>gi|26553499|ref|NP_757433.1| putative integral membrane protein [Mycoplasma penetrans HF-2] >gi|26453505|dbj|BAC43837.1| putative integral membrane protein [Mycoplasma penetrans HF-2] (303 aa)
Score = 1216, Expect = 9.1e-132, Identities = 303/303 (100%), Positives = 303/303 (100%)
  Q:     1 MKQIFTIKKEQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWKIG 303
           MKQIFTIKKEQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWKIG
  S:     1 MKQIFTIKKEQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWKIG 303
>gi|171920973|ref|ZP_02696325.2| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188024142|ref|ZP_02996874.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039424|ref|ZP_02998191.1| hypothetical protein Uures_01791 [Ureaplasma urealyticum serovar 8] >gi|188518611|ref|ZP_03004062.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188530893|ref|ZP_03005173.1| hypothetical protein Uurese_01000004_0200002030 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568586|ref|ZP_03005382.1| hypothetical protein Uurealyserovar_00265 [Ureaplasma urealyticum serovar 2] >gi|188592396|ref|ZP_03005769.1| hypothetical protein Uureaserovar_00300 [Ureaplasma urealyticum serovar 10] >gi|195867599|ref|ZP_03079601.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171902998|gb|EDT49287.1| putative membrane protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|188018768|gb|EDU56808.1| putative membrane protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997800|gb|EDU66897.1| putative membrane protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195660656|gb|EDX53911.1| putative membrane protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (327 aa)
Score = 355, Expect = 6.5e-32, Identities = 112/294 (38%), Positives = 171/294 (58%)
  Q:     8 KKEQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNS-----------KWVILSSIIFFAVCMETLALVFF---KKFSK----NFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
           KK++ K R L FLFP YPLK+F ++N I + AVL+A+RL +    I IP F++ IS  W  L+++ W +GP+ G+ +G + D+LA L+S   WFW+YAIQEP +G IA   G    L      P  I   I  Q  +L FS + +++++  V+     +GK+SL   L               K++ ++ +  F + +E   ++++   K  SK    NFI C+L   L    +++FSF LGP  +  Y K+I   I +  ++KYGV +YL+PR IKESIK PI I +L  +I   +     +K     KWK
  S:    27 KKQKIKKRFLLFLFPFYPLKLFKTINLIVVFAVLVAIRLGMGFLHIKIPGFNMVISFTWMALMVLSWYFGPLIGIFAGFLVDTLAWLISGGIWFWMYAIQEPAVGFIAGFLGSVVTLRKKTKRP--IIDLIVNQVFILFFSILTLFMILTLVN-----DGKNSLFSILKKRDKEINEDWISIFKYLAIAFLATFVLLVEAFVIIYYLRNKNRSKVQLVNFIYCSL---LAIFSTMLFSFALGPYVSVAYLKYIKVPITN--YLKYGVNYYLLPRIIKESIKTPIYIILLSSIISAFDYVFLNIKQINMHKWK 326
>gi|171920133|ref|ZP_02931539.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701831|ref|ZP_02971500.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|171902500|gb|EDT48789.1| putative membrane protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701119|gb|EDU19401.1| putative membrane protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (327 aa)
Score = 342, Expect = 2.1e-30, Identities = 107/286 (37%), Positives = 166/286 (58%)
  Q:    16 LLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNS-----------KWVILSSIIFFAVCMETLALVFFKKFSK-------NFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
            L FLFP YPLK+F ++N I + AVL+A+RL +    I IP F++ IS  W  L+++GW +GP+ G+ +G + D+LA L+S   WFW+YAIQEP++G IA   G    L      P  I   I  Q  +L FS + +++++  V+     +GK+SL   L               K++ ++ +  F + +E   ++++ +          NFI C+L   LV   +++FSF LGP  +  Y K+I   I +  ++KYGV +YL+PR IKESIK PI I +L  +I   +     +K     KWK
  S:    35 FLLFLFPFYPLKLFKTINLIVVFAVLVAIRLGMGFLHIKIPGFNMVISFTWMALMVLGWYFGPLIGIFAGFLVDTLAWLISGGIWFWMYAIQEPIVGFIAGFLGSVATLRKKTKRP--IIDLIVNQIFILFFSILTLFMILTLVN-----DGKNSLFSILKKRDKEINEDWISIFKYLAIAFLATFVLLVEAFVIIYYLRNRNRSKVQLINFIYCSL---LVIFSTMLFSFALGPYVSVAYLKYIKVPITN--YLKYGVNYYLLPRIIKESIKTPIYIILLSSIISAFDYVFLNIKQINMHKWK 326
>gi|13357890|ref|NP_078164.1| hypothetical protein UU330 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762131|ref|YP_001752412.1| hypothetical protein UPA3_0345 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508788|ref|ZP_02958252.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|11356799|pir||F82904 conserved hypothetical UU330 [imported] - Ureaplasma urealyticum >gi|6899308|gb|AAF30739.1|AE002130_6 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827708|gb|ACA32970.1| putative membrane protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675733|gb|EDT87638.1| putative membrane protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (327 aa)
