>gi|26553930|ref|NP_757864.1| ATP/GTP-binding protein [Mycoplasma penetrans HF-2] >gi|26453938|dbj|BAC44268.1| hypothetical ATP/GTP-binding protein [Mycoplasma penetrans HF-2] (407 aa)
Score = 1882, Expect = 0.0e+00, Identities = 407/407 (100%), Positives = 407/407 (100%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKENN 407
           MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKENN
  S:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKENN 407
>gi|160936294|ref|ZP_02083664.1| hypothetical protein CLOBOL_01187 [Clostridium bolteae ATCC BAA-613] >gi|158440763|gb|EDP18494.1| hypothetical protein CLOBOL_01187 [Clostridium bolteae ATCC BAA-613] (675 aa)
Score = 446, Expect = 3.3e-42, Identities = 123/317 (38%), Positives = 186/317 (58%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK-------------NWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSL---FYADEKEYKQVSHK---SIVRFNINQSIIDNISSSKGSNTLRKL---GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT--KQDINKTIAKDIC 317
           MM  RL+ AK LL +DG+IFISIDDNEQ  L  L D++FG +N I  I+ +K+NA+ND   I+KNHE+IL Y K             + K       +E + +   L        E G L  R N+G+T+Y+NP T +KI + DY+    +  +    +Y  D E++ KG+V IRPP   G L  W+W+ +K   + ++II       Y++    +  +++   V  K   +      ++SI+D  S++ G+NTL  +      F NPK +E+IK+LI   ++++ I+LDFF+GS TT HAVM+ N++    G R+FI+    E T  K D  K   K IC
  S:   180 MMYPRLRLAKDLLTEDGVIFISIDDNEQCNLVKLCDEVFGAENCIGPIIQNKQNAKNDTVNIQKNHEFILVYRKSSNSINGSIAATLSRKVITYRNAYEDDGRFYYLNDPITTRGEGGTLNARPNLGYTVYYNPETKDKIAVADYNVTLAKTSNDEGEIYTTDNELLCKGYVAIRPPRVRGKLGCWTWALEKFNAQKDEIIITGKPGSYAVRKRTFVKKEDIVTVDGKMQYTASSMTNSRSILD-FSTNDGTNTLNTVLGKNAVFSNPKNLEMIKYLIQLVADKSFIVLDFFSGSATTAHAVMQANAE--DGGKRRFIMVQISEETEDKSDAYKAGYKTIC 517
>gi|13358040|ref|NP_078314.1| adenine specific DNA methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762184|ref|YP_001752561.1| DNA methylase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11356738|pir||A82886 adenine specific DNA methyltransferase UU477 [imported] - Ureaplasma urealyticum >gi|6899472|gb|AAF30889.1|AE002144_3 adenine specific DNA methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827761|gb|ACA33023.1| DNA methylase [Ureaplasma parvum serovar 3 str. ATCC 27815] (360 aa)
Score = 436, Expect = 4.3e-41, Identities = 150/405 (37%), Positives = 216/405 (53%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVN----RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGE-SFNNLSVDE--LKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRD--FDINNESIIKQLYSLFTLEKE 405
           MM+ERLK AK LLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF++N +W K++    NK I + HEYIL YSKN  NF ++   E NKK    I+     N +   +N    R N G                  D K   R+   E+L K+DKE                   +W+   D     +     +  K+  +  + DE++    +  SI++     + +  I +  G+N +  L I+F NPKP++LI  L++ HSN+NA +LDFFAGSGTTGHAV+ELN +    GNR F L TN E         I  ++C+ERLY +   I T  E  F+ +S ++  L K     LK F+ N  +V  NS I K+  ++        +   F+ N   ++  L +L  +EK+
  S:     1 MMNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFVTNFIWQKKSGGGLNKLIYEGHEYILCYSKNNYNFCLS---EKNKKMSGFIKYK-DKNNNSFFINSDIIRNNFG----------------KKDNKFEHRNKAYEDLSKEDKE-------------------KWNLKLDNKNYILVPFKKEPGKHLVAKIFNDERK----TTYSIIKLPF--TFVSGIWTKDGNNEVDSLNIDFQNPKPIQLIMHLLDLHSNKNARVLDFFAGSGTTGHAVLELNKE--DGGNRTFTLITNNE-------NQIGTNVCYERLYRINNGIGTKNEIDFDWVSKNKPYLNKLNVYDLKYFDTNPIEVD-NSKIKKVFAKMLVDFNNTSQSSLFENNQRELLINLSTLKPIEKK 359
>gi|188524337|ref|ZP_03004371.1| adenine specific DNA methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660179|gb|EDX53559.1| adenine specific DNA methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (529 aa)
Score = 435, Expect = 5.8e-41, Identities = 146/391 (37%), Positives = 211/391 (53%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVN----RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES-FNNLSVDE--LKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNES 391
           MM+ERLK AK LLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF++N +W K++    NK I + HEYIL YSKN  NF ++   E NKK    I+     N +   +N    R N G                  D K   R+   E+L K+DKE                   +W+   D     +     +  K+  +  + DE++    +  SI++     + +  I +  G+N +  L I+F NPKP++LI  L++ HSN+NA +LDFFAGSGTTGHAV+ELN +    GNR F L TN E         I  ++C+ERLY +   + T  E+ F+ ++ +E  L       LK FN N   + I++N      EIK++   +  DF+  ++S
  S:   170 MMNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFVTNFIWQKKSGGGLNKLIYEGHEYILCYSKNNYNFCLS---EKNKKMSGFIKYK-DKNNNSFFINSDIIRNNFG----------------KKDNKFEHRNKAYEDLSKEDKE-------------------KWNLKLDNKNYILVPFKKEPGKHLVAKIFNDERK----TTYSIIKLPF--TFVSGIWTKDGNNEVDSLNIDFQNPKPIQLIMHLLDLHSNKNARVLDFFAGSGTTGHAVLELNKE--DGGNRTFTLVTNNE-------NQIGTNVCYERLYRINNGVGTKNEADFDWINKNEAYLNNLNVYDLKYFNTN--PIKIDNN------EIKEAFTKMLVDFNNTSQS 505
>gi|188530696|ref|ZP_02546261.2| DNA methylase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] (359 aa)
Score = 425, Expect = 8.5e-40, Identities = 145/390 (37%), Positives = 210/390 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVN----RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES-FNNLSVDE--LKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNES 391
           M+ERLK AK LLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF++N +W K++    NK I + HEYIL YSKN  NF ++   E NKK    I+     N +   +N    R N G                  D K   R+   E+L K+DKE                   +W+   D     +     +  K+  +  + DE++    +  SI++     + +  I +  G+N +  L I+F NPKP++LI  L++ HSN+NA +LDFFAGSGTTGHAV+ELN +    GNR F L TN E         I  ++C+ERLY +   + T  E+ F+ ++ +E  L       LK FN N   + I++N      EIK++   +  DF+  ++S
  S:     1 MNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFVTNFIWQKKSGGGLNKLIYEGHEYILCYSKNNYNFCLS---EKNKKMSGFIKYK-DKNNNSFFINSDIIRNNFG----------------KKDNKFEHRNKAYEDLSKEDKE-------------------KWNLKLDNKNYILVPFKKEPGKHLVAKIFNDERK----TTYSIIKLPF--TFVSGIWTKDGNNEVDSLNIDFQNPKPIQLIMHLLDLHSNKNARVLDFFAGSGTTGHAVLELNKE--DGGNRTFTLVTNNE-------NQIGTNVCYERLYRINNGVGTKNEADFDWINKNEAYLNNLNVYDLKYFNTN--PIKIDNN------EIKEAFTKMLVDFNNTSQS 335
>gi|188592767|ref|ZP_02694776.2| DNA methylase [Ureaplasma urealyticum serovar 10] (359 aa)
Score = 424, Expect = 1.2e-39, Identities = 143/390 (36%), Positives = 205/390 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVN----RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES---FNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNES 391
           M+ERLK AK LLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF++N +W K++    NK I + HEYIL YSKN  NF ++   E NKK    I+     N +   +N    R N G                  D K   R+   E+L K+DKE                   +W+   D     +     +  K+  +  + DE++    +  SI++     + +  I +  G+N +  L I+F NPKP++LI  L++ HSN+NA +LDFFAGSGTTGHAV+ELN +    GNR F L TN E         I  ++C+ERLY +   + T  E+   + N +   L       LK FN N  ++  N        EIK++   +  DF+  ++S
  S:     1 MNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFVTNFIWQKKSGGGLNKLIYEGHEYILCYSKNNYNFCLS---EKNKKMSGFIKYK-DKNNNSFFINSDIIRNNFG----------------KKDNKFEHRNKAYEDLSKEDKE-------------------KWNLKLDNKNYILVPFKKEPGKHLVAKIFNDERK----TTYSIIKLPF--TFVSGIWTKDGNNEVDSLNIDFQNPKPIQLIMHLLDLHSNKNARVLDFFAGSGTTGHAVLELNKE--DGGNRTFTLITNNE-------NQIGTNVCYERLYRINNGVGTKNEADFDWINKNKPYLNNLNVYDLKYFNTNPIEIDNN--------EIKEAFTKMLVDFNNTSQS 335
>gi|15828951|ref|NP_326311.1| type III restriction-modification system: methylase [Mycoplasma pulmonis UAB CTIP] >gi|14089894|emb|CAC13653.1| TYPE III RESTRICTION-MODIFICATION SYSTEM: METHYLASE [Mycoplasma pulmonis] (587 aa)
Score = 409, Expect = 6.6e-38, Identities = 153/403 (37%), Positives = 227/403 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-----KYIEKNHEYILAYSK-------------NWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL---------YKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSI--IDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSIN----SNIDKLLEEIKKSMRLIH-RDFDINNESIIKQLYSLFTLEK 404
           M+E L  A++LL DDGIIF+SIDDNEQAYLKVLMD+IFGE+NFIS I W K N+ + N     K++   HEYI  Y+K             + ++F+ NQ ++   K  QL Q         L+  R N G +  + P+ + +I   D    K+ ++  ++N          Y    E   +GF+ I+   KNG      W   + +       PK  K        +  +Y  +S+KS  +   N+ I      ++   +N L+++GI F   KP +LIK LIN + N++A ILDFFAGSGTTGHAV++LN +    G R F L TN E         IA +I +ERLY +IK   T GES N   +++ K + + +L  F I Y ++SI+    S+I KL E  K+S+   + + + ++ + I+  L  L  L K
  S:   169 MNEILTLARKLLSDDGIIFVSIDDNEQAYLKVLMDEIFGEENFISTIKWRKTNSPSGNTNQNKKFVNIQHEYIHLYAKDKGEINSLNYYKYDEEDFEKNQ-YKFRDKDEQLFQQRGYYKLTPLI--RNNSGSSFKYTPSLDYEIEAPDGTFFKIGQNMNVKNAVDKSCYTWSYDTFLEGKKQGFIVIKKNNKNGF-----WEAHRKVYSNVIFNPKTRKVETQEKGLEYNDYFDLSNKSNKKDTFNEKIDYYHESTTQSSANDLKQIGIFFKFSKPYKLIKHLINLYPNKDAKILDFFAGSGTTGHAVLDLNRE--DGGKRTFTLVTNNE-------NNIASEITYERLYRIIKGRSTKGES-NFKWLEKNKPFINTNLNVFKIKYFNISIDSHNESDITKLFEIFKESLVDFNVKKYSLDEKEILYNLTELKALRK 587
>gi|188159200|ref|ZP_02998606.1| putative type III restriction-modification system: methylase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (400 aa)
Score = 404, Expect = 2.1e-37, Identities = 152/399 (38%), Positives = 225/399 (56%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY----IEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPL-MDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVS----HKSIVRFNINQ---SIIDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCL-----------IKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSL 399
           M++ERL  A QLLKDDG+IF+SIDD+EQAYLKVLMD+IFGE+NF++NI W K+     N      I KN EYIL Y+K  +  K N  ++I+ +K   ++     N+D     R     TL F+P++          D      D T   L+ ++          I+P  ++G    ++W +D  ++  E    +  KN  + + A  K+Y+ V     +++I+  N  Q   +IID+I SS G   ++ +  +   F  PKP +LIK+LIN H N+NA +LDF+AGSGTTGHAV+ELN   +  GNR F L TN E         I  D+C+ERL+ +            K I+ +    +NL V ++K Y   S K F  N A+  I     K+L ++K     I+ D DI+    ++QL +L
  S:     1 MLNERLIMAHQLLKDDGVIFVSIDDSEQAYLKVLMDEIFGEENFVANISWVKKKGPGGNTSLNYKIVKNTEYILVYAKEKEKTKFN--YKIHNEK--TLKDLGYTNKDEYFSTRGFYKTTLLFHPSSTGSFNYSKSLDYPITAPDGTKFMLHVNE----------IKP--ESGC---YTWGYDAYLKGNELGFIECKKNKDNKWVAYRKQYQFVKFDPKNENIIFVNAGQEYENIIDDIFSSNGGEEIKSIFSDKNKFDFPKPSDLIKYLINIHPNKNAKVLDFYAGSGTTGHAVLELNR--QDNGNRTFTLVTNNE-------NNIGIDVCYERLFRINNGKSTDNKTDFKWIEKNEPYLSNLDVFDIKYY---STKLFEDNSANEIIKKQFIKMLNDLK-----INAD-DISTIKTLRQLTAL 388
>gi|47459296|ref|YP_016158.1| type III restriction-modification system methylase [Mycoplasma mobile 163K] >gi|47458626|gb|AAT27947.1| type III restriction-modification system methylase [Mycoplasma mobile 163K] (549 aa)
Score = 386, Expect = 3.0e-35, Identities = 148/405 (36%), Positives = 224/405 (55%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVW--DKRNAQNDNKYIEKNHEYILAYSKNW-KNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKK--VERDSTIEN-LYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKE-----YKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSG-ESFNNLSVDELKKYQDVSLKTFNINYA-DVSINSNI-DKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKE 405
           M++ERL  AK LL D+G+IF+SIDD+EQAYLKVLMD+IFGEDNF++ I W  +K+  Q  N  + K +EYIL YSKN  K FK N++ +   KK   I  +I    D   + R   G  +  N   N  I   + + +K        IEN ++ +D +  ++  V   P  + G+   W WS +K             +N     Y DEK      Y ++   SI  F  +  +   IS+  G++   ++  E  F  PKPVEL+KFLI    N+N+I+LDFFAGSGTTG AV+ELN +    GNR FILCTN E         IA++I +ERL+ +I    T G + F  L  D+ + +    L+  NI+ +  +S+N  + + +  +  K ++L++ +++     +   L +L  + +E
  S:   157 MINERLILAKDLLTDEGLIFVSIDDSEQAYLKVLMDNIFGEDNFVNQIAWVSNKKGRQISNSLLAKTYEYILIYSKNSDKEFKFNKLDQEYAKK---IMPSIYEKTD-YEIMRDEYGEFVIKNELHNSNIKAFNINTRKNLFFPLFIIENEIFTNDTKNRNQKIV-FPPKNQEGLQGVWRWSKEK------------IENSKQDLYIDEKNNQIKIYTKIRDMSI--FPKDVILSPKISTKSGTSEFLQIFEEEKFQYPKPVELLKFLIKISGNKNSIVLDFFAGSGTTGQAVLELNKE--DGGNRNFILCTNNE-------NNIAEEISYERLFRIITGKTTDGNKKFKWL--DKNEPFYGAKLRVINIDDSIKISLNDQVSENVYYDCVKGLKLLNNNYNKEGLELFYDLSALNPINEE 547
>gi|148377420|ref|YP_001256296.1| Type III restriction-modification system:methylase [Mycoplasma agalactiae PG2] >gi|148291466|emb|CAL58851.1| Type III restriction-modification system:Methylase [Mycoplasma agalactiae PG2] (571 aa)
Score = 374, Expect = 6.1e-34, Identities = 143/406 (35%), Positives = 213/406 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN--AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIEN----LYKDDKEIID----KGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESF-----------NNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKEN 406
           M++ERL+ + QLLK+DG+IF+SIDD+E AYLKVLMD+IFGE+NF+ NIVW ++N    +    I+   EYIL YSKN      N+  +I+  K  L            L     +     F    +   P+   D +       IEN     Y   K++ D     GF+                   K I++   I  K ++  Y   Y D K    +  K +   N + +I +  +++KG   +  +    +F  PKPV+LIKFLIN H N+   +LDF+AGSGTTGHAVMELN +    GNR + L TN E         IA ++C+ERLY +   I T+ ES            +NL+V  ++ Y   S K F+ N +++SI +   K+L++       I+ +   +N  I++ L SL  + KE+
  S:   167 MLNERLRLSHQLLKEDGVIFVSIDDSEHAYLKVLMDEIFGEENFVCNIVWQRKNTGGGSGKAGIDVETEYILIYSKNINKVNWNKK-DIDSSKYTLKDQYFNERGHYKLEELDRVCSKSTFQYIKSLDYPIKAPDGQIFINHRNIENPESYRYIVGKDLFDFLNQNGFIEF-----------------KQIKKGNNIFWKASRKKYEHVYVDPKLKPYIIQKRLKGNNFS-NIYNESTTTKGKQIVISILENKDFSFPKPVDLIKFLINLHPNKETRVLDFYAGSGTTGHAVMELNKE--DGGNRNYTLVTNNE-------NNIATNVCYERLYRINNGISTNNESNFDWIKKNEPYKSNLNVYNIEYY---STKLFDDNQSNMSIKNQYIKMLQDFG-----INTENKDSNIDILRSLTSLKPISKED 559
>gi|71893774|ref|YP_279220.1| putative type III restriction-modification system: methylase [Mycoplasma hyopneumoniae J] (552 aa)
Score = 365, Expect = 6.8e-33, Identities = 139/394 (35%), Positives = 211/394 (53%)
  Q:     9 AKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN--AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG----LLVNRKNMGWT--LYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLF-----YADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ--DVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDI---NNESIIKQLYSLFTL 402
           AK+LLKDDGIIF+SIDDN+  YLKVLMD+IFGE+NF++N+VW K+N  +  D+K+++   EY+LAYSKN ++   N ++  N   G          E G    + ++R ++ W+  L +    N KI       +K +         KD                      RW W+         K +    KNG+ +F     ++ + ++   +++ I R +   ++I     ++G+   + +     F +PKP+ELIK+LIN H N+NA ILDFFAGSGTTGHAV ELN   +  GNR F L TN +         IA +I +ERL+ +     T  E     + D +KK Q    +L  F INY +  I +  + +   +KK  +++  DF I   NN ++I+ L  L  L
  S:   175 AKKLLKDDGIIFVSIDDNQHGYLKVLMDEIFGEENFVANLVWQKKNEGSAADSKFVKVLTEYVLAYSKNIQHLTTN-IYVQNINDGSYKFSDEYIQERGKYKLIQLDRASLTWSEGLDYPIEYNGKIYYAGGSQEKWQARHQGNRAVKD---------------------WRWRWA--------RKKLDWGIKNGFIVFKNEKVFSKQYQFVDNNNQKIERVSKFSNLILLAQGTEGTQEQKNIFSTKVFDHPKPIELIKYLINIHPNKNAKILDFFAGSGTTGHAVWELNR--QDGGNRIFTLVTNNQ-------NNIATNITYERLFRINHGFGTKKEQ----NFDWIKKNQPYKTNLDVFRINYFNTEILNKENDVNLLVKKLEKML-VDFGISSKNNINLIEYLNYLLAL 544
>gi|144227622|gb|AAZ44509.2| putative type III restriction-modification system: methylase [Mycoplasma hyopneumoniae J] (561 aa)
Score = 365, Expect = 8.5e-33, Identities = 139/394 (35%), Positives = 211/394 (53%)
  Q:     9 AKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN--AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG----LLVNRKNMGWT--LYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLF-----YADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ--DVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDI---NNESIIKQLYSLFTL 402
           AK+LLKDDGIIF+SIDDN+  YLKVLMD+IFGE+NF++N+VW K+N  +  D+K+++   EY+LAYSKN ++   N ++  N   G          E G    + ++R ++ W+  L +    N KI       +K +         KD                      RW W+         K +    KNG+ +F     ++ + ++   +++ I R +   ++I     ++G+   + +     F +PKP+ELIK+LIN H N+NA ILDFFAGSGTTGHAV ELN   +  GNR F L TN +         IA +I +ERL+ +     T  E     + D +KK Q    +L  F INY +  I +  + +   +KK  +++  DF I   NN ++I+ L  L  L
  S:   184 AKKLLKDDGIIFVSIDDNQHGYLKVLMDEIFGEENFVANLVWQKKNEGSAADSKFVKVLTEYVLAYSKNIQHLTTN-IYVQNINDGSYKFSDEYIQERGKYKLIQLDRASLTWSEGLDYPIEYNGKIYYAGGSQEKWQARHQGNRAVKD---------------------WRWRWA--------RKKLDWGIKNGFIVFKNEKVFSKQYQFVDNNNQKIERVSKFSNLILLAQGTEGTQEQKNIFSTKVFDHPKPIELIKYLINIHPNKNAKILDFFAGSGTTGHAVWELNR--QDGGNRIFTLVTNNQ-------NNIATNITYERLFRINHGFGTKKEQ----NFDWIKKNQPYKTNLDVFRINYFNTEILNKENDVNLLVKKLEKML-VDFGISSKNNINLIEYLNYLLAL 553
>gi|188518306|ref|ZP_03003823.1| type III restriction-modification system: methylase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188998050|gb|EDU67147.1| type III restriction-modification system: methylase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (530 aa)
Score = 350, Expect = 4.3e-31, Identities = 130/355 (36%), Positives = 188/355 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDK--EIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES-----------FNNLSVDELKKYQDVSLKTFN 355
           MM+ERLK AK LLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF  N VW+K  A +N+NK++  NH+YIL Y    KN  +   F  N++  +  ++    ++ G   +              +  I  + +D KK         LY ++K  E+I +  + +     N   L+      K +  ++ +I        S+      +Y+ V+H    +  ++ SI+DN +              F  PKP+ELIK+LIN  S  NA ILDFFAGSGTTGHAV+ LN +    GNR F + TN E         I  ++C+ERLY +     T  E+            NNL+V +LK +    +K  N
  S:   170 MMNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFTCNFVWEKNYAPKNNNKFVSVNHDYILCYC---KNKILKNKFNRNQRTEKNNRLYFYKDDRGFYKSSD-------LTKKGSNNIYDIIWDGKKYLCPKNSSWLYNEEKMYELIKQNRIFLPENENNRPFLK------KYLNEVDDVI------SLSIL-----KYEVVNHTDGSKKQLD-SILDNHN--------------FNTPKPIELIKYLINIASTNNARILDFFAGSGTTGHAVLALNKE--DGGNRTFTIVTNNE-------NEIGTNVCYERLYRINNGFGTKNETDFDWINKNKPYLNNLNVYDLKYFDTNPIKIDN 487
>gi|185179129|ref|ZP_02964848.1| type III restriction-modification system:Methylase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188039595|ref|ZP_02998311.1| Type III restriction-modification system:Methylase [Ureaplasma urealyticum serovar 8] >gi|184208967|gb|EDU06010.1| type III restriction-modification system:Methylase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] (528 aa)
Score = 350, Expect = 4.3e-31, Identities = 130/355 (36%), Positives = 188/355 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDK--EIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES-----------FNNLSVDELKKYQDVSLKTFN 355
           MM+ERLK AK LLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF  N VW+K  A +N+NK++  NH+YIL Y    KN  +   F  N++  +  ++    ++ G   +              +  I  + +D KK         LY ++K  E+I +  + +     N   L+      K +  ++ +I        S+      +Y+ V+H    +  ++ SI+DN +              F  PKP+ELIK+LIN  S  NA ILDFFAGSGTTGHAV+ LN +    GNR F + TN E         I  ++C+ERLY +     T  E+            NNL+V +LK +    +K  N
  S:   168 MMNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFTCNFVWEKNYAPKNNNKFVSVNHDYILCYC---KNKILKNKFNRNQRTEKNNRLYFYKDDRGFYKSSD-------LTKKGSNNIYDIIWDGKKYLCPKNSSWLYNEEKMYELIKQNRIFLPENENNRPFLK------KYLNEVDDVI------SLSIL-----KYEVVNHTDGSKKQLD-SILDNHN--------------FNTPKPIELIKYLINIASTNNARILDFFAGSGTTGHAVLALNKE--DGGNRTFTIVTNNE-------NEIGTNVCYERLYRINNGFGTKNETDFDWINKNKPYLNNLNVYDLKYFDTNPIKIDN 485
>gi|144574983|gb|AAZ43581.2| putative type III restriction-modification system: methylase [Mycoplasma synoviae 53] (392 aa)
Score = 340, Expect = 5.3e-30, Identities = 139/405 (34%), Positives = 208/405 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN----KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQM-TIG-ANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVER-DSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQV----SHKSIVRFNINQSI---IDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINS--NIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKE 405
           MM ERL+ AK+LLK+ GIIF+SIDDNEQAYLKVLMD IFGE+NFI+NI W K+     N      + KN EYIL Y+KN+     N+  +I  K   L ++  +G  N+D     R         +P+++            +E  D T   LY +           ++P         ++WS D      +    ++ KN    + A  K+Y+ V      KSIV+    Q     I+NI S  G   + ++      F  PKP +LIK+L++  +N+NA +LDFFAG GTTGHAV +LN   +  GNR + L TN E         I   + +ERL+ +     T G SF  +  +   K    +L  F + Y   +IN   N+D+++ ++ K +     +  +  + I+  L SL  L+ +
  S:     1 MMYERLQLAKKLLKETGIIFVSIDDNEQAYLKVLMDQIFGEENFIANISWIKKRGPGSNTSFINKVVKNCEYILMYAKNY-----NEDTQIGYKIHDLEKLKKLGYTNKDEFFEERGFYKLADLHHPSSSGAFRYSKSLDYLIEAPDGTKFELYSN----------ILKPESAC-----YTWSEDSFNVGNKLGFIEIKKNPKGYWQAYRKQYQFVKFDPKEKSIVKVVAGQEFENYIENIYSQNGGKEIIEIFENKNVFDFPKPPDLIKYLLSFSNNKNARVLDFFAGGGTTGHAVEDLNK--QDGGNRTYTLVTNNE-------NNIGYSVTYERLFRVNFGKSTDGNSFKWVENNNAYK---SNLDVFEVKYESTNINDSRNVDQIVNKVSKMLFDFGINKTVEYKKILNGLSSLKKLKSD 392
>gi|195867571|ref|ZP_03079574.1| adenine specific DNA methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660815|gb|EDX54069.1| adenine specific DNA methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (433 aa)
Score = 339, Expect = 7.0e-30, Identities = 103/272 (37%), Positives = 147/272 (54%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVN----RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAG 272
           MM+ERLK AK LLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF++N +W K++    NK I + HEYIL YSKN  NF ++   E NKK    I+     N +   +N    R N G                  D K   R+   E+L K+DKE                   +W+   D     +     +  K+  +  + DE++    +  SI++     + +  I +  G+N +  L I+F NPKP++LI  L++ HSN+NA +LDFFAG
  S:   168 MMNERLKLAKNLLKNDGVIFVSIDDNEQAYLKVLMDEIFGEENFVTNFIWQKKSGGGLNKLIYEGHEYILCYSKNNYNFCLS---EKNKKMSGFIKYK-DKNNNSFFINSDIIRNNFG----------------KKDNKFEHRNKAYEDLSKEDKE-------------------KWNLKLDNKNYILVPFKKEPGKHLVAKIFNDERK----TTYSIIKLPF--TFVSGIWTKDGNNEVDSLNIDFQNPKPIQLIMHLLDLHSNKNARVLDFFAG 398
>gi|188039596|ref|ZP_02528777.2| DNA methylase [Ureaplasma urealyticum serovar 8] (367 aa)
Score = 339, Expect = 7.5e-30, Identities = 129/354 (36%), Positives = 189/354 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ---NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES-----------FNNLSVDELKKYQDVSLKTFN 355
           M+ERLK AK LLK+DG+IF+SIDD+EQAYLKVLMD+IFGE+NFI + +W++ N     N+ K I +N EYI  YSKN  +  IN + E +KK+     +   +N++ L+   KN  +    N   ++  PL  +   +  ++   + L+   K I+           +   ++R  +S +K       +IPK   N   L+   EK +K  +       N    I++N +              F  PKP ELI +L+    N+NA +LDFFAGSGTTGHAV+ELN +    GNR F L TN E         I  ++C+ERLY +   + T  E+            NNL+V +LK +    +K  N
  S:     1 MNERLKLAKNLLKNDGVIFVSIDDSEQAYLKVLMDEIFGEENFICSFIWERTNHTNQGNNGKKIFRNSEYIHTYSKNINS--INYINEGDKKEFDTAPLKNNSNKEILIKFDKNQIFVKEKNQLNDK--PLEFFIRSRWTQNRIDQELFLGTKFILTN---------QKDQIIRVKYSDNKK----GFLIPKALLNTSKLYL--EKYFKSTTEHGTKELN---DILENNN--------------FSYPKPKELICYLLEIIQNKNARVLDFFAGSGTTGHAVLELNKE--DGGNRTFTLVTNNE-------NQIGTNVCYERLYRINNGVGTKNEADFDWINKNEAYLNNLNVYDLKYFDTNPIKIDN 323
>gi|71894184|ref|YP_278292.1| putative type III restriction-modification system: methylase [Mycoplasma synoviae 53] (436 aa)
Score = 339, Expect = 8.2e-30, Identities = 139/405 (34%), Positives = 208/405 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN----KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQM-TIG-ANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVER-DSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQV----SHKSIVRFNINQSI---IDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINS--NIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKE 405
           MM ERL+ AK+LLK+ GIIF+SIDDNEQAYLKVLMD IFGE+NFI+NI W K+     N      + KN EYIL Y+KN+     N+  +I  K   L ++  +G  N+D     R         +P+++            +E  D T   LY +           ++P         ++WS D      +    ++ KN    + A  K+Y+ V      KSIV+    Q     I+NI S  G   + ++      F  PKP +LIK+L++  +N+NA +LDFFAG GTTGHAV +LN   +  GNR + L TN E         I   + +ERL+ +     T G SF  +  +   K    +L  F + Y   +IN   N+D+++ ++ K +     +  +  + I+  L SL  L+ +
  S:    45 MMYERLQLAKKLLKETGIIFVSIDDNEQAYLKVLMDQIFGEENFIANISWIKKRGPGSNTSFINKVVKNCEYILMYAKNY-----NEDTQIGYKIHDLEKLKKLGYTNKDEFFEERGFYKLADLHHPSSSGAFRYSKSLDYLIEAPDGTKFELYSN----------ILKPESAC-----YTWSEDSFNVGNKLGFIEIKKNPKGYWQAYRKQYQFVKFDPKEKSIVKVVAGQEFENYIENIYSQNGGKEIIEIFENKNVFDFPKPPDLIKYLLSFSNNKNARVLDFFAGGGTTGHAVEDLNK--QDGGNRTYTLVTNNE-------NNIGYSVTYERLFRVNFGKSTDGNSFKWVENNNAYK---SNLDVFEVKYESTNINDSRNVDQIVNKVSKMLFDFGINKTVEYKKILNGLSSLKKLKSD 436
>gi|165976075|ref|YP_001651668.1| type III restriction-modification system methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876176|gb|ABY69224.1| type III restriction-modification system methyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (618 aa)
Score = 334, Expect = 3.0e-29, Identities = 104/306 (33%), Positives = 158/306 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGY---SLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           M+  RLK A+ LL DDG+IFISIDDNEQA LK + D++FGE NF+++++W K+N  QND ++   +HEY++ Y+KN +   +N++   +++K +        N D    N     WT     A +         P  V    T     +  KE + K F   R          W       + R++K + ++ K+G    ++++ DE    Q S K +V+  +N +I D                    PKP+E IK ++    N N+IILDFFAGS TT HAVM+LN++    GNRKFI+    E+T +
  S:   179 MIYSRLKLARNLLTDDGVIFISIDDNEQANLKRVCDEVFGERNFVADVIWKKKNVVQNDARFFSTDHEYLICYTKNSEYLTLNRLPRTDEQKSRY------QNPD----NDPRGDWTSVALQAKSGSSSYEITFPNGVSWKPTEGTFPRLSKESLMKAFEENR---------LWFGVNGTNVPRLKKYLSEV-KDGVLSNTIWFNDEVGSTQ-SSKEMVKKLLNSNIFD-------------------TPKPIEYIKKMMRLTCNNNSIILDFFAGSATTAHAVMQLNAE--DGGNRKFIMVQIPEQTDE 446
>gi|71893735|ref|YP_279181.1| putative type III restriction-modification system: methylase [Mycoplasma hyopneumoniae J] >gi|71851862|gb|AAZ44470.1| putative type III restriction-modification system: methylase [Mycoplasma hyopneumoniae J] (575 aa)
Score = 334, Expect = 3.3e-29, Identities = 144/406 (35%), Positives = 223/406 (54%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-----HEYILAYSKNWKNFKINQVFEINKKKGQLIQM------TIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWS---FDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNI------------NQSIID-NISSSKGSNTLRKL--GIEFPNPKPVELIKFLINK-HSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ--DVSL-----KTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKEN 406
           +++ERLK A+QLLK+DG+IF+SIDDNEQAYLKVLMD+IFGE+NF++N+VW +++AQ  +K +E +     +EYI+ Y+K+   FK + V    +K  ++ +         GA +   LVN  N  W   +    + ++   D    K+ ++                        I       +SWS   FDKA + +  I  K  K  Y + +  E +Y +   K  V   +            NQ+ ++ +I +S+G+  L  +    EF  PKPV LIK+LI    S +N  +LDFFAGSGTTG AV+ELN +    G R F L TN E         I +++ +ERLY + K   T G+       + +KK +  D SL     KT+N +  +  I +   K   +       I+++    N+S++K L SL + ++EN
  S:   172 LLNERLKLARQLLKEDGVIFVSIDDNEQAYLKVLMDEIFGEENFVANMVW-RKSAQGTHKDVEVDNLNTVNEYIVTYAKDKSKFKFDYVKHSQEKLDEIYKFRDKNFEKYGAYKLQPLVNSWNGAW---YRSGQDYELEAPDGTNFKIWQN------------------------IDKPQSASYSWSKPTFDKA-KNLGLIEFKKNKQDYWVVHKKEYQYAKFDTKEGVLKTVARGVPFTNMIVANQNNLESDIYTSEGARELNSIFNSKEFDYPKPVRLIKYLIKMLSSKKNIRVLDFFAGSGTTGQAVLELNKE--DNGTRTFTLVTNNE-------NNIGQNVTYERLYRINKGQGTKGQK----DFEWIKKNEAFDTSLNVFWSKTYNTSLLNNDITNQELKDKFKKLLKEFGIYKNKSKVNDSVLKTLSSLRSYKEEN 572
>gi|134298388|ref|YP_001111884.1| DNA methylase N-4/N-6 domain-containing protein [Desulfotomaculum reducens MI-1] >gi|134051088|gb|ABO49059.1| DNA methylase N-4/N-6 domain protein [Desulfotomaculum reducens MI-1] (664 aa)
Score = 334, Expect = 3.3e-29, Identities = 116/363 (31%), Positives = 193/363 (53%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN--------------------WKNFKINQVF---EINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSL--FYADEK---EYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSI 363
           MM  RL  A+ LL++DG+IF+SIDDNE   L+ +MD+IFGE+NF+S  +W+     ++   ++ NHEYI+ Y+KN                    WK +  N +    E N     L+        + + ++  ++    Y      +++  + Y  +++ +   I    +  + I+++G +     +++ ++     + +K  E I+     +     +L  FY  E+    YK+   K+    NI   + +  ++ +  + L +LGI F  PKP EL+++LI   S E  I+LDFFAGSGTT HAV++LN+  +  GNRKFIL    E T +    TIA DI  ER+  +I   K + E  N L  D   K QD   + F +  ++  I
  S:   173 MMYPRLFLARNLLREDGVIFVSIDDNEVKNLRSIMDEIFGEENFVSQFIWNTEGHTDNQFQVKVNHEYIVLYAKNQLIVSLGYIIDPNTRGQSNLWKGYAENSITKNGEANPPSEVLLPSGFPCVAEKIDLDATDVSSEFY------KEVSELGYISRQITQKYNISYPIRKKRMIVEEGKL-----VEDCLVFSGWANVNKLKEFIKNDFKPLDDEDGNLLEFYLSERGVIYYKKSREKA---RNILSVLRNMGTTEQMRSELERLGILFQYPKPKELLQYLIKIGSAEGEIVLDFFAGSGTTAHAVLDLNA--QDNGNRKFILVQLPEPTNKPDYPTIA-DITKERVLRVIS--KLNEEDQNKLDFD--GKKQDRGFRVFKLTSSNFKI 542
