>gi|26553498|ref|NP_757432.1| putative integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453504|dbj|BAC43836.1| putative integral membrane protein [Mycoplasma penetrans HF-2] (447 aa)
Score = 2194, Expect = 0.0e+00, Identities = 447/447 (100%), Positives = 447/447 (100%)
  Q:     1 MEENMDYSKIKKLYLEQTKTVITLLDNQEFVGLLTSNELLRTNFVDQISVLRFLEKKLTDTKLIEKEISDSKKKKTKLDLIEIKDLDKSDIYIKKFKEITSSSPEFNEFSEIKKTENIKDIIKYLNVFLKNTFNKDLDYFLKNKSENETVRAEKIENDNFDSNTNQNPHSNTSQPNGGPGMFGNMFGGQGPMFRGWPNYEQNLQEQLLIIASTELKNQINSGKFYLYKTKPKIMLYLKNIIGCLSLFVSAIWIIVMVMQIITTSLQSGNLSALWYGDPSASTPIVLAPGNTFFTYILHIFLIGCFGFYGYKHLVNKKNENILYGFDKRTAMLLTFVMISVSGIFIFYLANWIPYIDDVKNFTGGAYSSQSIPSRAVQNSSGAVVTFQIFVWTLLSGLVMFAFLIISYIFAWVYMPKIDEERIRLKTQEIIEQLKKGDQFKSAANPIN 447
           MEENMDYSKIKKLYLEQTKTVITLLDNQEFVGLLTSNELLRTNFVDQISVLRFLEKKLTDTKLIEKEISDSKKKKTKLDLIEIKDLDKSDIYIKKFKEITSSSPEFNEFSEIKKTENIKDIIKYLNVFLKNTFNKDLDYFLKNKSENETVRAEKIENDNFDSNTNQNPHSNTSQPNGGPGMFGNMFGGQGPMFRGWPNYEQNLQEQLLIIASTELKNQINSGKFYLYKTKPKIMLYLKNIIGCLSLFVSAIWIIVMVMQIITTSLQSGNLSALWYGDPSASTPIVLAPGNTFFTYILHIFLIGCFGFYGYKHLVNKKNENILYGFDKRTAMLLTFVMISVSGIFIFYLANWIPYIDDVKNFTGGAYSSQSIPSRAVQNSSGAVVTFQIFVWTLLSGLVMFAFLIISYIFAWVYMPKIDEERIRLKTQEIIEQLKKGDQFKSAANPIN
  S:     1 MEENMDYSKIKKLYLEQTKTVITLLDNQEFVGLLTSNELLRTNFVDQISVLRFLEKKLTDTKLIEKEISDSKKKKTKLDLIEIKDLDKSDIYIKKFKEITSSSPEFNEFSEIKKTENIKDIIKYLNVFLKNTFNKDLDYFLKNKSENETVRAEKIENDNFDSNTNQNPHSNTSQPNGGPGMFGNMFGGQGPMFRGWPNYEQNLQEQLLIIASTELKNQINSGKFYLYKTKPKIMLYLKNIIGCLSLFVSAIWIIVMVMQIITTSLQSGNLSALWYGDPSASTPIVLAPGNTFFTYILHIFLIGCFGFYGYKHLVNKKNENILYGFDKRTAMLLTFVMISVSGIFIFYLANWIPYIDDVKNFTGGAYSSQSIPSRAVQNSSGAVVTFQIFVWTLLSGLVMFAFLIISYIFAWVYMPKIDEERIRLKTQEIIEQLKKGDQFKSAANPIN 447
>gi|31544769|ref|NP_853347.1| hypothetical protein MGA_0335 [Mycoplasma gallisepticum R] >gi|31541615|gb|AAP56915.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (455 aa)
Score = 112, Expect = 1.8e-03, Identities = 95/353 (26%), Positives = 161/353 (45%)
  Q:    84 KDLDKSDIYIKKFKEITSSSPEFNEFSEIKKTENIKDIIKYLNVFLKNTFNKDLDYFLK----------------NKSENETVRAEKIENDNFDSNTNQNPHSNTSQP-NGGPGMFGNMFGGQGPMFR--GWPNYEQNLQEQLLIIASTELKNQINSGKFYLYKTKPKIMLYLKNIIGCLSLFVS------AIWIIVMVMQ--IITTSLQSGNLSALWYGDPSASTPIVLAPGN--TFFTYILHIF----------LIGCFGFYGYKHL-VNKKNENILYGFDKRTAMLLTFVMISVSGIFIFYLANWIPYIDDVKNFTGGAY-----SSQSIPSRAVQNSSGAVVTFQI------FVWTLLSGLVMFAFLIISYIFAWVYMPKIDEERIRLKTQEIIEQLKKG 436
           ++L+  D+ +++    +S     +E +   + ++  D I+YL++F+ NTFN   D  +K                NK E  T     IE D            N S P NGG     N+      +F   G P+Y Q         AS  +K++++ GK +LYK K K+M  L      +SL  +       IW  V+  +  I T   Q    S   +  P+  +  VL   +  T  +YI               +     Y  K + V + N+N+ Y F  R  +L    ++  S         + P++     F GG+      S  S+P+R +   + A +T +I       +W  L  L +    +I  + ++ + PKID ER+     +  E++KK 
  S:    61 QNLEYVDVALERLNHHSSDKRTADELATYTEIDDAMDDIRYLDIFILNTFNLSFDEIVKDDKTPDKNTDSKSSVENKVEAATPTVSDIEEDEIK--------PNRSIPFNGGINSPINLKDNLEKIFTTIGQPDYRQ--------FASIVVKSELDIGKIFLYKEKLKLMPLLNYFAFVISLLFALLGASLMIWYFVLFQRQAIPTFVSQFDKNSYPIFATPNFISAAVLIAVSVVTSISYINSATGKTPPKRAQNAVALISTYMNKEVKVPQINDNLKYSFKIRPLVLFILFLLVYS---------FSPFLTP---FAGGSLLQGIISLYSVPAR-IDFVTNATITPEIVSKITEVIWISLMTLPLAILFLI--VVSFFFKPKIDNERLEETINKYAEEIKKA 433