Score = 341, Expect = 2.7e-30, Identities = 107/286 (37%), Positives = 166/286 (58%)
  Q:    16 LLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNS-----------KWVILSSIIFFAVCMETLALVFFKKFSK-------NFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
            L FLFP YPLK+F ++N I + AVL+A+RL +    I IP F++ IS  W  L+++GW +GP+ G+ +G + D+LA L+S   WFW+YAIQEP++G IA   G    L      P  I   I  Q  +L FS + +++++  V+     +GK+SL   L               K++ ++ +  F + +E   ++++ +          NFI C+L   LV   +++FSF LGP  +  Y K+I   I +  ++KYGV +YL+PR IKESIK PI I +L  +I   +     +K     KWK
  S:    35 FLLFLFPFYPLKLFKTINLIVVFAVLVAIRLGMGFLHIKIPGFNMVISFTWMALMVLGWYFGPLIGIFAGFLVDTLAWLISGGIWFWMYAIQEPIVGFIAGFLGSVATLRKKTKRP--IIDLIVNQIFILFFSILTLFMILTLVN-----DGKNSLFSILKKRDKEINEDWISIFKYLAIAFLATFVLLVEAFVIIYYLRNRNRSKVQLINFIYCSL---LVIFSTMLFSFALGPYVSVAYLKYIKVPITN--YLKYGVNYYLLPRIIKESIKTPIYIILLSSIISAFDYVFLNIKQINMHKWK 326
>gi|188524505|ref|ZP_03004502.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195659665|gb|EDX53045.1| putative membrane protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (327 aa)
Score = 307, Expect = 2.4e-26, Identities = 111/294 (37%), Positives = 170/294 (57%)
  Q:     8 KKEQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNS-----------KWVILSSIIFFAVCMETLALVFF---KKFSK----NFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
           KK++S    L FLFP YPLK+F ++N I + AVL+A+RL +    I IP F++ IS  W  L+++ W +GP+ G+ +G + D+LA L+S   WFW+YAIQEP +G IA   G    L      P  I   I  Q  +L FS + +++++  V+     +GK+SL   L               K++ ++ +  F + +E   ++++   K  SK    NFI C+L   L    +++FSF LGP  +  Y K+I   I +  ++KYGV +YL+PR IKESIK PI I +L  +I   +     +K     KWK
  S:    27 KKQKSFFNFLLFLFPFYPLKLFKTINLIVVFAVLVAIRLGMGFLHIKIPGFNMVISFTWMALMVLSWYFGPLIGIFAGFLVDTLAWLISGGIWFWMYAIQEPAVGFIAGFLGSVVTLRKKTKRP--IIDLIVNQVFILFFSILTLFMILTLVN-----DGKNSLFSILKKRDKEINEDWISIFKYLAIAFLATFVLLVEAFVIIYYLRNKNRSKVQLVNFIYCSL---LAIFSTMLFSFALGPYVSVAYLKYIKVPITN--YLKYGVNYYLLPRIIKESIKTPIYIILLSSIISAFDYVFLNIKQINMHKWK 326
>gi|31544768|ref|NP_853346.1| hypothetical protein MGA_0333 [Mycoplasma gallisepticum R] >gi|31541614|gb|AAP56914.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (306 aa)
Score = 292, Expect = 1.5e-24, Identities = 96/299 (32%), Positives = 166/299 (55%)
  Q:     2 KQIFTIKKEQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKS-TWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIF------FAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKW 300
           KQ+   KK   ++ ++ F  P +PLK+  ++  I+ LA+ IAL++VL  F + I   ++S+ ++W  L +IGWI+GP+  +  G +TD+L+  +     W+WLYA+QEP++   A+LFG  YR+   KN  +  W F+F Q +++ F   CI   IF     +     +  ++FL  N+ +    S++F      FA  +  L  +  +K  ++  +   + +++ ++SI++S VLG IS NE+   I+     P    + +  YLIPR IKE+++ PI I   I LI I+  Y+        L+W
  S:    14 KQLGVTKKSIDRSAIIKFFLPFWPLKLRYNIYLISFLALFIALKIVLGIFVVRIGP-TISLGISWVGLALIGWIFGPVVAIPIGFLTDTLSFFLGGGGIWYWLYAVQEPLIIFTAALFGSIYRI--RKNYASNFWDFVFQQILIVGF---CISGFIF-----LSLYNNADTDRFLVRNNSFGTTLSMVFMALFFVFAELISWLLYLKHRKTKESIKLFLYVSTMMITLSILYSLVLGTISINEF--LINVVHQKPKTRDFILSAYLIPRVIKETLRLPILIICAIALIKISEPYLQNFFNLSRLRW 306
>gi|31544763|ref|NP_853341.1| hypothetical protein MGA_0323 [Mycoplasma gallisepticum R] >gi|31541609|gb|AAP56909.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (338 aa)
Score = 286, Expect = 7.0e-24, Identities = 93/281 (33%), Positives = 154/281 (54%)
  Q:    20 LFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFI-PAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLM-SKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIF------FAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKW 300
             P +PLK+  ++  I+ LA+ IAL++VL  F + I P  SL IS  W  L +IGWI+GP+  +  G +TD+L+  +     W+WLY +QEP++   A+LFG  YR+   KN  +  W F+F Q +++ F   CI   IF     +     +  ++FL  N+ +    S++F      FA  +  L  +  +K  ++  +   + +++ ++SI++S VLG IS NE+   I+     P    + +  YLIPR IKE+++  I I  +I LI I+  Y+        L+W
  S:    64 FLPFWPLKLRYNIYLISFLALFIALKIVLGIFVVRIGPTISLGIS--WVGLALIGWIFGPVVAIPIGFLTDTLSFFLGGGGVWYWLYGVQEPLIIFTAALFGSIYRI--RKNYASNFWDFVFQQILIVGF---CISGFIF-----LSLYNNADTDRFLVRNNSFGTTLSMVFMALFFVFAELISWLLYLKHRKTKESIKLFLYVSTMMITLSILYSLVLGTISINEF--LINVVHQKPKTRDFILSAYLIPRVIKETLRLAILIICVIALIKISEPYLQNFFNLSRLRW 338
>gi|13508187|ref|NP_110136.1| hypothetical protein MPN448 [Mycoplasma pneumoniae M129] >gi|13959706|sp|Q50364|Y448_MYCPN Uncharacterized protein MG313 homolog >gi|11379539|gb|AAG34746.1|AE000038_7 conserved hypothetical protein [Mycoplasma pneumoniae M129] >gi|639789|gb|AAA61696.1| ORF9 [Mycoplasma pneumoniae] (285 aa)
