>gi|26553496|ref|NP_757430.1| hypothetical protein MYPE440 [Mycoplasma penetrans HF-2] >gi|26453502|dbj|BAC43834.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (666 aa)
Score = 2583, Expect = 0.0e+00, Identities = 645/645 (100%), Positives = 645/645 (100%)
  Q:     1 MDFFHLLFFFRIIQFIYISKKEFNEMKIKQIRKSVLGFISFFPCIPFATAYSFHAENNNLQINNFQTSSTSNIPSFQTATSSLRTSENSLYIATPNNEINKMLNFNFSYNSSSNNVLYINESNKNKIAKIIALYMFQNYDFFFDDALNTVSSVIKQEYEKISSNKGLVYSKLENTSSEPLLSFFYFFKYENSMLGSAGIKVSSVPIMKYLKWNNIGNDQYTISFTIPYTWTSGPRFYLDNIKANHKLIDIYYQTRYENEFITIGFGNIIFRNIANNISNFSYTNIDPMDLTYEKLKILFKLNNSLIPSSLSYTMEKSDGFYKINIKKITYEIKDIQKFNLYYEGNYSVVFTKSNYEFNWDVIKSRHNLISLSTNDLWNELVINQSYKNMINNISLSKDYQNNKIRIDIDFNKYKYQNLLLFTLMEQLFKDQSFEIKLDTDSSVNFYVDDKYEHILFKNFNLDLINAKFNLLPYDLKLNKIELVNEDLEKETISFKSYLSTTINKINYDFSVFGIFTNFENYNFWDIEKITNFFNNNFYDEEQNLDIEKIEEVFKVQSNWSYLLDHSKNLIFKNLKIDLNDDENKFVLSFDIFNNKNLYLDSSFIEIKTKEKIVVEDNEESEETNKPEEEIVVPQKKKSNLNYLWF 645
           MDFFHLLFFFRIIQFIYISKKEFNEMKIKQIRKSVLGFISFFPCIPFATAYSFHAENNNLQINNFQTSSTSNIPSFQTATSSLRTSENSLYIATPNNEINKMLNFNFSYNSSSNNVLYINESNKNKIAKIIALYMFQNYDFFFDDALNTVSSVIKQEYEKISSNKGLVYSKLENTSSEPLLSFFYFFKYENSMLGSAGIKVSSVPIMKYLKWNNIGNDQYTISFTIPYTWTSGPRFYLDNIKANHKLIDIYYQTRYENEFITIGFGNIIFRNIANNISNFSYTNIDPMDLTYEKLKILFKLNNSLIPSSLSYTMEKSDGFYKINIKKITYEIKDIQKFNLYYEGNYSVVFTKSNYEFNWDVIKSRHNLISLSTNDLWNELVINQSYKNMINNISLSKDYQNNKIRIDIDFNKYKYQNLLLFTLMEQLFKDQSFEIKLDTDSSVNFYVDDKYEHILFKNFNLDLINAKFNLLPYDLKLNKIELVNEDLEKETISFKSYLSTTINKINYDFSVFGIFTNFENYNFWDIEKITNFFNNNFYDEEQNLDIEKIEEVFKVQSNWSYLLDHSKNLIFKNLKIDLNDDENKFVLSFDIFNNKNLYLDSSFIEIKTKEKIVVEDNEESEETNKPEEEIVVPQKKKSNLNYLWF
  S:     1 MDFFHLLFFFRIIQFIYISKKEFNEMKIKQIRKSVLGFISFFPCIPFATAYSFHAENNNLQINNFQTSSTSNIPSFQTATSSLRTSENSLYIATPNNEINKMLNFNFSYNSSSNNVLYINESNKNKIAKIIALYMFQNYDFFFDDALNTVSSVIKQEYEKISSNKGLVYSKLENTSSEPLLSFFYFFKYENSMLGSAGIKVSSVPIMKYLKWNNIGNDQYTISFTIPYTWTSGPRFYLDNIKANHKLIDIYYQTRYENEFITIGFGNIIFRNIANNISNFSYTNIDPMDLTYEKLKILFKLNNSLIPSSLSYTMEKSDGFYKINIKKITYEIKDIQKFNLYYEGNYSVVFTKSNYEFNWDVIKSRHNLISLSTNDLWNELVINQSYKNMINNISLSKDYQNNKIRIDIDFNKYKYQNLLLFTLMEQLFKDQSFEIKLDTDSSVNFYVDDKYEHILFKNFNLDLINAKFNLLPYDLKLNKIELVNEDLEKETISFKSYLSTTINKINYDFSVFGIFTNFENYNFWDIEKITNFFNNNFYDEEQNLDIEKIEEVFKVQSNWSYLLDHSKNLIFKNLKIDLNDDENKFVLSFDIFNNKNLYLDSSFIEIKTKEKIVVEDNEESEETNKPEEEIVVPQKKKSNLNYLWF 645