>gi|167040461|ref|YP_001663446.1| site-specific DNA-methyltransferase (adenine-specific) [Thermoanaerobacter sp. X514] >gi|166854701|gb|ABY93110.1| Site-specific DNA-methyltransferase (adenine-specific) [Thermoanaerobacter sp. X514] (632 aa)
Score = 320, Expect = 1.4e-27, Identities = 127/366 (34%), Positives = 185/366 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSH-KSIVRFNINQSIIDNIS----SSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN------KTIAKDICFERLYCLIKNIKTSGESFNNLS-VDELKKYQDVSLKTFNINYADVSINSN 366
           MM  RLK AK LL DDG+IFISIDDNE A L+ + D+IFGE+NFI+ I+W+K+   QND K+   +H+YI+A +KN + F+   +   +K+  +                        Y NP  + + P +  D   V R +      KD  EII      + PP  N      SW   K  E+ E+++    K+    F  D     ++    S V+  I    I   S    +   +  LR L  G  F  PKPV+L+K  I+  +  ++I+LDFF+GS TT HAVMELN++    G RKFI+    ER  ++        KTIA DI  ER+    + IK   E F +   +D+L    D+  K F +   ++  N +
  S:   172 MMYPRLKVAKDLLSDDGVIFISIDDNEVANLRKICDEIFGEENFIATIIWEKKYGIQNDAKWFSTSHDYIIAVAKNKEVFRPTLLPRTDKQNAR------------------------YKNPDNDPRGPWIS-DNLSVGRVTE-----KDIYEIITPSGRKVLPPPGN------SWRVSK--EKFEELV----KDNRIWFGEDGNNVPRIKRFLSEVKNGITPKTIWEYSEVGHTDSAAKELRALLKGSIFDYPKPVDLVKRCIHIGTKHDSIVLDFFSGSATTAHAVMELNAE--DGGKRKFIMVQLPERVDEESEAYKAGFKTIA-DIGKERIRRAGEKIK---EEFKDKEWIDDL----DIGFKVFKVGKTNIRWNDD 500
>gi|163756649|ref|ZP_02163760.1| hypothetical protein KAOT1_00260 [Kordia algicida OT-1] >gi|161323324|gb|EDP94662.1| hypothetical protein KAOT1_00260 [Kordia algicida OT-1] (662 aa)
Score = 318, Expect = 2.0e-27, Identities = 107/310 (34%), Positives = 158/310 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN------QVFEINKKKGQL-IQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKT 311
           M  RL  AKQLLK+DG+IF+SIDDNE A L++LMD++FGE+NF+   V +      D  +I K HEY++ YSKN +N + N      + F+   KKG   I     +N      NR N+ +  Y NP                ++ +    +  + KE    G + + P    K G+   W W  +K+ + + + I        S     +  + +   +S+V       +   +SS +G+  + ++  +  F  PKP+ LIK       N+N +ILDFFAGSGTTG AVM+LNS+    G RKFIL    E      NKT
  S:   178 MYPRLYIAKQLLKEDGVIFVSIDDNEVAQLRLLMDEVFGEENFLGEFVVNSTPNARDYGHIGKMHEYVVFYSKNEQNAQTNLLEEKEKTFKFKDKKGGFNIHPLYNSNVAFTPDNRPNLYYPFYLNPQ---------------KQSNGFFEISLEKKE----GLIEVFPAKSQKEGIQFVWRWGKEKSQKNLNEEIIGYQNGDGSFRVVQKMRHSEKLIRSLV-------LDKGVSSRRGTAEVERIFGKKVFSFPKPITLIKSFALIGLNQNDLILDFFAGSGTTGDAVMQLNSE--DGGQRKFILAQLPELIDPKSNKT 470
>gi|59800979|ref|YP_207691.1| putative type III restriction-modification system methyltransferase [Neisseria gonorrhoeae FA 1090] >gi|59717874|gb|AAW89279.1| putative type III restriction-modification system methyltransferase [Neisseria gonorrhoeae FA 1090] (687 aa)
Score = 312, Expect = 1.1e-26, Identities = 109/305 (35%), Positives = 173/305 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKNWKNF-----KINQVFEINK------KKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEII--DKGFVPIRPPIKNGVLLRWSWSFD--KAIERIEKII--PKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSK-GSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           M  RL  A++LLKDDG+IFISIDDNE A LK+L D++FGE NF++ + W KR A++D  + I +++E+I  ++K+ +       K  + +E +       +   L + T  A        R N  +T+  +P T +K P       +V +D T ++ Y   K +   D  F+ I  P+     +R+    D  KA E   K+    ++ +N  +L  A   EY  +          ++++ +NI  +K G+  +  L     F  PKP +LIKFL++  S  N +ILDFFAGSGTT HAVM+LN++ +  GNR++I     E+T +
  S:   210 MYPRLYIARELLKDDGVIFISIDDNEAAQLKLLCDEVFGEGNFVAQLPWRKRTAKSDVPFGISQDYEWIFVFAKSCQFIAATKGKERRYYETDDFPDRPWRTHDLTKQTTAA-------ERPNSFFTM-VDPKTGKKYPANPNATWRVTKD-TFQDYYNKGKIVFPDDYDFLNISNPV-----MRYFKDDDMKKAGEDFGKVAVSSRLPENVGTLADA-VAEYLAI---------FSRTLPENIGMTKEGTKEITDLFGSKIFTFPKPSQLIKFLVSISSKSNDLILDFFAGSGTTAHAVMQLNAEGQN-GNRRYICVQLPEKTAE 510
>gi|194098944|ref|YP_002002009.1| Putative type III restriction-modification system methyltransferase [Neisseria gonorrhoeae NCCP11945] >gi|193934234|gb|ACF30058.1| Putative type III restriction-modification system methyltransferase [Neisseria gonorrhoeae NCCP11945] (598 aa)
Score = 310, Expect = 1.9e-26, Identities = 109/305 (35%), Positives = 173/305 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKNWKNF-----KINQVFEINK------KKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEII--DKGFVPIRPPIKNGVLLRWSWSFD--KAIERIEKII--PKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSK-GSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           M  RL  A++LLKDDG+IFISIDDNE A LK+L D++FGE NF++ + W KR A++D  + I +++E+I  ++K+ +       K  + +E +       +   L + T  A        R N  +T+  +P T +K P       +V +D T ++ Y   K +   D  F+ I  P+     +R+    D  KA E   K+    ++ +N  +L  A   EY  +          ++++ +NI  +K G+  +  L     F  PKP +LIKFL++  S  N +ILDFFAGSGTT HAVM+LN++ +  GNR++I     E+T +
  S:   121 MYPRLYIARELLKDDGVIFISIDDNEAAQLKLLCDEVFGEGNFVAQLPWRKRTAKSDVPFGISQDYEWIFVFAKSCQFIAATKGKERRYYETDDFPDRPWRTHDLTKQTTAA-------ERPNSFFTM-VDPKTGKKYPANPNATWRVTKD-TFQDYYNKGKIVFPDDYDFLNISNPV-----MRYFKDDDMKKAGEDFGKVAVSSRLPENVGTLADA-VAEYLAI---------FSRTLPENIGMTKEGTKEITDLFGSKIFTFPKPSQLIKFLVSISSKSNDLILDFFAGSGTTAHAVMQLNAEGQN-GNRRYICVQLPEKTAE 421
>gi|53712450|ref|YP_098442.1| methyltransferase [Bacteroides fragilis YCH46] >gi|52215315|dbj|BAD47908.1| methyltransferase [Bacteroides fragilis YCH46] (584 aa)
Score = 308, Expect = 2.9e-26, Identities = 116/346 (33%), Positives = 168/346 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSF-----DKAIERIEKIIPK--MTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFP--NPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKT-SGESFNNLSVDELKKYQ 347
           M++RL  AKQLL D G+IFISIDDNEQA LK+L D+IFGE+NFI++ V  +R++Q N +  I   HEY+  + K + +  +N++  I   K                          Y NP         D DP+   +     N          KG          G ++   W F     D  +E    + P+    K  Y LF  D+K    +++  +     NQ         +G+  L+ +  E P  NPKP+ L+KFL+   S  N+ ILDFFAGSGTT HA M+LN++    G+RK IL TN E         I +++ +ER   +IK   T  GE    L+ + L+ Y+
  S:   134 MAKRLCIAKQLLSDKGVIFISIDDNEQAQLKLLCDEIFGENNFIASCVRKRRDSQANLSHNISPIHEYVFIFCKRYDDL-LNKIPAIIDDKD-------------------------YRNP---------DNDPRGPYKTMPCTN----------KGGAVYSVTTPTGRIITEEWRFKKETYDALLEDNRLVFPRGGEGKPRYKLFLRDKKNEGVLANTWLSEIASNQ---------QGTIELKDIFDELPFNNPKPIGLLKFLLILGSQTNSTILDFFAGSGTTLHATMQLNAE--DGGHRKCILVTNNE-------NNICEEVTYERNKRVIKGYTTPKGEEVAGLAGNTLRYYR 427
>gi|72080723|ref|YP_287781.1| type III restriction-modification system: methylase [Mycoplasma hyopneumoniae 7448] (466 aa)
Score = 308, Expect = 3.0e-26, Identities = 135/378 (35%), Positives = 203/378 (53%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVW-DKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVP-IRP-----------------------------------PIKNG--VLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ--DVSLKTFNINYADVSI---NSNIDKLLEEIKKSM 378
           +M+ERL+ AK LLKDDGIIF+SIDD EQAYLKVLMD+IFGE+NF++N  +    + +  N  +   HEY+L Y KN  NF  N+   I+K         +      ++ N          +P  N++I   D  P++ E +ST + + +D+ E  +  F P  RP                                   P KN   + L W W   K + +I  ++    ++     Y    + K       V+  I     +N S++K  N +     E  F  PKP  LI++LIN H N+NA +LDFFAGSGTTG AV+ELN      G R F L TN +         IA+++ +ERL+ +     T  E     + D +KK Q    +L  F INY +  I    ++++ L+++++K +
  S:    46 LMNERLRLAKDLLKDDGIIFVSIDDAEQAYLKVLMDEIFGEENFVANFPFISNLSGRQVNTNLALCHEYLLLYKKN--NFIFNK---IDKDYANNFMPIVYPERSNVIFNE---------DPDVNKEI--YDNSPEQKEDNST-QYILRDNLENSNGEFNPKTRPNLFFPIYARKINEKNKLWDITVEEPDSKHDFIEIWPRKNSKNIQLVWRWGKKKIMNQINDLVIVEPRDKNDKNY--RIKVKIFDQSYTVKSFILGKKFNNKSATKELNKIFSESSEKVFNFPKPTALIEYLINLHPNKNARVLDFFAGSGTTGQAVLELNY--HDGGTRSFTLITNNQ-------NKIAENVTYERLFRINHGFGTKKEQ----NFDWIKKNQPYKTNLDVFRINYFNTEIFTKENDVNLLVKKLEKML 437
>gi|86146749|ref|ZP_01065069.1| Site-specific DNA-methyltransferase (adenine-specific) [Vibrio sp. MED222] >gi|85835399|gb|EAQ53537.1| Site-specific DNA-methyltransferase (adenine-specific) [Vibrio sp. MED222] (611 aa)
Score = 307, Expect = 3.7e-26, Identities = 127/401 (31%), Positives = 196/401 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIE---NLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSL-----FYADEKE---------YKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE----FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFT 401
           MM  RLK A+ LL DDG IFISIDD EQ+ LK + D+IFGEDNF++NI+W K+ + QND K++  NH++IL Y+KN + ++ N +    K+                         T Y NP         D DP+ V + + +        +D EI       + PP        WS + DK  E +         NG ++     F  + K          Y++V H        NQ+             L+KL  E    F  PKPV LI  +++  +++++I+LDFFAGSGTT HAVME N     +G R+FI     E T +   + I+ D  +ER++           +  +L  ++  K++   L   NI   D   + N++++L++  +S++      D+  E  +K  Y L T
  S:   179 MMYPRLKLARNLLADDGAIFISIDDGEQSNLKQICDEIFGEDNFVNNIIWQKKYSPQNDAKWLSDNHDFILCYAKNKELWRPNLLARTEKQN------------------------TAYKNP---------DNDPRGVWKATDLSVKTYASNNDYEITTPSGRVVSPPESRC----WSVNKDKFSELVADNRIWFGSNGNNVPSLKKFITEVKNGITPLTLWTYEEVGH--------NQT---------AKQELKKLFPETKEVFDTPKPVSLISRILDIGADKDSIVLDFFAGSGTTAHAVMEKNI--TDEGTRRFITVQLPEPTGKKDFEYIS-DFTYERIH----------RASESLGYNDPMKFK---LDETNIRPWDADFD-NLEQVLQQATESIKADRSSEDVLYEIFLKYGYDLTT 530
>gi|21229692|ref|NP_635609.1| methyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66766569|ref|YP_241331.1| methyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|21111176|gb|AAM39533.1| methyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66571901|gb|AAY47311.1| methyltransferase [Xanthomonas campestris pv. campestris str. 8004] (543 aa)
Score = 307, Expect = 4.0e-26, Identities = 100/320 (31%), Positives = 161/320 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKV--ERDSTIENLYKDDKEII--DKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKI--------IPKMTKNGYSLFYADEKE---------YKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           M  RL+ AK+LL DDG+IF+SIDDNE   L +LMD +FGE+NFI+N++W K  + +   ++   +HEY++ Y +           + NK +  L+  T   +               Y NP         D DP+ +    D +  N Y      I    G V   PP   G   R+S    K ++   +I        +P++ +     F AD ++         Y +V H    +  + + +  N +S+            F  PKP++L++ +++  S     +LDFFAGSGT   AV +LN++    GNRKFIL ++ E T+   +K + +D+C ER+
  S:   123 MYRRLQLAKELLADDGVIFVSIDDNEVFRLGMLMDRVFGENNFIANVIWQKVFSPKGTAQHFSDDHEYVIIYGR-----------DKNKWRPNLLARTAAQDR-------------AYKNP---------DDDPRGLWTSGDLSARNYYSKGVYSIVGPTGRVIAGPPA--GTYWRFSEERFKELDADNRIWWGKSGDNMPRLKR-----FLADVQQGTVPQTLWTYGEVGHTQDAKKQLLEVL--NFNSTNDV---------FSTPKPIQLMERILSIASKPGDTVLDFFAGSGTFAQAVAKLNAE--DGGNRKFILVSSTEATEDTPDKNLCRDVCAERV 411
>gi|54020181|ref|YP_115910.1| hypothetical protein mhp400 [Mycoplasma hyopneumoniae 232] >gi|53987354|gb|AAV27555.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (420 aa)
Score = 301, Expect = 1.8e-25, Identities = 134/377 (35%), Positives = 204/377 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVW-DKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVP-IRP-----------------------------------PIKNG--VLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ--DVSLKTFNINYADVSI---NSNIDKLLEEIKKSM 378
           M+ERLK A+ LLK+DGIIF+SIDDN+QAYLKVLMD+IFGE+NF++N  +    + +  N  +   HEY+L Y KN  NF  N+   I+K         +      ++ N          +P  N++I   D  P++ E +ST + + +D+ E  +  F P  RP                                   P KN   + L W W   K + +I  ++    ++     Y    + K       V+  I     +N S++K  N +     E  F  PK   LI++LIN H N+NA +LDFFAGSGTTG AV+ELNS  +  G R F L TN +         IA+++ +ERL+ +     T  E     + D +KK Q    +L  F INY +  I    ++++ L+++++K +
  S:     1 MNERLKLARDLLKEDGIIFVSIDDNQQAYLKVLMDEIFGEENFVANFPFISNLSGRQVNTNLALCHEYLLLYKKN--NFIFNK---IDKDYANNFMPIVYPERSNVIFNE---------DPDVNKEI--YDNSPEQKEDNST-QYILRDNLENSNGEFNPKTRPNLFFPIYARKINEKNKLWDITVEKPDSKHDFIEIWPRKNSKNIQLVWRWGKKKIMNQINDLVIVEPRDKNDKNY--RIKVKIFDQSYTVKSFILGKKFNNKSATKELNKIFSESSEKVFNFPKSTALIEYLINLHPNKNARVLDFFAGSGTTGQAVLELNS--QDGGTRSFTLITNNQ-------NKIAENVTYERLFRINHGFGTKKEQ----NFDWIKKNQPYKTNLDVFRINYFNTEIFNKENDVNLLVKKLEKML 391
>gi|167568214|ref|ZP_02361088.1| type III DNA modification methyltransferase [Burkholderia oklahomensis C6786] (673 aa)
Score = 301, Expect = 2.2e-25, Identities = 97/320 (30%), Positives = 155/320 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDICFER 320
           M+  RLK A+ LL DDG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++    GA      +   N+ +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+      R     ++        +  +   G   F ADE    Q        + +++++ +N+ S     GS+   L+ L I F  PKPVE    +I   ++ N +I+DFF GSGTT HAVM LN+     GNR++ L    E    D  ++  A D C  R
  S:   183 MIYPRLKLARDLLADDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAELLFERAPLKRPKRNAQRMLDAARGAIAGASTIAEANVAYRSWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTG----RPCPVPERGWRNPPATMQALLDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALLKSLEIPFDQPKPVEFAASIIGWCTDGNDLIVDFFGGSGTTAHAVMALNA--ADGGNRRYALVQLPEPLDADSKDQKAAADFCAAR 499
>gi|167560955|ref|ZP_02353871.1| type III DNA modification methyltransferase [Burkholderia oklahomensis EO147] (673 aa)
Score = 301, Expect = 2.2e-25, Identities = 97/320 (30%), Positives = 155/320 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDICFER 320
           M+  RLK A+ LL DDG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++    GA      +   N+ +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+      R     ++        +  +   G   F ADE    Q        + +++++ +N+ S     GS+   L+ L I F  PKPVE    +I   ++ N +I+DFF GSGTT HAVM LN+     GNR++ L    E    D  ++  A D C  R
  S:   183 MIYPRLKLARDLLADDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAELLFERAPLKRPKRNAQRMLDAARGAIAGASTIAEANVAYRSWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTG----RPCPVPERGWRNPPATMQALLDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALLKSLEIPFDQPKPVEFAASIIGWCTDGNDLIVDFFGGSGTTAHAVMALNA--ADGGNRRYALVQLPEPLDADSKDQKAAADFCAAR 499
>gi|124008287|ref|ZP_01692983.1| site-specific DNA-methyltransferase [Microscilla marina ATCC 23134] >gi|123986236|gb|EAY26065.1| site-specific DNA-methyltransferase [Microscilla marina ATCC 23134] (678 aa)
Score = 300, Expect = 2.3e-25, Identities = 125/377 (33%), Positives = 194/377 (51%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKY-IEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK---IIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII--------DNIS-SSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT--KQDINKT----IAKDICFERLYCLIKNIKTSGESF--------NNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSM 378
           M  RLK AK LLKDDG IF+SIDD+E   L+ LM++IFGE+NF+  ++W +R NA N N+  +  +HEY+L YSK+     + +  +++K                            Y NP  + + P    D   +       NL+ D   I+D       PP  N     WS S +  ++ IE+   + PK             +E K +S       N+NQ++         DN+  ++ G+  + ++  G  F  PKPV+LI+ LI + +    IILDFFAGS TT  AV ELN +    GNRKFIL   EE T  K +  K     IA+ I  +R+  +I+ I+T   S         ++L + + +K Q V+ +  ++   D   N+   K L++++  +
  S:   166 MYPRLKIAKSLLKDDGAIFVSIDDHEVHNLRALMNEIFGEENFMGILLWKRRQNADNRNQSNVSSDHEYLLLYSKSENTKFLGKSIDLSK----------------------------YKNPDNDPRGPWASIDLSGLATKDQRPNLHYD---IVDPKTNLSYPPNPN---RGWSKSKENVLKMIEEGRILFPKKVT-------GRPREKKFLS-------NLNQTVTGFSTWLESDNVGFTTNGTRDIAEVMGGKIFNFPKPVKLIQTLIKQATTSQDIILDFFAGSATTAQAVTELNKE--DGGNRKFILVQLEEETPPKSEARKAGYEHIAQ-ISKDRIRKVIEKIQTEQNSLEAEVMQLEDDLQMLKNEKDQLVAEQNIDLTLFDNDANATKPKALQKLEDKL 521
>gi|15838562|ref|NP_299250.1| methyltransferase [Xylella fastidiosa 9a5c] >gi|9107074|gb|AAF84770.1|AE004016_4 methyltransferase [Xylella fastidiosa 9a5c] (534 aa)
Score = 299, Expect = 3.3e-25, Identities = 93/320 (29%), Positives = 160/320 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLM--DYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYK----QVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           M  RL+ AK+LL DDG+IF+SIDDNE   L +LMD +FGE NF++N +W      N  K  + + +  LA++      +    F +N        + + A++              + N   +++ P +   +D   + ++ T    Y        K F+P  P  ++     W ++ D+ +E +++      K+G       + +YK    + + K    F I   +     ++K    +      F  PKPV LI+ +++  +++ A +LDFFAGSGTT HAV +LN++    G+R+FIL +N E T+   +K + +D+C ERL
  S:   123 MYRRLQLAKELLADDGVIFVSIDDNELFRLGMLMDRVFGEQNFVANFIW------NHRKSSQNDTDVSLAHNYTLCYARTRDRFSLNP-------LPVDADK--------------FNNTDGDQRGPWVADPFDAPNIRKNLT----YPIKNPKTGKEFLP--PQGRH-----WRFTEDRYLEALKEGRIVFGKHG-----TGKPQYKRFLFEAAGKGKNIFTIWNDVGTATEATKELMAIFDGEKMFNTPKPVSLIERILSVATDKEAWVLDFFAGSGTTAHAVAKLNAE--DGGHRRFILISNTEATQAQPDKNLCRDVCAERL 403
>gi|118498062|ref|YP_899112.1| adenine specific DNA methylase [Francisella tularensis subsp. novicida U112] >gi|194323287|ref|ZP_03057071.1| DNA methylase domain protein [Francisella tularensis subsp. novicida FTE] >gi|118423968|gb|ABK90358.1| adenine specific DNA methylase [Francisella tularensis subsp. novicida U112] >gi|194322651|gb|EDX20131.1| DNA methylase domain protein [Francisella tularensis subsp. novicida FTE] (660 aa)
Score = 298, Expect = 4.6e-25, Identities = 109/301 (36%), Positives = 160/301 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQ-----------MTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRK-LGIE-FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           M  RLK A++LLK+DG+IFISIDDNEQA LK++ D+IFGE+NF++ +         +DN    + HEYI  Y  +    +IN+ F++++ + +  Q                 +D   +NR    + ++ +   NEKI + + D  +  R+ TI                 I P   NG  L WSW   K ++    +I K T NG+S++         +  K    F          SS+  +N L+K  G + F NPKP+ L+K LI    N N +ILDFFAGSGTTG AVM+LN++    G RK+IL   +E
  S:   185 MYPRLKIARELLKEDGVIFISIDDNEQANLKIICDEIFGEENFVACLPTIMNLKGNHDNYGFAETHEYIFVYVIDKNICEINK-FDVDESELEKWQEDDYGLWKEADTLKRTGQDASRINRPKGYFPVFID--KNEKIYVTENDLPE-NRNDTI-----------------IYPVNDNGDELSWSWGKRKIMQENYNLILKKTSNGFSIYKKQRPGIGDLPTKKAKSFLYKTE----YSSTTATNYLKKEFGKKIFDNPKPLPLLKDLIILGLNSNDVILDFFAGSGTTGDAVMQLNAE--DGGKRKYILAQLDE 472
>gi|127461|sp|P25238|MTK1_KLEPN Modification methylase KpnI (M.KpnI) (Adenine-specific methyltransferase KpnI) >gi|43889|emb|CAA43898.1| DNA methylase [Klebsiella pneumoniae] >gi|149228|gb|AAA25090.1| DNA methylase (417 aa)
Score = 297, Expect = 5.3e-25, Identities = 116/304 (38%), Positives = 161/304 (52%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKN--------------------WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSI-VRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC-TNEERTKQDI 308
           RL  A ++LKD GII ISIDD E A+LK+LMD IFGEDNFI NI V   +N +   + I   HEY+L Y K+                    +  ++I+ +F   +KKG          +  L  +R NM + LYFNP+T E          +VE +  ++ +Y  D + I++               RW WS + A ER  ++    +KNG  + Y   K Y   SHK I VR   N S   +  + + +N + K+     F  PK +  I  +IN  +  +A+ILDFFAGSGTT HA   LNS     G+RK IL  +N   TK  I
  S:   103 RLFHAHKMLKDTGIIAISIDDYEFAHLKILMDKIFGEDNFIGNIVVCRSKNGKGSKRNIASAHEYLLVYGKSDMAELSGQPDDKSLYDKVDCFGEYRIDGMF---RKKG----------DSSLRTDRPNMFYPLYFNPSTGE---------VQVEPELGLKTVYPIDSKGIER---------------RWLWSKETARERSWELFA--SKNG--VVYV--KNYSS-SHKRIKVRTLWNDS---SFYTERATNEITKIFGSKVFDTPKALNYIMSIINCMAKPDALILDFFAGSGTTAHAAAVLNS--LDGGSRKTILMESNHPITKTHI 382
>gi|71897935|ref|ZP_00680140.1| Site-specific DNA-methyltransferase (adenine-specific) [Xylella fastidiosa Ann-1] >gi|71732179|gb|EAO34234.1| Site-specific DNA-methyltransferase (adenine-specific) [Xylella fastidiosa Ann-1] (534 aa)
Score = 295, Expect = 9.5e-25, Identities = 92/317 (29%), Positives = 159/317 (50%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLM--DYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYK----QVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           RL+ AK+LL DDG+IF+SIDDNE   L +LMD +FGE NF++N +W      N  K  + + +  LA++      +    F +N        + + A++              + N   +++ P +   +D   + ++ T    Y        K F+P  P  ++     W ++ D+ +E +++      K+G       + +YK    + + K    F I   +     ++K    +      F  PKPV LI+ +++  +++ A +LDFFAGSGTT HAV +LN++    G+R+FIL +N E T+   +K + +D+C ERL
  S:   126 RLQLAKELLADDGVIFVSIDDNELFRLGMLMDRVFGEQNFVANFIW------NHRKSSQNDTDVSLAHNYTLCYARTRDRFSLNP-------LPVDADK--------------FNNTDGDQRGPWVADPFDAPNIRKNLT----YPIKNPKTGKEFLP--PQGRH-----WRFTEDRYLEALKEGRIVFGKHG-----TGKPQYKRFLFEAAGKGKNIFTIWNDVGTATEATKELMAIFDGEKMFNTPKPVSLIERILSVATDKEAWVLDFFAGSGTTAHAVAKLNAE--DGGHRRFILISNTEATQAQPDKNLCRDVCAERL 403
>gi|72536117|gb|AAZ73166.1| PstII restriction-modification enzyme Mod subunit [Providencia stuartii] (561 aa)
Score = 294, Expect = 1.3e-24, Identities = 109/332 (32%), Positives = 163/332 (49%)
  Q:     1 MMSERLKKAKQLLK-DDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEI--IDKGFVPIRPPIKNGVLLRWSWSFDKAIE-------------RIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVR-FNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSG 332
           MM +RL+   +LL  ++G++ ISI+D+E  YLKVL DD+FG D FI+N++W+     ++   I   HEYIL YSK  +      VF+ N              E   L N +     +   P    K  L+   P          ++YK D +    D   V     +KN V     WS    +E             + ++ I ++TK G ++     +E ++    S++R F          ++++    L K+GI+F  PKPV LI +LI   + EN IILD FAGSGTTGHAV++LN +  T  NRKFIL         ++ K     +   RL  +IK  K + 
  S:    92 MMRDRLEIIWRLLSSNNGVLLISINDDELHYLKVLCDDVFGRDKFIANLIWNYEGNTDNQAKIINYHEYILVYSKTGR-IDDPSVFDPNLP------------ESSKLFNAEIRNTIVKNGPKNPPKSVLL---PAGFPCSFQEGHIYKSDVQYPSYDNDLVIGNGKLKNPVTATTGWSSKSILEAFINNNFEAVLDSKKQETIFEITKTG-AIEAVKRREQRKGHFVSVLRGFG---------TTNQMRLMLSKIGIKFTYPKPVNLISYLIEAFTGENDIILDSFAGSGTTGHAVLQLNKNKST--NRKFILI--------ELKKETVDSVIIPRLQAVIKGHKAAA 404
>gi|85859485|ref|YP_461687.1| type III restriction-modification system methylation subunit [Syntrophus aciditrophicus SB] >gi|85722576|gb|ABC77519.1| type III restriction-modification system methylation subunit [Syntrophus aciditrophicus SB] (643 aa)
Score = 292, Expect = 2.4e-24, Identities = 104/321 (32%), Positives = 169/321 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL---GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL------CTNEERTKQDINKTIAKDICFERL 321
           M+  RLK A+ LL+DDG+IFISIDDNE   L+   D+IFG  NF++ +    +       +  K H+YIL Y KN +   +N++        + ++     ++ G  +          FN +TN   P + Y P  V++ +   N +     I    FV +     +G+   W WS +K+ +  + ++     +G    +  E++  Q++ K+++    ++ II N    KG+  L+ L   GI F  PKPV LIK +    S+E+++ILDFF+GS TT HAV++LN++    GNRKFI+      C  +    +   KTIA +I  ER+
  S:   181 MIYPRLKLARNLLRDDGVIFISIDDNEVTNLQRACDEIFGGANFVAQLTIIVKPEGRRYGFFAKTHDYILVYCKNHEYASMNEILV------EGLEHPHSDDQGGFTLKGLRNRNVQAFN-STNR--PNLRY-PFFVDKQNPDANGFFKVSTIPLDRFVKVEASTVDGLKSVWRWSKEKSEKEKDSLVAYEGNDGEIRIFQKERKLSQMA-KTVLS---DKEIISN----KGTRELQVLLGKGI-FDFPKPVALIKLITTIGSDEHSLILDFFSGSATTAHAVIQLNAE--DGGNRKFIMVQLPEPCDEKSEAFKAGYKTIA-EISKERI 488
>gi|148926992|ref|ZP_01810668.1| adenine specific DNA methyltransferase (mod) [Campylobacter jejuni subsp. jejuni CG8486] >gi|145844400|gb|EDK21509.1| adenine specific DNA methyltransferase (mod) [Campylobacter jejuni subsp. jejuni CG8486] (637 aa)
Score = 292, Expect = 2.5e-24, Identities = 129/355 (36%), Positives = 187/355 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKK----VERDSTIEN-LYKDDKEIIDKGFVPIRPPIKNGVLLRWSWS---FDKAIERIEKIIPKMTKNGYSLFYAD-EKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYC--------LIKNIKTSGESFNNLSVDELKKYQDVSLKTFNI 356
           M  RLK A+ LL++DG+IFISIDDNEQA LK+L D+IFGE+NF++NIVW K+ NA    K I    EYIL Y K+             K   +LI  +   +E  L  N     + ++ N   N  +   +Y  K+    + +D  I N + KDD +I  KG              R+ WS    D  I++  KI  K  K    +FY +  K+      ++++   I + +  N  +++    + +L I F   KP +LIK  I   +  + IILDFFAGSGTT  AVMELN++    GNRKFIL   +E+  ++ +K IA D C   L           I+ +K +GE     +VD   K  D+  K F++
  S:   186 MLPRLKLARDLLREDGVIFISIDDNEQANLKILCDEIFGEENFVANIVWHKKDNASFLGKNIVDLIEYILIYRKSETFEGTRDALIDPKGHRELIIKSSNVSERILDKN-----FCIFENGKFNGLLKRGEYGSKQFNIEILKDVEITNGIAKDDIQI--KG--------------RFCWSQQKIDNEIKQGGKIEIKSIKGMKPIFYKNFGKDIPFRPMRNLLSKKIEEDVYTNNDAAEEIKKIFELPI-FNYSKPSKLIKKFIKNVTKNDDIILDFFAGSGTTAQAVMELNAE--DNGNRKFILVQLDEKIDENKSK-IAYDFCKNELGSENPVISDITIERVKRAGEKILKENVD---KNLDLDFKVFSL 530
>gi|147676551|ref|YP_001210766.1| adenine specific DNA methylase Mod [Pelotomaculum thermopropionicum SI] >gi|146272648|dbj|BAF58397.1| adenine specific DNA methylase Mod [Pelotomaculum thermopropionicum SI] (558 aa)
Score = 290, Expect = 3.5e-24, Identities = 102/318 (32%), Positives = 164/318 (51%)
  Q:    16 DGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKN-WKNFKINQVFEINKKKGQLIQMTIGANEDGL-----LVNRKNMGWTLYFNPATN-EKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFP--NPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGE 333
           DG+IF+SIDDNE  +L++LMD++FG+ NFI+ IV       +  ++++ K HEYIL Y+K+  K+  +N +    +K+G +++     +E G+     L NR         NP  N E  P + Y P  V  ++   +L +D K  I+     + P    G+   W+W  +K    I K++ +    G    Y  +  Y +    ++ + +    +  NI++  G     ++ ++ P   PK  EL+K  I   S    I+LD FAGSGTT HAV+ELN +    GNRKFIL   E+          A +I  ER+  +IK +  + E
  S:   127 DGVIFVSIDDNEVHHLRMLMDEVFGDQNFIACIVVQLNPRGRTLDRFLAKTHEYILLYAKDVTKDNAVNLI----QKEGIVLKTYNKQDEKGIYRELELRNR---------NPVFNRENRPNLFY-PLYVNSETGQVSLTRDKKHSIE-----VLPKNSRGIDGCWTWGREKVASNISKLVGRQASTGAWRIYRKDYLYDESGDVTVTK-SKALWVEKNINNENGKEVCNEIFLKCPFDFPKSPELVKRCIKLGSGNTDIVLDSFAGSGTTAHAVLELNKE--DGGNRKFILVECED---------YADEITAERVRRVIKGVPGAKE 423
>gi|125973039|ref|YP_001036949.1| DNA methylase N-4/N-6 [Clostridium thermocellum ATCC 27405] >gi|125713264|gb|ABN51756.1| DNA methylase N-4/N-6 [Clostridium thermocellum ATCC 27405] (610 aa)
Score = 290, Expect = 3.7e-24, Identities = 103/307 (33%), Positives = 157/307 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSW---SFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSK-GSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           MM  RL+ A+ LL DDG+IFISIDDNE   LK + ++IFGEDNFI+N V  +R++Q N ++ I   HEY+L Y+K + N        +NK    L                 +MG   Y NP         D DP+         N        +      I  P    +   W +   +F+K +     + P   +NG       +  YK    + +    +  + +D I+S++ G+  +++L  G+ F NPKP  L+KFL+   S++++IILDFF+GS TT HAVM+LN++    GNR+FI+    E T ++
  S:   172 MMYPRLRLARNLLSDDGVIFISIDDNEVDNLKKICNEIFGEDNFIANCVRKRRDSQANLSQNISPIHEYVLIYAKRFGNI-------LNKVTPSL-----------------DMG--SYKNP---------DNDPRGPYTTMPCTN--------VGGAVYSIVTPTGKTITDEWRFKKETFEKLLLDNRIVFP---RNG-----EGKPRYKIFLSEKMAEGVLANTWLDKIASNQEGTREIKELFGGLLFNNPKPTGLLKFLLELGSSKDSIILDFFSGSATTAHAVMQLNAE--DGGNRRFIMVQLPEPTDEN 432
>gi|145637602|ref|ZP_01793258.1| Adenine specific DNA methylase Mod [Haemophilus influenzae PittHH] >gi|145269199|gb|EDK09146.1| Adenine specific DNA methylase Mod [Haemophilus influenzae PittHH] (523 aa)
Score = 289, Expect = 4.5e-24, Identities = 110/296 (37%), Positives = 166/296 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-----AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANED----GLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKV--------ERDSTIENLYKDDKEIIDKGFVP---IRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNG---YSLFYADEK-----EYKQVSHK---SIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           M  RLK A  LLKDDG+IFISIDDNEQA LK+L D++FGE+NFI+ +  + +N        ++K ++KN E +L Y+K++ NF + +      + G+LIQ      +      +LVN  N  +          +I +   +  K+        E + T   +Y      I +  +P   IRP +   V           +  IE  IP+  +N    Y  FY  +        K VS K    + +  +  +  D +S +K  N  ++ G+ +PN  KP++LIK L    + EN +ILDFFAGSGTTGH++M LN++    GNR+FIL
  S:     1 MYPRLKVAHDLLKDDGVIFISIDDNEQAQLKLLCDEVFGEENFINIVSVNMKNIAGASGGGEDKRLKKNVESLLIYAKSYDNFPMFKNIYDYIEIGELIQHYKNEEKSWKYTSVLVNAGNANYIGSTIDGDGNEIKIFTREDYKISSVSALAKEENKTETEIYNKYSSQIFQTAMPQTSIRPRVMEKVK---QLGVSNNLYSIE-YIPRSGRNKGKIYEQFYKGDNFRLFAWLKDVSEKIDGVLYKKEMIGTYWDFVSETK--NLTKEGGVPYPNGKKPMKLIKQLAYMVTEENDLILDFFAGSGTTGHSIMHLNTE--DLGNRQFIL 320
>gi|170730167|ref|YP_001775600.1| methyltransferase [Xylella fastidiosa M12] >gi|167964960|gb|ACA11970.1| methyltransferase [Xylella fastidiosa M12] (526 aa)
Score = 289, Expect = 4.6e-24, Identities = 93/317 (29%), Positives = 160/317 (50%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLM--DYDPKKVERDST--IENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYK----QVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           RL+ AK+LL DDG+IF+SIDDNE   L +LMD +FGE NF++N +W      N  K  + + +  LA++      +    F +N        + + A++              + N   +++ P +   +D   + ++ T  I+N  K  KE +        PP        W ++ D+ +E +++      K+G       + +YK    + + K    F I   +     ++K    +      F  PKPV LI+ +++  +++ A +LDFFAGSGTT HAV +LN++    G+R+FIL +N E T+   +K + +D+C +RL
