>gi|26553497|ref|NP_757431.1| hypothetical protein MYPE450 [Mycoplasma penetrans HF-2] >gi|26453503|dbj|BAC43835.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (312 aa)
Score = 1200, Expect = 7.9e-130, Identities = 312/312 (100%), Positives = 312/312 (100%)
  Q:     1 MILIHGEDIGLLEEKVSELTNNKFTKIIFDSNFDDIFLRFTQRNLFDDFDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLVTETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSYRKICMDFNVQQFQIDKWEKLILNIDVFQIDNLLNNLLKLNIFYLSGKKSLPTYLKIILLNGGEYGL 312
           MILIHGEDIGLLEEKVSELTNNKFTKIIFDSNFDDIFLRFTQRNLFDDFDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLVTETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSYRKICMDFNVQQFQIDKWEKLILNIDVFQIDNLLNNLLKLNIFYLSGKKSLPTYLKIILLNGGEYGL
  S:     1 MILIHGEDIGLLEEKVSELTNNKFTKIIFDSNFDDIFLRFTQRNLFDDFDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLVTETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSYRKICMDFNVQQFQIDKWEKLILNIDVFQIDNLLNNLLKLNIFYLSGKKSLPTYLKIILLNGGEYGL 312
>gi|160915316|ref|ZP_02077529.1| hypothetical protein EUBDOL_01325 [Eubacterium dolichum DSM 3991] >gi|158433115|gb|EDP11404.1| hypothetical protein EUBDOL_01325 [Eubacterium dolichum DSM 3991] (316 aa)
Score = 125, Expect = 3.9e-05, Identities = 38/181 (20%), Positives = 88/181 (48%)
  Q:   113 KVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLVTETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSYRKICMDFNVQQFQIDKWEKLILNIDVFQIDNLLNNLLKLNIFYLSGK 293
           KV+  +KL++   + +  + LK+ ++S+++N  E L+  +  D L+I+NE+ KL L  +T+  + ++ I++  +  + F+L++    +R ++       L     D   +  ++  Q   L   R    E +  ++I        +++ +  + ++++    I N+L  L  L+    SGK
  S:   119 KVLQFRKLDEQGKRRFVDEQLKKRSISIERNARELLLSRMPFDILMIQNELSKLELYGDTITTEVVSSIVTRPLEDDVFQLVNAVVEKRIKEAFHIWEDLSTLNKDAVFLIALLAGQFRFLYQVRELLDEGKQQKEITAVLGAHPYRVQRSIQTVMHLSTNAILNILERLATLDQQIKSGK 299
>gi|15606373|ref|NP_213752.1| hypothetical protein aq_1104 [Aquifex aeolicus VF5] >gi|7388450|sp|O67189|Y1104_AQUAE Uncharacterized protein aq_1104 >gi|2983581|gb|AAC07153.1| putative protein [Aquifex aeolicus VF5] (350 aa)
Score = 107, Expect = 4.4e-03, Identities = 41/142 (28%), Positives = 76/142 (53%)
  Q:   103 EPSKVYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKL---SLVTETLNMDTITKI-ISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENR 244
           EP K  + F  ++   +L+K  +K   LK  K+  ++++ +  EYL+     + + +K E+EKL   +   + L +D + ++  S   + N FE +D    + YEK +K + +L +  I   +I  I+ S  ++LKLY L  LE +
  S:   128 EPLKSVASFGGIVVANRLSKERIKQLVLKKFKEKGINVENDALEYLLQLTGYNLMELKLEVEKLIDYASEKKILTLDEVKRVAFSVSENVNVFEFVDLLLLKDYEKALKVLDSLISFGIHPLQIMKILSS--YALKLYTLKRLEEK 271
>gi|149182760|ref|ZP_01861224.1| hypothetical protein BSG1_17475 [Bacillus sp. SG-1] >gi|148849526|gb|EDL63712.1| hypothetical protein BSG1_17475 [Bacillus sp. SG-1] (350 aa)
Score = 99, Expect = 3.2e-02, Identities = 40/163 (24%), Positives = 82/163 (50%)