Score = 241, Expect = 1.3e-18, Identities = 81/282 (28%), Positives = 147/282 (52%)
  Q:    20 LFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILL-IFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNS---KWVILSSIIFFAVCMETLALVFFKKFS--KNFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
           +FP YPLK+  ++  +   AVL+AL  +   FSI + +  L +S    P  +IGW++GP++G   G + D++  L    TWFWL+AIQ+PM   +A L    Y++   +++ N    F   Q+IL+  F    + +L++    + +  G  S  +    N    + + +++ I F V +E      + K    K  I+   I+ +   ++++ S ++G +++ EY  F+ +G  S  FVKYG  F+L+PR + +++  P+ + +   LI IA   +        L WK
  S:     1 MFPYYPLKVTRNLQLLVWAAVLMALSFIFNIFSINVTSV-LKVSFTRIPFALIGWMFGPVWGFTFGAIADTMDWLTRGYTWFWLFAIQKPMFCFLAGLVKGVYQV--RQSSTNWKIDFWILQSILIGFFVLTLVLLLMYLTDGNFQAAGNQSFGRGFDVNVHILQGITMAAFISFFVGLEIFLGWKYTKVKKPKEMILNLYILMMALLMTLVVSLLIGTVASIEYLVFL-SGKPSKNFVKYGSYFFLMPRVLVQALLMPLYLALFKPLIRIAENNLRNYLRVYNLSWK 284
>gi|12045169|ref|NP_072980.1| hypothetical protein MG_313 [Mycoplasma genitalium G37] >gi|13959726|sp|Q49414|Y313_MYCGE Uncharacterized protein MG313 >gi|3844890|gb|AAC71535.1| membrane protein, putative [Mycoplasma genitalium G37] >gi|166078879|gb|ABY79497.1| membrane protein, putative [synthetic Mycoplasma genitalium JCVI-1.0] (287 aa)
Score = 228, Expect = 4.2e-17, Identities = 89/282 (31%), Positives = 152/282 (53%)
  Q:    20 LFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICI-YILIFKVSTDIRFEGKSSLEKFLYSNSKWV-----ILSSIIFFAVCMETLALVFFKKFSK-NFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
           +FP YPL++  S+  +   +VL+AL  +   FSI +    LSIS    P  + GWI+GPI+G + G ++D++  L     WFW++A+Q+P+   +A +    Y  L  KN  N    F   QT+L+ F  + +  +L++  + + +  G  + +    S +  V     ++S +IFF V    L  V+ KK +K   ++    + L+  +S++ S +LG I+A E+  FI+NG  S  FV YGV F+L+PR + +++  PI + +   LI I    +    +   L WK
  S:     1 MFPYYPLRLLKSLQLLVWASVLLALTFIFSIFSISVTNV-LSISFLRIPFALFGWIFGPIWGFIFGFLSDTIDWLTKGYVWFWMFALQKPLFAFLAGIVKGIY--LVRKNASNYKVDFWVLQTLLVTFFVVSVTLLLLYLTNNEFQQIGTKNFQTADLSVNVVVLQIITLVSFVIFFLVTEGFLGFVYVKKRNKEQALLTIYSLVLMVLMSVVVSILLGTIAAIEFITFINNGRPSNNFVLYGVYFFLLPRVLVQALLLPIYVALFYPLIGIVENNLKNYLLLFTLSWK 286
>gi|1361473|pir||F64234 cytadherence-accessory protein (hmw1) homolog MG313 - Mycoplasma genitalium (209 aa)
Score = 141, Expect = 5.1e-07, Identities = 61/202 (30%), Positives = 107/202 (52%)
  Q:   100 WFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICI-YILIFKVSTDIRFEGKSSLEKFLYSNSKWVI-----LSSIIFFAVCMETLALVFFKKFSK-NFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
           WFW++A+Q+P+   +A +    Y  L  KN  N    F   QT+L+ F  + +  +L++  + + +  G  + +    S +  V+     +S +IFF V    L  V+ KK +K   ++    + L+  +S++ S +LG I+A E+  FI+NG  S  FV YGV F+L+PR + +++  PI + +   LI I    +    +   L WK
  S:     2 WFWMFALQKPLFAFLAGIVKGIY--LVRKNASNYKVDFWVLQTLLVTFFVVSVTLLLLYLTNNEFQQIGTKNFQTADLSVNVVVLQIITLVSFVIFFLVTEGFLGFVYVKKRNKEQALLTIYSLVLMVLMSVVVSILLGTIAAIEFITFINNGRPSNNFVLYGVYFFLLPRVLVQALLLPIYVALFYPLIGIVENNLKNYLLLFTLSWK 208
>gi|148377729|ref|YP_001256605.1| hypothetical protein MAG4660 [Mycoplasma agalactiae PG2] >gi|148291775|emb|CAL59164.1| Conserved hypothetical protein [Mycoplasma agalactiae PG2] (319 aa)
Score = 118, Expect = 2.1e-04, Identities = 73/282 (25%), Positives = 137/282 (48%)
  Q:    10 EQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSK--STWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKV------STDIRFEG--KSSLEKFLYSNSKWVILSSIIFFAVCMET-LALVFFKKFSKN--FIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQ 291
           E+ +++ +S +  L+      +V  +AI  ++I+L LV      F+   S  I       I+ G I GPI G   G++ D LALL++     W+W Y +   ++  +++++   ++        + I   I    +++   +  IYI    +      ST I F    K   +K +       ++  II+ ++ + T + LV F   SKN  F+   LI S+V  I +I+ ++ GPI   +Y  +I N  +  Y  KY  + + IP  +K  +  PI  +VL  + P+ ++  ++
  S:    26 EKKESKFISNIKALFEKPFRFTVMELAISGLVISLFLVTSSILYFV-GLSKLIKAEILFCILYGIILGPIKGAFLGVIADVLALLLTGRIGLWYWTYQLVPAIIAFLSAIYFALFK-------SSVIARLIIPFVVIISAMATMIYIYTQNIVKLEDGSTGISFANYEKKIKDKTIEYPYLLTLIGIIIYLSLSLVTVITLVSFYLKSKNPKFLDYLLIFSIVTFIQVIYRWIFGPILYIQYRNYIDNK-NWGYADKY--VTFAIPIIVKSMVNIPIYTFVLSAIYPVVSLLCDK 309
>gi|47458916|ref|YP_015778.1| hypothetical protein MMOB0810 [Mycoplasma mobile 163K] >gi|47458244|gb|AAT27567.1| conserved hypothetical protein [Mycoplasma mobile 163K] (302 aa)
Score = 114, Expect = 6.9e-04, Identities = 58/259 (22%), Positives = 119/259 (45%)
