTKFFYKLNTKFKWTTIITYLFYLIVFLLSYLTNFSYASLRIVIFFVISLY--FKNFNKNTELVFKRFLT--LLICFVLTPSFLTSSSAVFIIVSFMFYYEKIFRNKFLDLCLKSLIFTFYFIPLQIFYFYSFSIVIQSLLIILRPLFSFLYFSIFIWIWFDHNFLTNILIKIFEFIKKIN 406
>gi|196039278|ref|ZP_03106584.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus NVH0597-99] >gi|196029905|gb|EDX68506.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus NVH0597-99] (579 aa)
Score = 92, Expect = 2.9e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:     7 GAFMNALLFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASVTGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 203
>gi|110803317|ref|YP_699325.1| comC competence related protein, putative [Clostridium perfringens SM101] >gi|110683818|gb|ABG87188.1| comC competence related protein, putative [Clostridium perfringens SM101] (551 aa)
Score = 92, Expect = 2.9e-01, Identities = 53/177 (29%), Positives = 84/177 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP 278
           + ++ VL   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  + L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAVILLIYKPYNLFSMGFLLSFGGTLGIILFYKKLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVIAFGKFSINFLISTFLVTP 361
>gi|196034371|ref|ZP_03101780.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus W] >gi|195992913|gb|EDX56872.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus W] (693 aa)
Score = 92, Expect = 3.0e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   121 GAFMNALLFGDRQQMTFEVEGQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 317
>gi|168215671|ref|ZP_02641296.1| competence family protein [Clostridium perfringens NCTC 8239] >gi|182382025|gb|EDT79504.1| competence family protein [Clostridium perfringens NCTC 8239] (551 aa)
Score = 92, Expect = 3.0e-01, Identities = 53/177 (29%), Positives = 84/177 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP 278
           + ++ VL   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  + L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P
  S:   179 ALLNAVLWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAVILLIYKPYNLFSMGFLLSFGGTLGIILFYKKLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVIAFGKFSINFLISTFLVTP 361
>gi|118479491|ref|YP_896642.1| DNA internalization-related competence protein [Bacillus thuringiensis str. Al Hakam] >gi|118418716|gb|ABK87135.1| DNA internalization-related competence protein [Bacillus thuringiensis str. Al Hakam] (773 aa)
Score = 92, Expect = 3.1e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   201 GAFMNALLFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 397
>gi|170707463|ref|ZP_02897917.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0389] >gi|190566917|ref|ZP_03019833.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis Tsiankovskii-I] >gi|170127707|gb|EDS96580.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0389] >gi|190561908|gb|EDV15877.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis Tsiankovskii-I] (692 aa)
Score = 92, Expect = 3.1e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   121 GAFMNALLFGDRQQMTFEVEGQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 317