  Q:    98 LSNIKEPSKVYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSL-VTETLNMD--TITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSY--RKICMDFNVQQFQI 260
           L   K+ +K   K  +V+  KKLN+  ++ +  +    NN+ + ++  + L+     + +++  EI+KLSL V++T  +D   +  + +  + +N F L++    RR E  ++    L     +  +I  ++  Q F L +Y++  L  R Y  +KI     V  F++
  S:   129 LDERKKITKTLKKQAEVVEAKKLNEKELRTWVRERTAANNVQIDESAIDLLLALAGTNLMMLTKEIDKLSLYVSDTSRIDESVVESLTARSLEQNIFALVEKVVQRRTEDALRIYYDLLKQNEEPIKILAVLSGQ-FRL-IYQVKELARRGYGQQKIASFLRVHPFRV 294
>gi|159905326|ref|YP_001548988.1| DNA polymerase II small subunit [Methanococcus maripaludis C6] >gi|159886819|gb|ABX01756.1| DNA-directed DNA polymerase [Methanococcus maripaludis C6] (584 aa)
Score = 99, Expect = 4.0e-02, Identities = 33/107 (30%), Positives = 52/107 (48%)
  Q:     7 EDIGLLEEKVSELTNNKFTKIIFDSNFDDIFLRFTQRNLFDDFDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFK 113
           ED   L +K+ E  + K   I+ DS+F +IFL    +N+F+D+           FL Y      SN  T EN++I+E        + E++    IK+ +KVY   F+
  S:    26 EDFSDLFDKIKEFKSKKDDFILLDSHFLNIFLGNNLKNIFEDY-------GKFDFLAY----YTSNEVTSENQEIIEQTDDFEPVEPEVLMEKEIKKETKVYDLDFE 121
>gi|12045171|ref|NP_072982.1| DNA polymerase III, delta subunit, putative [Mycoplasma genitalium G37] >gi|2496380|sp|Q49416|Y315_MYCGE Uncharacterized protein MG315 >gi|3844892|gb|AAC71537.1| DNA polymerase III, delta subunit, putative [Mycoplasma genitalium G37] >gi|166078740|gb|ABY79358.1| DNA polymerase III, delta subunit, putative [synthetic Mycoplasma genitalium JCVI-1.0] (297 aa)
Score = 97, Expect = 5.9e-02, Identities = 68/287 (23%), Positives = 132/287 (45%)
  Q:     1 MILIHGEDIGLLEEKVSELTNNKFTKIIFDSNFDDIFLRFTQRNLFDDFDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLV--TETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSYRKIC-MDFNVQQFQIDKWEKLILNIDVFQIDNLLNNLLKLNI 287
           M +I+G+DIGL+ +K+S++ +N   K I+   F D+      + L+D F       ++EKF++ +   +   S T +    LE L+  T      ++  N     K       V    KL+  +M     ++ ++ NL L     ++L + L  +  +I  EI KLSL+   E  +   +  +I +      ++L     N +  K  K I  L ++K +F   F     + FS +L     +++ + +++  ++ NV QF++   +    N     + N++N + KL+I
  S:     1 MTIIYGQDIGLIHQKLSQIKSNSPYKTIW---FKDL------KQLYDLFSQPLFGSNNEKFIVNNCSFLEKTSLTRQENLCLEKLK--TTDVVLTVYTDNPFSGIKTIKSITTVF-CDKLDWKSMHKAIGEVCRELNLKLDLEIIDWLANALPLNMGVIYQEINKLSLLGKNEIKDNKLVETVICDYQPVQIYKLTKALTNSQIVKAFKYIDELASTKPNFATQF----LEFFSGELLLALMVKSCNPKQLTNINLNVNQFRLIAIQSQYHNFTSKVLVNIINAIQKLDI 274
>gi|125973555|ref|YP_001037465.1| DNA polymerase III, delta subunit [Clostridium thermocellum ATCC 27405] >gi|125713780|gb|ABN52272.1| DNA polymerase III, delta subunit [Clostridium thermocellum ATCC 27405] (342 aa)
Score = 94, Expect = 1.3e-01, Identities = 40/159 (25%), Positives = 75/159 (47%)
  Q:    49 FDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYS---KFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLV---TETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVK 207