  Q:    29 FSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWL--YAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANI 287
           + S+  IA++ +L+ L L++     +       I+  +   I+IG I+GP  G    I  D+ +LL++    FWL  YAI  P++ +I+  F   YR     N  +K++   F  +I+ + S   ++ L + +  +++ +G +    F    +  +I  ++IF  +      +   K   K  I    I++L+  I I   ++ GPI+  EYY         P+ ++       +   +K ++  P+   ++I L+ +  +
  S:    35 YLSIKDIALMGILMGLYLIVAALVNYTLIGVTRINFDYLFFILIGIIFGPFKGAFWAIFADTFSLLLTGRIAFWLIHYAITPPLIAIISYFFFLLYR-----NKNDKLFVIPFSLSIVSLASVFAVFSLGW-IRNNLKIDGLNGQVTFFAILAISLISVTVIFINIFCFLKYIRTGKNIYKRIIY---ILALIIFIKIFARWLWGPIAFIEYYNVFLAKGRVPFTLQRNFPIISLRIILKSALVIPLFTLLIIPLVDVTKL 286
>gi|185179153|ref|ZP_02964867.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|184208935|gb|EDU05978.1| putative membrane protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] (157 aa)
Score = 112, Expect = 1.1e-03, Identities = 45/122 (36%), Positives = 71/122 (58%)
  Q:   180 KWVILSSIIFFAVCMETLALVFF---KKFSK----NFIMCALIISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPIANIYINQLKMSKFLKWK 301
           K++ ++ +  F + +E   ++++   K  SK    NFI C+L   L    +++FSF LGP  +  Y K+I   I +  ++KYGV +YL+PR IKESIK PI I +L  +I   +     +K     KWK
  S:    33 KYLAIAFLATFVLLVEAFVIIYYLRNKNRSKVQLVNFIYCSL---LAIFSTMLFSFALGPYVSVAYLKYIKVPITN--YLKYGVNYYLLPRIIKESIKTPIYIILLSSIISAFDYVFLNIKQINMHKWK 156
>gi|193216893|ref|YP_002000135.1| hypothetical membrane protein [Mycoplasma arthritidis 158L3-1] >gi|193002216|gb|ACF07431.1| hypothetical membrane protein [Mycoplasma arthritidis 158L3-1] (325 aa)
Score = 105, Expect = 7.1e-03, Identities = 69/254 (27%), Positives = 116/254 (45%)
  Q:    31 SVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSL-ALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFF---KKFSKNFIMCALI--ISLVCSISIIFSFVLGPISANEYYKFIHNGIDSPYFVKYGVIFYLIPRAIKESIKAPIQIYVLIVLIPI 284
           +V  IAI  +L+A+ LV   F  ++    L++++ +   II G I GP  G    I+ D+L  ++   STW   YAI   +  LIA L G    L+T+  N   I  FIF   +     +I ++   F     I ++     E+++ S   WV+ S  +        ++LV F   K F+K +        +  +  I I+  ++ GP +   Y+    NG    Y  +Y  I  ++P   K  I  PI  + +  ++PI
  S:    59 TVFEIAIYGILLAIYLVASMFEKYVFTGPLNVNITYAVFIIFGLILGPWRGAFLCILCDTLNQVIFGISTWMLEYAI---VPVLIAFLSGALMNLMTSGKNKTWIVGFIFLAVL-----TIFLFAFFFNYHDKIVWKRVKKQEQYVSSMIIWVVSSICLGIFWIAGFISLVIFLKTKNFAKKYRAQTFFAVLITILIIVILMRWLWGPFAYITYFNRFRNG-SWKYSERYFTI--MVPIIFKSLIAMPIYSFAVFAIMPI 307
>gi|168144722|ref|ZP_02587951.1| hypothetical protein BcerG_30460 [Bacillus cereus G9842] (84 aa)
Score = 98, Expect = 4.9e-02, Identities = 24/49 (48%), Positives = 33/49 (67%)
  Q:    16 LLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISL 64
            L FLFP YPLK+F ++N I + AVL+A+RL +    I IP F++ IS 
  S:    35 FLLFLFPFYPLKLFKTINLIVVFAVLVAIRLGMGFLHIKIPGFNMVISF 83
>gi|184154421|ref|YP_001842762.1| hypothetical protein LAR_1766 [Lactobacillus reuteri F275] >gi|183225765|dbj|BAG26282.1| conserved hypothetical protein [Lactobacillus reuteri F275] (205 aa)
Score = 95, Expect = 8.7e-02, Identities = 44/137 (32%), Positives = 70/137 (51%)
  Q:     8 KKEQSKNRLLSFLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTD--SLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTIL 144
           K+E      LSF  P +  K      ++ + A+LIAL+++L K SI  PA  L  S  +    +IG+  GP  G  S +V+D  S  +L S S +F  + +   + G+IA +F Y  R+     +  +I  + FFQ +L
  S:    14 KREWIDMSTLSFAGPRFTTK------NLTLAAMLIALQVILNKLSIGDPAV-LKFSFGFIATALIGYCLGPWIGGWSMVVSDIISNTILNSGSLFFPGFTLSAFIAGVIAGMFLYQQRI-----SWQRILIYEFFQILL 140
>gi|149187476|ref|ZP_01865774.1| Permease of the major facilitator superfamily protein [Vibrio shilonii AK1] >gi|148839012|gb|EDL55951.1| Permease of the major facilitator superfamily protein [Vibrio shilonii AK1] (495 aa)
Score = 94, Expect = 1.2e-01, Identities = 26/72 (36%), Positives = 39/72 (54%)
  Q:    72 IGWIYGPIFG-LVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTI 143
           IG + GPI G +V G++TD+L        W W++ +  P  GL+ +   Y Y  L+NK+ PN  W  I F  +
  S:   143 IGILLGPILGPVVGGVITDNL-------NWRWIFYVNLP-FGLVCTALIYKYIHLSNKSKPNFDWWIIGFMAL 207
>gi|15828726|ref|NP_326086.1| hypothetical protein MYPU_2550 [Mycoplasma pulmonis UAB CTIP] >gi|14089668|emb|CAC13428.1| conserved hypothetical protein [Mycoplasma pulmonis] (324 aa)
Score = 93, Expect = 1.5e-01, Identities = 32/98 (32%), Positives = 53/98 (54%)
  Q:    22 PLYPLKIFSSVNSIAILAVLIALRLVLQKF-SIFIPAFSL---SISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFG 119