  S:   118 RLQLAKELLPDDGVIFVSIDDNELFRLGMLMDRVFGEQNFVANFIW------NHRKSSQNDTDVSLAHNYTLCYARTRDRFSLNP-------LPVDADK--------------FNNTDGDQRGPWVADPFDAPNIRKNLTYPIKNP-KSGKEFL--------PPQGR----HWRFTEDRYLEALKEGRIVFGKHG-----TGKPQYKRFLFEAAGKGKNIFTIWNDVGTATEATKELMAIFDGEKMFNTPKPVSLIERILSVTTDKEAWVLDFFAGSGTTAHAVAKLNAE--DGGHRRFILISNTEATQAQPDKNLCRDVCAKRL 395
>gi|166982992|ref|ZP_02254416.1| Adenine specific DNA methylase Mod-like protein [Bacillus cereus AH187] (643 aa)
Score = 288, Expect = 6.3e-24, Identities = 116/344 (33%), Positives = 179/344 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWK-----------NFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTL-----YFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEII----DKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKK 345
           M  RL+ A +++ +DGI+F+SIDD EQA LK+L D+IFGEDNFI  +    + +        KNH+Y+L Y+K  K           N+K    F   + K +L Q      +   L   K++ + L      F P  +++  L     K    D      ++ +KE+     + GFV I+   K+G    ++ ++  A     KI  + +K     F     + K +S    +   +N+   DN   +K   ++  L  EF   KPV+LIK LI+ H N +A +LDFFAGSGTTG A++ELN +    GNRKFILCTN +         I ++I ++R+  L+K  +   E    L  ++L K
  S:   149 MKRRLELAHEVMSNDGILFMSIDDKEQAALKILTDEIFGEDNFIVALPRQTKKSGKTTGSFSKNHDYVLVYTKLNKDVFVMEEHIDDNYKYEDEFVDERGKYKLNQTL----DYDSLSYSKSLDYPLEIDGEIFYPGGSKEKHLERQSGKHKRADWA----WRWNKEMFKYGYENGFVVIKRK-KDGTARIYTKTYLNA-----KIEKRKSKGMTEYFIKYVHKTKPLSS---IELTLNKYSNDN---AKKDLSVFNLQDEFDYSKPVDLIKRLISCHYNPDAYVLDFFAGSGTTGQAILELNKE--RGGNRKFILCTNNQ-------NNICREITYKRVSSLLKGFEYKKEYMVELLEEKLTK 483
>gi|109947917|ref|YP_665145.1| adenine specific DNA methylase [Helicobacter acinonychis str. Sheeba] >gi|109715138|emb|CAK00146.1| adenine specific DNA methylase [Helicobacter acinonychis str. Sheeba] (614 aa)
Score = 288, Expect = 7.2e-24, Identities = 112/356 (31%), Positives = 173/356 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKN--WKNFKINQVFEINKKKGQLIQMTIGANED-GLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYK--DDKEII--------DKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNIN 357
           M  RLK A+ LLK+DG+IFISIDDNEQA LK+L D+IFGE NF+++ +   ++  ND K  +   HE++L Y+KN  + N    +    N K        +  N D       K  G+    NP T +    +DY P  +    +   + K  DD  I         ++GF+                      +R  K +    K   SL ++D     Q + K ++R  + +                     F  PK V+ +  +I   + +  IILDFFAGSGTT HAVMELN++   KGNR+FIL   +E  K+D NK+ A D C         ++K++    ++++++ +K+     L++ N N
  S:   183 MLPRLKLARDLLKEDGVIFISIDDNEQANLKLLCDEIFGEGNFVADFIRKTKSTTNDAKIGVNYQHEFLLCYAKNKEFVNLLGGEKNLENYKNPDNDPNGVWTNTDPSAKSGTKENGYFAITNPYTGK----VDYPPVGMFWRFSQNTIQKHIDDGRICFKKEHGENERGFI---------------------YKRYLKDLKTTKKTFDSLIFSDNCYMNQAATKELLRLELAEY--------------------FSYPKGVDFMAKIIEHATEKGDIILDFFAGSGTTAHAVMELNAE--DKGNREFILVQIDEEIKEDKNKS-AYDFC-------QNDLKSAKPVISDITIERVKRAAQKILESSNEN 497
>gi|150026205|ref|YP_001297031.1| type III modification methyltransferase [Flavobacterium psychrophilum JIP02/86] >gi|149772746|emb|CAL44230.1| Probable type III modification methyltransferase [Flavobacterium psychrophilum JIP02/86] (554 aa)
Score = 287, Expect = 7.5e-24, Identities = 111/309 (35%), Positives = 168/309 (54%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQV-------FEINKKKGQLIQMTIGANEDG---LLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKM--TKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNE--------ERTKQDIN 309
           MM  RLK   +LL  DG IFISIDDNEQAYLK+L D+IFG +NF+ NI V +    ++D+K+I   HE +L + K   NF  N V        E  +K        +G  + G     ++R N+ + +YF+  +N           K+  D        DD        + I P + NG    W W  +   +R++++  ++  T+N + +F  D  E + ++ +   +   + S     SS  G+  L+K+  E  F  PK V+ I++ + + +++N+IILD FAGSGTT HAV+ LN+     GNRKFIL   E        ER K+ IN
  S:   117 MMYPRLKLLHKLLAKDGAIFISIDDNEQAYLKLLCDEIFGANNFVGNIAVVNNFKGRSDDKFIATAHESLLIFHKG--NFITNGVEIPSEYSTEYKEKDSVGNYRLLGLRKRGSNSREIDRPNLFYPIYFDEKSN-----------KISLDKN------DD-------LIEILPKLSNGENGNWRWGKETLAKRVDEVEIRIVKTRNEFDVFQKDYLEKEGINKRIKPKSFWHGS---EFSSEAGTLQLKKIFQEKTFDTPKSVDFIEYCLQQATDKNSIILDSFAGSGTTAHAVLNLNN--HDGGNRKFILIEMEDYANRITAERVKRVIN 417
>gi|134294161|ref|YP_001117896.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia vietnamiensis G4] >gi|134137318|gb|ABO53061.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia vietnamiensis G4] (672 aa)
Score = 286, Expect = 1.1e-23, Identities = 96/317 (30%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + I   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD  ++  D  +  L    + + K+  D+ F P+  P+  K   +    W     +    IER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   183 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGIAYQHESLVLFARNAETLLEQAPLKRPKRNAQRM---LDAAHDAVYRSGNAKDAQKAYRAWMKAQTNLSGGEVMYD--RLSADGRVYRLVSMAWPNKKKAPDEYFTPLIHPVTGKPCAMPARGWRNPPATMQALIERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKALGIPFDQPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPEALDRRDKAQQAAADFC 496
>gi|167617396|ref|ZP_02386027.1| type III DNA modification methyltransferase [Burkholderia thailandensis Bt4] (676 aa)
Score = 285, Expect = 1.6e-23, Identities = 95/297 (31%), Positives = 153/297 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           M+  RLK A+ LL DDG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++    GA      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A   ++ +I K    G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTTGHAVM LN+     GNR+++L
  S:   182 MIYPRLKLARDLLADDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAQLLFERAPLKRPKRNAQRMLDAARGAIAGAATIADANAAYRAWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPAT--MQALIDK----GLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTGHAVMALNA--ADGGNRRYVL 474
>gi|167579290|ref|ZP_02372164.1| type III DNA modification methyltransferase [Burkholderia thailandensis TXDOH] (594 aa)
Score = 285, Expect = 1.6e-23, Identities = 95/297 (31%), Positives = 153/297 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           M+  RLK A+ LL DDG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++    GA      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A   ++ +I K    G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTTGHAVM LN+     GNR+++L
  S:   182 MIYPRLKLARDLLADDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAQLLFERAPLKRPKRNAQRMLDAARGAIAGAATIADANAAYRAWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPAT--MQALIDK----GLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTGHAVMALNA--ADGGNRRYVL 474
>gi|83718634|ref|YP_440601.1| type III DNA modification methyltransferase [Burkholderia thailandensis E264] >gi|83652459|gb|ABC36522.1| type III DNA modification methyltransferase [Burkholderia thailandensis E264] (682 aa)
Score = 285, Expect = 1.6e-23, Identities = 95/297 (31%), Positives = 153/297 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           M+  RLK A+ LL DDG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++    GA      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A   ++ +I K    G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTTGHAVM LN+     GNR+++L
  S:   188 MIYPRLKLARDLLADDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAQLLFERAPLKRPKRNAQRMLDAARGAIAGAATIADANAAYRAWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPAT--MQALIDK----GLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTGHAVMALNA--ADGGNRRYVL 480
>gi|160941925|ref|ZP_02089251.1| hypothetical protein CLOBOL_06820 [Clostridium bolteae ATCC BAA-613] >gi|158435157|gb|EDP12924.1| hypothetical protein CLOBOL_06820 [Clostridium bolteae ATCC BAA-613] (631 aa)
Score = 284, Expect = 2.0e-23, Identities = 120/399 (30%), Positives = 196/399 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN--AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKS--IVRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNE--NAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE--RTKQDINKTIAKDIC---FERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSI-------NSNIDKLLEEIKK---SMRLIHRDFDINNESIIKQLYSL 399
           MM  RL+ A  LL+DDG+IFISI+D+E   L+ L D+ FGE+NF+ +++W  +     +D+K     HE+IL Y KN +  ++N V   N+++ +              + +  MG   Y   +T+   P+   D  ++        +  D+                NG    W WS DK          ++ K+   ++    K+Y    ++   I R     S+ID  SS++ S  L+ L  G  F   KPV+LI +L+ +   E  N +ILDFF+GS TT HA+M+LN+  K  GNR+FI+    E    K +  K    +IC    ER+  + K +  +     +L  D  K   DV  K F ++ +++ +       + ++  L   I K    ++    D D+  E ++K  YSL
  S:   165 MMYPRLRLAANLLRDDGVIFISINDSEITNLRKLCDETFGEENFVVDLIWTNKEGGGSSDSKLFRIKHEHILCYCKNLELIEVNGVVISNEERYKSSD-EYEEIRGKYYLQKLGMGSIQY---STSLDYPITAPDGTEI--------MPADN---------------NNGKKACWRWSQDKFKWGQSNGFVEIKKDPNDIWTVYTKQYLNCDNEGNIIKRTQRPMSVIDKFSSTQASKLLQNLFDGKVFDYSKPVDLIIYLMQRVLKEKSNDLILDFFSGSATTAHAIMQLNA--KDGGNRRFIMVQLPEVCDDKSEAYKAGYTNICEIGKERIRRIGKKVLEADGGQTSLDGD--KPSIDVGFKVFKLDTSNLKLWEDTPIEDGDVATLFNRIDKHIDGLKPDRSDEDLIYEILLKMGYSL 555
>gi|161504452|ref|YP_001571564.1| hypothetical protein SARI_02565 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160865799|gb|ABX22422.1| hypothetical protein SARI_02565 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (652 aa)
Score = 281, Expect = 4.1e-23, Identities = 101/313 (32%), Positives = 146/313 (46%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQ-VSHKSIVRFNINQSIIDNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+                K GQ      GA               L   P + E I     +P +   D     +     + +  G    +    NG + +  W++ +A  +      K+  +    F  D     Q V +    +     +  DN++S+K G   +  L  +  F  PKP  L+K +I    ++N I+LDFFAGSGTT HAVM LN +    G R FILCT ++    +   TIAK
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEHANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSTQGEYILVYA----------------KTGQ------GA---------------LRLEPLSKEYIQKSYKEPTEQFPDGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHKRLWAYPEASYQ------KLVADNLVYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKNGIVLDFFAGSGTTAHAVMALNEE--DGGQRAFILCTLDQTLNHN---TIAK 457
>gi|194562022|ref|YP_002097045.1| Adenine specific DNA methylase Mod [Burkholderia dolosa AUO158] >gi|124893646|gb|EAY67526.1| Adenine specific DNA methylase Mod [Burkholderia dolosa AUO158] (672 aa)
Score = 281, Expect = 4.2e-23, Identities = 94/317 (29%), Positives = 157/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK    LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + I   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD  ++  D  +  L    + + K+  D+ F P+  P+  K   +    W     +    +ER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   183 MMYPRLKLVHALLSDEGLIVVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGIAYQHESLVLFARNAETLLERAPLKRPKRNAQRM---LDAAHDAMYRSGNPKDAQKAYRAWLKAQTNLSGGEVMYD--RLSADGRVYRLVSMAWPNKKKAPDEYFTPLIHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKALGIPFEQPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPEALDRRDKAQQAAADFC 496
>gi|171316876|ref|ZP_02906085.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria MEX-5] >gi|171097957|gb|EDT42775.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria MEX-5] (668 aa)
Score = 281, Expect = 4.5e-23, Identities = 94/317 (29%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD  ++  D  +  L    + + K+  ++ F P+  P+  K   +    W     +    IER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   179 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLEQAPLKRPKRNAQRM---LDAAHDAVYRSGNAKDAQKAYRAWMKAQTNLSGGEVMYD--RLSADGRVYRLVSMAWPNKKKAPEEYFTPLIHPVTGKPCAMPARGWRNPPATMQALIERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKTLGIPFDQPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPETLDRRDKTQLAAADFC 492
>gi|170698060|ref|ZP_02889141.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria IOP40-10] >gi|170137021|gb|EDT05268.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria IOP40-10] (668 aa)
Score = 281, Expect = 4.5e-23, Identities = 94/317 (29%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD  ++  D  +  L    + + K+  ++ F P+  P+  K   +    W     +    IER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   179 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLEQAPLKRPKRNAQRM---LDAAHDAVYRSGNAKDAQKAYRAWMKAQTNLSGGEVMYD--RLSADGRVYRLVSMAWPNKKKAPEEYFTPLIHPVTGKPCAMPARGWRNPPATMQALIERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKTLGIPFDQPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPETLDRRDKTQLAAADFC 492
>gi|115350076|ref|YP_771915.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria AMMD] >gi|115280064|gb|ABI85581.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria AMMD] (672 aa)
Score = 281, Expect = 4.5e-23, Identities = 94/317 (29%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD  ++  D  +  L    + + K+  ++ F P+  P+  K   +    W     +    IER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   183 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLEQAPLKRPKRNAQRM---LDAAHDAVYRSGNAKDAQKAYRAWMKAQTNLSGGEVMYD--RLSADGRVYRLVSMAWPNKKKAPEEYFTPLIHPVTGKPCAMPARGWRNPPATMQALIERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKTLGIPFDQPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPETLDRRDKTQLAAADFC 496
>gi|189348934|ref|YP_001944562.1| adenine-specific DNA methyltransferase [Burkholderia multivorans ATCC 17616] >gi|189332956|dbj|BAG42026.1| adenine-specific DNA methyltransferase [Burkholderia multivorans ATCC 17616] (668 aa)
Score = 280, Expect = 5.3e-23, Identities = 92/317 (29%), Positives = 156/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVN----RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL ++G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + I   HE ++ +++N +        +  K+  Q +   + A  D +  +         +  +    TN       YD  ++  D  +  L    + + K+  D+ F P+  P+  K   +    W     +    +ER + +  P  T     ++Y DE  Y+ V   S++ F  +   +           L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   179 MMYPRLKLAHALLSEEGLIVVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGIAYQHESLVLFARNAETLLERAPLKRPKRNAQRM---LDAAHDAMYRSGTPKDAAKAYRAWVKAQTNLSGGEAMYD--RLSEDGRVYRLVSMAWPNKKKAPDEYFTPLLHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPFGGSDDAL-----------LKALGIPFEQPKPVDFAAAVIGWCTRRDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPEPLDRRDKTQQAAADFC 492
>gi|161523209|ref|YP_001578221.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia multivorans ATCC 17616] >gi|160340638|gb|ABX13724.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia multivorans ATCC 17616] (688 aa)
Score = 280, Expect = 5.3e-23, Identities = 92/317 (29%), Positives = 156/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVN----RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL ++G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + I   HE ++ +++N +        +  K+  Q +   + A  D +  +         +  +    TN       YD  ++  D  +  L    + + K+  D+ F P+  P+  K   +    W     +    +ER + +  P  T     ++Y DE  Y+ V   S++ F  +   +           L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   199 MMYPRLKLAHALLSEEGLIVVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGIAYQHESLVLFARNAETLLERAPLKRPKRNAQRM---LDAAHDAMYRSGTPKDAAKAYRAWVKAQTNLSGGEAMYD--RLSEDGRVYRLVSMAWPNKKKAPDEYFTPLLHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPFGGSDDAL-----------LKALGIPFEQPKPVDFAAAVIGWCTRRDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPEPLDRRDKTQQAAADFC 512
>gi|167834884|ref|ZP_02461767.1| type III DNA modification methyltransferase [Burkholderia thailandensis MSMB43] (671 aa)
Score = 280, Expect = 5.4e-23, Identities = 93/297 (31%), Positives = 151/297 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           M+  RLK A+ LL DDG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++    GA  D   +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+           +      ++ +I K    G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVEL   +I   ++ + +I+DFF GSGTT HAVM LN+     GNR+++L
  S:   180 MIYPRLKLARDLLADDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAELLFERAPLKRAKRNAQRMLDAARGAIADAATIADANAAYRSWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGEPCPVPERGWRNPPATMQALIDK----GLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVELAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGNRRYVL 472
>gi|15341560|gb|AAK95338.1| type III restriction-modification system methyltransferase [Moraxella catarrhalis] (636 aa)
Score = 279, Expect = 7.2e-23, Identities = 124/394 (31%), Positives = 194/394 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPI-RPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII---DNISSSKGSN----TLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKN-IKTSGESFNNLSVDELKKYQDVSLKTFNI---NYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIK 394
           MM  RL  A  LL DDG+IFISIDDNEQA LK+L D+IFG +NF+++ +W+ +   +++  +   HE+I+ + KN   F++N +    K+           N D    N  N  W         +  P+         R  ++ N+Y+ +     K   PI R P          +S DK +E   +      KNG      D K Y      S VR  +    +   +++  S G+N     +   GI F +PK  +L+K +I+ +S++N+IILDFFAGS TT HAVM+LN++    GNR+FI+    E T +   K+ A+   F+ +  + K  I+ +G      + D   K  D   K F +   N+    I+ +I K LE     ++    + DI  E ++K
  S:   206 MMLPRLHLAHTLLSDDGVIFISIDDNEQAQLKLLCDEIFGGENFVADFIWNNKYTVSNDTDVSYQHEHIVCFCKNRDIFELNLLPRTEKQNKSY------KNRD----NDPNGAW---------KPTPIH-------ARSGSLNNIYEIEFPNGIKWTAPIGRYP---------RYSKDKLMELYYQEALYFNKNG----GVDRKTY-----LSEVRQGVTCGTLWSYEDVGHSHGNNEEFSEIIGKGI-FNDPKGTKLLKRIISLNSDKNSIILDFFAGSATTAHAVMQLNAE--DNGNRQFIMVQLPELTDE---KSEARKAGFKNIAEISKERIRRAGAKIKAENPD---KNIDTGFKVFKLTDSNFKAWQIDDDIAKQLEMYIDPLKDNVNEMDIVYELLLK 558
>gi|170731402|ref|YP_001763349.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia cenocepacia MC0-3] >gi|169814644|gb|ACA89227.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia cenocepacia MC0-3] (668 aa)
Score = 279, Expect = 7.3e-23, Identities = 96/317 (30%), Positives = 160/317 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYD---PK-KVERDSTIENLYKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD   P+ +V R   +   + + K+  D+ F P+  P+  K   +    W     +    +ER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +T A D C
  S:   179 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLERAPLKRPKRNAQRM---LDAAHDAVYRSGNPKDAQKAYRAWMKAQTNLSGGEVMYDRLSPEGRVYR--LVSMAWPNKKKAPDEYFTPLIHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKTLGIPFDLPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPEALDRRDKTQTAAADFC 492
>gi|194557614|ref|YP_002092640.1| Adenine specific DNA methylase Mod [Burkholderia cenocepacia PC184] >gi|124871405|gb|EAY63121.1| Adenine specific DNA methylase Mod [Burkholderia cenocepacia PC184] (672 aa)
Score = 279, Expect = 7.3e-23, Identities = 96/317 (30%), Positives = 160/317 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYD---PK-KVERDSTIENLYKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD   P+ +V R   +   + + K+  D+ F P+  P+  K   +    W     +    +ER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +T A D C
  S:   183 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLERAPLKRPKRNAQRM---LDAAHDAVYRSGNPKDAQKAYRAWMKAQTNLSGGEVMYDRLSPEGRVYR--LVSMAWPNKKKAPDEYFTPLIHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKTLGIPFDLPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPEALDRRDKTQTAAADFC 496
>gi|107021604|ref|YP_619931.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia cenocepacia AU 1054] >gi|116688052|ref|YP_833675.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia cenocepacia HI2424] >gi|105891793|gb|ABF74958.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia cenocepacia AU 1054] >gi|116646141|gb|ABK06782.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia cenocepacia HI2424] (672 aa)
Score = 279, Expect = 7.3e-23, Identities = 96/317 (30%), Positives = 160/317 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYD---PK-KVERDSTIENLYKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD   P+ +V R   +   + + K+  D+ F P+  P+  K   +    W     +    +ER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R++IL    E   ++D  +T A D C
  S:   183 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLERAPLKRPKRNAQRM---LDAAHDAVYRSGNPKDAQKAYRAWMKAQTNLSGGEVMYDRLSPEGRVYR--LVSMAWPNKKKAPDEYFTPLIHPVTGKPCAMPARGWRNPPATMQALLERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKTLGIPFDLPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYILVQLPEALDRRDKTQTAAADFC 496
>gi|15602563|ref|NP_245635.1| hypothetical protein PM0698 [Pasteurella multocida subsp. multocida str. Pm70] >gi|12720985|gb|AAK02782.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] (636 aa)
Score = 278, Expect = 9.5e-23, Identities = 111/306 (36%), Positives = 155/306 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ--NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDN------ISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           MM  RLK A+ LL DDG+IFISIDDNEQA LK + D+IFGE NFIS I   + +AQ  +  KY+   H+YIL Y+K  K+   N    I +    L Q     + +GL +                      + D   +   ST       D +I  KG +  +P   NG   RW W+  +  + I   +   TK    +     KE+ QV    +V  N N  +  N        + K ++ L +L +   F   KPV LI+ L+N  +  EN IILDFFAGS TT HAVM+ N++    GNR+FI+    E+T++
  S:   181 MMYSRLKLARNLLTDDGVIFISIDDNEQANLKRICDEIFGEKNFISTIP-RQTSAQRPSQEKYVSITHDYILVYAKVKKH---NFQHVIKRDLRDLKQ-----DANGLYI----------------------EGDTSPILASSTQGYSSGGDYDIEFKGKI-YQPIDSNGNRRRWLWTKPRMEKAISLNLVVETKTTLRVQNYINKEF-QVGTNILVDKNPNLILTTNDLISPYYVNQKATSMLNELNLNKVFDFSKPVALIELLVNLSALQENDIILDFFAGSSTTAHAVMQFNAE--NGGNRRFIMVQLPEKTEE 462
>gi|194502229|ref|YP_002031807.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1655] >gi|184214641|gb|EDU11684.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1655] (671 aa)
Score = 278, Expect = 9.7e-23, Identities = 95/317 (29%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++     A      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   182 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQRMLDAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPMPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 495
>gi|26251181|ref|NP_757221.1| hypothetical protein c5373 [Escherichia coli CFT073] >gi|26111613|gb|AAN83795.1|AE016771_306 Hypothetical protein c5373 [Escherichia coli CFT073] (670 aa)
Score = 278, Expect = 1.0e-22, Identities = 96/297 (32%), Positives = 150/297 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINK--------KKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISS---SKGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RLK ++ LL+DDG+I I ID+NE   L+ L+ +I+GE N +  IVWDKRN + D   + + HE I  Y K+ + FK    F+  K        K  Q++    G  E      ++   W    +    EK      D   V R  ++   + + K+  +  F+P+  P+  K   +    W    A       + ++ K+G  +F  DEK       +   ++ +N ++ +NI S     GS+   L  L I F  PKPV++ K LI      + I++DFFAGS T  HA+M LN++     NR+FI+
  S:   190 MMYSRLKLSRNLLRDDGLIVIHIDENEYPNLEKLLAEIYGEKNNLGTIVWDKRNPKGDATGVAQQHELICIYCKDREFFKTTCEFQRPKENAGKMLAKAKQILSKEGGVTEKA---RKEYKDWVNQQDLTGGEKAYNQIDDNGDVFRPVSMA--WPNKKKAPEDYFIPLIHPVTGKECPVPERGWRNPPA------TMQELLKSGLIIFGPDEKT------QPTRKYRLNDNLFENIPSLLYYGGSDDALLADLKIPFDTPKPVQVAKRLIQSICKNDDILIDFFAGSCTAAHALMLLNAE--DGANRRFIM 482
>gi|172059095|ref|YP_001806747.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria MC40-6] >gi|171991612|gb|ACB62531.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria MC40-6] (668 aa)
Score = 278, Expect = 1.0e-22, Identities = 93/317 (29%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIERIE-KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD  ++  D  +  L    + + K+  ++ F P+  P+  K   +    W     +    IER + +  P  T     ++Y DE  Y+ V   S++ F           +      L+ LGI F  PKPV+    +I   +  + I+LD FAG+G+TGHAVM++N+     G R++IL    E   ++D  +  A D C
  S:   179 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLEQAPLKRPKRNAQRM---LDAAHDAVYRSGNAKDAQKAYRAWMKAQTNLSGGEVMYD--RLSADGRVYRLVSMAWPNKKKAPEEYFTPLIHPVTGKPCAMPARGWRNPPATMQALIERGQIEFGPDETTQPQRIYYLDENMYENVP--SVLPF-----------AGSDDALLKTLGIPFDQPKPVDFAAAVIGWCTRGDDIVLDCFAGAGSTGHAVMQVNA--TDGGARRYILVQLPETLDRRDKTQLAAADFC 492
>gi|167631025|ref|YP_001681524.1| DNA methylase [Heliobacterium modesticaldum Ice1] >gi|167593765|gb|ABZ85513.1| DNA methylase [Heliobacterium modesticaldum Ice1] (637 aa)
Score = 277, Expect = 1.2e-22, Identities = 102/297 (34%), Positives = 149/297 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSK--NWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNIS----SSKGSNTLRKLGIEFP------NPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RLK AK LLK+DG+IFISIDDNE + LK+L D++FG ++FI +IVW   +  N+N     ++H YIL Y+K  +WK   +N     N  K Q  +                       NP  + + P  D +P  V       NL  D   I   G +   PP  NG    W WS        ++ I +  K G   F  DE    + ++   ++     S+  ++     + +    L+KL  E P       PKP  L+K+++   S+ NAI+LDFF+GS T+  AVM+LN++    G RKFI+
  S:   176 MMYPRLKVAKDLLKEDGVIFISIDDNEHSNLKLLCDEVFGSNSFIGDIVWRSSDNSNNNALTFSEDHNYILVYAKSPDWKPNFLN-----NDSKRQHFK-----------------------NPDNDPRGPWFDGNP--VNNPGLRPNLQFDI--ITPSGKLIKHPP--NG----WRWS--------KETIEEKLKTGELRFSEDETRLIRRTYLYEMKGLPPSSLCIDLEITGHTRRAKYELKKLFPEVPVTSLFSTPKPTLLLKYILTIASDNNAIVLDFFSGSATSADAVMQLNAE--DGGKRKFIM 437
>gi|53724233|ref|YP_104200.1| type III DNA modification methyltransferase [Burkholderia mallei ATCC 23344] >gi|194316802|ref|YP_002012626.1| type III DNA modification methyltransferase [Burkholderia mallei ATCC 10399] >gi|52427656|gb|AAU48249.1| type III DNA modification methyltransferase [Burkholderia mallei ATCC 23344] >gi|160695957|gb|EDP85927.1| type III DNA modification methyltransferase [Burkholderia mallei ATCC 10399] (677 aa)
Score = 277, Expect = 1.4e-22, Identities = 95/317 (29%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++     A      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   188 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQRMLDAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 501
>gi|167916925|ref|ZP_02504016.1| type III DNA modification methyltransferase [Burkholderia pseudomallei BCC215] >gi|194576086|ref|YP_002110969.1| type III DNA modification methyltransferase [Burkholderia mallei 2002721280] >gi|148026407|gb|EDK84492.1| type III DNA modification methyltransferase [Burkholderia mallei 2002721280] (674 aa)
Score = 277, Expect = 1.4e-22, Identities = 95/317 (29%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++     A      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   185 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQRMLDAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 498
>gi|67641556|ref|ZP_00440332.1| COG2189: Adenine specific DNA methylase Mod [Burkholderia mallei GB8 horse 4] >gi|121598234|ref|YP_994560.1| type III DNA modification methyltransferase [Burkholderia mallei SAVP1] >gi|124383968|ref|YP_001027824.1| type III DNA modification methyltransferase [Burkholderia mallei NCTC 10229] >gi|126448952|ref|YP_001082228.1| type III DNA modification methyltransferase [Burkholderia mallei NCTC 10247] >gi|134281343|ref|ZP_01768051.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 305] >gi|167001631|ref|ZP_02267425.1| type III DNA modification methyltransferase [Burkholderia mallei PRL-20] >gi|167717412|ref|ZP_02400648.1| type III DNA modification methyltransferase [Burkholderia pseudomallei DM98] >gi|167892155|ref|ZP_02479557.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 7894] >gi|194523154|ref|YP_002058686.1| type III DNA modification methyltransferase [Burkholderia mallei FMH] >gi|194528143|ref|YP_002063665.1| type III DNA modification methyltransferase [Burkholderia mallei JHU] >gi|121227044|gb|ABM49562.1| type III DNA modification methyltransferase [Burkholderia mallei SAVP1] >gi|124291988|gb|ABN01257.1| type III DNA modification methyltransferase [Burkholderia mallei NCTC 10229] >gi|126241822|gb|ABO04915.1| type III DNA modification methyltransferase [Burkholderia mallei NCTC 10247] >gi|134247010|gb|EBA47096.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 305] >gi|147747164|gb|EDK54240.1| type III DNA modification methyltransferase [Burkholderia mallei FMH] >gi|147752153|gb|EDK59219.1| type III DNA modification methyltransferase [Burkholderia mallei JHU] (671 aa)