>gi|166995909|ref|ZP_02262369.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus cereus AH820] (773 aa)
Score = 92, Expect = 3.2e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   201 GAFMNALLFGDRQQMTFEVEGQYQQFGLVHLLAISGSHIVLLVVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 397
>gi|185178965|ref|ZP_02964722.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188039584|ref|ZP_02998301.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 8] >gi|188524408|ref|ZP_03004429.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530967|ref|ZP_03005229.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|195867901|ref|ZP_03079900.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|184209244|gb|EDU06287.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|195659951|gb|EDX53331.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660478|gb|EDX53736.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (365 aa)
Score = 91, Expect = 3.5e-01, Identities = 89/348 (25%), Positives = 161/348 (46%)
  Q:     3 ITNTIILWMLACCFYMNSETVSSTFLFLFFFGSCLVNHVNKFKVLLISGLGFIFLFYVLSFETPSSFN--FLNDYLNKIMGINLREIINSYFIKIH-GQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKI-FHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF----ILVYIFLFIFSWVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLEL-FNLYIFRKR 350
           I+  I+   +ACCFY N+  +    +  F++    +  +     L+I  + F  L + L      +FN  +L   L K    +LR+ I  Y  K +  +     I L++ N K   N+     L DL+I HL ++S  H+NIF  ++NKI F K+P +  +I         YL  FS   IRVF  ++  I    +  K +      GL+   + I    ++SF+ +          N      +   +I+  +YI+    II+ +++    FLS+++  +     + VY  LF F ++   + V     N++ +    +  I+  I I  +    I +I+Y+S+ L  +L+I+ K+
  S:    13 ISFLILATSIACCFYYNNFWILIVNVCQFYW----LYQIKFNYKLIILIIVFSILCFALCLLIHKNFNTHYLITNLEKECDWSLRKQIIVYLSKKYLNKNTLMLIKLMIFNEKVSGNFKQI--LYDLNIAHLFIVSGLHLNIFLLIINKIFFKKWPKISFVIGICFLIFYGYLLEFSIGFIRVFIMHILSIKFFQKISKMD-KLAISGLIIASLSIYNLSMLSFIFAYLALFCIYLLNLFIKDNSILKNIYINLYILSITFIISINLNEKINFLSIIFGYVMNLPILFVYQVLFWFMFIPHFEVVLDGVTNILVKAIYFINEIDANIYIKNYSE--IITIFYTSIWLTISLWIYYKK 360
>gi|30264396|ref|NP_846773.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. Ames] >gi|47529847|ref|YP_021196.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49187219|ref|YP_030471.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. Sterne] >gi|165872029|ref|ZP_02216669.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0488] >gi|167638533|ref|ZP_02396809.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0193] >gi|177653305|ref|ZP_02935557.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0174] >gi|30259054|gb|AAP28259.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. Ames] >gi|47504995|gb|AAT33671.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. 'Ames Ancestor'] >gi|49181146|gb|AAT56522.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. Sterne] >gi|164712160|gb|EDR17697.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0488] >gi|167513381|gb|EDR88751.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0193] >gi|172081587|gb|EDT66659.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus anthracis str. A0174] (772 aa)