           PL   K + ++  I  +++LIA+ +V     +  IP  SL    IS    P+ I G+I+GPI GL  G++TD +++L   S +   Y +   + G I  + G
  S:    11 PLVVFKKYWTIKKITFVSILIAISVVFAILGATIIPITSLPTYKISFTGLPVKISGYIFGPIIGLFVGLLTDLISILFLPSYYHPYYTLASGINGFIPGIVG 112
>gi|167750254|ref|ZP_02422381.1| hypothetical protein EUBSIR_01228 [Eubacterium siraeum DSM 15702] >gi|167656816|gb|EDS00946.1| hypothetical protein EUBSIR_01228 [Eubacterium siraeum DSM 15702] (208 aa)
Score = 93, Expect = 1.5e-01, Identities = 24/73 (32%), Positives = 43/73 (58%)
  Q:    29 FSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWF 101
             S+  + + A+LI + + L KF + +P+ +L IS A+  L  IG +YGP+   ++G+VTD +  L+  +  F
  S:    14 LKSIRCLTVTALLIGVSVAL-KFVMIMPSETLKISFAFVGLAAIGMLYGPVVAGLAGVVTDVIGFLVKPTGAF 85
>gi|71894017|ref|YP_279463.1| hypothetical protein MHJ_0669 [Mycoplasma hyopneumoniae J] >gi|71852144|gb|AAZ44752.1| conserved hypothetical protein [Mycoplasma hyopneumoniae J] (321 aa)
Score = 93, Expect = 1.6e-01, Identities = 29/85 (34%), Positives = 48/85 (56%)
  Q:    34 SIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLF 118
           SIA++ ++I +RL    F+I +P F LSI     P+ I G+I+GPI G ++G++ D +  L     + W Y +   + G I  +F
  S:    17 SIAVIMLIIGVRLA--PFAI-LPNFRLSI--IGLPIKITGFIFGPIVGFLTGLLADLITFLFIPGVYSWYYTLHLSLAGFIPGIF 96
>gi|54020303|ref|YP_116199.1| hypothetical protein mhp692 [Mycoplasma hyopneumoniae 232] >gi|53987476|gb|AAV27677.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (321 aa)
Score = 93, Expect = 1.7e-01, Identities = 29/85 (34%), Positives = 48/85 (56%)
  Q:    34 SIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLF 118
           SIA++ ++I +RL    F+I +P F LSI     P+ I G+I+GPI G ++G++ D +  L     + W Y +   + G I  +F
  S:    17 SIAVIMLIIGVRLA--PFAI-LPNFRLSI--IGLPIKITGFIFGPIVGFLTGLLADLITFLFIPGVYSWYYTLHLSLAGFIPGIF 96
>gi|72080997|ref|YP_288055.1| hypothetical protein MHP7448_0670 [Mycoplasma hyopneumoniae 7448] >gi|71914121|gb|AAZ54032.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 7448] (321 aa)
Score = 93, Expect = 1.7e-01, Identities = 29/85 (34%), Positives = 48/85 (56%)
  Q:    34 SIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLF 118
           SIA++ ++I +RL    F+I +P F LSI     P+ I G+I+GPI G ++G++ D +  L     + W Y +   + G I  +F
  S:    17 SIAVIMLIIGVRLA--PFAI-LPNFRLSI--IGLPIKITGFIFGPIVGFLTGLLADLITFLFIPGVYSWYYTLHLSLAGFIPGIF 96
>gi|168485603|ref|ZP_02710111.1| protein YdcD [Streptococcus pneumoniae CDC1087-00] >gi|183571270|gb|EDT91798.1| protein YdcD [Streptococcus pneumoniae CDC1087-00] (182 aa)
Score = 92, Expect = 2.1e-01, Identities = 24/100 (24%), Positives = 52/100 (52%)
  Q:    26 LKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLL 125
           ++I  ++  +  + +  AL +V+  F+I  P  + SI L +    ++  I+GPI GL+ G++  ++   ++    +W + I   + GL+  LF    R++
  S:     1 MEIKFTIKQVVAVGIGAALFVVIGMFNIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVGLIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVI 100
>gi|156042728|ref|XP_001587921.1| hypothetical protein SS1G_11163 [Sclerotinia sclerotiorum 1980] >gi|154695548|gb|EDN95286.1| hypothetical protein SS1G_11163 [Sclerotinia sclerotiorum 1980] (229 aa)
Score = 92, Expect = 2.1e-01, Identities = 33/96 (34%), Positives = 51/96 (53%)
  Q:    23 LYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPL---IIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLF 118
           L PLKIFS +  + +L  +I   L+L    +    FSL + L+W  L     +GW+ G ++ L S I   SL LL+S+S     +A+    L L+ + F
  S:    16 LPPLKIFSQILILQVLWYVIGTALILFTALVAGRPFSLDMVLSWRSLRGDTTVGWMLGFVWMLNSFIGVISLLLLVSRSKLIPDFALTIHFLHLLITSF 114
>gi|169351233|ref|ZP_02868171.1| hypothetical protein CLOSPI_02012 [Clostridium spiroforme DSM 1552] >gi|169292295|gb|EDS74428.1| hypothetical protein CLOSPI_02012 [Clostridium spiroforme DSM 1552] (264 aa)
Score = 92, Expect = 2.2e-01, Identities = 29/85 (34%), Positives = 54/85 (63%)
  Q:    19 FLFPLYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAF---SLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWL 103
           F+F  YP+K  S   S+ + A+L+ L +VL++FSI IP F   SL IS+   P+++ G +  P +  + G+  D + L+++ +++ +L
  S:    16 FVFWKYPIK--SDTKSLTLAALLVILAVVLKRFSIMIPLFGFESLKISVEVIPMLLAGVLLAPGYCFIIGLAIDWVGLIIAPTSFPFL 101
>gi|148545088|ref|YP_001272458.1| hypothetical protein Lreu_1884 [Lactobacillus reuteri F275] >gi|148532122|gb|ABQ84121.1| hypothetical protein Lreu_1884 [Lactobacillus reuteri F275] (186 aa)