           F  E   V  +K  +++ KK  S S   +N +++  LQ + +    + +  NI    K+ S   K+  V+         +  + +K+ K    ++ +N   YLID  +     I NEI K+ L    ++ + +D+I K+ +  I    F+LID    R+ +  +K
  S:    77 FFAEKKLVVVKKSELFNSKK--SGSSNNKNDELITYLQNIPEHTCLVFYEENIDNRLKITSAVKKYGMVVEFPFQKPAELVKWAIKVFKSYGKAIDENTASYLIDTCEEGMTEILNEINKVVLYLGESQKVTVDSIKKVCTKSIKSRIFDLIDAIAERKLDLALK 239
>gi|89101075|ref|ZP_01173914.1| DNA polymerase III subunit delta [Bacillus sp. NRRL B-14911] >gi|89084218|gb|EAR63380.1| DNA polymerase III subunit delta [Bacillus sp. NRRL B-14911] (346 aa)
Score = 93, Expect = 1.7e-01, Identities = 28/133 (21%), Positives = 70/133 (52%)
  Q:   114 VMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLVTET---LNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSY 246
           V+  KKL +  +K +  +   QN + ++++  + ++     +  ++  EI+KL+L  +    ++ + + K+++  + +N F L+D   +R+ ++ ++    L     +  +I +I+  Q F L +Y++  L  R Y
  S:   140 VLEAKKLGEQELKVWIRERAAQNGVQIEEDAVQLMLTLAGTNLFMLTGEIDKLALYADEEKLIDAEAVDKLVARSLEQNIFTLVDKVVHRKIDEALRIYYDLLKQNEEPIKILSILTGQ-FRL-IYQVKELSRRGY 273
>gi|188996127|ref|YP_001930378.1| DNA polymerase III, delta subunit [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931194|gb|ACD65824.1| DNA polymerase III, delta subunit [Sulfurihydrogenibium sp. YO3AOP1] (331 aa)
Score = 93, Expect = 1.7e-01, Identities = 43/173 (24%), Positives = 86/173 (49%)
  Q:    58 SEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFKVMNIKKL--NKLTMKNYTLKL---LKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLVT---ETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQL 230
           S+  ++ DF+      K +E K+I+E ++ +    + ++ ++  K   + Y    K+ N+  +   KLT + +   L   L +   ++     +YL   L  D  + KNE+EKL L     + +  + I  +++    +N F  +D FF +    + K  I L N+ +   EI ++++SQL
  S:    71 SKAIVVRDFEAFTDKLKKDELKQIIEDIKNIKLPDRLVLIVNLEKLDKEPYKSLLKLGNVDVVISKKLTFQGFLTSLKNKLAKEGKTVSDENLKYLASLLNNDLTIAKNEVEKLLLYVGDKKEITKEDIDAVVTPVFEENVFNFLDKFFKKDISAL-KIFINLLNNGVHPFEIQSLILSQL 250
>gi|91762513|ref|ZP_01264478.1| DNA-directed DNA polymerase III [Candidatus Pelagibacter ubique HTCC1002] >gi|91718315|gb|EAS84965.1| DNA-directed DNA polymerase III [Candidatus Pelagibacter ubique HTCC1002] (331 aa)
Score = 91, Expect = 3.4e-01, Identities = 59/236 (25%), Positives = 110/236 (46%)
  Q:     3 LIHGEDIGLLEEKVSELTNNKFTKIIFDSNFDDIFLRFTQRNLFDDFDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFK------VMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKL---SLVTETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRL 238
           L +GE+ GL EE +  L         F+ N+ D   R+ ++ + DD ++  N V ++ F   + K I+ N  T++ K I+E L        +II  S   E      KFF+       +   + N  T+ +      +   + + Q     L++  + D   + NE+EK+   SL  + LN+  I K+ +   + +  EL+D+   +   K V  +     S+ ++++  NI++ +    KL RL
  S:    20 LFYGENEGLKEENIKNL---------FEENYKDKIHRYEEKEILDDINIFFNSVLTKSFFDNE-KLIIINRATDKIKTIIEELIEKNPEDIKIILNSKNLEKKSTLRKFFEKEKSIVCVPFYEDNNQTLNSIISLFFRNKKIPISQQLINVLVERSRGDRKNLNNELEKIENFSLNKKNLNIQEIIKLTNLADNYSASELVDHSLAKNTRKTVTIL-----SENNYSDEDNIIIIRTLLAKLKRL 249