Score = 91, Expect = 3.6e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   201 GAFMNALLFGDRQQMTFEVEGQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 397
>gi|188592842|ref|ZP_03006103.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 10] (365 aa)
Score = 91, Expect = 3.6e-01, Identities = 89/348 (25%), Positives = 161/348 (46%)
  Q:     3 ITNTIILWMLACCFYMNSETVSSTFLFLFFFGSCLVNHVNKFKVLLISGLGFIFLFYVLSFETPSSFN--FLNDYLNKIMGINLREIINSYFIKIH-GQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKI-FHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF----ILVYIFLFIFSWVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLEL-FNLYIFRKR 350
           I+  I+   +ACCFY N+  +    +  F++    +  +     L+I  + F  L + L      +FN  +L   L K    +LR+ I  Y  K +  +     I L++ N K   N+     L DL+I HL ++S  H+NIF  ++NKI F K+P +  +I         YL  FS   IRVF  ++  I    +  K +      GL+   + I    ++SF+ +          N      +   +I+  +YI+    II+ +++    FLS+++  +     + VY  LF F ++   + V     N++ +    +  I+  I I  +    I +I+Y+S+ L  +L+I+ K+
  S:    13 ISFLILATSIACCFYYNNFWILIVNVCQFYW----LYQIKFNYKLIILIIVFSILCFALCLLIHKNFNIHYLITNLEKECDWSLRKQIIVYLSKKYLNKNTLMLIKLMIFNEKVSGNFKQI--LYDLNIAHLFIVSGLHLNIFLLIINKIFFKKWPKISFVIGICFLIFYGYLLEFSIGFIRVFIMHILSIKFFQKISKMD-KLAISGLIIASLSIYNLSMLSFIFAYLALFCIYLLNLFIKDNSILKNIYINLYILSITFIISINLNEKINFLSIIFGYVMNLPILFVYQVLFWFMFIPHFEVVLDGVTNILVKAIYFINEIDANIYIKNYSE--IITIFYTSIWLTISLWIYYKK 360
>gi|49481367|ref|YP_038379.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|49332923|gb|AAT63569.1| DNA internalization-related competence protein ComEC/Rec2 [Bacillus thuringiensis serovar konkukian str. 97-27] (773 aa)
Score = 91, Expect = 3.7e-01, Identities = 43/185 (23%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS IR     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   201 GAFMNALLFGDRQQMTFEVEGQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVIRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 397
>gi|171920892|ref|ZP_02932046.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|171903108|gb|EDT49397.1| ComEC/Rec2 family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] (365 aa)
Score = 91, Expect = 3.9e-01, Identities = 89/348 (25%), Positives = 160/348 (45%)
  Q:     3 ITNTIILWMLACCFYMNSETVSSTFLFLFFFGSCLVNHVNKFKVLLISGLGFIFLFYVLSFETPSSFN--FLNDYLNKIMGINLREIINSYFIKIH-GQTLGSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKI-FHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF----ILVYIFLFIFSWVNWLDPVFIVAYNLIFEVSKVLEHINVVIPISIFKNEWIFSIYYSSLEL-FNLYIFRKR 350
           I+  I+   +ACCFY N+  +    +  F++    +  +     L+I  + F  L + L      +FN  +L   L K    +LR+ I  Y  K +  +     I L++ N K   N+     L DL+I HL ++S  H+NIF  ++NKI F K+P +  +I         YL  FS   IRVF  ++  I    +  K +      GL+   + I    ++SF+ +          N      +   +I+  +YI+    II+ +++    FLS+++  +     + VY  LF F +    + V     N++ +    +  I+  I I  +    I +I+Y+S+ L  +L+I+ K+
  S:    13 ISFLILATSIACCFYYNNFWILIVNVCQFYW----LYQIKFNYKLIILIIVFSILCFALCLLIHKNFNTHYLITNLEKECDWSLRKQIIVYLSKKYLNKNTLMLIKLMIFNEKVSGNFKQI--LYDLNIAHLFIVSGLHLNIFLLIINKIFFKKWPKISFVIGICFLIFYGYLLEFSIGFIRVFIMHILSIKFFQKISKMD-KLAISGLIIASLSIYNLSMLSFIFAYLALFCIYLLNLFIKDNSILKNIYINLYILSITFIISINLNEKINFLSIIFGYVMNLPILFVYQVLFWFMFTPHFEVVLDEVTNILVKAIYFINEIDANIYIKNYSE--IITIFYTSIWLTISLWIYYKK 360