Score = 91, Expect = 2.6e-01, Identities = 37/114 (32%), Positives = 62/114 (54%)
  Q:    31 SVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTD--SLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTIL 144
           +  ++ + A+LIAL+++L K SI  PA  L  S  +    +IG+  GP  G  S +V+D  S  +L S S +F  + +   + G+IA +F Y  R+     +  +I  + FFQ +L
  S:    12 TTKNLTLAAMLIALQVILNKLSIGDPAV-LKFSFGFIATALIGYCLGPWIGGWSMVVSDIISNTILNSGSLFFPGFTLSAFIAGVIAGMFLYQQRI-----SWQRILIYEFFQILL 121
>gi|68464775|ref|XP_723465.1| potential MFS-MDR transporter [Candida albicans SC5314] >gi|46445499|gb|EAL04767.1| potential MFS-MDR transporter [Candida albicans SC5314] (620 aa)
Score = 91, Expect = 2.8e-01, Identities = 37/150 (24%), Positives = 67/150 (44%)
  Q:    96 SKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNK-NNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFS-FVLGPISANEYYKFIHNG 245
           SK TW W + I  P+ G    +F YA+R    K N   ++  F +F T LLI  S+ + + I   ++D  ++  + +  F        +L  ++  A  +        +  S   +    II+   +IS IFS F++  I    Y++ + + 
  S:   226 SKVTWRWAFYINLPIGGFATLVFLYAFRPPRPKVNVKQQLKQFDYFGTFLLIAGSVILLLAITFGTSDFPWDSAAVISCF--------VLGPVLLIAFVVWNFGFSKNQVISTEIVKVPQIIASTLAISGIFSAFIMFMIYGAIYFQVVKDA 369
>gi|68465154|ref|XP_723276.1| potential MFS-MDR transporter [Candida albicans SC5314] >gi|46445303|gb|EAL04572.1| potential MFS-MDR transporter [Candida albicans SC5314] (620 aa)
Score = 91, Expect = 2.8e-01, Identities = 37/150 (24%), Positives = 67/150 (44%)
  Q:    96 SKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNK-NNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFS-FVLGPISANEYYKFIHNG 245
           SK TW W + I  P+ G    +F YA+R    K N   ++  F +F T LLI  S+ + + I   ++D  ++  + +  F        +L  ++  A  +        +  S   +    II+   +IS IFS F++  I    Y++ + + 
  S:   226 SKVTWRWAFYINLPIGGFATLVFLYAFRPPRPKVNVKQQLKQFDYFGTFLLIAGSVILLLAITFGTSDFPWDSAAVISCF--------VLGPVLLIAFVVWNFGFSKNQVISTEIVKVPQIIASTLAISGIFSAFIMFMIYGAIYFQVVKDA 369
>gi|83319841|ref|YP_424725.1| hypothetical protein MCAP_0776 [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283727|gb|ABC01659.1| membrane protein, putative [Mycoplasma capricolum subsp. capricolum ATCC 27343] (224 aa)
Score = 91, Expect = 3.2e-01, Identities = 38/152 (25%), Positives = 73/152 (48%)
  Q:    24 YPLKIFSSVNSIAILAVLIALRLVLQKF--SIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLA-LLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFL 175
           + LK F+ + +I I+  L+AL ++L       F+      I+L +    +IG ++GP+ G+++GI TD +  +++  + W   +   + MLG + SL      +   KNN + +W  ++   I L      ++ + F            SL KF+
  S:    33 FKLKTFT-IKNITIIGTLVALSVILSYVVNRNFLQILGTRITLGYFVNFLIGMVFGPLAGILAGIATDLIGTMIVGAAQWHIGFVFAKSMLGFLGSL------VFIFKNNKHWVWLMVWSYAIGLFLVIFVVHPISFATVGGPSLAVAYSLTKFI 180
>gi|145252284|ref|XP_001397655.1| hypothetical protein An16g03420 [Aspergillus niger] >gi|134083203|emb|CAK42841.1| unnamed protein product [Aspergillus niger] (220 aa)
Score = 89, Expect = 5.0e-01, Identities = 30/94 (31%), Positives = 48/94 (51%)
  Q:    23 LYPLKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPL---IIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIAS 116
           L PLKI   +  + +   + A  L+L    ++   FSL +  +W  L     IGW+ G ++ L SGI    L LL+++S     +A+    L LIA+
  S:    16 LPPLKIVRKILLLQVAYYVTATALILFTTVVYGTPFSLDLVFSWNALRGDTTIGWMLGLVWLLTSGIGVIFLLLLVARSKLIPDFALTLHFLHLIAT 112
>gi|193216446|ref|YP_001999688.1| conserved hypothetical membrane protein [Mycoplasma arthritidis 158L3-1] >gi|193001769|gb|ACF06984.1| conserved hypothetical membrane protein [Mycoplasma arthritidis 158L3-1] (335 aa)
Score = 88, Expect = 6.3e-01, Identities = 26/88 (29%), Positives = 48/88 (54%)
  Q:    35 IAILAVLIALRLVLQKFSIFIPAFS----LSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAY 122
           IA + VLIA+ +V    S+ I   S       S    P+ I G+I+GPI G+++GI+ D ++  +  + + +LY +   + G +  +  Y +
  S:    32 IAFVGVLIAISVVFFLISVRILPISALPSFKFSFIGLPIKITGFIFGPIVGMITGILADLISFALVPTYYHFLYTLAVAVSGFVPGICAYYF 123
>gi|42519580|ref|NP_965510.1| hypothetical protein LJ1703 [Lactobacillus johnsonii NCC 533] >gi|81667547|sp|Q74I63|Y1703_LACJO UPF0397 protein LJ_1703 >gi|41583869|gb|AAS09476.1| hypothetical protein LJ_1703 [Lactobacillus johnsonii NCC 533] (185 aa)
Score = 88, Expect = 6.4e-01, Identities = 34/122 (27%), Positives = 59/122 (48%)
  Q:    31 SVNSIAILAVLIALRLVLQKF-SIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLA-LLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTILLIFSSICI 152