>gi|126297633|ref|XP_001365436.1| PREDICTED: similar to chromosome 9 open reading frame 117, [Monodelphis domestica] (511 aa)
Score = 104, Expect = 1.6e-02, Identities = 42/155 (27%), Positives = 78/155 (50%)
  Q:    81 IEIKDLD-KSDIYIKKFKEITSSSPEF-NEFSEIKKTENIKDIIKYLNVFLKNTFNKDLDYFLKNKSENETVRAEK-IENDNFDSNTNQNPHSNTSQPNGGPGMFGNMFGGQGPMFRGWPNYEQNLQEQLLIIASTELKNQINSGKFYLYKTKPKIML 235
           I+I+DL+ + D Y KK++EI+     F +EF ++  T N K+++     FLK T N+ +D      S+ + ++  K +E D F++   Q  H    +      M   M GG+      +  ++  L  +  ++   +LKNQ +  K Y+Y  + K ++
  S:    34 IQIRDLENRLDRYKKKWEEISEQEKVFQDEFQQL--THNQKEVVS----FLKRTLNQRVDEITDLNSQIQGLQISKEVEKDAFEAQLAQVRHE-FQETKDQLTMENIMLGGKLSALEDFQFHKSELMSRFSLL-EEQLKNQQDEYKTYIYNMERKALI 183
>gi|157126803|ref|XP_001660954.1| hypothetical protein AaeL_AAEL010619 [Aedes aegypti] >gi|108873164|gb|EAT37389.1| conserved hypothetical protein [Aedes aegypti] (1044 aa)
Score = 95, Expect = 1.7e-01, Identities = 43/150 (28%), Positives = 69/150 (46%)
  Q:     6 DYSKIKKLYLEQTKTVITLLDNQEFVGLLTSNELLRTNFVDQISVLRFLEKKLTDTKLIEKEISDSKKKKTKLDLIEIKDLDKSDIYIKKF----KEITSSSPEFNEFSEIK-KTENIKDIIKYLNVFLKNTFNKDLDYFLKNKSENETVRAEKI 155
           +Y K KK   + T+ V+   D +E   L      L     D  S+     +     K +++ I DS K+   L  +  K+LDK +   K+     KE TS      E SE K K  N+ + I ++   LK   + +L  ++  KSE +++R E I
  S:   578 EYEKAKK---QLTRAVVNGADKKEINHLKGKTSQLEQRLKDLDSIRYIAGESGHKKKKLQQSIKDSHKQLEVLQKMLKKELDKKESIEKEIEVVRKEKTSKVSAIQEISEGKSKIRNMNERISHIEHVLKEK-SSNLKKYVNKKSEKDSLRQEII 728
>gi|149370930|ref|ZP_01890525.1| heme/copper-type cytochrome/quinol oxidase, subunit 2 [unidentified eubacterium SCB49] >gi|149355716|gb|EDM44274.1| heme/copper-type cytochrome/quinol oxidase, subunit 2 [unidentified eubacterium SCB49] (357 aa)
Score = 90, Expect = 7.6e-01, Identities = 37/135 (27%), Positives = 64/135 (47%)
  Q:   286 LAPGNTFFTYILHIFLIGCFGFYGYKHLVNKKNENILYGFDKRTAMLLTFVMISVSGIFIFYLANWIPYIDDVKNFTGGAYSSQSIPSRAVQNSSGAVVTFQIFVWTLLSGLVMFAFLIISYIFAWVYMPKIDEE 420
           L  G   FTY+L   LI CF  +G   L    +E   +G +    ML++  +I + G F  +L +W  +      + G A       +RA+  +    + F   +WT++  +++ A LII  +F W  + ++DEE
  S:    51 LMLGLAIFTYVL---LIICFWKWGDVLLPKAASE---HGANIDNLMLISMALIFIVGFFTLWLLSWFSF-----KYRGNA------TNRALFFADNDKLEF---IWTIIP-VIVLAGLIIYGLFTWTDIMQVDEE 164
>gi|70948030|ref|XP_743574.1| hypothetical protein PC000979.01.0 [Plasmodium chabaudi chabaudi] >gi|56523135|emb|CAH77101.1| hypothetical protein PC000979.01.0 [Plasmodium chabaudi] (144 aa)
Score = 89, Expect = 9.2e-01, Identities = 28/91 (30%), Positives = 50/91 (54%)
  Q:    64 IEKEISDSKKKKTKLDLIEIKDLDKSDIYIKKFKEITSSSPEFNEFSEIKKTENIKDIIKYLNVFLKNTFNKDL----DYFLKNKSENETVRAEK 154
           +  +IS  KK+K ++D+ E  +   +D+Y  K  EI  S    N++SE K  EN  D++ Y N+ + ++   +L    +YF   K  N  ++ +K
  S:    46 VGSDISSHKKRKNEIDIFEANESIVNDLYDYKKNEIYFSPNNINKYSEEKFYENEVDLLHYNNMHINSSIKTELVKNNNYFKNLKKYNFLLKKKK 140