>gi|168208746|ref|ZP_02634371.1| competence family protein [Clostridium perfringens B str. ATCC 3626] >gi|170713204|gb|EDT25386.1| competence family protein [Clostridium perfringens B str. ATCC 3626] (551 aa)
Score = 90, Expect = 4.8e-01, Identities = 52/177 (29%), Positives = 84/177 (47%)
  Q:   102 SFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRN--------CKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSG------KLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSP 278
           + ++ +L   K +  Y     L DL ++HLI IS +HI +   ++ K F    +    +S    + I  L G S S++R     +  + KS++            +L  + L +  P  L S GFL+SF G+ G+ LFYK    G      KL E     + A  +I P L I     S+  +  + L +P
  S:   179 ALLNAILWGDKENLTYNQKDFLSDLGVIHLICISGFHIALLFSIIYKKF----SFKIALSICTIYVI--LVGASSSALRALI--MITLLKSSKRLFKTYDPLSSISLGAVILLIYKPYNLFSMGFLLSFGGTLGIILFYKKLLEGFYMLPPKLNEYLSLGLSAQAFIYPILVIAFGKFSINFLISTFLVTP 361
>gi|187735350|ref|YP_001877462.1| ComEC/Rec2-related protein [Akkermansia muciniphila ATCC BAA-835] >gi|187425402|gb|ACD04681.1| ComEC/Rec2-related protein [Akkermansia muciniphila ATCC BAA-835] (689 aa)
Score = 90, Expect = 5.2e-01, Identities = 30/115 (26%), Positives = 51/115 (44%)
  Q:   108 LLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLV---NKIFHKFPTLGRIISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKAN------LSFIFLGLVAPKVLISFGFLMSF 222
           +L  K D       K ++   +H+  +S  H+ +   LV    ++ H  P   R+   LL     ++ G S S++R F      +       K +      L+FI L L+ P  +   GF +SF
  S:   204 VLGDKTDARLETMAKFLESGCMHVFAVSGMHVGVAAMLVLGMLRLLHVHPRAARLACILLLAAYVFVTGMSASALRAFIMATVWLLAFVLRRKGHPANILALAFILLCLMNPLQVFQPGFQLSF 327
>gi|114772147|ref|ZP_01449530.1| DNA internalization-related competence protein ComEC/Rec2 [alpha proteobacterium HTCC2255] (745 aa)
Score = 90, Expect = 5.5e-01, Identities = 51/183 (27%), Positives = 86/183 (46%)
  Q:   103 FISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIIS--------ALLSFTIS-----YLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISF-------GFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISL--------WGVFLSLLYSPIFILVYI 285
           +I+ ++L  K+D        +      HL VIS  HI I  G +  IFH    LG++++         LL+  I      YL GF+   +R F   +  ++   +    ++   +L L    VL+SF       GF +SFL    + +    H   K   + +  + A I I  +L I+   I++        W +  +L   PI  L  +
  S:   159 WINALILGYKHDLTKSDKVLIRHTGTAHLFVISGLHIGIVAGWIYYIFHTVAKLGKLVNRQAFSDQYVLLATLIGTWGYCYLLGFTIPMLRAFIVLLLCLYIHYKQLNISMWHKYL-LCLCGVLVSFPLSSFNTGFWLSFLAVSAISII--VHCLSKSVRSLWDKVMAFIMIQIALTILLFPINIVVFGQIFPWSILANLWAIPIVTLFLV 366
>gi|152990088|ref|YP_001355810.1| DNA uptake protein [Nitratiruptor sp. SB155-2] >gi|151421949|dbj|BAF69453.1| DNA uptake protein [Nitratiruptor sp. SB155-2] (413 aa)
Score = 89, Expect = 6.3e-01, Identities = 50/163 (30%), Positives = 81/163 (49%)
  Q:   122 KLIDLSIVHLIVISSYHIN--------IFCGLVNKIFHKFPTLGRIISALLSFTI------SYLNGFSPSSIRVFCANVFGIFKSTRNCK----ANLSFIFLGLVA--PKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVY 284
           K+ D ++ HL+ IS +H+         +F  L+  ++ +F     + +   SF I      +   G  PS IR  C  +FG F  +R+ K      L ++ L L+A  PK L S GF +S  G   + LF       K+      + +  + ++P    I +  SL   F  LL S +F+L Y