           SV S+  + +  A+ ++L +F SI     + +I + +  L ++  IYGP+ G   G +  +L+  LM   TW W + +   +LGLI  L+G    L        ++  F   Q I  + S + I
  S:     8 SVKSVVAIGIGAAIYVILARFTSIPTGIPNTNIEIVYPFLALLATIYGPVVGFSVGFIGHALSDFLMYGQTW-WSWVLATAVLGLIIGLYGMRLDLENGVFTTKQMIGFNIVQIIANVVSWLII 130
>gi|153809917|ref|ZP_01962585.1| hypothetical protein RUMOBE_00298 [Ruminococcus obeum ATCC 29174] >gi|149834095|gb|EDM89175.1| hypothetical protein RUMOBE_00298 [Ruminococcus obeum ATCC 29174] (195 aa)
Score = 88, Expect = 6.5e-01, Identities = 29/118 (24%), Positives = 57/118 (48%)
  Q:    26 LKIFSSVNSIAILAVLIALRLVLQKF-SIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTI 143
           +K  SS+ ++  + +  AL  VL +F +I  P  + +ISL +  L ++  +YGP+ G + G +  +L  L    + +W + I    +G++  LF     +   +    K+  F+    I
  S:    13 MKNNSSIKTVVAVGIGAALFFVLGRFVAIPSPVPNTNISLQYAVLALLATMYGPVAGGLIGFIGHALIDLSWGGSPWWSWVITSAFVGVVIGLFAKKLDVQEGEFGKGKVAVFVVANVI 131
>gi|149246966|ref|XP_001527908.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] >gi|146447862|gb|EDK42250.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL YB-4239] (617 aa)
Score = 88, Expect = 6.6e-01, Identities = 37/147 (25%), Positives = 66/147 (44%)
  Q:    99 TWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNP-NKIWSFIFFQTILLIFSSICIYILIFKVSTDIRFEGKSSLEKFLYSNSKWVILSSIIFFAVCMETLALVFFKKFSKNFIMCALIISLVCSISIIFS-FVLGPISANEYYKFIHNG 245
           TW W + I  P+ GL   +F Y++R  T K N   ++  F +F T LLI   +   + +   S+D  ++  + +  F        +L  I+    C+        +  + + IM   II+    I+ IF+ F+   I A  Y++ I + 
  S:   219 TWRWAFYINLPVGGLALVVFLYSFRPPTPKGNYFQQLKEFDYFGTFLLIAGCVLFLLALTFGSSDFSWDSGAVISCF--------VLGPILIICFCIWNFRFSKNQVIATDVIMTPQIIASSFGIAGIFTAFISVMIYAAVYFQVIRDA 359
>gi|116493189|ref|YP_804924.1| hypothetical protein PEPE_1451 [Pediococcus pentosaceus ATCC 25745] >gi|116103339|gb|ABJ68482.1| hypothetical protein PEPE_1451 [Pediococcus pentosaceus ATCC 25745] (184 aa)
Score = 88, Expect = 7.0e-01, Identities = 29/98 (29%), Positives = 57/98 (58%)
  Q:    23 LYPLKIFSSVNSIAILAVLIALRLVLQKFSI--FIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSK-STWFWLYAIQEPMLGLIASLFGY 120
            + +K   SV ++ I+A+L AL +VL +++     P F+L +S  + P  ++  ++GP  G+V G+V+D++    +    +  ++AI   +  LI S+F Y
  S:     4 FFSIKNVFSVRNLTIMALLAALDVVLARYTTIHLTPQFTL-VSFEYIPAAVVSALFGPWAGIVFGLVSDTVGYFSNPVGPYLPIWAISAMVANLIQSIFLY 103
>gi|168482728|ref|ZP_02707680.1| protein YdcD [Streptococcus pneumoniae CDC1873-00] >gi|169833418|ref|YP_001693985.1| protein YdcD [Streptococcus pneumoniae Hungary19A-6] >gi|168995920|gb|ACA36532.1| protein YdcD [Streptococcus pneumoniae Hungary19A-6] >gi|172043846|gb|EDT51892.1| protein YdcD [Streptococcus pneumoniae CDC1873-00] (182 aa)
Score = 88, Expect = 7.2e-01, Identities = 23/100 (23%), Positives = 51/100 (51%)
  Q:    26 LKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLL 125
           ++I  ++  +  + +  AL +V+   +I  P  + SI L +    ++  I+GPI GL+ G++  ++   ++    +W + I   + GL+  LF    R++
  S:     1 MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVGVIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVI 100
>gi|149003698|ref|ZP_01828543.1| hypothetical protein CGSSp14BS69_13610 [Streptococcus pneumoniae SP14-BS69] >gi|147758260|gb|EDK65261.1| hypothetical protein CGSSp14BS69_13610 [Streptococcus pneumoniae SP14-BS69] (182 aa)
Score = 88, Expect = 7.3e-01, Identities = 26/118 (22%), Positives = 57/118 (48%)
  Q:    26 LKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTI 143
           ++I  ++  +  + +  AL +V+   +I  P  + SI L +    ++  I+GPI GL+ G++  ++   ++    +W + I   + GL+  LF    R++ +  +   I  F   Q +
  S:     1 MEIKFTIKQVVAVGIGAALFIVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVGLIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVINSVFDWKDILIFNLIQLL 118
>gi|194467332|ref|ZP_03073319.1| conserved hypothetical membrane spanning protein [Lactobacillus reuteri 100-23] >gi|194454368|gb|EDX43265.1| conserved hypothetical membrane spanning protein [Lactobacillus reuteri 100-23] (186 aa)
Score = 87, Expect = 7.9e-01, Identities = 38/125 (30%), Positives = 71/125 (56%)
  Q:    31 SVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTD--SLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTIL--LIFSSICIYIL 155
           +  ++ + A+L+AL+++L K SI  PA  L  S  +    +IG+  GP  G  S +V+D  S  +L S S +F  + +   + G+IA +F Y  R+     +  +I  + FFQ +L  +I +++ +Y++
  S:    12 TTKNLTLSAMLVALQVILNKLSIGDPAV-LKFSFGFIATALIGYCLGPWIGGWSMVVSDIISNTILNSGSLFFPGFTLSAFIAGVIAGMFLYQQRI-----SWQRILIYEFFQILLTNVIGTTLWLYLM 134