>gi|169334725|ref|ZP_02861918.1| hypothetical protein ANASTE_01131 [Anaerofustis stercorihominis DSM 17244] >gi|169257463|gb|EDS71429.1| hypothetical protein ANASTE_01131 [Anaerofustis stercorihominis DSM 17244] (343 aa)
Score = 89, Expect = 4.6e-01, Identities = 35/155 (22%), Positives = 80/155 (51%)
  Q:   106 KVYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEY-------LIDCLQPDSLLIKNEIEKLS-LVTETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKIDFTEIFNIMVSQLFSLKLYRLNYLENRSYRKICMDFNVQQFQI 260
           K   K   +++ +K  +  ++N+    +K  NL L ++   Y       L+D  + D     +EI+KLS L    ++++ + KIIS +I    F+L D   ++  +   + +  LE + ++F +I  +++  L ++ L +    + +S + I  D+++  + +
  S:   131 KTIKKEGDIVDFEKFKEYKLENWIRSKIKNKNLILTKDAIGYFIEASGYLLDGSEVDLGYFVSEIDKLSSLGKREIDLEDVKKIISVNIKDEIFKLTDALRDKDTDYAFRLLSNLEYNNVNFMQILAVVIRNLENMYLCKEYMKKRKSEQDIVKDYSLHPYAV 293
>gi|50365185|ref|YP_053610.1| hypothetical protein Mfl368 [Mesoplasma florum L1] >gi|50363741|gb|AAT75726.1| unknown protein [Mesoplasma florum L1] (319 aa)
Score = 88, Expect = 6.8e-01, Identities = 60/229 (26%), Positives = 112/229 (48%)
  Q:     1 MILIHGEDIGLLEEKVSELTNNKFTKIIFDSN-----FDDIFLRFTQRNLFDDFDLENNHVDSEKFLIYDFKKILSNSKTEENKKILEMLQFLTDSKKEIIFLSNIKEPSK------VYSKFFKVMNIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLV-TETLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVK-------------QIIALENSKIDFTEIFNIMVSQ 229
           M  I+ ED  LL + V++L  N  T+  ++       ++DI   +T  N F  F      + S+ +   + K  L  + +EE   +  +L+  TD+   +IF  N +  SK         +  +V N+K + +  + NY      +N  S+  ++  ++   +  D   + NE+ KLS + ++ + +D I   +S  I  + FEL + F N   +  +K             ++IAL +S + F    N+M  Q
  S:     1 MYFIYSEDHFLLTKTVNKLVKNLLTEKEYEVENYSLIYNDISEIYTSLNTFSLFGEPKILIISDAWFATEEKISLHRNYSEE--ALYRILESKTDNV--VIFTLNNERISKRLKIAKYIEENLEVTNVKTMQENEVLNYIKAFFTRNEKSITDHDAAFIFQSIPKDMQTLTNELTKLSHIESDVITLDDIKNNLSKYIDNDIFELSNAFVNNETKTFLKLYKDYLLMNDDISKLIALLSSTVVFFRDVNVMKQQ 250
>gi|90416855|ref|ZP_01224784.1| DNA polymerase III subunit delta [marine gamma proteobacterium HTCC2207] >gi|90331202|gb|EAS46446.1| DNA polymerase III subunit delta [marine gamma proteobacterium HTCC2207] (348 aa)
Score = 87, Expect = 9.6e-01, Identities = 42/179 (23%), Positives = 83/179 (46%)
  Q:    40 FTQRNLFD---DFDLENNHVDSEKFLIYDFKKILS----NSKT-EENKKILEMLQFLTDSKKEIIFLSNIKEPSKVYSKFFKVM-------NIKKLNKLTMKNYTLKLLKQNNLSLKQNEFEYLIDCLQPDSLLIKNEIEKLSLVTE--TLNMDTITKIISNDISKNTFELIDNFFNRRYEKIVKQIIALENSKID 218
           F++R++F    +FD      +S    ++  KKIL     N K  ++    L  L    +    ++ +    E S   SK+ K +        +  ++   M  +  + L+  N+S  Q   + L D ++ + L    EIEKL L+    T++  T++ ++++    N FE +D       +   + +  L+N   D
  S:    46 FSERDIFHAEGNFDWNQILNESNALSLFSDKKILEIRIPNGKPGDKGAAALSELCANPNPDNLVLVILPKLERSAQNSKWMKTLEAAGGHIQVWPVDAKQMPRWIQQRLRSANISANQEAVQILADRVEGNLLAAVQEIEKLKLLATDGTVDGSTMSSVVADSARYNLFEFVDKILIGDGQSAARSLRGLQNEGTD 241