Score = 276, Expect = 1.4e-22, Identities = 95/317 (29%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++     A      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   182 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQRMLDAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 495
>gi|53717681|ref|YP_106667.1| type III restriction-modification system methylase [Burkholderia pseudomallei K96243] >gi|52208095|emb|CAH34025.1| type III restriction-modification system methylase [Burkholderia pseudomallei K96243] (670 aa)
Score = 276, Expect = 1.4e-22, Identities = 95/317 (29%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++     A      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   181 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQRMLDAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 494
>gi|126440391|ref|YP_001057101.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 668] >gi|167736454|ref|ZP_02409228.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 14] >gi|167900667|ref|ZP_02487872.1| type III DNA modification methyltransferase [Burkholderia pseudomallei NCTC 13177] >gi|126219884|gb|ABN83390.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 668] (671 aa)
Score = 276, Expect = 1.4e-22, Identities = 95/317 (29%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++     A      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   182 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQRMLDAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 495
>gi|167813529|ref|ZP_02445209.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 91] >gi|194518175|ref|YP_002053597.1| type III DNA modification methyltransferase [Burkholderia pseudomallei S13] >gi|169651498|gb|EDS84191.1| type III DNA modification methyltransferase [Burkholderia pseudomallei S13] (671 aa)
Score = 276, Expect = 1.4e-22, Identities = 95/317 (29%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++ +        +  K+  Q ++     A      +   N  +  +    T        YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   182 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARDAERLFERAPLKRPKRNAQRMLDAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 495
>gi|194569733|ref|YP_002104735.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 406e] >gi|157808512|gb|EDO85682.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 406e] (677 aa)
Score = 276, Expect = 1.7e-22, Identities = 97/317 (30%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEIN--KKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMD----YDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++       ++FE    K+  +  Q  +GA  + +            +      +  L      YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   188 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARD-----AERLFERAPLKRPKRNAQRMLGAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 501
>gi|76811368|ref|YP_331675.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1710b] >gi|126452068|ref|YP_001064331.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1106a] >gi|194512718|ref|YP_002025242.1| type III DNA modification methyltransferase [Burkholderia pseudomallei Pasteur 52237] >gi|76580821|gb|ABA50296.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1710b] >gi|126225710|gb|ABN89250.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1106a] >gi|157934259|gb|EDO89929.1| type III DNA modification methyltransferase [Burkholderia pseudomallei Pasteur 52237] (677 aa)
Score = 276, Expect = 1.7e-22, Identities = 97/317 (30%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEIN--KKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMD----YDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++       ++FE    K+  +  Q  +GA  + +            +      +  L      YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   188 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARD-----AERLFERAPLKRPKRNAQRMLGAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 501
>gi|150008744|ref|YP_001303487.1| methyltransferase [Parabacteroides distasonis ATCC 8503] >gi|149937168|gb|ABR43865.1| methyltransferase [Parabacteroides distasonis ATCC 8503] (602 aa)
Score = 276, Expect = 1.7e-22, Identities = 110/298 (36%), Positives = 146/298 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKN----WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNG--YSLFYADEKEYKQVSHKSIVRFNINQSIIDNI-SSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT 299
           MS RL+ AK+LL D G+IFISIDDNEQA LK+L D IF   NF    +W K++     ++Y    HEYIL Y       WK+ +I +                         +RKN  +          K+        K +R S    +   D E     F P+ P  K G   RW     K    I+  + +  KNG  Y   Y  E E K  + KS       +SI+ N+  +  GSN L  +  E   F NPKP+ LIK LI+ H++ N  ILDFF+GSGTT HA M+LN++    GNR+ IL T
  S:   137 MSRRLRIAKKLLSDYGVIFISIDDNEQADLKILCDSIFMPSNFCGQFIWRKKSGGGQTDRYFVTEHEYILVYQATNKFCWKDIQIEK-------------------------SRKNYKYQDEKGSYNLIKLEKWGSSAHKEDRPSMYFPIKNPDGE----DFYPVAPDGKAG---RWRVGVKKMQTLIKDNLIEW-KNGIPYEKDYYSETEVKTKTQKS-------RSILYNVGETGDGSNLLTNIFREKDVFQNPKPLSLIKELIS-HNSAN-YILDFFSGSGTTLHATMQLNAE--DGGNRQCILIT 401
>gi|77166378|ref|YP_344903.1| site-specific DNA-methyltransferase (adenine-specific) [Nitrosococcus oceani ATCC 19707] >gi|76884692|gb|ABA59373.1| Site-specific DNA-methyltransferase (adenine-specific) [Nitrosococcus oceani ATCC 19707] (624 aa)
Score = 276, Expect = 1.7e-22, Identities = 109/361 (30%), Positives = 174/361 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN---WKNFKI--------NQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFL--INKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADV 361
           MM  RLK AKQLL  +G+IFI+IDDNE A L+ + D+IFGE+NF+++IVW K+ +  ND  +   +H++IL Y+KN   W+ FK+        N     N  +G     T   N+D     R N+ + L  NP T +     D  PKK         ++K  +E+  K             ++ W         R++K + K         +     Y  V H       +++ I D               I+F  PKPV LI+ +  I+   +   I+LDFFAGS +T HA++ +N++  +  NR+FI+    E  + +  ++IA DI   R       +K +G+   N + D      D   K F ++ +++
  S:   175 MMYPRLKLAKQLLSQEGVIFITIDDNEVATLRQVCDEIFGEENFVTSIVWQKKVSPSNDATWFSSDHDHILVYAKNKLIWRPFKLPMNERQKSNYTNPDNDPRGNWNSATYTCNKDS--DERPNLYYPL-VNPNTGQ-----DVWPKKTA-------VWKYSREVSQKH--------AEENIIYWGKDGTSNSPRLKKFLSKAKGVVPRTVWL----YSDVGHTQEATKVLSELIDD---------------IKFDTPKPVRLIEHMLRISTGGDSEEIVLDFFAGSASTAHAILNINANEGS--NRRFIMVQLPELLESESYRSIA-DIGKRR-------VKEAGKKITNENPDATF---DQGFKVFKLSSSNI 494
>gi|167822072|ref|ZP_02453543.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 9] (671 aa)
Score = 276, Expect = 1.7e-22, Identities = 97/317 (30%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEIN--KKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMD----YDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++       ++FE    K+  +  Q  +GA  + +            +      +  L      YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   182 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARD-----AERLFERAPLKRPKRNAQRMLGAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 495
>gi|161359589|ref|ZP_02105456.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1106b] >gi|161371794|ref|ZP_02111357.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 1710a] >gi|167843680|ref|ZP_02469188.1| type III DNA modification methyltransferase [Burkholderia pseudomallei B7210] >gi|167908886|ref|ZP_02495977.1| type III DNA modification methyltransferase [Burkholderia pseudomallei 112] (671 aa)
Score = 276, Expect = 1.7e-22, Identities = 97/317 (30%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEIN--KKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMD----YDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI-NKTIAKDIC 317
           M+  RLK A+ LL +DG+I + ID++EQ  L ++M +IFGEDN +   VWDKRN + D + I   HE I+ ++++       ++FE    K+  +  Q  +GA  + +            +      +  L      YD  ++  D  +  L    + + K+  D  FVP+  P+  K   +    W    A  R       +   G   F ADE    Q        + +++++ +N+ S     GS+   ++ LGI F  PKPVE    +I   ++ + +I+DFF GSGTT HAVM LN+     G+R+++L    E    D  ++  A D C
  S:   182 MIYPRLKLARDLLTEDGVIAVHIDEHEQHALVLVMREIFGEDNELGVAVWDKRNPKGDARGIAYQHESIVLFARD-----AERLFERAPLKRPKRNAQRMLGAAREAVAGAATIADANAAYRGWVKSQTTLSGGEAMYD--RISADGRVYRLVSMAWPNKKKAPDDYFVPLVHPVTGKPCPVPERGWRNPPATMR------ALIDKGLVEFGADETTQPQRI------YFLDENMYENVPSVLPFGGSDDALMKSLGIPFDQPKPVEFAASIIGWCTDGDDLIVDFFGGSGTTAHAVMALNA--ADGGHRRYVLVQLPEPLDADSKDQKAAADFC 495
>gi|120608867|ref|YP_968545.1| site-specific DNA-methyltransferase (adenine-specific) [Acidovorax avenae subsp. citrulli AAC00-1] >gi|120587331|gb|ABM30771.1| Site-specific DNA-methyltransferase (adenine-specific) [Acidovorax avenae subsp. citrulli AAC00-1] (668 aa)
Score = 276, Expect = 1.7e-22, Identities = 95/307 (30%), Positives = 149/307 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ-----LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPL---MDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK-IIPKMTKNGYSLFYADEK--EYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           MM  RLK A+QLLK+DG IF+SIDD E   LK+ +D++FGEDN I+  VW      ++   ++  HEYI+AY+K+  NF    V + +           I+ TI  N                 NP +   +P     D+D   +E  +    +YK    I  +G   I P +   V   WS S D  +E +    +P     G S  +   +    + +  ++  + ++   +     + K ++ L +LG  F   PKP+ELI++L       + I LDFFAGS   GH + E N++   +G R+F+L    E+   D
  S:   184 MMYPRLKLARQLLKEDGAIFVSIDDIELPRLKIALDELFGEDNLIAQFVWRSDGNFDNQAKVKVCHEYIVAYAKSAPNFAHPPVVDPSTPTDSKIFRPQIRNTIVKNGPK--------------NPPSEILLPAGFPADFDDGVIEGRTEGWPIYKGAAVI--RGGRLIAPAL---VESGWS-SKDLLLEFVANGCLPIFDGKGQSTSFVISRTGAIEVIKERTDTKSHVISVLTGFGGTQKATSQLEELGAFFNGYPKPLELIRYLTKMVPGNDGIFLDFFAGSAPLGHVIYEQNAE--DEGTRRFVLVQLPEQLSPD 480
>gi|52425081|ref|YP_088218.1| hypothetical protein MS1026 [Mannheimia succiniciproducens MBEL55E] >gi|52307133|gb|AAU37633.1| unknown [Mannheimia succiniciproducens MBEL55E] (649 aa)
Score = 276, Expect = 1.8e-22, Identities = 104/303 (34%), Positives = 151/303 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLY-FNPATNEKIPLMDYDPKKVERDST---IENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII--DNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           M  RL  A++LLK+DG+IFISIDDNE A LK+L D++FGE NF++ +         ND       HE+ L Y KN      N V ++N    +   +   + ED   + +   G TL     A +       Y P  V  + T   +E   +DD E+         P    G  + W  S +   +   + I K T +G S +       KQ   + + +    +S+      SS  G+  L  L  +  F NPKP+EL+K  I+    +N +ILDFFAGSG+T HAVM+LN++    GNR+FIL    E+T
  S:   178 MYPRLYVARELLKEDGVIFISIDDNEVAQLKLLCDEVFGEGNFVAKLPTIMNLKGNNDEFGFAGTHEFTLVYIKN-----KNSVEDLNGIPLENEDLAEYSKEDE--IGKYKQGATLMRTGEAGSRNARPKGYYPIYVNTELTRMSLERQKEDDFEVY--------PKTTKGKDMSWRRSPETLSKTFSEFIIKKTSSGISFY------KKQRLEEDLEKGKKPKSLFYKPQYSSGNGTTLLESLFGKRIFNNPKPIELLKDFISIGMGKNDLILDFFAGSGSTAHAVMQLNAE--DGGNRQFILVQLPEQT 466
>gi|15645218|ref|NP_207388.1| adenine specific DNA methyltransferase (mod) [Helicobacter pylori 26695] >gi|2313713|gb|AAD07659.1| adenine specific DNA methyltransferase (mod) [Helicobacter pylori 26695] (598 aa)
Score = 275, Expect = 1.8e-22, Identities = 112/344 (32%), Positives = 167/344 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYS------------KNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLI--NKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKK 345
           M  RLK A+ LLK+DG+IFISIDDNE A LK+L D+IFGEDNF+ + +   ++  ND K  +   HE++L Y+            KN +N+K       N   G  I     A    +       G+    NP TN+    +DY P  +    +   + K     ID+G +  +   K+              +R  K +    K   SL ++D     Q + K ++                       +G  F  PK VE +K +I  +   NE  IILDFFAGSGTT HAVMELN++   KGNR+FIL   +E  K+D +   A D C        K +K++    ++++++ +K+
  S:   167 MLPRLKLARDLLKEDGVIFISIDDNECANLKILCDEIFGEDNFVGDFIRKTKSTTNDAKIGLNYQHEFLLCYAKDKNYTNLLGGEKNLENYKNPD----NDPNGAWINDNPSAKSGNM-----KTGYFGVTNPYTNK----VDYPPVGMFWRFSQNTIQKH----IDEGRICFKKEHKDN-------ERGFIYKRYLKDLKTTQKTFDSLIFSDNCYMNQAATKELLNLG--------------------MGEYFTYPKGVEFMKKIILHSTTPNEGDIILDFFAGSGTTVHAVMELNAE--DKGNREFILVQIDEEIKEDES---AYDFC-------KKELKSAKPVISDITIERVKR 469
>gi|34762302|ref|ZP_00143306.1| TYPE III RESTRICTION-MODIFICATION SYSTEM METHYLATION SUBUNIT [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27888024|gb|EAA25087.1| TYPE III RESTRICTION-MODIFICATION SYSTEM METHYLATION SUBUNIT [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (524 aa)
Score = 275, Expect = 2.0e-22, Identities = 120/384 (31%), Positives = 200/384 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFIS---NIVWDKRNAQNDNKYIEKNHEYILAY-----SKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENA-IILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ--DINKTIAKDIC---FERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADV-SINSNIDKLLEEIKKSMRLIHRD 384
           MM  RLK A+ LL DDG+IFISIDDNEQA LK + D+IFGE+NF++           A N +  + K ++++  Y     +K  KN K ++ +    K G+   + + A+                 + AT    P M Y     E  S   ++  ++K I+ K  +P +   ++G   RW W  ++  E  EK      +  Y   Y DE E + V       + + ++  D+ ++++G+    +L  +   F +PKP++LIK LIN  + EN+ +ILDFF+GS TT H+VM+LN++    GNRK+I+    E   +  +  K   K+IC    ER+    + IK+      +L ++  +K  D+  K F ++ +++   ++N   L + +  SM  I  D
  S:    58 MMYPRLKLARNLLTDDGVIFISIDDNEQANLKKICDEIFGEENFVAVAPRKTGAGSAATNSDSELRKLNDFLFIYLKSRKAKFRKNIKGSRKYPYEDKNGKYELVKLQASG----------------SDATRRARPKMYYSIYLKEDGSLTTDM--NEKNIV-KEIIPNKVNEEDG---RWIWGKERFEEMKEKFTYYDGETIYRKLYYDETEDQNV-------YQVEKAWFDSFTNAQGTKEFDELFKKKKIFSHPKPIDLIKLLINLSNKENSFLILDFFSGSATTAHSVMQLNAE--DGGNRKYIMVQLPELCDESSEAYKAGYKNICEIGKERIRRAGEKIKSD----ESLPLENREKL-DIGFKIFKLDSSNIKEWDTNTKDLQQTLLDSMENIKSD 423
>gi|126179426|ref|YP_001047391.1| DNA methylase N-4/N-6 domain-containing protein [Methanoculleus marisnigri JR1] >gi|125862220|gb|ABN57409.1| DNA methylase N-4/N-6 domain protein [Methanoculleus marisnigri JR1] (1055 aa)
Score = 275, Expect = 2.0e-22, Identities = 100/297 (33%), Positives = 152/297 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKN-WKNFKI------NQVFEINKKKGQ-----LIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKM--TKNGYSLFYAD----EKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM +RL  A  ++ + G +F SIDD+E   L+ LM+  FG  NFIS I V +    ++D   I   HE +L Y +N +K F +       Q +      G      L +   GA  +    +R N+ + +Y+NP +N++I L                         +  F+ I P + +G   RW W  +   E I+KI+ K   T++ Y +F  D    + E K    KSI        +    SS  G++  +KL   ++F NPK  ELIK +++  S E  IILDFFAGSGTTG +V+E+N    +   RK++L
  S:   546 MMGDRLNLAHTIISNHGALFSSIDDHEIVNLRSLMNSTFGSLNFISTISVVNNLKGRSDRANIATAHENLLMYIRNDFKAFDLPLPDNYRQEYAERDDNGPYRLQGLRKRGAGARRE----DRPNLYYPIYYNP-SNKEISLEG-----------------------NGSFIKILPKLSDGSDGRWRWKKETVRENIQKILIKKVSTRDEYDVFQKDYLLIDGEEKGTKAKSI-------WLDTKYSSDYGTHAYKKLLGEVQFDNPKSPELIKDILHISSGEEDIILDFFAGSGTTGQSVLEINKTQTS--TRKYVL 826
>gi|108563818|ref|YP_628134.1| type III R-M system modification enzyme [Helicobacter pylori HPAG1] >gi|107837591|gb|ABF85460.1| type III R-M system modification enzyme [Helicobacter pylori HPAG1] (654 aa)
Score = 274, Expect = 2.5e-22, Identities = 113/320 (35%), Positives = 156/320 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFE---------INKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIP--KMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSI--IDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTK----------------GNRKFILCTNEERTKQDINKTIAKDICFERL 321
           M  RL  AK LLK DG+IFISIDDNE A LK+L D+IFGE NF++ +    + A      I KNH+Y+L Y KN  NFK   + E          N++ G  +   +  N    L   K M + +           L  Y  ++     TI+ +++  K   D G       +KN  +   +++  K  +     I     TKN  S+ + D K    +S+K +      QSI  + NI               F   KPVELI FLI++ + +  IILDFFAGSGTT HAV+E N     K                  R+FIL   +E+     NK+ A D C   L
  S:   171 MYPRLLLAKDLLKQDGVIFISIDDNECANLKILCDEIFGEGNFVAEMPRLTKKAGKSTNQIAKNHDYVLCYQKNSINFKQIDIDENDYSLKDEFYNERGGYKLNQNLDYNS---LQYNKRMDYEIVIGNEKFYAGGLETYTERQKGNFGTIDWVWRWSKAKFDFGLANGFVEVKNNRIYTKTYTKAKISDSKPYKIEYFNRTKNISSIEFLDNKYSNDMSNKKL------QSIFNVKNI---------------FDYSKPVELISFLIDQTTEKGDIILDFFAGSGTTAHAVLESNKSDYQKLSEGGGGLFNGLNAAFKERRFILVQLDEKIDPKKNKS-AYDFCLNTL 494
>gi|149194672|ref|ZP_01871767.1| hypothetical protein CMTB2_04807 [Caminibacter mediatlanticus TB-2] >gi|149135095|gb|EDM23576.1| hypothetical protein CMTB2_04807 [Caminibacter mediatlanticus TB-2] (683 aa)
Score = 268, Expect = 1.3e-21, Identities = 110/296 (37%), Positives = 150/296 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK--IIPKMTKNGYSLFYADEKEYKQVSHKSIVR-FNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSN--ENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           M  RL  A++LL+ DG+IFISIDDNE A LK+LMD+IFGE+NFI+  +      A+ D  +I    +YIL YSKN      N+ F  N  KG + +           +N+ + G   Y   +++   P+   D   +    T EN                     NG    W WS DK    I+   I+ K  K G    Y  + ++    +K I R       +++N ++  GS  + +L  +  F  PKP  LIKFLIN  SN   N IILDFFAGSGTTG AVM+LN +     +RKFIL
  S:   173 MYPRLYIARRLLRKDGVIFISIDDNEIAQLKILMDEIFGEENFIAQFIRKTGIAARLDATHISTEQDYILCYSKNLNLSSFNKQFS-NINKGYIYEDKHYKIRGKYKLNKLDRGSIRY---SSSLDYPIESPDGTLIYPGGTPEN---------------------NGWC--WRWSKDKVEWGIKNDFIVFKKDKAGNWKVYFKQYQFVDNDNKPIKRTLPFKTLLLENYNNEIGSKEILELFSKKIFSYPKPTTLIKFLINLVSNPDNNDIILDFFAGSGTTGDAVMQLNVENGV--DRKFIL 447
>gi|167585031|ref|ZP_02377419.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ubonensis Bu] (672 aa)
Score = 268, Expect = 1.5e-21, Identities = 87/297 (29%), Positives = 152/297 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKN------MGWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIER-IEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RLK A  LL D G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +   +++   + + K    +M   A++   LV R          +  +    TN     + YD  ++  D  +  L    + + K+  D+ FVP+  P+  K   +    W     +    +ER + +     T     ++Y DE  Y+ V   S++ F  +   +           L+ LG+ F  PKPV+    +I   +  + I++D FAGSG+TGHAVM+LN+     G R+++L
  S:   183 MMYPRLKLAHALLSDAGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAE--ALHEATPLKRPKRNAQRMLDAAHD---LVRRSGTHADAAQAYRAWVKAQTNLSGGEVMYD--RLSEDGRVYRLVSMAWPNKKKAPDEYFVPLVHPVTGKPCAMPERGWRNPPATMQALLERGLIEFGADETTQPQRIYYLDENMYENVP--SVLPFGGSDDAL-----------LKALGVPFEQPKPVDFAAAVIGWCTRGDDIVVDCFAGSGSTGHAVMQLNA--TDGGARRYVL 475
>gi|121634979|ref|YP_975224.1| pseudogene (putative type III restriction-modification system modification protein) [Neisseria meningitidis FAM18] >gi|120866685|emb|CAM10437.1| pseudogene (putative type III restriction-modification system modification protein) [Neisseria meningitidis FAM18] (658 aa)
Score = 267, Expect = 1.6e-21, Identities = 97/305 (31%), Positives = 148/305 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNF-KINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDK--AIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHS---NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           M  RL  A++LLKDDG+IFISIDDNE A LK+L D++FGE NFI +++ +      + KY+   HE +L Y+K+  +F  + +  +I  KK  +        ED +       G   Y +    + I   +   K +E +  I       K II             G L + S  F K  +I  I  I   +TK+G        +E +++                   + KG +        F  PKP++L+K L+   +   N+  +ILDFFAGSGTT HAVM+LN++ +  GNR++I     E+T +
  S:   216 MYPRLYIARELLKDDGVIFISIDDNEAAQLKLLCDEVFGEGNFIKDLIVNTSEGGGNAKYVVNGHETVLVYAKDITHFDNLKRPKDIRGKKIVINDELYWIQEDAVREQFGKYGNLHYEDIIEIKGIEFKNKIDKDIENNEYILIPKSYGKTII-------------GKLRKVSDDFSKFHSILNIGNISKNLTKDGI-------RELEEL-----------------FETGKGYSP-------FETPKPLDLLKRLVLSATFKGNQTDLILDFFAGSGTTAHAVMQLNAEGQN-GNRRYICVQLPEKTAE 481
>gi|150398910|ref|YP_001322677.1| site-specific DNA-methyltransferase (adenine-specific) [Methanococcus vannielii SB] >gi|150011613|gb|ABR54065.1| Site-specific DNA-methyltransferase (adenine-specific) [Methanococcus vannielii SB] (646 aa)
Score = 267, Expect = 1.9e-21, Identities = 96/317 (30%), Positives = 156/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN--AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKS--IVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN--KTIAKDIC 317
           MM  RL+ A +LLK DG+IFISIDDNE   LK + ++IFGE+NFI+ +VW+ +     +D+K+    HEYIL Y+K+          E+ + KG+  +           V  +     +  N  + +    +DY+ +    +                       P +NG    W WS  K    I+    +  +N     +   K+Y ++ H    I R   ++ +I   SS++ +  + K+  +  F   KP +LI+FL    ++++  ILDFF+GS TT HAVM+LN++    G+RKFI+    E  ++     K   K+IC
  S:   180 MMYPRLQLAYKLLKKDGVIFISIDDNEVDNLKKVCNEIFGENNFIAQLVWENKEGGGSSDSKFFRIKHEYILVYTKS---------IELAELKGEFKKEDSSYAYSDEFVEERGRYKLIKLNSFSIQYSKSLDYEIEMPNGEKVT--------------------PSENGKRGCWRWSKTKFEWGIKNNFIEFKENTDGKLWVYTKQYFKLDHNGNPITRSVPHRGVIAKYSSTQATKQMEKIFGKKMFDYSKPYDLIQFLGLLATDKDDTILDFFSGSATTAHAVMQLNAE--DNGSRKFIMVQLPEEVEEGTEAFKAGYKNIC 473
>gi|177676279|ref|ZP_02946694.1| Site-specific DNA-methyltransferase (adenine-specific) [Methylocella silvestris BL2] >gi|172069612|gb|EDT55721.1| Site-specific DNA-methyltransferase (adenine-specific) [Methylocella silvestris BL2] (647 aa)
Score = 267, Expect = 2.0e-21, Identities = 120/401 (29%), Positives = 193/401 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIID----KGFVPIRP---PIKNGVL--------LRWSWSFDKAIERIEKIIPKMT--KNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENA-IILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKK------YQDVSLKTFNINYAD--VSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFT 401
           MM  RL  A+ LL+DDG IFISIDDNE   L+ LMD IFGE+NF++ I+W K  A +N  K+   +H+YIL Y++N   +K                          L+ R      LY NP  +++ P M         + T  N Y +    +     K F P +    P+             + W  S D ++ R ++ + +++  +   +L+     +Y++V H    +  +N+     +   +  NTL  +       KPV LI+ +I   +  +  I+LDFFAGSGTTG AV+E + D   +  R+FI+    EE  K + N     D    R    +KN+  + +S      D LKK      ++  +L + N    D  VS +S+++  L+     +R      D+  E ++K  + L T
  S:   198 MMFPRLYLARNLLRDDGAIFISIDDNEVHNLRALMDQIFGEENFVATIIWQKVYAPKNSAKFFSDDHDYILVYARNSDQWKPE------------------------LLERTPEQDALYKNPDKDQRGPWM-------SDNLTARNFYGEGSYEVTGPSGKKFTPGKGRYWPVSQSKFNDLNADGRIWWGVSGD-SMPRYKRYLSEVSAGRVPQTLW-----KYEEVGHTQDAKRELNKY----VPYEETENTLNSV-------KPVNLIRRMIKIATKSDGDIVLDFFAGSGTTGQAVIEQSLDDGIR--RRFIMVQLPEELPKPEANFKTISDFARAR----VKNVIAASQS------DLLKKDSHGRGFRSFALDSSNFRSWDGGVSTSSDLESQLQLHVDHLRDAGEPEDVLYELLLKSGFPLAT 566
>gi|138894944|ref|YP_001125397.1| Type III restriction-modification systemmethyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|134266457|gb|ABO66652.1| Type III restriction-modification systemmethyltransferase [Geobacillus thermodenitrificans NG80-2] (474 aa)
Score = 265, Expect = 2.7e-21, Identities = 90/303 (29%), Positives = 142/303 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYD-------PKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLR---------------WSWSFDKAIERIEKII----PKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEER 303
           MM  RL  AK LL + G IFISIDD EQA LK + D+IFGE NF++  +W +  +  N NK+  +NH++IL Y+KN        +   ++  G+                        Y NP  + + P M  D       P+K+              +I+  G   + PP  +G   R               W       + R+++ +    P MT    +++  DE  + Q + K +       +++D                    PKPV+LI+ ++   + ++ +ILDFF+GS TT HAVM+ N++    G R FI+    ER
  S:   154 MMYPRLWMAKALLAETGAIFISIDDTEQANLKKMCDEIFGEHNFVATFIWQRAFSPVNMNKFASRNHDFILCYAKNIDRLAWYGLPRDSEANGR------------------------YANPDNDPRGPWMSGDLSVGPPIPEKI-------------YDIVTPGGRVVSPP--SGYCWRVTKERFAELAADNRIWFGKDGNGVPRLKRFLREVKPTMTP--LTIWTHDEVSHSQEAKKELKELFDGVAVMD-------------------YPKPVKLIQRMVALTTKDDDVILDFFSGSATTAHAVMQQNAE--DGGQRSFIMVQLPER 421
>gi|146318337|ref|YP_001198049.1| putative modification enzyme of type III restriction-modification system [Streptococcus suis 05ZYH33] >gi|146320531|ref|YP_001200242.1| putative modification enzyme of type III restriction-modification system [Streptococcus suis 98HAH33] >gi|145689143|gb|ABP89649.1| putative modification enzyme of type III restriction-modification system [Streptococcus suis 05ZYH33] >gi|145691337|gb|ABP91842.1| putative modification enzyme of type III restriction-modification system [Streptococcus suis 98HAH33] (429 aa)
Score = 265, Expect = 3.1e-21, Identities = 111/347 (31%), Positives = 170/347 (48%)
  Q:    20 FISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNI-------------SSSKGSNTLRKL---GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKN-IKTSGESFNNLSVDELKKYQDVSLKTFNI---NYADVSINSN 366
            ISIDDNEQA LK + D+IFGE+NF+++++W++  A  N  K+  ++H+YIL Y+KN + F +N                I  +ED    N +      Y NP  + + P    D       +   N+Y    EII      I PP         SW   K  ER E+            F AD + +   +  ++ R     S + N               S   S  L+KL      F  PKPV L+K ++  +S ++ +ILDFFAGS TT  AVM+LN++    GNRK+ILCT +E   Q  +K+ AK+  +E +  + +  I+ + +       + + K QD   + + +   N+ DVS   N
  S:     5 LISIDDNEQANLKAICDEIFGEENFVADVIWERAFAPVNLKKHFSESHDYILVYAKNVE-FAVNH--------------GIPRSEDS---NSR------YQNPDNDVRGPWTSGDLSV--GPAVPSNIY----EIISPSGRSIFPPSGR------SWLLSK--ERFEE------------FIADNRIWFGANGDNVPRIKRFLSEVKNTVTPMTIWKYADVGHSQSASQDLKKLFDGKAYFTYPKPVPLMKQIVQLYSEKDGLILDFFAGSATTADAVMQLNAE--DGGNRKYILCTLDE---QVADKSAAKEAGYETIDQISRERIRRAAKKIQEEHPETVGK-QDFGFRAYKLDTSNFKDVSQTPN 316
>gi|188585004|ref|YP_001916549.1| DNA methylase N-4/N-6 domain protein [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179349691|gb|ACB83961.1| DNA methylase N-4/N-6 domain protein [Natranaerobius thermophilus JW/NM-WN-LF] (637 aa)
Score = 264, Expect = 4.1e-21, Identities = 94/306 (30%), Positives = 157/306 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK-IIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           MM  RLK A+ LL D G+IFISIDDNE   L  + ++IFGE NF++ I    +       +  K+HE I  Y+KN  N  +N++ +I  KK      T      G  +       T  FN +     P + Y P  V  D+  EN + +      +G+  + P I NG+   W W  + A ++  K ++ +  ++G    Y   ++  ++  K++ +   ++ II +I  +K    L   GI F  PKPV+L+  +I   +++++IILDFF+G+ TT HA ++ N++    G RK+I+    E++ +
  S:   170 MMYPRLKLARNLLNDQGVIFISIDDNESGNLWKVCNEIFGETNFVAEITVIVKTEGRRYGFFAKSHEKIYVYAKNIDNLALNEI-DIKGKK-----FTYRDEFGGFNIKELRNQNTRAFNSSNR---PNLRY-PFYVNTDNVDENGFMEVSVDYQEGWEEVYPMITNGLKSVWRWGKESARQQENKNLVARRGRDGIIRIYQKYRKLTEIP-KTVWK---DKEII-SIKGTKEVQELLGSGI-FDFPKPVKLLSDIITIATDQDSIILDFFSGAATTAHATIKKNAE--DGGTRKYIMVQLPEKSDE 458
>gi|119510950|ref|ZP_01630072.1| Site-specific DNA-methyltransferase (adenine-specific) [Nodularia spumigena CCY9414] >gi|119464389|gb|EAW45304.1| Site-specific DNA-methyltransferase (adenine-specific) [Nodularia spumigena CCY9414] (633 aa)
Score = 263, Expect = 5.1e-21, Identities = 112/360 (31%), Positives = 170/360 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSK--GSNTLRKLGIE---------FPNPKPVELIKFLINKHSNENA--IILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYAD 360
           MM  RL  A+QLLK+DG+IF+SIDD+E   L++LM++IFGE+NF++ + W K+ A  ND       H++IL YSK        Q  +  K    + +M            R      LY NP         D DP+ + + S  + L     E     + PI  P     +    W    A+ R  K   +       +++   +E K  ++K  +   +   I D     K  G N   K  I+         F  PKP  LIK ++   +N ++  IILDFFAGS TT  AV+ELN +    G+R+FIL    ++T      TI+ DI  ER+   I+ IK S      L +   +  +D+  K   ++ ++
  S:   175 MMYPRLFLARQLLKEDGVIFVSIDDHEVHNLRLLMNEIFGEENFVACVCWQKKYAPANDTVDFSATHDFILVYSKQ------RQFLDSGKPIALIGRM-----------ERTEEQNKLYKNP---------DNDPRGLWKAS--DYLCNKSAEQRPNLYYPIIHPKTEEEI----WPSRTAVWRYSKARHQQNVQDNRVWWGLNQENKVPAYKRFLS-EVGGIISDTWWQHKDVGHNDEAKKQIKSLFPEASQSFDTPKPTRLIKRIVELSTNTDSTDIILDFFAGSATTAQAVLELNHE--DTGDRRFILIQLPQKTYNPQFTTIS-DISKERIRRSIQKIKNSANG--KLPLQNRETPEDLGFKVLKLSKSN 510
>gi|196248490|ref|ZP_03147191.1| DNA methylase N-4/N-6 domain protein [Geobacillus sp. G11MC16] >gi|196212215|gb|EDY06973.1| DNA methylase N-4/N-6 domain protein [Geobacillus sp. G11MC16] (474 aa)
Score = 263, Expect = 5.6e-21, Identities = 90/303 (29%), Positives = 142/303 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYD-------PKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLR---------------WSWSFDKAIERIEKII----PKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEER 303