>gi|149025473|ref|ZP_01836409.1| hypothetical protein CGSSp23BS72_01854 [Streptococcus pneumoniae SP23-BS72] >gi|168492648|ref|ZP_02716791.1| protein YdcD [Streptococcus pneumoniae CDC3059-06] >gi|147929423|gb|EDK80419.1| hypothetical protein CGSSp23BS72_01854 [Streptococcus pneumoniae SP23-BS72] >gi|183576888|gb|EDT97416.1| protein YdcD [Streptococcus pneumoniae CDC3059-06] (182 aa)
Score = 87, Expect = 8.8e-01, Identities = 26/118 (22%), Positives = 57/118 (48%)
  Q:    26 LKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTI 143
           ++I  ++  +  + +  AL +V+   +I  P  + SI L +    ++  I+GPI GL+ G++  ++   ++    +W + I   + GL+  LF    R++ +  +   I  F   Q +
  S:     1 MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVGLIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVINSVFDWKDILIFNLIQLL 118
>gi|27366625|ref|NP_762152.1| major facilitator superfamily permease [Vibrio vulnificus CMCP6] >gi|27358191|gb|AAO07142.1|AE016808_162 Permease of the major facilitator superfamily [Vibrio vulnificus CMCP6] (495 aa)
Score = 87, Expect = 8.9e-01, Identities = 24/72 (33%), Positives = 38/72 (52%)
  Q:    72 IGWIYGPIFG-LVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTI 143
           IG + GPI G +V GI+TD++        W W++ +  P  GL+ +   Y Y  ++NK  PN  W  I +  +
  S:   143 IGILLGPILGPVVGGIITDNI-------NWRWIFYVNLP-FGLVCATLIYRYIHISNKTKPNFDWWIIGYMAL 207
>gi|116630121|ref|YP_815293.1| hypothetical protein LGAS_1499 [Lactobacillus gasseri ATCC 33323] >gi|122272942|sp|Q041L7|Y1499_LACGA UPF0397 protein LGAS_1499 >gi|116095703|gb|ABJ60855.1| Predicted membrane protein [Lactobacillus gasseri ATCC 33323] (185 aa)
Score = 87, Expect = 9.4e-01, Identities = 28/89 (31%), Positives = 48/89 (53%)
  Q:    31 SVNSIAILAVLIALRLVLQKF-SIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLA-LLMSKSTWFWLYAIQEPMLGLIASLFG 119
           SV S+  + +  A+ ++L +F SI     + +I + +  L ++  IYGP+ G   G +  +L   LM   TW W + +   +LGLI  L+G
  S:     8 SVKSVVAIGIGAAIYVILARFTSIPTGIPNTNIEIVYPFLALLATIYGPVVGFSVGFIGHALGDFLMYGQTW-WSWVLATAVLGLIIGLYG 97
>gi|37676339|ref|NP_936735.1| permease [Vibrio vulnificus YJ016] >gi|37200881|dbj|BAC96705.1| permease [Vibrio vulnificus YJ016] (495 aa)
Score = 87, Expect = 9.5e-01, Identities = 24/72 (33%), Positives = 38/72 (52%)
  Q:    72 IGWIYGPIFG-LVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTI 143
           IG + GPI G +V GI+TD++        W W++ +  P  GL+ +   Y Y  ++NK  PN  W  I +  +
  S:   143 IGILLGPILGPVVGGIITDNI-------NWRWIFYVNLP-FGLVCATLIYRYIHISNKTKPNFDWWIIGYMAL 207
>gi|163803861|ref|ZP_02197707.1| permease [Vibrio campbellii AND4] >gi|159172336|gb|EDP57217.1| permease [Vibrio campbellii AND4] (495 aa)
Score = 86, Expect = 9.6e-01, Identities = 24/72 (33%), Positives = 38/72 (52%)
  Q:    72 IGWIYGPIFG-LVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLLTNKNNPNKIWSFIFFQTI 143
           IG + GPI G +V G++TD++        W W++ I  P  GL+ +   Y Y  ++NK  PN  W  I +  +
  S:   143 IGILLGPILGPVVGGVITDNI-------DWRWIFYINLP-FGLVCTALIYRYIHISNKTKPNFDWWIIGYMAL 207
>gi|148993526|ref|ZP_01823017.1| hypothetical protein CGSSp9BS68_08052 [Streptococcus pneumoniae SP9-BS68] >gi|149012639|ref|ZP_01833636.1| hypothetical protein CGSSp19BS75_10433 [Streptococcus pneumoniae SP19-BS75] >gi|168488171|ref|ZP_02712370.1| conserved hypothetical protein [Streptococcus pneumoniae SP195] >gi|168490620|ref|ZP_02714763.1| protein YdcD [Streptococcus pneumoniae CDC0288-04] >gi|182683433|ref|YP_001835180.1| hypothetical protein SPCG_0463 [Streptococcus pneumoniae CGSP14] >gi|147763444|gb|EDK70381.1| hypothetical protein CGSSp19BS75_10433 [Streptococcus pneumoniae SP19-BS75] >gi|147927895|gb|EDK78916.1| hypothetical protein CGSSp9BS68_08052 [Streptococcus pneumoniae SP9-BS68] >gi|182628767|gb|ACB89715.1| hypothetical protein SPCG_0463 [Streptococcus pneumoniae CGSP14] >gi|183573048|gb|EDT93576.1| conserved hypothetical protein [Streptococcus pneumoniae SP195] >gi|183574937|gb|EDT95465.1| protein YdcD [Streptococcus pneumoniae CDC0288-04] (182 aa)
Score = 86, Expect = 1.0e+00, Identities = 23/100 (23%), Positives = 51/100 (51%)
  Q:    26 LKIFSSVNSIAILAVLIALRLVLQKFSIFIPAFSLSISLAWTPLIIIGWIYGPIFGLVSGIVTDSLALLMSKSTWFWLYAIQEPMLGLIASLFGYAYRLL 125
           ++I  ++  +  + +  AL +V+   +I  P  + SI L +    ++  I+GPI GL+ G++  ++   ++    +W + I   + GL+  LF    R++
  S:     1 MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVGLIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVI 100