  S:   161 KIADFAVSHLVAISGFHLGLIVAVITFVFSILLKPLWQRFFPYKNLYTYAFSFAIFVAISYTLFLGTIPSLIRSLCMLLFGFFLFSRHMKILSFETLLWVVLVLIALFPKFLFSIGFWLSVSGVFYIYLFLHHFRYSKVAIFVLINFWMYLVMMPWSLYIFHHFSLMQFFAPLL-SMVFVLFY 342
>gi|52141179|ref|YP_085650.1| DNA internalization-related competence protein [Bacillus cereus E33L] >gi|51974648|gb|AAU16198.1| DNA internalization-related competence protein [Bacillus cereus E33L] (773 aa)
Score = 89, Expect = 6.5e-01, Identities = 42/185 (22%), Positives = 82/185 (44%)
  Q:   101 GSFISLVLLNIKNDYNYPIYYKLIDLSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISALLSFTIS---YLNGFSPSSIRVFCANVFGIFKSTRNCK------ANLSFIFLGLVAPKVLISFGFLMSFLGS---RGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIFILVYI 285
           G+F++ +L   +    + +  +     +VHL+ IS  HI +   +V  I  +      I +  L F I     L G SPS +R     V  +     + +       +++ I + +  P ++ + GF  SF+GS              +G +  + + S+ + +   P L       S + +FL++LY P   L+ +
  S:   201 GAFMNALLFGDRQQMTFEVEEQYQQFGLVHLLAISGSHIVLLMVIVYFILLRSGVTREIATVCLIFFIPIYMILAGASPSVMRASITGVLMLIAFMCSIRLSSLDALSITAICMLIFDPYLVFNIGFQFSFVGSFALLLSAPLLLESGNGVIRNSIYISLISQLVSTPILLYHFGYYSPYSIFLNILYVPFLSLIVL 397
>gi|57168096|ref|ZP_00367235.1| competence locus E (comE3), putative [Campylobacter coli RM2228] >gi|57020470|gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] (419 aa)
Score = 89, Expect = 6.8e-01, Identities = 59/181 (32%), Positives = 90/181 (49%)
  Q:   128 IVHLIVISSYHINIFCGLVNKIFHKFPTLGR--------------IISALLSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKA------NLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIY-----IIPSLGIINNSISLWGVFLSLLYSPIFILVYIFLFIFSWV---NWLDPVFIVAYNLIF 308
           + HLI IS YHI +   LV  I     +  +              I   +L F  +YL GF PS +R     ++G +   +N K        +S     ++ P++L+S GF  S LG     +F   H+  KL+  F   I   I+     I P L      +  +  FL+++ S IFI+ Y  +    ++   N LDPV I  +NL F
  S:   170 VAHLIAISGYHIGLLFTLVFFILAPLYSFFQKRYFPYRSLRFDLSIFIFILLFAYAYLIGFVPSYVRSLIMALWGFYLLCKNIKILSFFTLFISIYLCIVLYPRLLLSIGFFFSCLGV--FYIFLYLHHFSKLFNNFLNIILVNIWTFFCMITPVLYFF--PLISYQQFLAIILSGIFIVFYPLVLCLHFIAHGNLLDPVLIDFFNLKF 374
>gi|157150217|ref|YP_001450879.1| DNA internalization-related competence protein celB [Streptococcus gordonii str. Challis substr. CH1] >gi|157075011|gb|ABV09694.1| DNA internalization-related competence protein celB [Streptococcus gordonii str. Challis substr. CH1] (746 aa)
Score = 88, Expect = 9.0e-01, Identities = 49/174 (28%), Positives = 82/174 (47%)
  Q:   126 LSIVHLIVISSYHINIFCGLVNKIFHKFPTLGRIISAL---LSFTISYLNGFSPSSIRVFCANVFGIFKSTRNCKANLSFIFLGLVAPKVLISFGFLMSFLGSRGVKLFYKTHNSGKLYEAFFTSIFATIYIIPSLGIINNSISLWGVFLSLLYSPIF------ILVYIF----LFIFSWVN----WLDPV 299
           L I+HL  +S   +  F  +  KI  +       +  L   LSF  + L GFS S +R     +   F   R     ++ + L L+ P  L++ G ++S   +  + +     +SG   +A   S+  ++ I+P L         W + L+ L+S +F      +L  IF    LF F+ VN    WL+ V
  S:   235 LGIIHLFALSGMQVGFFMDVFRKILLRIGLRMETVDWLQFPLSFLYAGLTGFSVSVVRSLVQKLLSQFGVRRLDNFAMTMLVLMLLMPSFLLTTGGVLSCAYAFIITMLDFEDSSG-FRKAVLESLSISLGILPLLIYYFAEFQPWSILLTFLFSIVFDTFMLPLLSLIFLISPLFAFTQVNVFFQWLEMV 424