           MM  RL  AK LL + G IFISIDD EQA LK + D+IFGE NF++  +W +  +  N NK+  +NH++IL Y+KN        +   ++  G+                        Y NP  + + P M  D       P+K+              +I+  G   + PP  +G   R               W       + R+++ +    P MT    +++  DE  + Q + K +       +++D                    PKPV+LI+ ++   + ++ +ILDFF+GS TT HAVM+ N++    G R FI+    ER
  S:   154 MMYPRLWVAKALLAETGAIFISIDDTEQANLKKMCDEIFGERNFVATFIWQRAFSPVNMNKFASRNHDFILCYAKNIDRLAWYGLPRDSEANGR------------------------YANPDNDPRGPWMSGDLSVGPPIPEKI-------------YDIVTPGGRVVSPP--SGYCWRVTKERFAELAADNRIWFGKDGNGVPRLKRFLREVKPTMTP--LTIWTHDEVSHSQEAKKELKELFDGVAVMD-------------------YPKPVKLIQRMVALTTKDDDVILDFFSGSATTAHAVMQQNAE--DGGQRSFIMVQLPER 421
>gi|78064690|ref|YP_367459.1| site-specific DNA-methyltransferase (adenine-specific) [Burkholderia sp. 383] >gi|77965435|gb|ABB06815.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia sp. 383] (672 aa)
Score = 261, Expect = 9.7e-21, Identities = 91/317 (28%), Positives = 160/317 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNM--GWTLYFNPATNEKIPLMDYDPKKVERDSTIENL----YKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS---KGSNT--LRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A  LL D+G+I + ID++E   L +++ +IFGE+N +   VWDKRN + D + +   HE ++ +++N +        +  K+  Q +   + A  D +    N K+    +  +    TN     + YD  ++  +  +  L    + + K+  ++ F P+  P+  K   +    W    A       +  + + G   F ADE    Q        + +++++ +N+ S     GS+   L+ LGI F  PKPV+    +I   +  + I+LD FAGSG+TGHAVM++N+     G R+++L    E   ++D  +  A D C
  S:   183 MMYPRLKLAHALLSDEGLIAVHIDEHEVHALVLMLREIFGEENELGVAVWDKRNPKGDARGVAYQHESLVLFARNAETLLEQAPLKRPKRNAQRM---LDAAHDAVYRSGNPKDAQKAYRAWMKAQTNLSGGEVMYD--RLSEEGRVYRLVSMAWPNKKKAPEEYFTPLIHPVTGKPCAMPARGWRNPPA------TMQALIERGQIEFGADESTQPQRI------YYLDENMYENVPSVLPFAGSDDALLKTLGIPFDLPKPVDFAAAVIGWCTRGDDIVLDCFAGSGSTGHAVMQVNA--TDGGARRYVLVQLPEALDRRDKTQQSAADFC 496
>gi|121534470|ref|ZP_01666293.1| Site-specific DNA-methyltransferase (adenine-specific) [Thermosinus carboxydivorans Nor1] >gi|121306963|gb|EAX47882.1| Site-specific DNA-methyltransferase (adenine-specific) [Thermosinus carboxydivorans Nor1] (654 aa)
Score = 260, Expect = 1.1e-20, Identities = 110/317 (34%), Positives = 160/317 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVW-DKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMD-YDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIE--KIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINK--HSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE--RTKQDINKTIAKDIC 317
           M+  RLK AK LL +DG+IFISIDDNE   LK + D+IFGE+NFI+   W  K+   + +K I    EYIL + K             N  K +L      +N+   LV R N   TL F PA   +  L D      V  + T   L++ D  II K  + I      G  +   W+  K  E +E    +   +K G+++F AD+ E  +   + +   +   S+  N  + +   ++  +      PKPV L+K+LIN   + N+   +LDFF+GS TT HAVM+LN++    GNRKFI+    E    K +  K   K+IC
  S:   176 MIYPRLKVAKDLLTEDGVIFISIDDNEVHNLKKICDEIFGEENFIACFTWVKKKKGSHLSKTIRNMVEYILLFGK-------------NALKIELFGEEAYSNKWQPLVKRTNAPKTLVF-PAKKVETTLNDGIYQAGVYGEGTSSLLFETD--IIIKNNLVINEITVTGPFV---WTQSKLNEELELGTRVSLSSKFGFNVFRADQDEKIK---RPVDILDNKMSVGTNEDAYQELLSIFNVENILDYPKPVSLLKYLINTIGYFNKEFTVLDFFSGSATTAHAVMQLNAE--DGGNRKFIMVQLPEPCDEKSEAYKAGFKNIC 476
>gi|167957119|ref|ZP_02544193.1| adenine specific DNA methylase Mod [candidate division TM7 single-cell isolate TM7c] (429 aa)
Score = 260, Expect = 1.2e-20, Identities = 97/296 (32%), Positives = 145/296 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVER-DSTIENLYKDDKEIIDK--GFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNI--NQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFL--INKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI 296
           MM  RL  A+ LL+ DG+IF+SIDDNE   L+++M++IFGE+NF++ ++W+K    +N  +Y   NH+Y++  ++    +K                          L+ R+N   + Y NP         D DPK V + D    N   D   +I K  G V  RP     V   W +S    +++++       K G    Y   K Y       +V   I   +   DN  ++     + K+   F  PKP +LIK L  I+  +N   +ILDFFAGSGTT HAV ELN++    GNR++I
  S:   169 MMYPRLFLARNLLRQDGVIFVSIDDNEVHNLRLMMNEIFGEENFVAQVIWEKVHTRKNSAQYFSYNHDYVVTIARKKDEWKRK------------------------LIPRENN--SAYSNP---------DNDPKGVWKLDPIYANNPYDADYVISKPTGEVMSRP-----VGRYWRFSEKVWLQKVQDNAVVWGKRGS---YPMVKRYLSDVQDGLVPQTIFTREFAGDNALANTELKNILKMESLFDYPKPTQLIKRLMQISTDTNNGDVILDFFAGSGTTAHAVDELNAE--DGGNRRWI 427
>gi|46133049|ref|ZP_00156499.2| COG2189: Adenine specific DNA methylase Mod [Haemophilus influenzae R2866] >gi|145639457|ref|ZP_01795062.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae PittII] >gi|145271504|gb|EDK11416.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae PittII] (548 aa)
Score = 259, Expect = 1.3e-20, Identities = 118/400 (29%), Positives = 189/400 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLL---RWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII-DNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNIN-YADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFT 401
           M  RL  A++LL+DDG+IFISIDDNEQA LK+L D++FGE+NF++  VW  R  QN +             ++N     I+  +     K  L +   GA  D           + Y NP         D DP+       +  L  +D+   +  +  I P  K G+     +  W +DK    ++++I +  +  ++         K   ++   ++    SI+  +I +  G+  L  L     F  PK ++LIK LI +   N N +ILDFFAGSGTT HAVM+LN++ +  GNRKFI     E T +   K+ A    ++ ++ + K      +S   +  D  +   D+  K F    +   ++N++ D  ++ + K         D+NNE    QL+ L T
  S:   100 MYPRLYIARELLRDDGVIFISIDDNEQAQLKILCDEVFGEENFVAEFVWKSR--QNKD-------------NRNITGASIDHEYIFCYSKTNLYKALRGAERDT----------SQYSNP---------DNDPRGNWASGNMVGLLPEDQRP-NCHYDLINP--KTGINYGKPKLGWRYDK--NTMQRLIDE-DRILWAELPTGRPRRKVFFNELTEQYTGFSSILGKDIYTRNGTAELEDLFEAKYFDFPKSIQLIKQLIEQAILNPNDLILDFFAGSGTTAHAVMQLNAEDEDNGNRKFICVQLPEPTDE---KSEAYKAGYKTIFDITK--ARIEKSAVKIRQDFKETTADLGFKIFKTEPHFQTTLNTDFDPQIDFLPK--------IDLNNE----QLHQLLT 450
>gi|21673736|ref|NP_661801.1| type III restriction system methylase [Chlorobium tepidum TLS] >gi|21646860|gb|AAM72143.1| type III restriction system methylase [Chlorobium tepidum TLS] (669 aa)
Score = 259, Expect = 1.7e-20, Identities = 91/317 (28%), Positives = 158/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ--LIQMTIGANEDGLLVNRKNM--GW-----TLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPI--KNGVLLRWSW-----SFDKAIER-IEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RLK A+QLL   G+I + ID++E   L +++ D+FGE+N +   +WDKRN + D++ I   HE ++ ++++ +           K+  +  L   +    E G +   +     W     TL    +  +K+     +  +V R   +   + + K      FVP++ PI  K+  +    W     +  K +E  + +  P        +++ DE  Y+ V   SIV F                  L++L + F  PKPV+    +I+  S+++ I++DFFAGSGTTGHAVM  N+     GNR++IL    E    ++ ++ +A + C
  S:   179 MMYPRLKIARQLLSPTGVIAVHIDEHELEALVIVLRDLFGEENELGVTIWDKRNPKGDSRGIAYQHESLVLFARDAEELFARSPVRRAKRNAERMLNAASRFVTECGSIAEARAAYRSWVKSQSTLSGGESMYDKLS----ETGRVYR--LVSMAWPNKKRAPADYFVPLKHPITGKDCPIPERGWRNPPATMKKLLEDGLIEFGPDEIMQPQRIYFLDENMYENVP--SIVPF-----------GGSDDELLKELSVPFEQPKPVDFSVQVISWCSSKDEIVMDFFAGSGTTGHAVMAQNA--ADGGNRRYILVQLPEPLDPENKDQKVAAEFC 492
>gi|34762306|ref|ZP_00143310.1| TYPE III RESTRICTION-MODIFICATION SYSTEM METHYLATION SUBUNIT [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27888028|gb|EAA25091.1| TYPE III RESTRICTION-MODIFICATION SYSTEM METHYLATION SUBUNIT [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (525 aa)
Score = 257, Expect = 2.3e-20, Identities = 121/384 (31%), Positives = 190/384 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIE--RIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL---GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ--DINKTIAKDIC---FERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADV-SINSNIDKLLEEIKKSMRLIHRD 384
           MM  RLK A+ LL DDG+IFISID+NE   L+ + D+IFGE+NFI  I         D   I   HEY+L Y K+  +F  N    I K K      +I   E   L NR      + FN      +    Y P  +  +  ++N   + +    +G+V + P    GV   W W  +KA E   +  +  KM   GY +     ++Y++    +   +N         +S KG+  ++++      F  PK + +IK  I   SN + IILDFF+GS TT H+VM+LN++   +GNRK+I+    E   +  +  K   K+IC    ER+    + IK S ES     + E ++  D+  K F ++ +++   ++N + L + + +SM  I  D
  S:    58 MMYPRLKLARNLLTDDGVIFISIDNNEIHNLRKICDEIFGEENFIEVITVINNPRGRDYGGIANMHEYLLVYKKSENSFLNNL---IQKDKIFPFFDSISGFEIRELRNR-----NIVFNKENRPNL----YYPFYINTNKILDNNLLEIELEKKEGYVELFPKESQGVNTVWRWGKEKAKENLNVNIVAKKMQDGGYMIV----EKYRKAEVMARSVWNTKDD-----NSEKGTLLIKEIFKGNKVFEFPKSLNMIKKTIEIGSNNSDIILDFFSGSATTAHSVMQLNAE--DEGNRKYIMVQLPELCDESSEAYKAGYKNICEIGKERIRRAGEKIK-SDESL----LIENREKLDIGFKVFKLDSSNIKEWDTNTEDLQQTLLESMENIKSD 424
>gi|187736011|ref|YP_001878123.1| DNA methylase N-4/N-6 domain protein [Akkermansia muciniphila ATCC BAA-835] >gi|187426063|gb|ACD05342.1| DNA methylase N-4/N-6 domain protein [Akkermansia muciniphila ATCC BAA-835] (632 aa)
Score = 257, Expect = 2.9e-20, Identities = 108/317 (34%), Positives = 164/317 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVW-DKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWS---FDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSN---ENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT--KQDINKTIAKDIC 317
           M+  RLK A+ LL +DG+IFISID+NE   L+ + D+IF E N I   VW +K  A      +   HEYILAYSK                   ++ ++   +ED  L++  N     Y         PL         + + +  +Y    +I+ +G + I+PP K G   RW WS   FD A    E +I K   +GYS+ +   K+Y +  +  + R     S+I ++ + +G+    +L  +   F  PKP +LIKFL++ + N    +  I+DFF+GS +T HAVM+LN++    GNRKFI+    E T  K +  K   K+IC
  S:   184 MIYPRLKVARDLLSEDGVIFISIDNNEIENLRKICDEIFSESNCICQFVWKNKYGAGGGTNSVAYVHEYILAYSKT-----------------PIVSISSDLSED--LISSYNKTDEKYSTRGGYVTQPL-----ASTSKGARVNLMY----DILHEGNI-IKPP-KGG---RWIWSKDKFDAAYANNEIVISK-NSSGYSVRF---KQYLRDKNGKM-RKGTPLSLIASVFNQEGTKEFAELMGDKRIFDFPKPSDLIKFLLSLNINGGTTDFTIIDFFSGSSSTAHAVMKLNAE--DGGNRKFIMVQLPELTDEKSEAYKAGYKNIC 472
>gi|194337258|ref|YP_002019052.1| DNA methylase N-4/N-6 domain protein [Pelodictyon phaeoclathratiforme BU-1] >gi|194309735|gb|ACF44435.1| DNA methylase N-4/N-6 domain protein [Pelodictyon phaeoclathratiforme BU-1] (571 aa)
Score = 255, Expect = 4.7e-20, Identities = 109/343 (31%), Positives = 167/343 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKN-------WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIID----------------NISSSKGSNTLRKL----GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKG-NRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDEL 343
           MM  RL    + LK+DG+IF SID+ E A L++L D+IFG  N +  I+WD  NA ++N   I   HEYIL Y+KN       WK+  +         K +L+Q+     E       +   +T +F    +   P   Y  K ++ D             I  G   +  P K G      + +D  I    ++  K    GY   +  E  Y+ +S K ++  N    +I+                 +    G+N ++ +       F  PKP  L++ L +  ++ + +ILD FAGSGT+GHAV++LN   K+ G NR+FIL   +E+        IA+DI  ER    I+ +    ES  N+SV  L
  S:   121 MMYPRLMMLHEFLKEDGVIFASIDETEYANLRLLFDEIFGLGNRVGTIIWD--NATDNNPTNIAMEHEYILCYAKNKSQLPSVWKSPNL-------AVKTKLLQIGDDFVEQYPDQKERQEAYTKWFRENKDYLWPFDRY--KFIDGDG------------IYTGSQSVHNPGKEG------YRYD-IIHPTTELPCKQPMMGYR--FPQETYYRLLSEKRVIFGNDETKLIELKVYVKDYRAKLSSLFTLDGRVGTNEIKDILHYDKRPFDFPKPTTLLEELFSFTTSGDDLILDSFAGSGTSGHAVLKLN---KSDGQNRRFILIEMKEK--------IARDITAER----IRRVSEGYESIKNVSVKGL 445
>gi|42525618|ref|NP_970716.1| adenine-specific DNA modification methyltransferase [Treponema denticola ATCC 35405] >gi|41815629|gb|AAS10597.1| adenine-specific DNA modification methyltransferase [Treponema denticola ATCC 35405] (428 aa)
Score = 255, Expect = 4.9e-20, Identities = 103/303 (33%), Positives = 143/303 (47%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN-DNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFN----------PATNEKIPLMDYDPKKVER------DSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSN-ENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           RL  AK LL DDG+IFISIDD    YL++++D+IFG  NFIS +VW+         K+I  +HEYI+ Y+K+    K        K K    +M    + DG     +   W    +          P  N  IP   Y  + VE+      +  +    K DK +    F  I+     G   +W+      +E+ E+ +PK      SL  A   EY +                 NI S      L    I F   KPV L+K+L     N ++A++LDFF+GS TT HAVMELN++     NRKFIL    E   +D
  S:    99 RLSLAKNLLTDDGLIFISIDDKTCPYLRIILDEIFGTKNFISTLVWNNSTGGGLRKKHINTSHEYIILYAKDKTKVKPMTAPMPEKAK----KMYKYKDADGRFFRYQQFAWKNKTDAKRQKYPIKTPDGNFIIPKAGYIYRFVEKSFFNLLEKNLIEFKKSDKSV----FTDIK-----GRPTKWTIYVKTYLEKKEETVPK------SLLPA---EYVKT----------------NIQSVYEQKVLFGAKI-FDYAKPVSLLKYLFKLVPNSDDAVVLDFFSGSATTAHAVMELNAE--LNENRKFILVQRGEPCSED 378
>gi|56419951|ref|YP_147269.1| type III restriction-modification system, methyltransferase [Geobacillus kaustophilus HTA426] >gi|56379793|dbj|BAD75701.1| type III restriction-modification system, methyltransferase [Geobacillus kaustophilus HTA426] (478 aa)
Score = 254, Expect = 5.0e-20, Identities = 88/297 (29%), Positives = 137/297 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWT---LYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLR---------------WSWSFDKAIERIEKIIP--KMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RL  A++LL + G IFISIDD EQA L+ + D+IFGE NF++  +W +  +  N NK+  +NH++IL Y+KN        +    +  G+       AN D    N     WT   L   P   EKI                        EI+      + PP  NG   R               W       + R+++ +   K T    +++  DE  + Q + K +       +++D                    PKPV+LI+ ++   + ++ +ILDFF+GS TT HAVM+ N++    G R F++
  S:   154 MMYPRLWVARELLAETGAIFISIDDTEQANLRKMCDEIFGERNFVATFIWQRAFSPVNMNKFASRNHDFILCYAKNIDRLAWYGLPRHPEADGRY------ANPD----NDPRGPWTSGDLSVGPPIPEKI-----------------------YEIVTPSGRVVSPP--NGYCWRVTKERFAELAADNRIWFGKDGNGVPRLKRFLSEVKSTVTPLTIWTHDEVSHSQEAKKELKELFGGLAVMD-------------------YPKPVKLIQRMVALTTRDDDLILDFFSGSATTAHAVMQQNAE--DGGRRSFLM 415
>gi|167856572|ref|ZP_02479277.1| hypothetical protein HPS_06689 [Haemophilus parasuis 29755] >gi|167852303|gb|EDS23612.1| hypothetical protein HPS_06689 [Haemophilus parasuis 29755] (589 aa)
Score = 254, Expect = 5.1e-20, Identities = 96/296 (32%), Positives = 153/296 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN-------WKNFKINQVFEINKKKGQLIQMTIGANE--------------------------DGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPI--KNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRK-LGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI 296
           MM  RLK   +LL DDG+I I ID+NE   L  ++ +IFG+ N +  I+WDKRN + D++ I   HE I+ + KN        K  K N    +  KK +++   IG  +                          D   VN++   W    + +  EK     +  +  +   T+   + + ++  D+ F+P+  P+  K   +    W +          + KM KN   +F AD  E  Q   K +++ N+ ++    ++     +  +K +GI F NPKP E    L++     N+I+LD F GSGTT HAV+ LN+  K  GNR+FI
  S:   116 MMYPRLKLLHRLLADDGVIIIHIDENEYTNLHSILIEIFGKTNDLGTIIWDKRNPKGDSQKISYQHESIVLFGKNQFHTTHKLKRLKKNAPAML--KKAKMLFKKIGKKQYPENLKKVVKEYNLSTEILEQNKLIADLEWVNQEYQDWLKKQDFSNGEKA--YKFIDENGDIFQTVSMAWPNKEKAPDEYFIPLIHPVTKKECPIPEKGWRYPLV------TMEKMLKNNEIIFGAD--EVTQPRSKYLLKENLYENTPSILAFGGSDDKFQKEIGIHFENPKPNEFSTELLSSFLKPNSIVLDSFMGSGTTAHAVLNLNA--KDGGNRQFI 433
>gi|54020146|ref|YP_115842.1| site-specific DNA-methyltransferase (adenine-specific) [Mycoplasma hyopneumoniae 232] >gi|53987319|gb|AAV27520.1| site-specific DNA-methyltransferase (adenine-specific) [Mycoplasma hyopneumoniae 232] (367 aa)
Score = 254, Expect = 5.6e-20, Identities = 116/353 (32%), Positives = 174/353 (49%)
  Q:    35 MDDIFGEDNFISNIVWDKRNAQNDNKY----IEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTL---YFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEII--DKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSH----KSIVRFNIN---QSIIDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDI 387
           MD+IFGE+NF++NIVW K+N+   N      I +N EYI+ Y+KN    K N  ++   +K                   K +G+TL   YF+     K+     D  +       + +   D  II  D     +     N     ++W  D  +E  ++   ++ KN    + A  K+Y+ V      K I +       ++II +  S  G   L+ +      F  PKP+ELIK+LIN H N+NA ILDFFAGSGTTGHAV  LN   +  G R F L TN +         IA D+ +ERL+ +     T  E FN    +  K Y + +LK F+I Y +  I ++  +L + +   ++L  +DF I
  S:     1 MDEIFGEENFVANIVWVKKNSPGGNTSFDYKITQNTEYIITYAKNLNKCKFN--YQKYDEK-----------------TLKKLGYTLKDKYFDQRGYYKLT----DLHRTSSTGAFQYIKSLDYPIIAPDGTSFTLYLNKNNPESACYTWGKDTFVEGEKQGFIEIVKNSRGDWVAKRKQYQYVKFNPKTKKIEQIEAGVPFKNIISDFYSLNGGLELKDIFNSKNIFDFPKPIELIKYLINIHPNKNAKILDFFAGSGTTGHAVWNLNR--QDGGKRTFTLITNNQ-------NKIATDVTYERLFRISNGKGTKNEEFNWSKNN--KPYLE-NLKVFDIVYYNTQIFNSETELNDLVNLLLKLF-KDFAI 336
>gi|126741181|ref|ZP_01756861.1| adenine specific DNA methylase [Roseobacter sp. SK209-2-6] >gi|126717704|gb|EBA14426.1| adenine specific DNA methylase [Roseobacter sp. SK209-2-6] (544 aa)
Score = 253, Expect = 8.0e-20, Identities = 99/318 (31%), Positives = 151/318 (47%)
  Q:    16 DGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPP----IKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEY---KQVSHKSIVRF--NINQSIIDN---ISSSKGSNTLRKLGIE-----------FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGE 333
           DG+IFISIDDNE  +L +LM++IFG   ++S+I W K   +N+  K+I   HE+I+ +++N K  ++N              +  G  ED           + Y NP ++ + P           D +  N Y         G  P+R P    I+     R+ W+  K  E  EK+             AD + +   K  +   + RF   + Q +I N   + S  G N   K  +            F  PKP  LI+ ++   +N   I++D FAGSGTTGHAV+++N   +  GNR+FIL   +E+        IA D   ERL  +I      G+
  S:   127 DGVIFISIDDNELHHLILLMNEIFGPTAYVSSIAWQKVFGRNNTAKFISDTHEHIVCFARNIKALELN-------------LLERGEGED-----------SRYKNPDSDPRGPW-------TSSDLSARNPYS-------LGVYPLRTPSGREIEGPPAGRY-WTVSK--ENFEKL------------DADNRIWWGTKGNNFPRLKRFLSEVAQGVIPNSLWMHSEVGHNQEAKQEVGSIFHEANRETLFSTPKPKRLIRRILQIATNPGDIVMDSFAGSGTTGHAVLDMNK--QDGGNRQFILVEMDEK--------IAPDTTGERLRRVINGYHKGGD 405
>gi|153815967|ref|ZP_01968635.1| hypothetical protein RUMTOR_02212 [Ruminococcus torques ATCC 27756] >gi|145846786|gb|EDK23704.1| hypothetical protein RUMTOR_02212 [Ruminococcus torques ATCC 27756] (629 aa)
Score = 252, Expect = 8.5e-20, Identities = 95/317 (29%), Positives = 152/317 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPAT--NEKIPLMDYDPKKVE-RDSTIENLYKDD-KEIIDKGFVPIR-----PPI-KNGVLLRWSWSFDK----AIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDIC 317
           M+  RL  A+ LL DDG+IFISIDDNEQA LK + D++FGE NF++  +W+   A     K+  K HEYIL Y+KN    K           G+ I+M    +E GL  ++      ++ N +T  N+K  ++  D ++V  +D  I    ++  ++  ++G V  +     P + +NG    W+    K    A+     +IPK                     +++  +N     +  +   K           F N KPV +I++ IN  + +  I++DFF+GS TT HAVM+  +D     +   +    E   K +  K   K IC
  S:   178 MIYARLLAARNLLCDDGVIFISIDDNEQANLKKICDEVFGERNFVNCFIWNCSTAGGIRPKFASKTHEYILCYAKN----KTCLDMFFAPLSGEAIKMYREKDERGLYRDKD----FVFKNKSTNANQKYEIICPDGERVRPKDGYIYRFVRERFEQAKEEGLVTFKRTKTGPLVDQNGDQAHWNIYIKKYLGDAMGAPSTLIPK---------------------EAVSIYNAGTQCVQELFDGKRV---------FENVKPVNVIQYFINMAAKDGDIVMDFFSGSATTAHAVMQTEADKNIDLHYILVQIPQECDKKSEAYKAGYKTIC 471
>gi|109947857|ref|YP_665085.1| type II restriction-modification methyltransferase [Helicobacter acinonychis str. Sheeba] >gi|109715078|emb|CAK00086.1| type II restriction-modification methyltransferase [Helicobacter acinonychis str. Sheeba] (381 aa)
Score = 252, Expect = 8.6e-20, Identities = 100/310 (32%), Positives = 161/310 (51%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN---WKNFKI----------------NQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERI--EKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKT 311
           + E L  AK +LK  G IFISIDDN+ A +K++ ++IFG  NF+   +  K+  +++ K+I   HEY+L+Y+KN     +FKI                  +  I K+KGQ     +   +   L  +++  +   +N + +EK  +  Y  K +   ST  N      E I+    P++            WS D+ ++ +  E  +    K  Y  +Y  E +   +S             + +  S +G+  L KLG++  F  PKPVELIK+L+   + ++++ILDFFAGSGTT  A++E+N D     N  F LC  EE+ K +   T
  S:    44 IKEHLVLAKAVLKQSGCIFISIDDNQMAEVKIIANEIFGVHNFLGTFI-TKQATRSNAKHINITHEYVLSYAKNKAYAPSFKILRTLLPVYAKPLKDLMRTIKSIFKQKGQAQAQLVLKEQIKELSKKEHFSFLKNYN-SVDEKGEI--YFAKDL---STPSNPRSVAIEEINLFLEPLKSR---------GWSSDEKLKELHYENRLIFKNKRPYEKYYLKESQDNCLS-------------VLDFYSRQGTRDLEKLGLKGLFKTPKPVELIKYLLLCSTPKDSVILDFFAGSGTTAQAIIEVNKDYHL--NWSFYLCQKEEKIKNNPQAT 345
>gi|169334193|ref|ZP_02861386.1| hypothetical protein ANASTE_00591 [Anaerofustis stercorihominis DSM 17244] >gi|169258910|gb|EDS72876.1| hypothetical protein ANASTE_00591 [Anaerofustis stercorihominis DSM 17244] (685 aa)
Score = 251, Expect = 1.1e-19, Identities = 99/314 (31%), Positives = 159/314 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQL-IQMTIGANEDGLL---------VNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDK-------AIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIID------------NISSSKGSNTLR--KLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKD 315
           M  RL  A+ LL DDG+IFISIDDNEQ+ LK++ DD+FGE+NF++NI+          K + K HEY+  Y+KN       ++ E++K +G    Q  IG  E+  L          NR N+ + +Y NP +   I    Y P  +E+                   + I P    G    W W  DK       +     +++ K    G    Y   ++Y++ + K+   +  +  + D            N+ + +GS  L   ++G  F  PKP  LIK + +  SN+  I LDFF+GS ++  A++ LN++  +   R  I      +  +D++K I+ D
  S:   178 MYSRLLLARDLLTDDGVIFISIDDNEQSNLKLICDDVFGEENFVANIIVQANKRGQTYKQLAKTHEYLFVYTKNVS----TELNELSKGQGAFDKQDNIGEFEERELRNRNPKFGKFNRPNLYYPIYTNPNS---IDECGYCPVSLEKSEEFS--------------IEILPLNSEGEESCWRWGKDKFNRFNNSSSSMESELVAKKKNTGE---YGCYEKYRKGTFKAKTIWYEDDLVGDLSGEDDDIWEETNVITEQGSKELTAYEMGDAFDFPKPTYLIKKVFHIGSNDGDICLDFFSGSASSFEALLSLNAE--SNDTRTMIAV----QLPEDLDKKISND 492
>gi|120537207|ref|YP_957264.1| DNA methylase N-4/N-6 domain-containing protein [Marinobacter aquaeolei VT8] >gi|120327042|gb|ABM21349.1| DNA methylase N-4/N-6 domain protein [Marinobacter aquaeolei VT8] (635 aa)
Score = 251, Expect = 1.3e-19, Identities = 104/344 (30%), Positives = 181/344 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK--YIEKNHEYILAYSKNWKNFK-INQVFEI-----NKKKG--QLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIP---------LMDYDPKKVER------------------DSTIE----NLYKDDKEIIDKGFVPI--RPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEK-EYKQVSHKSIVRFNINQ-----SIIDNISSSKGSNTLRKLGIE-FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTS---GESFNNLSVDELKK 345
           M +RL  A+ LL  DG+I +SI+D  ++ L++LMD++      + ++VW  R   N ++  ++  +HE+IL Y      F+   + FE+     N  +G  +   +T+G + +     R N+ + L  +P T    P           + + K  +R                  DST E        D  E I  G VP   R P+ +  L    W     +           +  +  + AD K +Y+ VS   + +F   Q     S +   +    +      G   F   KP  LI+ L+++ +    I+LDFFAGSGTT  AV+ELN+  K  GNR+FI+C++ E T ++ +K + +D+C ER+  ++     +   G+ F  L++D++++
  S:   132 MYQRLSIARDLLTPDGVIMVSINDENRSRLELLMDEVM-PGMRLGSMVWRTRQGSNADQGCFMSSDHEHILIYGNPGFQFRGYEKSFEMYSNPDNDPRGDWRTDNITLGFSYN----ERPNLYYPLR-DPTTGIVYPPNPDRVWVYASEANLKAGQRLQAKSMEEFIRLGQIVFPDSTQEVRVWETMDDLLEAIRSGDVPKSGRKPLLSADLPNLEWWVGVPV--------GFGRPQFKRYKADLKNQYQPVSSWIVPKFEDGQYDAPGSFVSTTNHEGATGVANIFGSRVFNYAKPATLIRQLLDQATRPGDIVLDFFAGSGTTAQAVLELNA--KDGGNRRFIMCSSTEATAKEPDKNLCRDVCAERVRRVMAGYGDTPGLGDDFTYLTLDKVEE 512
>gi|99908362|gb|ABF68766.1| Mod [Arcanobacterium pyogenes] (510 aa)
Score = 251, Expect = 1.4e-19, Identities = 109/375 (29%), Positives = 175/375 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLI--KNIKTSG--------ESFNNLSVDELK-KYQDVSLKTFNINYADVSINSNIDKLLEEIK 375
           MM  RL+ A++LL DDG IF+SIDDNE   L  LMD+IFGE N I+ I    R + +++K I  NH  I  Y+KN ++              + I+ TIG + +                    E   L D D +   R   ++            G      P    + +   W F K   + +     + K G SL+   +K Y+  + ++  R  +     D   +S  ++ L++L  G  F  PKP+EL++ ++     S+++ I++DFF+GS T  HAVM +N +    G RKFIL    E      +K  A+++ ++ L C I  + IK +G        ES   L++ EL     DV  +   ++ + +        LLE +K
  S:    73 MMYPRLRLARELLADDGAIFVSIDDNEVTNLTKLMDEIFGERNRIALICHKARASVSNDKIISPNHNTIAFYAKNIESL-------------EAIRKTIGLDPN-------------------LEGFDLDDADGRGAYRLVPVDG----------PGGAKKGNPFFEFLGVEGYWRFSKETMQKKYEEGLVVKRGNSLY---QKYYQSAAKQT--RRTVTTWWDDAGLTSTATSRLKELMGGATFDTPKPIELLERMLKMITFSSDDCIVMDFFSGSATLAHAVMNINRE--YGGQRKFILVQLPEILD---SKAAARELGYDNL-CQIGEERIKRAGDLIVSEINESNKQLALGELPITIPDVGFRVLKLDSSGILCPEPGRLLLERVK 409
>gi|145631556|ref|ZP_01787323.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae 22.4-21] >gi|144982825|gb|EDJ90347.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae R3021] (628 aa)
Score = 251, Expect = 1.4e-19, Identities = 98/305 (32%), Positives = 151/305 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLL---RWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII-DNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           M  RL  A++LL+DDG+IFISIDDNEQA LK+L D++FGE+NF++  VW  ++ QN +             ++N     I+  +     K  L +   GA  D           + Y NP         D DP+       +  L  +D+   +  +  I P  K G+     +  W +DK    ++++I +  +  ++         K   ++   ++    SI+  +I +  G+  L  L     F  PK ++LIK LI +   N N +ILDFFAGSGTT HAVM+LN++ +  GNRKFI     E T +
  S:   180 MYPRLYIARELLRDDGVIFISIDDNEQAQLKILCDEVFGEENFVAEFVW--KSRQNKD-------------NRNITGASIDHEYIFCYSKTNLYKALRGAERDT----------SQYSNP---------DNDPRGNWASGNMVGLLPEDQRP-NCHYDLINP--KTGINYGKPKLGWRYDK--NTMQRLIDE-DRILWAELPTGRPRRKVFFNELTEQYTGFSSILGKDIYTRNGTAELEDLFEAKYFDFPKSIQLIKQLIEQAILNPNDLILDFFAGSGTTAHAVMQLNAEDEDNGNRKFICVQLPEPTDE 451
>gi|170697761|ref|ZP_02888848.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria IOP40-10] >gi|170137376|gb|EDT05617.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia ambifaria IOP40-10] (663 aa)
Score = 250, Expect = 1.5e-19, Identities = 103/332 (31%), Positives = 165/332 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKK----VERDSTIE--NLYKDDKEIIDKG--FVPIRPPIKNGVLLRWS--WSFDKA-------IERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKF--LINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL------CTNEERTKQDINKTIAKDICFERLYCLIKNIKTSG 332
           M+  RL+ A+ LL +DG+IFISIDDNE   L+ +  ++FGE NFI+ IVW+  N +ND K I  +HEY+L Y+KN     + + + I K+         G +E    V R N  +   +  A+ +          K    + R   I+    YK+D      G  F  + P     + LR +  WSFD+         +R+  + P        L   D      V ++        +S  + ++S  G+        +FP  + V + KF  +    ++++ I++DFFAGS TT HAVM+LN+D   +  R+F+L      C       +   +TIA D+  ER+      I++ G
  S:   194 MIYARLRLARNLLSEDGVIFISIDDNEVDNLRKVCSEVFGEGNFIAQIVWEGAN-KNDAKQIGVSHEYVLVYAKN--RSAVPREWSIRKE---------GVDEVLAEVARLNSVYGTDYESASKDLAGWFRSMKAKPVFGLRRFRYIDARGAYKEDDPTAPGGRRFQLVNPMNGEHIPLRRNRGWSFDQTEFNRLVEEKRVSFVTPTSIMIRRYLHETDALTPPSVFYQPA------RSASERLASLLGAGIF-----DFPKDETV-IAKFIEMATTGADDDCIVMDFFAGSATTAHAVMQLNADDGKR--RRFVLVQLPEACVERSAAAEAGYRTIA-DVSKERIRRAADAIRSQG 523
>gi|168212711|ref|ZP_02638336.1| type III restriction-modification system EcoPI enzyme mod [Clostridium perfringens CPE str. F4969] >gi|170715893|gb|EDT28075.1| type III restriction-modification system EcoPI enzyme mod [Clostridium perfringens CPE str. F4969] (526 aa)
Score = 250, Expect = 1.5e-19, Identities = 112/317 (35%), Positives = 155/317 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDST--IENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEK-EYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL---GIEFPNPKPVEL-IKFL-INKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE--RTKQDINKTIAKDIC 317
           MM  RLK AK LLKDDG+IFISIDDNE   LK + D+I GEDN ++ +         ND       HEY L Y K+    +   +   ++K  +      GA + G   N K  G       A  EK P + + P  + +D+   ++   K D E++         PI +G  + W WS +K I     II       +S++      + ++ S K    F   +      SS  G+N +++L      F NPKP  L I FL I   + +  IILDFF+GSGTT HA M+LNS+    GNRKFI+    E    K +  K   K IC
  S:    37 MMYPRLKVAKDLLKDDGVIFISIDDNEVDNLKKICDEILGEDNIVAILPTVMNLKGNNDQFGFAGTHEYTLVYCKSKNICEFGYLPIDDEKMNEWEYDEYGAFKKG--ANLKATGVN-----APREKRPNL-FFPLYISKDNKLYLDRNSKHDVEVL---------PITDGKEMSWRWSKNKFINEYYNIIINENDGKFSIYKKTRPLDGERPSQKPKTLFYKPE-----YSSGNGTNEIKQLFEGEKLFSNPKPTNLIIDFLRIVSFNEKEDIILDFFSGSGTTAHATMQLNSE--DNGNRKFIMVQLPEICDEKSEAYKNGYKTIC 340
>gi|163868337|ref|YP_001609546.1| methyltransferase [Bartonella tribocorum CIP 105476] >gi|161017993|emb|CAK01551.1| methyltransferase [Bartonella tribocorum CIP 105476] (546 aa)
Score = 250, Expect = 1.7e-19, Identities = 88/277 (31%), Positives = 135/277 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKN---WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLM--DYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPP---------IKNGVLLR----WSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           +M +RL+    LL DDG I+ISIDD+EQAYLKV+MD+IFG  NFI+NI+W K+ A QND K+   NH++I+ Y+K+   W+ +                           L+ R +     Y NP  + + P    D   K+V    T++++Y    EI+      + PP          K   LL+    W       I  +++ + ++ KNG  +       Y +V H    +  +     D++               F  PKP  L++ +I   +    +ILD FAGSGTTG
  S:   100 LMRDRLELLHHLLADDGSIWISIDDDEQAYLKVMMDEIFGRQNFINNIIWQKKYAPQNDTKWFSDNHDFIMVYAKDKTIWRPY---------------------------LLPRSSAMDARYKNPDNDPRGPWKPGDLSVKRV----TLKDIY----EIVTPSGRKVMPPHGRSWAMSEKKFSELLKDNRIWFGPTGSNIPSLKRFLSEV-KNG--MVSMTIWPYTEVGHNQDAKREVKAFNSDHV---------------FTTPKPERLMERIIQLATTPGDLILDSFAGSGTTG 342
>gi|19703758|ref|NP_603320.1| Type III restriction-modification system methylation subunit [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19713894|gb|AAL94619.1| Type III restriction-modification system methylation subunit [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (525 aa)
Score = 248, Expect = 2.5e-19, Identities = 121/384 (31%), Positives = 186/384 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEII-DKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFN-------INQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ--DINKTIAKDIC---FERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADV-SINSNIDKLLEEIKKSMRLIHRD 384
           MM  RLK A+ LL DDG IFISIDDNE   LK + D+IFGE+NFI+N +    N+ + D+      HEY+L YSKN    K+N+  +  + + +L  +                    Y N      I  +D    +            D  EI   KGF           + RWS    K     + I+ K   NG+ + Y    EY+  +   +   N       +N+   +  SS + S    K  I F  PKP+  I+ ++   +N+N++ILDFF+GS TT HAVM+LN +    GNRK+I+    E   +  +  K   K+IC    ER+    + IK+      +LS++  +K  D+  K F ++ +++   ++NI+ L + +  SM  I  D
  S:    58 MMYPRLKLARNLLTDDGAIFISIDDNEVTNLKKMCDEIFGEENFIANFIRRTINSGKQDSLTASSYHEYLLTYSKNINEIKLNRREKNEEDRQKLYPLK-----------------DEYENTRGRYYISQLDKGSIQYSDSLNYMITAPDGTEIWPGKGFT------DKTKVFRWSKEKVKWGIENDYIVFKKQLNGWKV-YVKSYEYRDNNDNYVSPSNPYTTLDYVNKEFSNFNSSLELSKIFDKNKI-FDFPKPILFIEDILKYSTNKNSLILDFFSGSATTAHAVMQLNVE--DGGNRKYIMVQLPELCDESSEAYKAGYKNICEIGKERIRRAGEKIKSD----ESLSLENREKL-DIGFKVFKLDSSNIKEWDTNIEDLQQILLDSMENIKSD 424
>gi|15612476|ref|NP_224129.1| type III DNA modification enzyme (methyltransferase) [Helicobacter pylori J99] >gi|4156030|gb|AAD06989.1| TYPE III DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter pylori J99] (641 aa)
Score = 248, Expect = 2.9e-19, Identities = 116/320 (36%), Positives = 156/320 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAI---ERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLIN---KHSNENAIILDFFAGSGTTGHAVMELNSDPKTK---------------GNRKFILCTNEERTKQDINKTIAKDICFERL 321
           M  RL  AK LLK DG+IFISIDDNE A LK+L D+IFGE NFI   +W+K +   + +    K HE+IL Y KN  N K+   F                  D  L N  N    L F PA      L +   KK  RD  IE L  DD E+ +   +       N   L+  + + +     E I  +   +  + +S+ Y  E E   +    I +     ++  N ++SK    L      F   KPV LIK+LI+    ++NE  IILDFFAGSGTT HAV+E N     K                 R+FIL   +E+ ++  NK+ A D C   L
  S:   171 MYPRLLLAKDLLKQDGVIFISIDDNECAQLKLLCDEIFGEGNFIETFLWNKTQTPPSASNKTRKTHEFILCYQKNKDNKKMIAKFS--------------DGGDAPLWNETNSERILTF-PANYVFSNLKNGIYKKGIRDK-IEVL--DDIEVYNGKII-------NSFRLKGHFRWKQETLNEEIINNVFLVVKSDKFSIRYCREGERIVMPTNEISK---KDNVGTNETASKELFKLFDNNKIFNFNKPVSLIKYLISICSNNTNEGDIILDFFAGSGTTAHAVLESNKSDYQKLSEGGGLFNGLNAVFKERRFILVQLDEKIEK--NKS-AYDFCLNTL 481
>gi|92116203|ref|YP_575932.1| DNA methylase N-4/N-6 [Nitrobacter hamburgensis X14] >gi|91799097|gb|ABE61472.1| DNA methylase N-4/N-6 [Nitrobacter hamburgensis X14] (660 aa)
Score = 247, Expect = 3.8e-19, Identities = 96/281 (34%), Positives = 139/281 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIE-NLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKA-IERIE----KIIPKMTKNGYSLFYADEKEYKQVSH-KSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVM 281
           M+  RLK A+ +L DDG IFISIDDNE+A LK + D+IFGEDNF++ I+          K I K HEYIL Y K     +   + E++K    L         D   +  +N  +  +  P  N   P+   +P  V  +     +L K D+   +       P    G    W WS  K   + I+     +  K  ++G    Y  EK  K  +  KSI     + ++I    S +G+    KLG+      PKP+ELI+  +   +NE+ +++DFFAGSGTT HAVM
  S:   178 MIYPRLKLARTMLADDGAIFISIDDNEKANLKEICDEIFGEDNFLTAIIVQSNKRGQTYKEIAKCHEYILVYYKT----ENGALGELDKDGDALPYADEHGGYDLWELRNRNPKFGRHNRP--NLYFPIY-VNPNSVGANGLASISLTKSDEYCREA-----LPKNSEGADSCWRWSSKKVQTDGIDATPITVFAKQRRDGEWNIY--EKSRKSTTKAKSIWS---DTAVI----SEQGTVEAGKLGMSGVLDFPKPIELIRRCVFLGTNEDDLVMDFFAGSGTTAHAVM 446
>gi|158320351|ref|YP_001512858.1| site-specific DNA-methyltransferase (adenine-specific) [Alkaliphilus oremlandii OhILAs] >gi|158140550|gb|ABW18862.1| Site-specific DNA-methyltransferase (adenine-specific) [Alkaliphilus oremlandii OhILAs] (656 aa)
Score = 245, Expect = 5.8e-19, Identities = 96/305 (31%), Positives = 161/305 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANE-------DGLLVNRKNMGWTLYF---NPATNEK-IPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEY-KQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           M  RL  AK LLK+DG+IFISID+NE + L++L D++FGE+N+   I+W K +++ND  +I   HEYI+++ KN    K     E N+KK  L ++    +E       +   ++++ + W   F   NP    K    MD +      + +  N  +   ++I     P+   +       W +  +   +RI++ +    K+  ++   + K Y K   ++S+          D   +SK  N L   G  F NPK V+L+  +      ++++II+DFF+GS TT HAVM+LN++    GNRK+I+    E  K+
  S:   178 MYPRLLLAKDLLKEDGVIFISIDENEHSNLRLLCDEVFGEENYSGEIIW-KNSSKNDQAFISIQHEYIISFVKN----KDLNSGEWNEKKEGLEEIFKAFDEFKKKHGDNWEEIHKEALNWFKQFPESNPIYASKHYTWMDENGVYFPDNISGPNFGQYRYDVIH----PVTGKVCKEPASGWRFPEETMKQRIKEKLVHFGKDETTI--PNNKTYLKNTQYQSLTSIKYK----DGRVASKQLNELMG-GKHFTNPKDVDLLNTIFKAVGVDKDSIIVDFFSGSATTAHAVMQLNAE--DGGNRKYIMVQLPEEVKE 477
>gi|157155781|ref|YP_001464330.1| DNA methylase [Escherichia coli E24377A] >gi|157077811|gb|ABV17519.1| DNA methylase [Escherichia coli E24377A] (542 aa)
Score = 245, Expect = 5.8e-19, Identities = 79/283 (27%), Positives = 130/283 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKIN-QVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--------FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMEL 283
           ++ +RL+  + LL +DG I+I+IDD+E  YLK L D+IFG +NFISN++W+K ++ + D  +    H++IL Y+K+   FK+  Q   +N       ++    N               Y  P     +  M    K+ +R +    L   D          I P  ++G   RW W   K  +   +I     +NG++ ++    +         + F+          S  GSN   K  I+        F  PKP  LIK ++   ++   ++LD FAGSGTTG    ++
  S:    92 LIRDRLELLRTLLSEDGSIWITIDDHEVHYLKCLCDEIFGRNNFISNVIWEKSDSPRMDAAFFSSRHDHILVYAKDQSKFKVKRQPLSLNDLPSHYDKVDPSGN-------------PYYLKP-----LRAMGQADKREDRPTMYFPLVAPDG-------TEIFPKRQDGTDGRWRWGVQKIDQEKWRIDWSKGRNGWTPYFRVYADSSSGRPPETIWFH----------SEVGSNRTSKAEIKKVIPTISAFDTPKPEALIKKILEIATDNGDLVLDSFAGSGTTGAVAQKM 349
>gi|163868946|ref|YP_001610175.1| type III restriction system methylase [Bartonella tribocorum CIP 105476] >gi|161018622|emb|CAK02180.1| type III restriction system methylase [Bartonella tribocorum CIP 105476] (621 aa)
Score = 244, Expect = 8.3e-19, Identities = 88/286 (30%), Positives = 150/286 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR--NAQNDNKYIEKNHEYILAYSKN--WKNFKINQVFEI-----NKKKGQLI--QMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKE---YKQVSHKSIVRFNINQSIIDNIS--SSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           MM  RLK A+ LL+DDG+IFISIDDNE   L+ L D++FGE+NFI+ ++W +R  +  ++N  +  +HEY+L Y ++  ++     ++F+      N  +G  I   +T+G N       R N  + L  +P T    P   Y+P +V                                     W++      I + + ++ K G  LF  D  +    K+   +    +N   SI+ +I   +++ +  ++++  G  F   KP+ L+  L+ + + ++ +ILDFFAGSGTT HAVM+LN++
  S:   170 MMYPRLKLARNLLRDDGVIFISIDDNEVHNLRKLCDEVFGEENFIAQLIWRRRAPSGMSENN-VSIDHEYVLCYQRSGIFEFMGRKKIFDKYQNPDNDPRGPWIADNLTVGMNAS----MRPNQAYDL-IDPRTGHIFP---YNPNRV-------------------------------------WAY------IPESMERLIKEGKVLFPIDTNKRPMLKRFQSELKSNYNPFSSIMTDIVGLNTEATRMIQEILHGNIFDYSKPISLLTTLLKQITTKDDLILDFFAGSGTTAHAVMQLNAE 421
>gi|108562687|ref|YP_627003.1| type III adenine methyltransferase [Helicobacter pylori HPAG1] >gi|107836460|gb|ABF84329.1| type III adenine methyltransferase [Helicobacter pylori HPAG1] (390 aa)
Score = 244, Expect = 8.9e-19, Identities = 104/310 (33%), Positives = 164/310 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQ---------------SIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKT 311
           + E L  AK +LK  G IFISIDDN+ A +K++ ++IFG  NF+   +  K+  +++ K+I   HEY+L+Y+KN K F     F+I +    L+ +   A +D L+   KN+     F      +  L+  +  K        N  K+   + +KG +     +      R       AIE I   +  +   G+S   +DEK  K++ +++ + F  N+               S++D   S +G+  L KLG++  F  PKPV LIK+L+   + +++IILDFFAGSGTT  AV+E+N D     N  F LC  EE+ K +   T
  S:    50 IKEHLILAKAVLKQSGCIFISIDDNKMAEVKIIANEIFGTRNFLGTFI-TKQATRSNAKHINITHEYVLSYAKN-KAFAPG--FKILRT---LLPIYAKALKD-LMRTIKNV-----FKQKGQAQAQLVLKEQIKELSKKEHFNFLKNYNLVDEKGEIYFAKDLSTPSHPR-----SVAIEEINLFLEPLKSRGWS---SDEK-LKELYYQNRLIFKNNRPYEKYYLKESQDNCLSVLD-FYSRQGTKDLEKLGLKGLFKTPKPVALIKYLLLCSTPKDSIILDFFAGSGTTAQAVIEVNKDYYL--NWSFYLCQKEEKIKNNPQAT 351
>gi|15828868|ref|NP_326228.1| type III restriction-modification system: methylase [Mycoplasma pulmonis UAB CTIP] >gi|14089811|emb|CAC13570.1| TYPE III RESTRICTION-MODIFICATION SYSTEM: METHYLASE [Mycoplasma pulmonis] (565 aa)
Score = 244, Expect = 9.2e-19, Identities = 92/275 (33%), Positives = 140/275 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMD-------YDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTK-NGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--------FPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           M  RL+ A++LLK+DG+IF+  DDNEQAYLKVLMDDIFG + FI+N +W K +     +K + K  EYIL Y+KN           I+  KG +++       D  L+N  N   TL+F P       + D        D   +E+D  +++ Y  ++ II   F                WS +  +E I+     + K + +++ Y    E          R  +  ++I  +    G+N   K  +E        F  PKP  LI +L+N ++N+N ++LDF  GSGTT
  S:   227 MKNRLELARKLLKEDGVIFVQCDDNEQAYLKVLMDDIFGVNKFIANFMWMKTSTPPSLSKNVRKKLEYILCYTKN----------SISGLKGGIVE-----GGDMPLLNEANKMVTLHF-PINTVSFKIKDNLYQKGQKDKVYLEQDLLVKDNYNKNELIITGNF---------------KWSQETLLEEIKNKTQFIVKSDKFAIRYMRLGE----------RIKVPSNLISKVECLVGTNEDAKKELEALFNKKTIFNFPKPESLIHYLVNMNTNKNDLVLDFNLGSGTT 477
>gi|154499070|ref|ZP_02037448.1| hypothetical protein BACCAP_03062 [Bacteroides capillosus ATCC 29799] >gi|150271910|gb|EDM99136.1| hypothetical protein BACCAP_03062 [Bacteroides capillosus ATCC 29799] (529 aa)
Score = 242, Expect = 1.3e-18, Identities = 96/297 (32%), Positives = 139/297 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN---WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKK--VERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVL-----LRWSWSFDKAIERIEKIIPKMTKNGYSL-----FYADEKE---------YKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RLK   +LL +DG IFISIDD E   L+ + +++FGE NFI+ ++W K  + ++  K+  ++H+YIL ++KN   W   K+ +  + NK                            Y NP         D DP+      D    N Y        KG   I  P  N +        W +S DK +E + +      KNG  +     F  D  +         Y++V H         Q     I +  G +      + F  PKP  LI+ ++   S+ ++IILD FAGSGTT HAV+ +N      GNRKFIL
  S:   117 MMYPRLKLLHRLLAEDGAIFISIDDVEFYNLRSICNEVFGEHNFITTVIWRKNFSPKSTAKHFSEDHDYILVFAKNADIWLPHKMPRTEKQNKA---------------------------YKNP---------DNDPRGPWTSGDLAARNYY-------GKGLYSITTPAGNVISGPPAGSYWRFSEDKFLELVAENKIWWGKNGDGVPRLKRFLKDVTDGVVPQTYWPYEEVGH--------TQDAKKEIKAIFGGD------MPFDTPKPSRLIERILQIASDPDSIILDSFAGSGTTAHAVLNMNK--ADGGNRKFIL 379
>gi|15794483|ref|NP_284305.1| type III restriction/modification system modification methylase [Neisseria meningitidis Z2491] (492 aa)
Score = 242, Expect = 1.5e-18, Identities = 103/308 (33%), Positives = 147/308 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKN-----WKNFKINQVFEINK---------KKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRP------------PIKNGVLLRWSWSFD-KAIERIEK-IIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN 309
           M  RL  AK+LL DDGII ISIDD+  AYLK+L+D+IFG +NFI N+        N+++Y     HEY L ++KN     +  F I++   + K         KKG  ++ T    ED     R++     Y     N  +  +         D     +Y  D E+ +  F+                PI N    RW W +  K   R++  II   +KNG SL+     E   +  K               SS  G+  ++ L  E  F NPKP ELI+  I   +NEN I+LD+  GSGTT     ++N          +I     ER K+ I+
  S:    36 MKNRLSIAKELLTDDGIIVISIDDDGNAYLKILLDEIFGFENFIGNLPTIMNLKGNNDEYAFAGTHEYTLVFAKNKDKSTFYEFPIDEDNFLEKWEEDEIGFYKKGAPMRAT--GTED----KREDRPEMFYPFLVKNNTVSTIT--------DEEFSQIYNKDLEVFNDDFIQKLKEKYENLGYNFILPIANKQWGRWRWGYSIKNKARLQTDIIVSQSKNGISLYKKQRPELDDLPTKKPKTIFYKPEY----SSGNGTEQMKNLFGEKAFKNPKPEELIQDFITITTNENDIVLDYHLGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERLKKVID 356
>gi|33323516|gb|AAQ07486.1|AF503408_10 Mod [Enterobacteria phage P7] (646 aa)
Score = 240, Expect = 2.2e-18, Identities = 94/307 (30%), Positives = 149/307 (48%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTL-RKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKT 311
           RL  A++LLK+DG+IFISIDDNE   L +L D++FG+ NF++ +         +DN      HEYI  Y+KN     + Q F+I++ +   ++     +E GL      +  T     A+ +  P   + P  +  ++ +  +  DDK + +  +V + P    G  L WSW   K  +    +I    K+G +++        ++  K             + ++++  N L  KL   F  PKPV LI  L+   + +++++LDFFAGSGTT  AV  LN   K  G R FI    +E     INKT
  S:   181 RLYIARELLKEDGVIFISIDDNEDKQLGLLCDEVFGQGNFVAKLPTIMNLKGNHDNFGFSDTHEYIYVYAKNKDVCSLGQ-FDIDESE---VEKEWDEDEYGLFKRADTLKRT--GQDASRKSRP-KGWFPVFINSENKVY-VTDDDKPLNEDDYV-LYPVSPTGEELSWSWGKKKINDEFYNLIVIDIKDGKNIYKKQRPALGELPTKKPKSIWYKPEYSTSTATTELKNLLGAKL---FEGPKPVPLITDLVKIGTKKDSLVLDFFAGSGTTAEAVAYLNE--KDSGCRNFICIQKDEV----INKT 471
>gi|135252|sp|P08763|T3MO_BPP1 Type III restriction-modification system EcoPI enzyme mod (M.EcoPI) (EcoPI methyltransferase) >gi|15139|emb|CAA29614.1| unnamed protein product [Enterobacteria phage P1] (646 aa)
Score = 240, Expect = 2.2e-18, Identities = 94/307 (30%), Positives = 149/307 (48%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTL-RKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKT 311
           RL  A++LLK+DG+IFISIDDNE   L +L D++FG+ NF++ +         +DN      HEYI  Y+KN     + Q F+I++ +   ++     +E GL      +  T     A+ +  P   + P  +  ++ +  +  DDK + +  +V + P    G  L WSW   K  +    +I    K+G +++        ++  K             + ++++  N L  KL   F  PKPV LI  L+   + +++++LDFFAGSGTT  AV  LN   K  G R FI    +E     INKT
  S:   181 RLYIARELLKEDGVIFISIDDNEDKQLGLLCDEVFGQGNFVAKLPTIMNLKGNHDNFGFSDTHEYIYVYAKNKDVCSLGQ-FDIDESE---VEKEWDEDEYGLFKRADTLKRT--GQDASRKSRP-KGWFPVFINSENKVY-VTDDDKPLNEDDYV-LYPVSPTGEELSWSWGKKKINDEFYNLIVIDIKDGKNIYKKQRPALGELPTKKPKSIWYKPEYSTSTATTELKNLLGAKL---FEGPKPVPLITDLVKIGTKKDSLVLDFFAGSGTTAEAVAYLNE--KDSGCRNFICIQKDEV----INKT 471
>gi|184155519|ref|YP_001843859.1| methyltransferase [Lactobacillus fermentum IFO 3956] >gi|183226863|dbj|BAG27379.1| methyltransferase [Lactobacillus fermentum IFO 3956] (573 aa)
Score = 240, Expect = 2.4e-18, Identities = 93/303 (30%), Positives = 139/303 (45%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTI-ENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL---GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           M  RL+ AK LLK  G+IFI+IDDNE   LK + D+IFGE NF++ +VW++  A  N  K    +H+Y+L Y ++    + N +             T  A+ D    N  N               P  D+ P  +     I  N+Y     +       + PP        WS S     ER+        KNG ++     K +K    K+ V         D   S + +  L+KL      F  PKPV+L++  I  +S+ ++I++DFFAGS TT  AVM  N +   +G+R+FI+    E+T
  S:   103 MYPRLQLAKHLLKQTGVIFIAIDDNEDGNLKEICDEIFGESNFLAQVVWERAYAPINLKKNFSPSHDYMLVYGRDANVIETNGI-------------TRTADTDSSYGNLDND--------------PRGDWRPDNLSVGPAIPANIYP----VTTPTGRVVEPPAGRS----WSLSQKAFRERLADNRIWFGKNGDAV--PSMKRFKSELRKTGVTPMTVWHYKDVGHSQEATQQLQKLMGGKKYFSYPKPVKLVERAIQLYSDRDSIVMDFFAGSATTAEAVMRQNIE--DQGHRRFIMVQLPEKT 371
>gi|149193953|ref|ZP_01871051.1| Adenine-specific DNA methylase [Caminibacter mediatlanticus TB-2] >gi|149135906|gb|EDM24384.1| Adenine-specific DNA methylase [Caminibacter mediatlanticus TB-2] (753 aa)
Score = 240, Expect = 2.6e-18, Identities = 93/297 (31%), Positives = 143/297 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYAD-EKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  R+  +K  LK DGI   +IDDNE+  L  L+  I+ E+NFIS++ V      ++D+K+I   HEY L Y+ N      N++ + N K    +        +  +  R N+ + +YF+   N           K+      EN+ K            I P   NG+   W W      E ++K++ +     + +F  + EKE+  V  KS+     N+S   N + S G+  L+ + +EF  PK   L+  L +   NE  ++LDFFAGSGTT  AV+ LN D    G+RKF+L
  S:   350 MMENRISLSKSFLKKDGIFECAIDDNERDKLNNLLVSIYLEENFISSLCVIQNPGGRSDDKFIAYTHEYCLLYANNKNKLTFNKLRKENFKGKINLNPFRRGGSNSTIDKRPNLHYPIYFSIEEN-----------KISLKKEKENMIK------------ILPIDTNGIKRVWRWGKQTLKENLDKVVVRKINGRFDVFIKEVEKEF--VKPKSL----WNKS---NYAGSTGTLILKNMELEFDFPKSPFLLYDLFSLIKNEKFVVLDFFAGSGTTADAVIRLNKD--DGGSRKFLL 614
>gi|121635081|ref|YP_975326.1| putative type III restriction/modification system modification methylase [Neisseria meningitidis FAM18] >gi|120866787|emb|CAM10540.1| conserved hypothetical protein; putative type III restriction/modification system modification methylase [Neisseria meningitidis FAM18] (744 aa)
Score = 239, Expect = 3.0e-18, Identities = 96/283 (33%), Positives = 139/283 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKN-----WKNFKINQVFEINK---------KKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRP------------PIKNGVLLRWSWSFD-KAIERIEK-IIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL  AK+LL DDGII ISIDD+  AYLK+L+D+IFG +NFI N+        N+++Y     HEY L ++KN     +  F I++   + K         KKG  ++ T    ED     R++     Y     N  +  +         D     +Y  D E+ +  F+                PI +    RW W +  K   R++  II   +KNG SL+     E   +  K               SS  G+  ++ L  E  F NPKP ELI+  I   +NE+ I+LD+  GSGTT     ++N
  S:   288 MKNRLSIAKELLTDDGIIVISIDDDGNAYLKILLDEIFGFENFIGNLPTIMNLKGNNDEYAFAGTHEYTLVFAKNKDKSTFYEFPIDEDNFLEKWEEDEIGFYKKGAPMRAT--GTED----KREDRPEMFYPFLVKNNTVSTIT--------DEEFSQIYNKDLEVFNDDFIQKLKEKYENLGYNFILPIADKQWGRWRWGYSIKNKARLQTDIIVSQSKNGISLYKKQRPELDDLPTKKPKTIFYKPEY----SSGNGTEQMKNLFGEKAFKNPKPEELIQDFITITTNESDIVLDYHLGSGTTAAVAHKMN 583
>gi|124514975|gb|EAY56486.1| Adenine specific DNA methylase Mod [Leptospirillum sp. Group II UBA] (452 aa)
Score = 239, Expect = 3.2e-18, Identities = 84/293 (28%), Positives = 136/293 (46%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLL-----RWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLIN-----KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           RL  A++LL++DG +F+SIDD    +L+ L+D+IFG DN    +VW K+  +   +++I    EY++ Y+++ ++              ++I     ++E G                   ++IPL         R + +                PI  P  +G L+     +W WS +  + R  ++     + G  + Y  ++ Y   S    +R     S  D +S+S G+   R L  G  F  PKP  LIK L+        S E  I+LDFFAG+  T  AV+ELN      G+RKFI+
  S:   139 RLILARELLREDGALFVSIDDRSIHHLRYLLDEIFGPDNHAGTVVWRKKVVRGRGHRHIIPQTEYVVVYARSLRSLPSFS----EPLSPEMIDEYRLSDERG-----------------PYKRIPLAKTGTAHSPRPNLV---------------YPIEAP--DGTLISCPTHQWRWSKETLMARKSELEFVKNRMGKWVVYTRQRLYPDGS----LRRKTPVSFYDRVSTSDGTREFRTLCQGALFDFPKPSRLIKDLLGWVPLPVDSQEPLIVLDFFAGTCPTAQAVLELNQ--SDNGHRKFIM 400
>gi|166712002|ref|ZP_02243209.1| type III restriction-modification system methyltransferase [Xanthomonas oryzae pv. oryzicola BLS256] (631 aa)
Score = 239, Expect = 3.2e-18, Identities = 102/321 (31%), Positives = 151/321 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKG----FVPIRPPIKNGVLL-----RWSWSFDKAIERIE--KIIPKMTKNGYSLF--YADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL-----GIEFPNPKPVELIKFLINK-HSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL------CTNEERTKQDINKTIAKDICFERL 321
           MM  RL+ AK LL+DDG IFISIDD E + L+ L D+IFG  N+    VW +R+   D+      +HEY+L Y K+               KG+L    I    DG            Y NP         D DP+           +K D     K       PI  P      L      W +S     E+I   ++I   T +G  +   + +E ++  V   + +       I +++ +   +   R+L        FP+PK  +L+  L ++    E  I+LDFFAGS TT HAV+ +N++  +  N +FIL      C    + K+D  +TIA DI  ER+
  S:   180 MMFARLRLAKNLLRDDGTIFISIDDFEASNLRALCDEIFGSQNYYCTFVWKRRSGAMDSVDNTSVDHEYVLCYGKS---------------KGRL--AGIERTYDG------------YTNP---------DNDPR---------GPWKADNLSAGKAGGDVHYPITDPKTGNQFLPPEGRYWPYSRKTMAEKIAEGRVIFPATASGRPMLKRFKNEAKFDTVPVSTWIVSRPEDKISNSLVAPANTQGTRELQDIFGAKLFPHPKSTQLVSSLASQCRLEEGDIVLDFFAGSATTAHAVLAMNAN--SGSNVRFILVQIPEECETGSQAKKDGFQTIA-DISKERV 476
>gi|188532552|ref|YP_001906349.1| Site-specific DNA-methyltransferase (Adenine-specific) [Erwinia tasmaniensis] >gi|188027594|emb|CAO95444.1| Site-specific DNA-methyltransferase (Adenine-specific) [Erwinia tasmaniensis] (628 aa)
Score = 239, Expect = 3.4e-18, Identities = 92/296 (31%), Positives = 136/296 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAI-ERIEKIIPKMTKNGYSLFYADEKEY--KQVSHKSIVRFNIN-------QSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI 296
           M+  R+K A+ LL DDG++F+SIDD E A L+ + D+IFGE+NFI+NIVW K       KY   N          W +   + +    K K ++       NED L           Y NP  + K P   +    +   S              K F       KNG     +W+  K    R      +    G  +++ ++     ++ S  S V+  +        Q +  N  ++     L   GI F NPKPV L++ +I+    ++   I+LDFFAGSGTT HAVM   S+ +  GNR+FI
  S:   179 MIYPRIKLARNLLSDDGVMFMSIDDGEVANLRKVCDEIFGEENFIANIVWQK-------KYTRSN-------DAKWFSDNHDHILAYGKNKERVTLNGQERNEDQL---------KAYTNPDNHAKGP---WKATPLHAKSGTNT----------KAFT-----FKNGA----AWAPPKGTYRRFNDAAMRQMDEGDEIWFGEDGSLTPQRKSFLSEVKQGVTPVTLWPYQEVGHNHEANSDLKALDLGGI-FDNPKPVRLLQRMIHLATSADRQHIVLDFFAGSGTTAHAVM--GSNAQDNGNRRFI 438
>gi|167366328|ref|ZP_02300471.1| Site-specific DNA-methyltransferase (adenine-specific) [Rhodopseudomonas palustris TIE-1] >gi|192292172|ref|YP_001992777.1| Site-specific DNA-methyltransferase (adenine-specific) [Rhodopseudomonas palustris TIE-1] >gi|192285921|gb|ACF02302.1| Site-specific DNA-methyltransferase (adenine-specific) [Rhodopseudomonas palustris TIE-1] (566 aa)
Score = 238, Expect = 3.9e-18, Identities = 84/277 (30%), Positives = 140/277 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWS-----WSFDKAIER--IEKIIPKMTKNGYSLFYADEKEYKQVS------HKSIVRFNI--NQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           +M +RL   ++L+ +DG ++I+IDDNE  YLK+L D++FG  NF++N+VW K+ + QND K+   +H++IL ++KN   +  N+V               G N+  L           Y NP         D DP+ +   S +    K   E  +  F PI+ P+ +  +  W      W +D+A  +  +E+ +    KNG       E+E  ++        + +V   I     + DN  + + +  L   G  F  PKP  LI+ +++  +    ++LD FAGSGTTG
  S:    99 LMRDRLDLIRRLMSEDGSLWITIDDNEAHYLKILCDEVFGRSNFVANVVWQKKYSKQNDAKHFSTSHDHILVFAKNKNEWAPNKV---------------GRNQSQL---------KGYSNP---------DDDPRGL-WTSVVYTCSKTRAERPNL-FYPIKHPVTD--VDVWPSETRVWGYDEARHKKHVEENMLWWGKNG-------EQEKPRIKVFLSKVGEGVVPSTIWLRDEVGDNQDARREAMALNSEG-SFSTPKPESLIRQMVSIATAPGDLVLDSFAGSGTTG 346
>gi|7465375|pir||B64710 site-specific DNA-methyltransferase (EC 2.1.1.-) HP1522 - Helicobacter pylori (strain 26695) (627 aa)
Score = 238, Expect = 3.9e-18, Identities = 93/289 (32%), Positives = 134/289 (46%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNG--YSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTK 290
           M  RL  AK LLK DG+IFISIDDNE A LK+L D+IFGE NF++ + W K+   +    +    EYIL Y+K+         F +  K G    +   ++ D  ++N  N     YF      K  L      K +  +       D    I+ G    R       + ++    +   E IEK +  +TKN         +E+  K+     +  +  NQ   + ++    +++   +   F NPKP +LI  LI   +NE  IILDFFAGSGTT HAV+E N     K
  S:   171 MYPRLLLAKDLLKQDGVIFISIDDNECAQLKLLCDEIFGEGNFVACLKWKKKKQPSFLSKVAVILEYILVYAKD---------FSLIDKLG----LDNVSDSDKPIINTSNNLSKRYFKKGIRVKSDLNFIKSGKYQNKTMTIEFMNDI--FIENG----RTKNDFECIGKFRTGQENINEFIEKDLIFITKNLGIRRDLLEEEQSNKKTITDLLTEWGQNQDATNELNILFNNSSDESI---FSNPKPTKLINRLIELSTNEGDIILDFFAGSGTTAHAVLESNKSDYQK 439
>gi|15611314|ref|NP_222965.1| type II DNA modification (methyltransferase [Helicobacter pylori J99] >gi|4154761|gb|AAD05820.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter pylori J99] (390 aa)
Score = 238, Expect = 4.2e-18, Identities = 101/306 (33%), Positives = 163/306 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQ---------------SIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           + E L  AK +LK  G IFIS+DDN+ A +K++ ++IFG  NF+   +  K+  +++ K+I   HEY+L+Y+KN K F     F+I +    L+ +   A +D L+   KN+     F      +  L+  +  K        N  K+   + +KG +     +      R       AI+ I   +  +   G+S   +DEK  K++ +++ + F  N+               S++D   S +G+  L KLG++  F  PKPV LIK+L+   + +++IILDFFAGSGTT  AV+E+N D     N  F LC  EE+ K +
  S:    50 IEEHLILAKAVLKQSGCIFISMDDNKMAEVKIIANEIFGTRNFLGTFI-TKQATRSNAKHINITHEYVLSYAKN-KAFAPG--FKILRT---LLPIYAKALKD-LMRTIKNV-----FKQKGQAQAQLILKEQIKELSQKEHFNFLKNYNLVDEKGEIYFAKDLSTPSNPR-----SVAIQEINLFLEPLKSRGWS---SDEK-LKELYYQNRLIFKNNRPYEKYYLKESQDNCLSVLD-FYSRQGTKDLEKLGLKGLFKTPKPVALIKYLLLCSTPKDSIILDFFAGSGTTAQAVIEVNKDYYL--NWSFYLCQKEEKIKNN 347
>gi|15644888|ref|NP_207058.1| adenine specific DNA methyltransferase (mod) [Helicobacter pylori 26695] >gi|2313354|gb|AAD07328.1| adenine specific DNA methyltransferase (mod) [Helicobacter pylori 26695] (384 aa)
Score = 237, Expect = 4.7e-18, Identities = 101/306 (33%), Positives = 163/306 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQ---------------SIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           + E L  AK +LK  G +FIS+DDN+ A +K++ ++IFG  NF+   +  K+  +++ K+I   HEY+L+Y+KN K F     F+I +    L+ +   A +D L+   KN+     F      +  L+  +  K        N  K+   + +KG +     +      R       AIE I   +  +   G+S   +DEK  K++ +++ + F  N+               S++D   S +G+  L KLG++  F  PKPV LIK+L+   + +++IILDFFAGSGTT  AV+E+N D     N  F LC  EE+ K +
  S:    50 IKEHLILAKAVLKQSGCLFISMDDNKMAEVKIIANEIFGTRNFLGTFI-TKQATRSNAKHINITHEYVLSYAKN-KAFAPG--FKILRT---LLPIYARALKD-LMRTIKNV-----FKQKGQAQAQLVLKEQIKELSQKEHFNFLKNYNLVDEKGEIYFAKDLSTPSNPR-----SVAIEEINLFLEPLKSRGWS---SDEK-LKELYYQNRLIFKNNRPYEKYYLKESQDNCLSVLD-FYSRQGTKDLEKLGLKGLFKTPKPVALIKYLLLCSTPKDSIILDFFAGSGTTAQAVIEVNRDYCL--NWSFYLCQKEEKIKNN 347
>gi|188527067|ref|YP_001909754.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] >gi|188143307|gb|ACD47724.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] (390 aa)
Score = 237, Expect = 5.2e-18, Identities = 97/306 (31%), Positives = 156/306 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQ---------------SIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           + E L  AK +LK  G IFISIDDN+ A +K++ ++IFG  NF+   +  K+  +++ K+I   HEY+L+Y+K       N+ F    K  + +          L+   KN+     F      +  L+  +  K        N  K+   + +KG +     +      R       AI+ I   +  +   G+S   +DEK  K++ +++ + F  N+               S++D   S +G+  L KLG++  F  PKPV LIK+L+   + +++IILDFFAGSGTT  AV+E+N D     N  F LC  EE+ K +
  S:    50 IKEHLILAKAVLKQSGCIFISIDDNKMAEVKIIANEIFGTRNFLGTFI-TKQATRSNAKHINITHEYVLSYAK-------NKAFAPGFKILRTLLPIYAKPLKDLMRTIKNV-----FKQKGQTQAQLVLKEQIKELSQKEHFNFLKNYNLVDEKGEIYFAKDLSTPSNPR-----SVAIQEINLFLEPLKSRGWS---SDEK-LKELYYQNRLIFKNNRPYEKYYLKESQDNCLSVLD-FYSRQGTKDLEKLGLKGLFKTPKPVALIKYLLLCSTPKDSIILDFFAGSGTTAQAVIEVNKDYYL--NWSFYLCQKEEKIKNN 347
>gi|54020499|ref|YP_115937.1| hypothetical protein mhp427 [Mycoplasma hyopneumoniae 232] >gi|53987672|gb|AAV27873.1| conserved hypothetical protein [Mycoplasma hyopneumoniae 232] (352 aa)
Score = 236, Expect = 6.1e-18, Identities = 104/344 (30%), Positives = 174/344 (50%)
  Q:    35 MDDIFGEDNFISNIVWDKRN--AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG----LLVNRKNMGWT--LYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLF-----YADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ--DVSLKTFNINYADVSI---NSNIDKLLEEIKKSM 378
           MD+IFGE+NF++N+VW K+N  +  D+K+++   E++LAYSKN ++   N ++  N   G          E G    + ++R ++ W+  L +    N KI       +K +         KD                      RW W+         K +    KNG+ +F     ++ + ++   +++ I R +   ++I     ++G+   + +     F +PKP+ELIK+LIN H N+NA ILDFFAGSGTTGHAV +LN   +  GNR F L TN +               +ERL+ +     T  E     + D +KK Q    +L  F INY +  I    ++++ L+++++K +
  S:     1 MDEIFGEENFVANLVWQKKNEGSAADSKFVKVLTEHVLAYSKNIQHLTTN-IYVQNINDGSYKFSDEYIQERGKYKLIQLDRASLTWSEGLDYPIEYNGKIYYAGGSQEKWQARHQGNRAVKD---------------------WRWRWA--------RKKLDWGIKNGFIVFKNEKVFSKQYQFVDNNNQKIERVSKFSNLILLAQGTEGTQEQKNIFSTKVFDHPKPIELIKYLINIHPNKNAKILDFFAGSGTTGHAVWDLNR--QDGGNRIFTLVTNNQNNIAINIT-------YERLFRINHGFGTKKEQ----NFDWIKKNQPYKTNLDVFRINYFNTEIFNKENDVNLLVKKLEKML 321
>gi|135253|sp|P12364|T3MO_ECOLX Type III restriction-modification system EcoP15I enzyme mod (M.EcoP15I) (EcoP15I methyltransferase) >gi|42237|emb|CAA29616.1| unnamed protein product [Escherichia coli] (645 aa)
Score = 236, Expect = 6.5e-18, Identities = 95/301 (31%), Positives = 152/301 (50%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQM--TIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTI---ENLYKDDKEIIDKGFV--PIRPPIKNGVLLRWSWSFDKAIERI---EKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE----FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTK 305
           RL  A++L+++DG IFISID NE + LK++ D+IFGE N + ++VW K    N+   I   HEYI+ Y+KN +         I+  K  L+ +     +   G   N     +T +F    +E  PL  Y  K +++D      ++++   KE      +    + P K   L+ + +  D  ++R+   EKII    +N         K+YKQ             S + ++     +N L++L  E    F N K ++L++ LI+   +   I+LDFFAGSGTT H V  LN+  K K + +FI    +E  K
  S:   181 RLYIARELMREDGTIFISIDHNEFSQLKLVCDEIFGEQNHVGDLVW-KNATDNNPSNIAVEHEYIIVYTKNKEQLISEWKSNISDVKNLLVNIGEEFASKYTG---NELQEKYTQWFREHRSELWPLDRY--KYIDKDGIYTGSQSVHNPGKEGYRYDIIHPKTKKPCKQQPLMGYRFPLD-TMDRLLSEEKIIFGDDENKIIELKVYAKDYKQ-----------KLSSVIHLDGRVATNELKELFPEMTQPFTNAKTIKLVEDLISFACDGEGIVLDFFAGSGTTAHTVFNLNN--KNKTSYQFITVQLDEPKK 475
>gi|54303973|emb|CAG24072.1| restriction endonuclease EcoP15I, modification subunit [Escherichia coli] (644 aa)
Score = 236, Expect = 7.3e-18, Identities = 97/301 (32%), Positives = 153/301 (50%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQM--TIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKG-----FVPIRPPIKNGV---LLRWSWSFDKAIERI---EKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE----FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTK 305
           RL  A++L+++DG IFISID NE + LK++ D+IFGE N + ++VW K    N+   I   HEYI+ Y+KN +         I+  K  L+ +     +   G   N     +T +F    +E  PL  Y  K +++D     +Y   + + + G     +  I P  K      L+ + +  D  ++R+   EKII    +N         K+YKQ             S + ++     +N L++L  E    F N K ++L++ LI+   +   I+LDFFAGSGTT H V  LN+  K K + +FI    +E TK
  S:   181 RLYIARELMREDGTIFISIDHNEFSQLKLVCDEIFGEQNHVGDLVW-KNATDNNPSNIAVEHEYIIVYTKNKEQLISEWKSNISDVKNLLVNIGEEFASKYTG---NELQEKYTQWFREHRSELWPLDRY--KYIDKDG----IYTGSQSVHNPGKEGYRYDIIHPKTKKPCKQPLMGYRFPLD-TMDRLLSEEKIIFGDDENKIIELKVYAKDYKQ-----------KLSSVIHLDGRVATNELKELFPEMTQPFTNAKTIKLVEDLISFACDGEGIVLDFFAGSGTTAHTVFNLNN--KNKTSYQFITVQLDEPTK 474
>gi|194015654|ref|ZP_03054270.1| type III DNA modification methyltransferase [Bacillus pumilus ATCC 7061] >gi|194013058|gb|EDW22624.1| type III DNA modification methyltransferase [Bacillus pumilus ATCC 7061] (634 aa)
Score = 235, Expect = 9.2e-18, Identities = 99/317 (31%), Positives = 146/317 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDS--TIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYS-----LFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEER--TKQDINKTIAKDIC 317
           MM  RLK ++ LL D G+I I+I + E   LK ++++I+GE N +  I+W K+   N+  +I   H+YI  Y+K                    I+M I   E GLL   + +    Y NP  + +      D          +IEN    +     KG               W ++  +   RI +      K G +     +FY +EKEYK++   SI        I  N  +S   + L      F +PKPV L+K L+   + +N I+LDFF+GS TT HA ++LNS+   +GNRKFIL    E    K +  K   K IC
  S:   172 MMYARLKLSRNLLSDKGVICINIGEEEHEKLKFILNEIYGEKNLLGTIIWKKKTNGNNQGHIPSIHDYIYCYAKK-------------------IEM-INEKEIGLLPTEEFLSKN-YSNPDNDTRGIWTTQDLSANHEGPYFSIENPNTGEIHYPPKG-------------RYWVFNEKEVQRRISEGRIIFGKRGITAPVQKVFY-NEKEYKKIKVSSIW-----SDIALNADASAEISDLFDQPKIFSHPKPVGLLKRLLEVFTEKNDIVLDFFSGSATTAHATIQLNSE--DEGNRKFILVQLPETLDEKSEAYKIGYKTIC 455
>gi|113971114|ref|YP_734907.1| DNA methylase N-4/N-6 domain-containing protein [Shewanella sp. MR-4] >gi|113885798|gb|ABI39850.1| DNA methylase N-4/N-6 domain protein [Shewanella sp. MR-4] (622 aa)
Score = 235, Expect = 1.0e-17, Identities = 96/309 (31%), Positives = 158/309 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFIS-NIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDP--KKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNG-----YSLFY--ADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNE--------ERTKQDIN 309
           MM  RL   K+LL +DG I++++DDNE    K+LMD++FG+D F+   +V +    +ND ++I   HEYIL YS +   F +++  ++ ++  QL   T+  +E G L + +++      +    E  P M Y     K     ++E    +D EI+     P+R    +G   RW W   +A + ++ +  + +  G     Y ++    D K+ K     +    ++  +++ NI +  G N L         PK +  ++  I        I+LD FAGSGTT HAV+E N   K  G+RKFIL   E        ER ++ IN
  S:   118 MMWPRLMLLKELLSNDGSIWLTLDDNEVNSAKLLMDEVFGDDKFVGLFVVVNNLKGRNDKEHIAITHEYILVYSGD--EF-VSKGLDLTEE--QLKDFTL-KDESGCLYSLRDL--RKRGSEDRREDRPKMFYPIFWNKSANTLSLERSSNNDIEIL-----PMR---GDGTHGRWRWGKARAFQNLKNLEARESSKGRFDVSYRVYLDETDGKKSKSFWQGTEFATDLGTTLLKNIFA--GQNPLGHA------PKTLAHVQRCIELSIGREGIVLDSFAGSGTTAHAVLEANK--KDNGSRKFILVECEDYADTLTAERVRRVIN 418
>gi|157158703|ref|YP_001465832.1| N4/N6-methyltransferase family protein [Escherichia coli E24377A] >gi|157080733|gb|ABV20441.1| N4/N6-methyltransferase family protein [Escherichia coli E24377A] (1040 aa)
Score = 234, Expect = 1.3e-17, Identities = 111/406 (27%), Positives = 182/406 (44%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGAN--EDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIE---NLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNIS-SSKGSNTLRKLGIEFPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFTLEKEN 406
           MM  RL   K LL ++G+ F  ID+NE   L ++   +   D     I+WDKRN  N    I   HEY   ++KN        +  INKK   ++++   A   ++   V         Y     N+K+   +   K ++    +    +L   +     K ++P+  P+           F +  E ++ ++ K    G  LF  DE    Q   K+ +  +  + I   I  + KG      LGI+FP      L  +LI   S N+N IILDFFAGSGT+GH+V+ELN   K  G+RK+IL    E   Q++  +  + + F   +   K + ++  S + L V +++ Y+DV                 ++ L  E +K ++ +   FD  NES+  +    + LE E+
  S:   519 MMDSRLLFVKNLLSENGVFFCHIDENEYERLYLINKQLGLID--AGTIIWDKRNPMNGGSGIAIQHEYTTCFTKN--------MISINKKNENVLEILEYAKLIKNKYPVINSEAKKKFYDWVTKNKKLTGGEQAYKYIDEKGRVYQSVSLRAPEPRTDKKFYIPLIHPVTGKPCAMPPNGFSRTPETLKDMMDK----GDILFGVDET--TQPRQKAYLYADAKKQITSIIQDAKKGKTQTTHLGIDFPYCHSTSLYNYLIGSASHNKNEIILDFFAGSGTSGHSVIELNR--KDAGSRKYILVEQGEYA-QNVTLSRLRKVIFSSNWKDGKAMDSTTGSSHILKVMKIESYEDV-----------------LNSLRFEQQKEIKDL---FDTVNESVANEYLIKYMLETES 892
>gi|109946647|ref|YP_663875.1| type III restriction-modification system methylation subunit fragment 1 [Helicobacter acinonychis str. Sheeba] >gi|109713868|emb|CAJ98876.1| type III restriction-modification system methylation subunit fragment 1 [Helicobacter acinonychis str. Sheeba] (463 aa)
Score = 232, Expect = 1.8e-17, Identities = 97/274 (35%), Positives = 140/274 (51%)
  Q:    17 GIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN----KYIEKNHEYILAYSK-NWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYF---NPATNEKIPLMDYDPKKVERD--STIENLYKD-------DKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL---GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTK 290
           G+IFISIDDNE A LK+L D+IFGE NF++  +W  +N  + N    K I+   EYI  Y K N+K  K     E  ++KG +++       D     R +   T      + ++ + I  +DY+ +  +       +N+ K+        K++ D G        +NG +      F K  +       KM    Y L   D K YK +  KS    N   ++I N+ S  G+N +R +      F  PKP++LI  LI   +NE  IILDFFAGSGTT HAV+E N     K
  S:   186 GVIFISIDDNEAAQLKLLCDEIFGEGNFVAQFIWHSKNKPSGNTTEDKTIDTRTEYIFCYQKCNFKANKHENTKEELEEKGYVLK-------DEYFETRGHYKLTPLMRSCSASSFQYIESLDYEIQAPDGTWFKNHQNIKKEKSYCYTWSKKLFDFGN-------QNGFI-----EFQKTSDGFWCAYRKM----YELCAIDNKNYKIIYRKS---GNAYSNLITNLYSDIGANEVRNIFNGEKIFSYPKPLKLINRLIELSTNEGDIILDFFAGSGTTAHAVLESNKSDYQK 453
>gi|4454667|gb|AAD20952.1| methyltransferase [Mannheimia haemolytica] (706 aa)
Score = 230, Expect = 3.4e-17, Identities = 96/317 (30%), Positives = 167/317 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKK------KGQLIQMT-----IGANEDGLLVN--RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNG-YSLFYADEKEYKQV----SHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFP---NPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           MM  RL  AK LL+DDG+IFISIDDNEQA LK+L D++FGE+NF++ + V +    + ++K+I  ++++ + Y+KN +  K  +    N K       G  +  +     +G N+    V     +  +++YFN   ++ I   +            ++L   D  +I++G+V       +   +  +++  K +E  E    + T++  Y   ++D    K +    ++K++   N+    +D  ++S G+        + P    PK    ++ LI    ++N I LDFFAGS +  HA++E  S+   KGNRKFI     EE   +  N  +AK  C
  S:   217 MMLPRLHLAKNLLRDDGVIFISIDDNEQAQLKLLCDEVFGEENFVAILSVENNPKGRKNSKFISVSNDFCIIYAKNKEMGKFVENIPKNAKDMCQDENGHYVHASGKRVLVGENKFNQPVTDFTSDKHYSVYFNKLDDDIILKFE------------DSLDDKDLNLINQGYVRYISFFDDE-FVENTYTRFKFLELFEDESLEFTEDKIYEKNFSDTIRMKSILNNKNYKAVSAGNLTNYTLDVKTTSAGTLVKELFETKLPVFSAPKNPNFLRHLITLFEDKNFISLDFFAGSSSFPHAILE--SNRIDKGNRKFIAVQYPEEIDIKSKNGKVAKQFC 541
>gi|119717929|ref|YP_924894.1| site-specific DNA-methyltransferase (adenine-specific) [Nocardioides sp. JS614] >gi|119538590|gb|ABL83207.1| Site-specific DNA-methyltransferase (adenine-specific) [Nocardioides sp. JS614] (392 aa)
Score = 229, Expect = 4.0e-17, Identities = 89/328 (27%), Positives = 158/328 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQV---------FEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTK----NGYSLFYADEKEYKQVSHKSIVRFNINQSI--IDNISSSKGSNTLRK--LGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN------KTIAKDICFERLYCLIKNI 328
           MM  RL  A+++L + G IF+SIDD+E A+L++LMD+++GE N ++ +V +     +   +    +HEY+L Y+++ +   ++           F +    G+  +     N      N+K       FNP T   +    +   +  R +T+            +G V I P   +G    W WS     +R + ++ +  K        +F  D            VR    ++I   + + S+  +    K  +G  F +PKP  L++ ++     + A++LDFFAGSGTTGHAV   N+     G R+ +   + E T++  N      +T+A DI   RL  + + +
  S:    58 MMRPRLTAAREVLAETGAIFVSIDDHEVAHLRLLMDEVYGEQNLLAQVVVNLNPKGRQLGRGFATSHEYLLVYARDARRTVLDAATHETVDPSDFPLESADGRRYRQLPLRN-----TNKK-------FNPVTARTLHFTVWGDPQTGRVATVPF----------EGAVEIGPVFGDGTPAVWRWSRPLIDQRPDDLVCRRVKGRLGERVDVFQKDWLHPVAAGGVPGVRRKKLRTIWLAEEVGSTDTAVAELKEVVGHVFESPKPTGLLRRILGTMPGD-AVVLDFFAGSGTTGHAVALQNA--ADGGTRRCVSINSAEPTREGSNARNAGLRTVA-DITRARLRAVAERV 383
>gi|188591328|ref|YP_001795927.1| restriction modification Type III methylase [Cupriavidus taiwanensis] >gi|170938723|emb|CAP63709.1| restriction modification Type III methylase [Cupriavidus taiwanensis] (685 aa)
Score = 229, Expect = 5.0e-17, Identities = 110/396 (27%), Positives = 196/396 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK----IIPKMTKNGYSLFYADEKEYKQVS-------HKSIVR-------FNINQSIIDNISSSKGSNTL-RKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES-----FNNLSVDELKKYQ------DVSLKTFNIN------YADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQL 396
           MM  RL  A+ LL +DG IF+SID++E   L  LMD+I+GE N I+ IVW K    N+   +   HEYI+ ++K+     I++   + K +       +   +D +L   + +   +Y +P   ++     +     E  ++I +    D + +  G   +  P   G + R        +E  E     ++P    NGY       KE  Q         H  IV+       F    S + ++ S  G+N + R LG    F NPKP EL+ ++ +   +   I+LDFFAGS  +  AVM+LN+    K  RKFI+    ER    + K   + + F R   L +NI    +S      +  S ++ ++ +      D+  + F ++      +  +  N+ +D++ E+++  + + H D   + E+++ ++
  S:   190 MMYPRLYLARNLLTEDGTIFVSIDEHEIENLNRLMDEIYGESNRIATIVW-KGATDNNPTRVAVEHEYIVCFAKD-----ISRCPAVWKSR-------VSDAKDMMLAKYEELR-PVYSSPGVIQE-HFRRFIKDNSESLASITHYNLVDNDGVYTGSRKVHNPKPGGYVYR--------VEHPETGENCVLP---ANGYRFPEERMKELIQQKKIIFGDDHTQIVQIKEYLKDFEEKLSSVIHLDSRAGANEIGRLLGNRKVFTNPKPYELLAYIFDFQLDNGDILLDFFAGSCASAQAVMDLNARDGAK--RKFIMVQLPERLDASV-KEHKEGLSFCRDNGLPENIAEISKSRLRRALDRYSGEDARQAELTSSDADLGFRVFKLDKSNFRRWQQIGANATVDQIAEQLE--LHVEHVDPSASQEALLFEI 592
>gi|187777772|ref|ZP_02994245.1| hypothetical protein CLOSPO_01364 [Clostridium sporogenes ATCC 15579] >gi|187774700|gb|EDU38502.1| hypothetical protein CLOSPO_01364 [Clostridium sporogenes ATCC 15579] (652 aa)
Score = 229, Expect = 5.1e-17, Identities = 97/317 (30%), Positives = 156/317 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIG----ANEDGLLVNRKNMGWTLYF---NPATNEK-IPLMD-----YDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSL----FYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENA-IILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT--KQDINKTIAKDIC 317
           MM  RL+ A+ LLKDDG+IFISID+NE   LK++ D+IF E NF   IVW K  ++ND  YI   HEYI+ Y ++ KNF      E  +    + +   G      ++   ++++ + W   +   NP +N K     D     Y P  +   +  + +Y     I  K   P++ P +      W    +    +I++      K+  ++     Y  + +Y+ ++        +    + N+   K           F NPK  +L++ +      E   I+LDFF+GSGTT  A+M++N+  K  GNRK IL    E    K++  K   K+IC
  S:   170 MMYPRLRLARNLLKDDGVIFISIDENEHDNLKLICDEIFAEYNFAGEIVW-KNGSKNDQDYISMQHEYIMFYVRD-KNFNKGDWKEKKEGLDDIFRAFEGFYKECGDNWGEIHKRALSWFKQYPESNPISNSKHYTWFDDINGVYFPDNISGPNDGQYVYDILHPITKK---PVKKPSRG-----WFCPLESMQVKIKEGKIHFGKDETTVPCLKTYLKDTQYQSLTSVKFKDGRVASKYLKNLLGGK----------YFNNPKDSDLLEGIFKSIGLEKEDIVLDFFSGSGTTAQAIMKMNT--KDNGNRKVILVQIPENIDEKEEAYKAGYKNIC 484
>gi|187250641|ref|YP_001875123.1| DNA methylase N-4/N-6 domain-containing protein [Elusimicrobium minutum Pei191] >gi|186970801|gb|ACC97786.1| DNA methylase N-4/N-6 domain protein [Elusimicrobium minutum Pei191] (656 aa)
Score = 227, Expect = 8.4e-17, Identities = 103/338 (30%), Positives = 164/338 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLL-----VNRKNMGWT------------LYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN------KTIAKDICFERLYCLIKNIKTSGESFNNL 338
           MM  RL  AK LLKDDG+IF+SIDDNE   L++LM+++FGEDNF +      +     ++   KNH+Y+L YS   KN     +  I               E G       ++  ++GW             +Y+   + EK     Y+ +   +    +  ++  K++ + GF      +K+       ++      +IEK+      N Y +   D         K +      ++   N +++K  + +   GI F   KP ELI  L +  + ++  +LDFFAGSGTT  AVMELN +    G RKFI     E+T++         KTI+ +I  ER+   IK I+T  ++ N +
  S:   177 MMYPRLFLAKNLLKDDGVIFVSIDDNEVHNLRLLMNEVFGEDNFKAIFPRVTKKGGKSSEATAKNHDYVLMYS---KNNSFADIIGIAHNDDGYSNQDEFFEERGFYKLNQTLDYDSLGWVKSLDYPIEIGEHVYYAGGSKEK-----YEERHSGKHGRADWGWRWSKDLFEFGFSNGFVELKDSGSRPRIYTKTYQNVKIEKV-----GNKYEIINIDRS-------KPLSTLEFIENKYSNDNATKVIDGVIGKGI-FEYTKPPELISQLAHLINEKDFFVLDFFAGSGTTAQAVMELNKE--DGGKRKFICVQLPEKTEETSEAFRAGYKTIS-EISAERIRRAIKKIETETKADNTM 513
>gi|74316954|ref|YP_314694.1| adenine specific DNA methylase MOD [Thiobacillus denitrificans ATCC 25259] >gi|74056449|gb|AAZ96889.1| adenine specific DNA methylase MOD [Thiobacillus denitrificans ATCC 25259] (577 aa)
Score = 227, Expect = 8.4e-17, Identities = 87/302 (28%), Positives = 143/302 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK-YIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIEN--LYKDDKEI--IDKG--FVPIRPPI--------KNGVLLRWSW---SFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE----FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           ++ +RL+  ++LL DDG ++ISIDDNE  YLKVL D+IFG   F+++ +W K ++ NDNK  +  +HEYIL Y KN                                        ++YF P  +E I L  Y     E D    +  L K+ K    ID+   + PI+ P          +G   RW+      D+ I + E +  +    G   +    +EY   +           +I  ++ +++ +   ++  +E    F  PKP +L+  +++  +N    +LD FAGSGTTG A  ++         R++I+   EE
  S:    98 LVRDRLEIIRRLLSDDGSLWISIDDNEAHYLKVLCDEIFGRKCFVTSFIWKKVDSPNDNKGALSPDHEYILCYVKNPD--------------------------------------SIYFRPKQDESI-LNAYRQPDAESDRPYRDRLLKKNGKNSLRIDRPSMYFPIKGPDGVDVYPIHDDGQEARWAMGKKGVDELIAKGELVWKQRESGGVLRWVPYTREYAPDAPTRPW-----PTIWSDLHTTRQTKAHQRSVLEGVQAFETPKPEDLVSRILSISTNPGDWVLDSFAGSGTTGAAAHKM--------GRRWIMVELEE 369
>gi|188528291|ref|YP_001910978.1| type III DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] >gi|188144531|gb|ACD48948.1| type III DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] (633 aa)
Score = 227, Expect = 8.6e-17, Identities = 113/355 (31%), Positives = 164/355 (46%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPI-------KNGVLLRWSW-SFDKAIERIEKIIPKMTK-NGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLI--NKHSNENAIILDFFAGSGTTGHAVMELNSDPKTK---------------GNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKK----------YQDVSLKTFNI 356
           M  RL  AK LLK DG+IFISIDDN+ A LK+L D+IFGE NF+++ +   ++  ND K  +   HE++  Y+KN K F                          LL   KN+    Y NP  +     +  DP     D             I  G+  ++ P         NG   R+S  +  K I+       K  K N     Y    +  + + K+      + +   N +++K   +L  +G  F  PK VE +K +I  +   N N IILDFFAGSGTT HAV+E N     K                 R+FIL   +E+     NK+ A D C   L       K++  S  +++ + +K+          Y DV  + F I
  S:   171 MYPRLLLAKDLLKQDGVIFISIDDNQAAQLKLLCDEIFGERNFVADFIRKTKSTTNDAKTGVNYQHEFLFCYAKN-KEFV------------------------NLLGGEKNL--ENYKNPDNDPNGAWVSSDPTAKSGD-------------IKTGYFVVKNPYTGKVDYPTNGRFWRFSQNTMQKHIDEGHICFKKEHKDNERGFIYKRYLKDLKTTQKTFDSLIFSDNCYMNQTATKELLSL-GMGEYFTYPKGVEFMKKIILHSTTPNSNDIILDFFAGSGTTAHAVLESNKSDYQKLSEGGGSFNGLNAAFKERQFILVQLDEKIDPKKNKS-AHDFCLNTL-------KSTSPSIFDITEERIKRAGAKIKEACAYLDVGFRAFEI 513
>gi|15612361|ref|NP_224014.1| putative type III DNA modification enzyme (methyltransferase) [Helicobacter pylori J99] >gi|4155899|gb|AAD06869.1| putative TYPE III DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter pylori J99] (620 aa)
Score = 226, Expect = 8.8e-17, Identities = 88/275 (32%), Positives = 131/275 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNP-ATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           M  RL+ A++ L DDG+IF+  DDNEQAYLKVLMD+IFG +NFI+  VW+K    N    I    EYIL Y +     K   +F      G + +      +D  ++N  N+  TL F P +   K       P K  +   I++L   +K   +   V I    K        W+ DK  + I++    + K+         K  ++V   ++  FN    +  NI ++     L        F  PKP  L++ ++   +NEN ++LDFFAGSGTT
  S:   219 MKNRLEAAREFLSDDGVIFVQCDDNEQAYLKVLMDEIFGRENFIACFVWEK--TSNSLSRIRIKTEYILCYEQT----KFGLIF-----NGDMAE----EGQDFPILNEVNVKRTLQFPPNSIYFKTFKGVIKPTKFNKMELIDDLRIVNK--TNSNMVRINAKFK--------WTQDKLDDEIKEGTTFVIKSDEFSMRYIRKGDREVKASNV--FNAECGVTTNIKATSEIKVLFANSNTDLFSTPKPEALLQRILEISTNENDLVLDFFAGSGTT 469
>gi|114320695|ref|YP_742378.1| DNA methylase N-4/N-6 domain-containing protein [Alkalilimnicola ehrlichei MLHE-1] >gi|114227089|gb|ABI56888.1| DNA methylase N-4/N-6 domain protein [Alkalilimnicola ehrlichei MLHE-1] (1077 aa)
Score = 226, Expect = 9.7e-17, Identities = 90/297 (30%), Positives = 136/297 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTL----YFNPATNEKIPL----MDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAI-------ERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGS--NTLRKLGIE-FPNPKPVELIKFLIN-KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           +M++RL+     L++DG    SIDDNE   L+ +++ ++G DNFI  I W  R++ + +  I  NH Y +AY+K+                               LV  K  G+ L    Y NP  + + P     +D +    E    IEN    D+           PP  NG     SW+F+++         RI   I         LF  +  E   V        N   SI  +  +++G     +   G + F  PKPV L++ LI   H N N ++ D+FAGSGTTGHA++ LN    ++  RKF+L
  S:   540 LMADRLQSGASFLREDGTFICSIDDNEYPTLREILNSVYGGDNFIGTIAWKSRDSVSSDHKISLNHNYHVAYAKD-------------------------------LVANKFGGFPLNPGDYSNPDNDPRGPWKPVPIDANKPGGETKYPIENPNTGDEHY---------PP--NGR----SWAFNRSRYDELLSDNRITFGIRGTGAPKRKLFLKERTEKGDV--------NTPVSIWPDAETTQGGTRQVMSLFGNKVFSYPKPVGLMRDLIRISHLNSNCVVADYFAGSGTTGHAIVNLNRADGSR--RKFLL 799
>gi|153955848|ref|YP_001396613.1| Type III restriction-modification system, modification subunit [Clostridium kluyveri DSM 555] >gi|146348706|gb|EDK35242.1| Type III restriction-modification system, modification subunit [Clostridium kluyveri DSM 555] (656 aa)
Score = 226, Expect = 1.1e-16, Identities = 93/305 (30%), Positives = 151/305 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKI-PLMDYDPKKVERDSTIENLYKDDKEIIDKG-FVPIRPPIKNGV--LLRWSWSFDKAIERIEK----IIPKMTKNGYSLFYA----------DEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           M  RL  A+ LL DDG+IFISIDDNE   LK+L DD+FGE+NFI+      +     ++ I KNH+Y+L YSK         +F I             A+ D    ++       +F      K+   +DYD   ++   +++   + D E+   G  + +    ++G+     W+W + KA          I+ K +KNG  L+            D+  Y +   ++     +  +  DN+ S+  +     L I    F + KP+ L+  L    + ++ IILDFF+GS  T  A+M+LN D  T+  RK+I+    E+ K+
  S:   178 MYSRLLLARDLLTDDGVIFISIDDNECHNLKLLCDDVFGEENFIAEFPRITKRGGKSSEIIAKNHDYVLMYSKT----NAPLLFPI-------------AHNDSAFKHKDE-----FFEERGYYKLNQTLDYD--SLQYSKSLDYPIEIDGEVFYPGSSLELYNERQSGIHDTADWAWRWSKAKFEFGYKNGFIVVKRSKNGSRLYTKTYQKATIEENDDGYYIEYGDRTKCLSTLETT--DNMYSNDNATKDVALTIGKKIFNHTKPLALMTLLAKLSTQDSDIILDFFSGSAATAEAIMKLNCDENTR--RKYIMVQLPEKCKE 475
>gi|160899639|ref|YP_001565221.1| DNA methylase N-4/N-6 domain-containing protein [Delftia acidovorans SPH-1] >gi|160365223|gb|ABX36836.1| DNA methylase N-4/N-6 domain protein [Delftia acidovorans SPH-1] (661 aa)
Score = 225, Expect = 1.3e-16, Identities = 98/297 (32%), Positives = 142/297 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFIS---NIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQV----------FEINK---KKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKII---PKMTKNGYSLFYADEKEYKQVSHKSIV---RFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RLK AK LL D G+I ISID +E   L+++MD++FG++NFI     I+  K N  ND       HE+ + Y++N +   + Q+           E  +   K+   ++ T    +D     R N GW   F     E    +D +P    R  +   L+               P  + G  L W+WS  K  +    +I    +  KN Y    A   +      KSI+    ++ +    + ISS  GSN           PKP  LI+  +   ++   IILDFFAG+GTTGHAVM  N     +GNR+FIL
  S:   179 MMYPRLKLAKNLLLDSGLIIISIDSSEATNLRLIMDEVFGQENFIGLLPTIMNLKGN--NDAFAFADTHEFTVVYARNKEKCVVFQLPVSEESLDDWLEDERGLYKRADTLRRT---GQDASRERRPN-GWFPVFIDEKGEVYATLDDEP----RSGSDLTLW---------------PVSEAGEELSWTWSKKKINDENFNLIVVEGRSGKNIYKKQRATLGDLPTSKPKSILYKPEYSSSNGTAE-ISSLLGSNVFDS------PPKPRSLIRDFVTIGTSPQDIILDFFAGTGTTGHAVMAQNF--LDEGNRRFIL 463
>gi|46143331|ref|ZP_00135457.2| COG2189: Adenine specific DNA methylase Mod [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126208289|ref|YP_001053514.1| type III restriction-modification system methyltransferase [Actinobacillus pleuropneumoniae L20] >gi|126097081|gb|ABN73909.1| type III restriction-modification system methyltransferase [Actinobacillus pleuropneumoniae L20] (615 aa)
Score = 224, Expect = 1.5e-16, Identities = 44/80 (55%), Positives = 61/80 (76%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           MM  RL  A+ LLKDDG+IFISIDDNEQA LK+L D++FGE+NF++ ++WDK+++Q    + +  HEY+L Y+KN  N K
  S:   151 MMLPRLHLARNLLKDDGVIFISIDDNEQAQLKLLCDEVFGEENFVAELIWDKQHSQQQGLF-KTYHEYVLLYAKNINNHK 229
Score = 105, Expect = 1.0e-02, Identities = 24/56 (42%), Positives = 36/56 (64%)
  Q:   229 SSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           SS  ++ L++L     F NPKP+ ++   I   +    IILDFF+GSG+T HA++E N
  S:   360 SSLHTDNLKELMNATAFNNPKPLPMLSDFIRWFTGRADIILDFFSGSGSTAHAILETN 417
>gi|165976230|ref|YP_001651823.1| adenine specific DNA methylase Mod [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876331|gb|ABY69379.1| adenine specific DNA methylase Mod [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (615 aa)
Score = 224, Expect = 1.6e-16, Identities = 44/80 (55%), Positives = 61/80 (76%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           MM  RL  A+ LLKDDG+IFISIDDNEQA LK+L D++FGE+NF++ ++WDK+++Q    + +  HEY+L Y+KN  N K
  S:   151 MMLPRLHLARNLLKDDGVIFISIDDNEQAQLKLLCDEVFGEENFVAELIWDKQHSQQQGLF-KTYHEYVLLYAKNINNHK 229
Score = 104, Expect = 1.6e-02, Identities = 24/56 (42%), Positives = 36/56 (64%)
  Q:   229 SSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           SS  ++ L++L     F NPKP+ ++   I   +    IILDFF+GSG+T HA++E N
  S:   360 SSLHTDNLKELMNATVFNNPKPLPMLSDFIRWFTGRADIILDFFSGSGSTAHAILETN 417
>gi|110798791|ref|YP_694818.1| type III restriction-modification system, Mod subunit [Clostridium perfringens ATCC 13124] >gi|110673438|gb|ABG82425.1| type III restriction-modification system, Mod subunit [Clostridium perfringens ATCC 13124] (683 aa)
Score = 224, Expect = 1.6e-16, Identities = 109/317 (34%), Positives = 152/317 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDST-IENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQV--------SHKSIVRFNINQSIIDNISSSKGSNTLRKL--GIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE--RTKQDINKTIAKDIC 317
           M+  RLK AK LL DDG+I ISIDDNE   LK + D+IFGE+NFI+N+VW+K+   +   K I    E+IL +SK  K++    + EIN  +           E    VN  N             K    DY   K    S+   NL      II  G +     I+      W +S +   E        +T++ Y      E  YK +          K+ V  N+        SS++ ++   +L  GI+     PKP +LI  +I  +  +  IILDFF+GS TT  AVM+LNS+    GNRKFI+    E    K +  K   K+IC
  S:   183 MIYPRLKVAKDLLSDDGVILISIDDNEVVNLKKICDEIFGEENFIANLVWEKKKKGSFLAKSITNIKEHILVFSK-VKDYFDGLIGEINDNQ-----------ETYPCVNASNKREIRIIPKGIISKFKEKDYILNKGSIISSGTMNLILHSDLIIKDGKLANELVIEG----NWRYSQEAMYEYAINRELYLTQDLYIRRIVSEVRYKALKDLLPRVGKDKNSVNLNLKDLFESGWSSNEDADDEMRLLMGIQGLIEYPKPTKLIMKIIASYRKKEFIILDFFSGSATTADAVMQLNSE--DNGNRKFIMVQLPELCNEKSEAYKNGYKNIC 497
>gi|21226295|ref|NP_632217.1| type III restriction-modification system methylation subunit [Methanosarcina mazei Go1] >gi|20904540|gb|AAM29889.1| type III restriction-modification system methylation subunit [Methanosarcina mazei Go1] (1051 aa)
Score = 224, Expect = 1.6e-16, Identities = 94/297 (31%), Positives = 154/297 (51%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWK---NFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPL-MDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAI-------ERIEKIIPKMTK-----NGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN--PKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           ++S+ ++ +K +L  DGI F SID NE   LK + ++ FG DN++++++WD         +  ++HEYI +Y+KN K   NF                        DG  +    +      NPA+    P  ++++  K E    I    K+   II +        +K  V+++  W+  K I       E  +    K+TK     NG   +   EKE  +++ K+++    N        + +G++TL+ +  E  +  PKP +L++FLIN  S +E +IILDFFAGSGTT HA++ LN +    GNRK+IL
  S:   556 LLSQTIQSSKGILTLDGIFFCSIDSNEAHNLKQVFNEYFGSDNYLADLIWDLGTGTTAGHFT-RSHEYIYSYAKNKKMLDNFDYT---------------------DGGTITHGALKKISKANPASEILFPAGIEFEGDKDEFSGCIGGSEKE--YIISEKMEFENGKLKKPVIIKAGWAMKKQILNWLEGKETYDTKGQKVTKFYFNKNGILCY---EKEKSKINPKTVISKLTN--------TKEGTSTLKNVINEDIDLYPKPPKLLEFLINLGSQDEASIILDFFAGSGTTAHAILNLNKE--ECGNRKYIL 834
>gi|171060836|ref|YP_001793185.1| DNA methylase N-4/N-6 domain-containing protein [Leptothrix cholodnii SP-6] >gi|170778281|gb|ACB36420.1| DNA methylase N-4/N-6 domain protein [Leptothrix cholodnii SP-6] (553 aa)
Score = 224, Expect = 1.7e-16, Identities = 72/277 (25%), Positives = 123/277 (44%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADE------KEYKQVSHKSIVR---FNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           +M +RL+  ++LL DDG ++I+IDDNE  YLKVL D++FG  N+++++VW+K   +  +     +H+Y+L Y++N   F                    G   +  L+ R     + Y NP  + + P +  D    +  S           ++  G   + PP +        WSF +      + +      G   F A        K Y       +V    +  +++  +  +     N L +    FP PKP  L+  + +  +N   ++LD FAGSGTTG
  S:    98 LMRDRLEIIRRLLSDDGSLWITIDDNEAHYLKVLCDEVFGRRNYLTSVVWEKDKGRRSDTTFSASHDYVLIYARNPDLF--------------------GKTRN--LLERTEDQESRYRNPDNDPRGPWLQGDNGTAKSSSEGSRF----PVVLPSGRSVVPPPSR-------GWSFSR------ETLETARAEGRVYFGAKGDGMPIIKRYLSAVQAGVVPRTWWPADEAGHNQEAKRDHLNKLLRDVEPFPTPKPERLLHRIFSIATNPGDLVLDSFAGSGTTG 344
>gi|170724675|ref|YP_001758701.1| DNA methylase N-4/N-6 domain-containing protein [Shewanella woodyi ATCC 51908] >gi|169810022|gb|ACA84606.1| DNA methylase N-4/N-6 domain protein [Shewanella woodyi ATCC 51908] (510 aa)
Score = 223, Expect = 2.1e-16, Identities = 96/319 (30%), Positives = 151/319 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTL-------YFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFD-KAIERIEKIIPKMTKNGY--SLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI----------LCTNEERTKQDINK-TIAKDICFE 319
           M+  R++   QLL DDG I+I++DDNE  Y+KV++D+IFG  NF++N +W K    +N  KY+   HE++L YSKN       Q++E N         +  +N D    + K   WT        Y++  T E +       K V    T   + +D  + +D                R  W  D   + R++K + +  K+G   + F++ +        K  VR   N+  +D I               F  PKP +LI+ ++N  S E  ++LD F GSGTT        S    K NRKFI          LC + ++   D  +  I+KD+ ++
  S:    91 MIYPRMELLHQLLADDGSIWITLDDNESHYMKVILDEIFGRKNFVANCIWQKLYTVKNSAKYLSDMHEHVLVYSKN------KQIWERNLLPRTEKSASNYSNAD----DDKRGAWTTNAIQARNYYSLGTYEIVS--PSGRKHVPPQGTFWRISEDSFKKLDSDN-------------RIWWGKDGNNVPRVKKFLSE-AKDGVVPATFWSYQDAGSNADAKKEVREVFNE--LDEI---------------FITPKPEKLIQRILNIASKEGDLVLDSFLGSGTT--------SAVSAKMNRKFIGIELGEHAESLCVHRQKKVIDGEQGGISKDVAWQ 380
>gi|55822847|ref|YP_141288.1| type III restriction-modification system methylation subunit [Streptococcus thermophilus CNRZ1066] >gi|55738832|gb|AAV62473.1| type III restriction-modification system methylation subunit [Streptococcus thermophilus CNRZ1066] (646 aa)
Score = 222, Expect = 3.0e-16, Identities = 95/283 (33%), Positives = 135/283 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDK----EIIDKGFVPIRPPIKNGVLLR--WSWSFDKAIERIEKIIPK----MTKNG-----YSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ A +LL DDG I+ISID  E  YLKVL D IFG +NF+  +VW +  A  N  K   K+H+YIL Y+KN    K     E+N+                  + RK      Y NP         D DP+ V         YK D       ++K    I  P    VL    +SW F K  ER E+++        K+G     Y  F ++ K+   V  +++  +   Q +  N  + K   +L      F  PKP +LI+ ++   S+EN ++LDFF GS TT    M++N
  S:   246 MKNRLEIAWELLSDDGTIWISIDGYESHYLKVLADGIFGAENFLDEVVWQRAYAPINLKKTFSKSHDYILVYAKNNSGAK-----ELNR------------------LPRKAEMVASYKNP---------DNDPRGV---------YKADNFSVGPAVEKNIYEITTPSGRKVLPPDGYSWRFSK--ERFEELLADNRVYFGKDGNSAPSYKRFLSEVKD--GVVAQTLWTY---QEVGHNQDAKKEIKSLFDGQTAFGTPKPEKLIQRILTLGSDENDLVLDFFMGSATTQAVAMKMN 496
>gi|117924097|ref|YP_864714.1| site-specific DNA-methyltransferase (adenine-specific) [Magnetococcus sp. MC-1] >gi|117607853|gb|ABK43308.1| Site-specific DNA-methyltransferase (adenine-specific) [Magnetococcus sp. MC-1] (649 aa)
Score = 222, Expect = 3.1e-16, Identities = 83/271 (30%), Positives = 131/271 (48%)
  Q:    15 DDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPK-KVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII--------DNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNS 285
           DDG+IFIS+DD E A  + + DDIFG +NF++NIVW K+ A  ND+  I   H++I+AY K+ + FK                        GLL   K      Y NP         D DP+ +   D+ + N  KD++  +   +  I+ P + G  +   W  + A+ R  K      +    L++  +  Y++   K  +   + Q I+        D+  + +G     KL     F  PKP+ L++ L+   + +  I++DFFAGSG  GHA +  NS
  S:   196 DDGVIFISLDDTEVANARSVCDDIFGAENFVANIVWQKKYAVSNDDPGIGVMHDHIIAYRKS-ETFK-----------------------RGLLPRTKEQN-DRYSNP---------DNDPRGEWASDNYVSNKSKDERPTL---WYSIKHP-RTGEEV---WPEEHAVWRYTKDKHDQLEREGRLYWGPDHSYRKPRLKRYLN-EVQQGIVPPTWWKFEDSGHNDEGQKETAKLIGKKVFSTPKPIRLLERLLEVGAPDGGIVVDFFAGSGAFGHAAISRNS 436
>gi|55820925|ref|YP_139367.1| type III restriction-modification system methylation subunit [Streptococcus thermophilus LMG 18311] >gi|55736910|gb|AAV60552.1| type III restriction-modification system methylation subunit [Streptococcus thermophilus LMG 18311] (641 aa)
Score = 221, Expect = 3.3e-16, Identities = 95/283 (33%), Positives = 135/283 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDK----EIIDKGFVPIRPPIKNGVLLR--WSWSFDKAIERIEKIIPK----MTKNG-----YSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ A +LL DDG I+ISID  E  YLKVL D IFG +NF+  +VW +  A  N  K   K+H+YIL Y+KN    K     E+N+                  + RK      Y NP         D DP+ V         YK D       ++K    I  P    VL    +SW F K  ER E+++        K+G     Y  F ++ K+   V  +++  +   Q +  N  + K   +L      F  PKP +LI+ ++   S+EN ++LDFF GS TT    M++N
  S:   241 MKNRLEIAWELLSDDGTIWISIDGYESHYLKVLADGIFGAENFLDEVVWQRAYAPINLKKTFSKSHDYILVYAKNNSGAK-----ELNR------------------LPRKAEMVASYKNP---------DNDPRGV---------YKADNFSVGPAVEKNIYEITTPSGRKVLPPDGYSWRFSK--ERFEELLADNRVYFGKDGNSAPSYKRFLSEVKD--GVVAQTLWTY---QEVGHNQDAKKEIKSLFDGQTAFGTPKPEKLIQRILTLGSDENDLVLDFFMGSATTQAVAMKMN 491
>gi|37518398|emb|CAD58550.1| hypothetical protein [Yersinia enterocolitica] (647 aa)
Score = 220, Expect = 4.4e-16, Identities = 97/320 (30%), Positives = 159/320 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVF--EINKKK--------------GQLIQMTIGANEDGLL------VNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVP--IRPPIKNGVLLRWS---WSF------DKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL------GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           M+ R+   +++LK  G++ I ID  E   L +LMD+IFGEDN ++ I W K   A+ DNK++    EY+L Y K+    +   +   E + K+              G L   +  A +D  +      V     G   + +P  N KI L  + P+  ERD          K ++ KG  P  I   +      R +   W F           R++  + ++ K    + Y  + +   ++ + +   ++  +  D   S + ++ + +L      G  F   KP++L+  +I      + I+LD FAGSGTTGHAV+ELN +  T  NR+FIL       K D     AK +  ER+
  S:   139 MTPRIWMMREMLKPGGVMAICIDHRELFRLGMLMDEIFGEDNRLAIINWQKSAAARPDNKHVSTATEYVLVYGKDITRVRTASLARGEADNKRYSNPDNDPGNDWREGNLTAKSYSAKDDYGIQSPFTGVVHYPAGNGAWRHPKKNVKIWLNAWGPEYEERDIGDGR----GKALVVKGQQPGAIASSVSKKAYARLAKNNWPFLWFGRDGLGRPRVKTYLEQIKKGKVPVTYWSDTD---LASEILTDIDLGSTSWDYSESGRSADGVAELTAVVGQGHGFSTVKPLKLMTKIIQLWCRPDGIVLDPFAGSGTTGHAVLELNKEADT--NRRFILIEQGNTEKGD---HYAKTLTAERV 486
>gi|118576298|ref|YP_876041.1| adenine specific DNA methylase [Cenarchaeum symbiosum A] >gi|118194819|gb|ABK77737.1| adenine specific DNA methylase [Cenarchaeum symbiosum A] (538 aa)
Score = 220, Expect = 5.2e-16, Identities = 45/74 (60%), Positives = 57/74 (77%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK 74
           MM  RL+  K+LL DDGIIFISIDDNE  +L+V+MDD+FGEDNFI+  VW+    +ND+KY   +H+YIL YSK
  S:    84 MMWPRLQILKELLTDDGIIFISIDDNEYHHLRVMMDDMFGEDNFIATCVWEG-GLKNDSKYFSVSHDYILCYSK 156
Score = 134, Expect = 4.4e-06, Identities = 33/61 (54%), Positives = 41/61 (67%)
  Q:   242 EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           EF NPK V +IK LI+  +  + IILD FAGSGTT  AV+ELN +    GNR+FIL   E+
  S:   325 EFENPKDVSVIKDLISMVTPSDGIILDSFAGSGTTAQAVLELNKE--DGGNRRFILVELED 383
>gi|188574834|ref|YP_001911763.1| methyltransferase [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188519286|gb|ACD57231.1| methyltransferase [Xanthomonas oryzae pv. oryzae PXO99A] (543 aa)
Score = 220, Expect = 5.3e-16, Identities = 41/83 (49%), Positives = 60/83 (72%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           M  RL+ AK+LL DDG+IF+SIDDNE   L +LMD +FGEDNFI+N++W K  + +N  ++   +HEYIL YS+  +++  N +
  S:   123 MYRRLQLAKELLADDGVIFVSIDDNEVFRLGMLMDRVFGEDNFIANVIWQKVYSPKNTAQHFSDDHEYILTYSRKKEDWVPNPI 206
Score = 168, Expect = 5.2e-10, Identities = 34/79 (43%), Positives = 51/79 (64%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           F  PKPV+L++ ++   S     +LDFFAGSGT   AV +LN++    GNRKFIL ++ E T+   +K + +D+C ER+
  S:   335 FSTPKPVQLMERILRIASKPGDTVLDFFAGSGTFAQAVAKLNAE--DGGNRKFILVSSTEATEDAPDKNLCRDVCAERV 411
>gi|158424882|ref|YP_001526174.1| DNA methylase [Azorhizobium caulinodans ORS 571] >gi|158331771|dbj|BAF89256.1| DNA methylase [Azorhizobium caulinodans ORS 571] (576 aa)
Score = 220, Expect = 5.6e-16, Identities = 97/331 (29%), Positives = 163/331 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDN------FISNIVWDKRNAQNDNKY-IEKNHEYILAY-----------SKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSI---------------IDNISSSKGSNTLRKLGIE----FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTS 331
           MM  RL+  + L+K   +IF SIDDNE A  K L+   FG++N       +  I+W  +NA ++N   I   HEY+  +           S  W + K   +     K+ +L+   +  +E    ++ +   W     P      PL +Y+  +++R      ++   + + + G              R  + +D    + +K++P+    GY  F  D ++      + I   + +Q I               I  I   +G+N L+K+  E    F NPK   LI++L++  +  +A++LD FAGSGTT  AVM+LN   +  GNRKFIL   E+          A ++  ER+  LI+ + TS
  S:   112 MMWPRLQLLRDLMKPGAVIFASIDDNEVALFKHLLHATFGDNNNPKSNPHLGTIIW--KNATDNNPTNIAIEHEYVHVFCLERDGVAPIWSSPWSDLKDCLL----AKEQELLAANLSDDE----LSSQYTEWFRLHKPQLG---PLQEYN--QIDRGG----IFTASRSVHNPG--------------REGYRWDLMNPKTQKLVPQPLM-GYR-FPEDTRDELLAQDRIIFSDDPDQLIRLKTYVKDYKEKMPGIIEIDGRRGANELKKIFPESKQAFKNPKTYTLIEWLLSYTAGPDAVVLDSFAGSGTTAQAVMKLNE--RDGGNRKFILVEMED---------YADELTAERVRRLIQGVPTS 433
>gi|47092613|ref|ZP_00230401.1| type III restriction system methylase [Listeria monocytogenes str. 4b H7858] >gi|47019041|gb|EAL09786.1| type III restriction system methylase [Listeria monocytogenes str. 4b H7858] (423 aa)
Score = 219, Expect = 6.0e-16, Identities = 83/256 (32%), Positives = 135/256 (52%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLY-----FNPATNEKIPLMDYDPKKVERDSTIENLYKD-DKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIID-NISSSKGSNTLRKLGIE---FPNPKPVELIKFLI 256
           M+  RLK A+ LL D GIIF+SID+NE A L++L+ +IFGE+N    IVWDKRN + D+K +   HEYI+A +KN   F   + F+  KK  ++I      N+   +  + N  +TL      +    N K  L   +    + D    N+Y++      DK       P+ + +  + +    K    I+K + K+ +    +F +DEK     + K ++  N+ + +     + + GS  + K+G +   F NPKPV+LI+ LI
  S:   158 MIYPRLKLARNLLSDSGIIFVSIDENEIANLELLLTEIFGENNLAGTIVWDKRNPKGDSKGVSMQHEYIVAAAKNINIFSEFKEFKRPKKNAEII-----LNKSKEIFKKINDKFTLSDANEEYRKWINSKKDLSGGEKAYSKLDEK-GNVYREVSMAAPDKPEKRSHRPLTHPLTGKQTSVPAKGWRYIDKTMDKLLQQDLVIFGSDEKTIP--NQKYLLVENMMEKLPSLYYNGASGSGDITKIGFKQNIFDNPKPVDLIRQLI 415
>gi|58583834|ref|YP_202850.1| methyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84625637|ref|YP_453009.1| methyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|58428428|gb|AAW77465.1| methyltransferase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84369577|dbj|BAE70735.1| methyltransferase [Xanthomonas oryzae pv. oryzae MAFF 311018] (543 aa)
Score = 219, Expect = 6.9e-16, Identities = 41/83 (49%), Positives = 60/83 (72%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           M  RL+ AK+LL DDG+IF+SIDDNE   L +LMD +FGEDNFI+N++W K  + +N  ++   +HEYIL YS+  +++  N +
  S:   123 MYRRLQLAKELLADDGVIFVSIDDNEVFRLGMLMDRVFGEDNFIANVIWQKVYSPKNTAQHFSDDHEYILTYSRKKEDWVPNPI 206
Score = 167, Expect = 6.2e-10, Identities = 34/79 (43%), Positives = 51/79 (64%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           F  PKPV+L++ ++   S     +LDFFAGSGT   AV +LN++    GNRKFIL ++ E T+   +K + +D+C ER+
  S:   335 FSTPKPVQLMERILRIASKPGDTVLDFFAGSGTFAQAVAKLNAE--DGGNRKFILVSSTEATEDAPDKNLCRDVCAERV 411
>gi|86149055|ref|ZP_01067287.1| type II dna modification enzyme [Campylobacter jejuni subsp. jejuni CF93-6] >gi|85840413|gb|EAQ57670.1| type II dna modification enzyme [Campylobacter jejuni subsp. jejuni CF93-6] (822 aa)
Score = 219, Expect = 7.0e-16, Identities = 90/276 (32%), Positives = 134/276 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK--IIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII--DNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           MM  RL  AK+ LK+ G IFISIDDNEQA LK+L D++FGE+NF++N++W KR    ND+ +I    EYI  Y+KN ++ K   +   N  + +        +E G  + +         N  + +  P + YD K                  +  G       I  G   +W  S +    R+E+  II K     Y   Y D            +  N+  S I  D + ++  +N + KL  E   F  PKP +L+K + +  SN+N+++LDFF GSGTT
  S:   428 MMKNRLDLAKEFLKNSGSIFISIDDNEQARLKILCDEVFGEENFVANVIWRKRAGGGNDSNHIAVEQEYINIYAKNIEHLKTYGIARTNISQYK-------KDEKGYYLEKP-------LNDTSLQDSPGLHYDIK------------------LPSG------KILKGSEHQWKVSENTFYSRLERDEIIFKNNDKVYYKHYID------------IASNLKPSSIWYDFVLNADATNEI-KLNFENKIFDTPKPEKLLKRICDIGSNQNSLVLDFFVGSGTT 660
>gi|194337015|ref|YP_002018809.1| DNA methylase N-4/N-6 domain protein [Pelodictyon phaeoclathratiforme BU-1] >gi|194309492|gb|ACF44192.1| DNA methylase N-4/N-6 domain protein [Pelodictyon phaeoclathratiforme BU-1] (547 aa)
Score = 219, Expect = 7.1e-16, Identities = 42/90 (46%), Positives = 69/90 (76%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN---WKNFKINQVFEINKK 90
           +M+ RLK  + LL +DG I+ISIDD+E  YLKVL D+IFG  NF++N++W+K+ + QND K++  +H++IL Y+KN   W+ + + +  E++K+
  S:    92 LMAPRLKILRDLLANDGSIWISIDDDESHYLKVLCDEIFGRRNFVNNVIWEKKYSPQNDAKWLSDSHDHILVYAKNKEIWRPYLLPRTEEMDKR 185
>gi|154498712|ref|ZP_02037090.1| hypothetical protein BACCAP_02703 [Bacteroides capillosus ATCC 29799] >gi|150272252|gb|EDM99450.1| hypothetical protein BACCAP_02703 [Bacteroides capillosus ATCC 29799] (1073 aa)
Score = 218, Expect = 8.9e-16, Identities = 89/297 (29%), Positives = 151/297 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN-----WKNFKINQ-----VFEINKKKGQLIQMTIGANEDG-LLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDD--KEIID----KGFVPIRPPIKNGVLLRWSWSFDKAIERIEKII---PKMTKNGYSLFYADEKEYKQVSHKSI---VRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           +M  RL + ++ L D GII ++IDD E  YL   MD++FG  N ISNI         D  +I + H+Y + Y+KN       NF +++      F  +K    L ++ +     G     R  M +  +++   +E I + +    K+    T  + + D    E+ID    +G+  I P    G   RW W +   +  ++  +     +   GY+++  D  + ++ + KS+    R++         +SSKG+N L  +     F  PK +  ++  +    N +  +LD+FAGSGTTGHAV++LN       NRK+IL
  S:   518 LMESRLAEGRRFLSDKGIIEVAIDDYELRYLNSCMDNVFGIGNAISNIAILTNPKGRDQGFIAQAHDYTVIYAKNKALAETNNFILSEDDLAKKFSKSKDGEALRELPLKRTGTGKRREERPYMYFPFFYSKDRDELIVIPEEYYVKIYDSQT--DTFNDSYLAEVIDNFKVQGYEAILPMSSKGEHFRWRWGYKSCVAGVKNGVLFCKPVRGGGYAVYQYDFAD-EEATPKSLWYGERYD---------ASSKGTNLLENIIPNNPFDYPKSLFTVEDNVIIGCNGDDTVLDYFAGSGTTGHAVLDLNRTID-GSNRKYIL 826
>gi|104774131|ref|YP_619111.1| Type III restriction-modification system methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423212|emb|CAI98032.1| Type III restriction-modification system methyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (624 aa)
Score = 215, Expect = 1.8e-15, Identities = 94/317 (29%), Positives = 147/317 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSW---SFDKAIERIEKIIPKMT-KNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT--KQDINKTIAKDIC 317
           M+  RL+ AK LL  DG+IFISIDDNE   LK + D+IFG  +F++  VW +R++ Q D      +HE    Y   +K  K   +  I+K                         +  Y NP ++ + P   + P  +    T +       +++D     +  P  N V   WS+   S ++ I+    + P+ T K      +A E         + +       +  NI  +K    L      FP  KP+ LIK LI + + +++II+DFF+GS TT  A M+LN++    G RK+IL   +E T  K +  K+  K+IC
  S:   186 MIYPRLRLAKDLLAPDGLIFISIDDNEFGNLKKICDEIFGTQSFLATFVWKRRSSSQLDKSKCSTDHE----YVLAYKREKFTALRGIDKD------------------------YKGYSNPDSDPRGP---WTPGDLTVGMTADMRPNQYYDLVDPKTGKVYKPNYNRV---WSYIPESMNQLIKENRIVFPEDTSKRPMRKRFASELNSATNPQSTWL-----SDVGMNIEGTKQMYDLFGKSF-FPYTKPMSLIKSLILQATEKDSIIVDFFSGSATTAQAAMQLNAE--DGGKRKYILVQLQEETGQKSEAYKSGFKNIC 467
>gi|114567068|ref|YP_754222.1| site-specific DNA-methyltransferase (adenine-specific) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114338003|gb|ABI68851.1| site-specific DNA-methyltransferase (adenine-specific) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (611 aa)
Score = 215, Expect = 1.9e-15, Identities = 95/307 (30%), Positives = 142/307 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYD------PKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           MM  RL+ AK LL DDG IFISIDD E   LK + +++FGE+NFI+ I                      A+ KN+ +         N  KG        +  D +LV RK+  +     P T+++  L  YD      P + +  S      + D  II+        P K    +    + DK I+   ++    T NG        K Y     + +V      S  +   + +    +++L  E  F  PKP  LIK ++N  +N+++I+LDFF+GS TT HAVM+LNS  +  GNRKF++    E   +D
  S:   164 MMYPRLRLAKNLLSDDGAIFISIDDTELDNLKKICNEVFGEENFIACI----------------------AWHKNYAS--------ANDSKG------FSSVLDYILVYRKSENFVRNLLPRTDKQNSLYKYDSNDGYGPWRPDNLSVKTYSKEYDFTIINPTTGVEYNPPKGRCWVTNKNTIDKWIKE-GRVFFGQTGNGAPQL----KRYLNEVQQGVVPITY-WSYDECGHNDEARKEIKQLFSEPPFDTPKPTRLIKQILNISTNKDSIVLDFFSGSSTTAHAVMKLNS--QDDGNRKFVMVQLPEPCNED 434
>gi|133757378|ref|YP_001096258.1| hypothetical protein pLEW279b_p16 [Corynebacterium sp. L2-79-05] >gi|110084153|gb|ABG49307.1| hypothetical protein [Corynebacterium sp. L2-79-05] (633 aa)
Score = 215, Expect = 2.0e-15, Identities = 81/289 (28%), Positives = 131/289 (45%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKV-----------ERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAI-ERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTK 290
           M  RL  A++LL  +G+ FIS+DDNEQ  L+++ D+IF E+NF++ IV      + D+ +    HEY+LAY+K++                                N+  +G     +   N   P +D D +             +R     NLY            P+RP   +G    W W     + + ++  +    K+G S + A +K Y+  S  +  +F       D++S  K  N  ++    F  PKPV  +K L+ +   +   IILDFF+GSG+T HA   L ++   K
  S:   177 MLPRLIIARELLASEGVFFISVDDNEQGNLRLICDEIFHENNFVAQIVRKGTGGKQDSTHFAAKHEYVLAYAKDF--------------------------------NQAQLG----LDIVENRIYPHVDDDGRAYRTQLLRKWGDNDRREDRSNLYYPIPAPDGTDLFPVRPDGSDGC---WRWEKTPTMSDALDSGMVHFEKDGSS-WVAYQKIYED-SDSNEKKFGTLIEKADDLSVDKLENLFQEPK-PFKYPKPVGFVKQLLKRAGLDSGDIILDFFSGSGSTAHAAYRLGAETGHK 436
>gi|119946134|ref|YP_943814.1| DNA methylase N-4/N-6 domain-containing protein [Psychromonas ingrahamii 37] >gi|119864738|gb|ABM04215.1| DNA methylase N-4/N-6 domain protein [Psychromonas ingrahamii 37] (658 aa)
Score = 215, Expect = 2.1e-15, Identities = 108/364 (29%), Positives = 177/364 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKG-FVPIRPPIKNGVLLR-----WSWSFDK-AIERIEKIIPKMTKNGYSLFYADEKE-----YKQVSHKSIVR-FNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIA-----KDICFERLYCLIKNIKTSGESF--NNLSVDELKKYQDVSLKTFNI---NYADVSIN 364
           M+  RL+ A+ LL +DG+IF+SI   E A    +++++ GE+NFI+ I    +       +     +YIL Y+K  ++  +NQ F     +  + ++      +GL    K     LY          ++D   K+  +   IE    D   +I  G  +P  P   N V  +     W W++++ A ER    +  +  +  SL   + K+     Y ++  K  +R   +  +I +   S   S  L+ +GI F  PKP  LI++L+   S N+N +ILDFFAGSGTT HA +E   D     N KF+     E T ++ ++  A      DI  ER       I+ +G+    +N + D ++K  DV  +   +   N ADV  N
  S:   180 MIYSRLRLARNLLTEDGVIFMSIGQEEVAASCQILNEVLGENNFITIISRVMKTGGQKGVHFSPCVDYILVYAKKIEH--LNQ-FREEISQNVIDKVYTKTCTEGLRKGEKYRSMGLY--------QAMLD---KRANQRYYIE--CPDGSYVIPPGELMPNSPKDGNKVTPQDGDGVWRWTYERFARERAAGNVEFIASDRTSLIDNEGKQAKWNVYYRIWLKDRMRDGQLPGNITEKFQSRHSSAELKNIGIPFDFPKPTSLIRYLMTLVSLNDNDVILDFFAGSGTTAHASIEYAKD--NNCNNKFVCVQLREETNKNSSEYKAGYEAISDITKER-------IRRAGQKILSDNAAKDGIEKL-DVGFRVLKVDSSNMADVHYN 541
>gi|76810413|ref|YP_335021.1| adenine specific DNA methylase Mod [Burkholderia pseudomallei 1710b] >gi|76579866|gb|ABA49341.1| Adenine specific DNA methylase Mod [Burkholderia pseudomallei 1710b] (567 aa)
Score = 214, Expect = 2.3e-15, Identities = 40/90 (44%), Positives = 65/90 (72%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN---WKNFKINQVFEINKK 90
           +M +RL+   +LL DDG ++I+IDDNE  YLKVL D+IFG  NF++N VW K+    ND K++ +NH+++L Y+KN   W+  ++ +  E++ +
  S:    98 LMRDRLELIVRLLADDGSLWITIDDNEAHYLKVLCDEIFGRGNFVANAVWQKKYTVANDAKWLAENHDHVLVYAKNKELWRPNRLERTAEMDGR 191
Score = 93, Expect = 2.8e-01, Identities = 18/35 (51%), Positives = 25/35 (71%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           F  PKP +L+K +I+  +N   ++LD FAGSGTTG
  S:   309 FSTPKPEKLLKRVIDLATNPGDLVLDSFAGSGTTG 343
>gi|160894867|ref|ZP_02075641.1| hypothetical protein CLOL250_02417 [Clostridium sp. L2-50] >gi|156863298|gb|EDO56729.1| hypothetical protein CLOL250_02417 [Clostridium sp. L2-50] (506 aa)
Score = 213, Expect = 3.3e-15, Identities = 43/82 (52%), Positives = 63/82 (76%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           M+ +RL   K+LL +DG I+ISIDD+EQAYLKVL D+IF   NF+SN++W+K+ + QND K++  +H++IL Y+KN   +K N
  S:    92 MIRKRLLILKELLSEDGTIWISIDDDEQAYLKVLCDEIFMRSNFVSNVIWEKKFSPQNDAKWLSDSHDFILVYAKNKNLWKPN 174
>gi|170694682|ref|ZP_02885833.1| DNA methylase N-4/N-6 domain protein [Burkholderia graminis C4D1M] >gi|170140313|gb|EDT08490.1| DNA methylase N-4/N-6 domain protein [Burkholderia graminis C4D1M] (661 aa)
Score = 213, Expect = 3.5e-15, Identities = 40/79 (50%), Positives = 56/79 (70%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           FP PKP+ LIK L+ + +    I+LDFFAGSGTTG AV+ELN++    G R+FILC++ E T ++  K + +D+C ERL
  S:   433 FPYPKPISLIKGLLAQATTPGDIVLDFFAGSGTTGQAVLELNAE--DGGQRRFILCSSTEATTKEPAKNLCRDVCAERL 509
Score = 129, Expect = 1.8e-05, Identities = 64/237 (27%), Positives = 108/237 (45%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKNWKNFKINQVFEINKK--------KGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEI---IDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRK 238
           + +RL  A+ LL  DG+I +SI+D  ++ L++LMD++F       ++VW  ++  ND ++     HE++L Y+     FK N       K        +G      + AN+   LV R N  + +  NP T    P    DP    R       +  +KEI   +D   V I+  +     LR         + IE++I K       L Y     +   S   +++F+  Q +++ IS+ KG    +K
  S:   134 LYQRLTLARDLLTSDGVILVSINDENRSRLELLMDEVFPRRR-AGSLVWRTKDTGNDLSQRFSHVHEHVLVYAN--AGFKFNGRATSKHKFRNPDKDSRGDWSPQPLTANKT--LVERPNTYYPIQ-NPETGYWYPC---DPDSTWR-------FASEKEIRKRLDNEEVAIQAALGG---LR--------SDTIEQLIEK------KLIY-----FPPCSSSEVMQFDTKQDLLNAISNGKGPTLPKK 344
>gi|124486021|ref|YP_001030637.1| hypothetical protein Mlab_1201 [Methanocorpusculum labreanum Z] >gi|124363562|gb|ABN07370.1| Site-specific DNA-methyltransferase (adenine-specific) [Methanocorpusculum labreanum Z] (636 aa)
Score = 212, Expect = 3.7e-15, Identities = 40/84 (47%), Positives = 63/84 (75%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKNWKNFKINQV 84
           MM  RL+ AK LL++DGI+FISIDDNE   L+ + D+IFG++NF++N++W+K+  + ND  +   NH++IL Y +N + FKI ++
  S:   178 MMYPRLRLAKNLLREDGIMFISIDDNEVGNLREICDEIFGDNNFLANLIWEKKYTRSNDATFFSDNHDHILCYCRNVECFKIGRL 262
Score = 131, Expect = 1.1e-05, Identities = 35/75 (46%), Positives = 45/75 (60%)
  Q:   243 FPNPKPVELIKFLIN-KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEER--TKQDINKTIAKDIC 317
           F NPKP  LI+ L    + N  ++ILDFF+GS TT HAVM+LN++    G RKFI+    E    K +  K   K IC
  S:   388 FTNPKPTRLIRHLATIANLNHESLILDFFSGSSTTAHAVMQLNAE--DGGTRKFIMVQLPEACDEKSEAYKAGYKTIC 463
>gi|62257282|gb|AAX77706.1| unknown protein [synthetic construct] (241 aa)
Score = 210, Expect = 7.7e-15, Identities = 43/89 (48%), Positives = 64/89 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKK 90
           M  RLK A++LLK+DG+IFISIDDNEQA LK++ D+IFGE+NF+ +IVW+ ++   D+ ++  N E+ L Y+KN   F +    + N+K
  S:    27 MYPRLKIARELLKEDGVIFISIDDNEQANLKIICDEIFGEENFVGDIVWNGQSGAEDDGFLRNNKEFFLIYAKNVNLFNVGLKDKENQK 115
>gi|110632903|ref|YP_673111.1| DNA methylase N-4/N-6 [Mesorhizobium sp. BNC1] >gi|110283887|gb|ABG61946.1| DNA methylase N-4/N-6 [Mesorhizobium sp. BNC1] (657 aa)
Score = 209, Expect = 8.9e-15, Identities = 39/92 (42%), Positives = 65/92 (70%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKG 92
           M++ RL+ AK LLK DG IF+S D+ EQ  L+++MD+IFG+ NF++++VW     +ND++ +  +HEYI+ Y+++ +  + NQV    +KKG
  S:   181 MIAPRLRLAKNLLKRDGAIFVSCDEGEQPRLRLIMDEIFGQSNFVADMVW-AAGRKNDSRLVSVSHEYIVCYARDSEYLRENQVIWRQRKKG 271
Score = 110, Expect = 2.9e-03, Identities = 32/76 (42%), Positives = 43/76 (56%)
  Q:   232 GSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
            S  LR L  G  F  PK   +++ +I   +  + IILDFFAGS TT H+VM  N+  K   NRKFI+   +E   +D
  S:   410 ASKRLRALMGGDLFDFPKDELVLQEVIEMMTEGSDIILDFFAGSSTTAHSVMLQNA--KDGANRKFIMVQLDEAAAED 485
>gi|151569481|gb|EDN35135.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] (206 aa)
Score = 209, Expect = 9.2e-15, Identities = 43/89 (48%), Positives = 64/89 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKK 90
           M  RLK A++LLK+DG+IFISIDDNEQA LK++ D+IFGE+NF+ +IVW+ ++   D+ ++  N E+ L Y+KN   F +    + N+K
  S:     1 MYPRLKIARELLKEDGVIFISIDDNEQANLKIICDEIFGEENFVGDIVWNGQSGAEDDGFLRNNKEFFLIYAKNVNLFNVGLKDKENQK 89
>gi|109948189|ref|YP_665417.1| type III restriction-modification system: methyltransferase [Helicobacter acinonychis str. Sheeba] >gi|109715410|emb|CAK00418.1| type III restriction-modification system: methyltransferase [Helicobacter acinonychis str. Sheeba] (642 aa)
Score = 209, Expect = 9.2e-15, Identities = 87/275 (31%), Positives = 142/275 (51%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN------DNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIG---ANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERD---STIENLYKDDKEIIDKGFVPIRPP-IKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           M  RL+ A++ L D+G+IF+  DDNEQAYLKVLMD++FG +NF++N+  +    Q           I KN EYIL YSKN +NF   +   + K+  +   + I       + LL    N   + Y N   ++ + L  Y+  K  RD       N+Y+D+   I+  F   +   + +G ++ ++       +    II ++ K   ++   D+ + K +  + I          D ++ +K +N + K G      KP  LIK ++   + EN ++LDFFAGSGTT
  S:   215 MKNRLEAAREFLSDNGVIFVQCDDNEQAYLKVLMDEVFGRENFVANLHVELSTTQGMKVASAKKGNIVKNAEYILIYSKNMENFSFIRSLYVAKEWDEHYSIYIDPKTKKRETLL----NFLKSKYENITKDKIVAL--YNDDKDFRDFVHKNANNIYRDNNAEINFNFTQEQESNLNSGEIVEYNQYL--IFKTSNNIIRQLLKLSDAIGETDDFDAK-IGLRKIRGDWWGGFYKDMMNINKEANLVWKAG-----KKPKRLIKDILEISTQENDLVLDFFAGSGTT 488
>gi|57238177|ref|YP_178742.1| type III restriction/modification enzyme, methylase subunit [Campylobacter jejuni RM1221] >gi|57166981|gb|AAW35760.1| type III restriction/modification enzyme, methylase subunit [Campylobacter jejuni RM1221] (675 aa)
Score = 209, Expect = 1.0e-14, Identities = 94/275 (34%), Positives = 150/275 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-----AQNDNKYIEKNHEYILAYSKNWKNF-KINQVFEINKKKGQLI---QMTIGANEDGLLVN---RKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEI----IDKGFVPIRP--PIKNGVLLRW-SWSFDKAIERIEKIIPKMTKNG---YSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS------KGSNTLRKLGIEFPNP-KPVELIKFLINKHSNENAIILDFFAGSGTT 276
           M  RL+ AK+ L+DDG+IF+  DDNEQAYLKVLMD+IFG DNF+++I    +N        ++K  +KN EYIL Y K+++   +   V++  +    +    +  I       L+N   +K +  TL  +    +    ++YD K + +   I++   ++KEI    ++K F    P   I+  VL +    +    +  IE   PK  +N    Y  FY  EK       K +V     Q     ++ +        +N  ++   +F N  KP  L++ +I   +NEN I++DFFAGSGTT
  S:   219 MKNRLEIAKEFLRDDGVIFVQCDDNEQAYLKVLMDEIFGRDNFVNSIAVKLKNIAGASGGGEDKRFKKNIEYILIYGKSYEKLEQFKSVYDSRELYSHISFCKENNISWKYTSALLNGGEKKLIATTLDGDGNEIKIFERINYDIKSIGQ--MIKDFKMNEKEIFYHYVNKIFRTTMPQSSIRVRVLEKLKELNLSPYLISIE-YTPKSGRNKGVVYEQFYNGEKLNLFAWLKDVVEIKDKQIFKKELAGTLWDFAFAMTNLTKEGDTQFSNAKKPEALLQRIIEISTNENDIVMDFFAGSGTT 519
>gi|91202366|emb|CAJ75426.1| partial CDS, similar to adenine specific DNA methylase [Candidatus Kuenenia stuttgartiensis] (488 aa)
Score = 209, Expect = 1.1e-14, Identities = 77/277 (27%), Positives = 129/277 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPK----MTKNGYSLFYADEK---EYKQ-VSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           +M  R++   +LL+DDG ++I+IDD E  YLK+L D++FG  NF++NIVW  ++   +N   I + H +IL +                 KKG L +  + A  +  L N        Y NP  + + P +     +VE                D+ +  IR P+   V      S+ +  E+++ +         K G + F  ++K   E K+ V +++   ++   S  +  +  KG    RK    F  PKP +LI+ +    +N +  +LD F GSGTT 
  S:    93 LMKPRIEIIHKLLRDDGTLWITIDDTEAHYLKILCDEVFGRGNFVANIVWQSKDTPGNNAIAIAQTHNHILVF-----------------KKGALFRPNLLARNEKQLAN--------YVNPDNDPRGPWLAAPLTRVEHR--------------DRDYYAIRNPVGREVFPPKGSSWRRPPEKMKWLEDDGRIWWGKKGDAEFPMEKKFLSEAKEGVVNQTWWAYDFGGSTRNASAEMKGLFEGRK---SFDTPKPEKLIQRIFEIATNPSDWVLDSFLGSGTTA 336
>gi|115289030|gb|ABI85522.1| M.Hin1056ModP-2 [Haemophilus influenzae] >gi|115289087|gb|ABI85561.1| M-Hin86orf1056P-2 [Haemophilus influenzae] (717 aa)
Score = 209, Expect = 1.1e-14, Identities = 85/283 (30%), Positives = 140/283 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN------DNKYIEKNHEYILAYSKN-WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDST---IENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKG----------------SNTLRKLGIEFPNPKPVE-LIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ AK LL DDG+IF+  DDNEQAYLK+LMD++FG +NF++ I       Q        +  I KN EYI+ +SKN  KN  IN ++++  +  +   + +           KN G       A  +   L DY   K  +++T   ++  +K   E  +     +   +++  +      FD ++E       ++ +NG       +K  K      ++R   +    DN ++ +G                 N  ++  ++F N K  E LI  +I   +NEN I+LD+  GSGTT     ++N
  S:   272 MKNRLEIAKTLLADDGVIFVQCDDNEQAYLKILMDEVFGRENFVTTIHCQMSTTQGMKVKAAQDGNIVKNAEYIIVFSKNGHKNIAINPLYDLRSEYDEHYSLYL-----------KNDG-------AIGQLKELYDYRFPKDLKNTTALSLKEAFKKSNEFAEIVKTHLSKIVRSDKVT----GFDLSVELENSKWKEVERNGRKYILTLDKNGKVC---QLLRLQDSWGKTDNYNNDEGLRKIRGNWWEGFYLDMGNVGKEGSVDFKNGKKGERLISQIIKTATNENDIVLDYHLGSGTTAAVAHKMN 556
>gi|72384717|gb|AAZ67650.1| methyltransferase putative [Haemophilus parasuis] (370 aa)
Score = 208, Expect = 1.4e-14, Identities = 93/302 (30%), Positives = 154/302 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYS-KNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNG-YSLFYADEKEYKQV-SHKSIVRF--NINQSIIDNISSSKGSNTLRKLGIE---FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           ++  RL  AK LL   G+IF SIDDNEQA LK+L ++IFG++NFIS + V +    + ++K+I   ++Y L Y+  N K++ I  + +  K   Q        N    ++  +N    L  N  +++   +  +D  K         L + D+ ++ +G+V     I N   +  +++  K ++  E    +   N  Y   ++     K + S+K  V    NI  +I  +  ++     L+ L  +   F  PK +  IK L+    ++N IILD+FAGSGTT HAV+ LN +   KGNR++IL    E
  S:    60 LIHNRLSLAKPLLNQAGVIFQSIDDNEQANLKLLSNEIFGKENFISLLTVENNPKGRKNSKFISVCNDYCLIYAFDNTKSYFIENIPKDIKDLTQDEYGNYVHNSGKRVLVGENKFNNLVQNFNSDKHYTIYYHDALKHLVTKKETQLNEIDENLVSQGYVRYISYIGNS-FVENTYTDRKFLKLFENKALEFKDNKIYEKNFSTTIRLKSILSNKKYVGVTQNIKSTIELDFKTTSAGTLLKNLFNKDDVFNAPKNITFIKTLVTLIDDKNQIILDYFAGSGTTAHAVINLNRE--DKGNRQYILVEQGE 367
>gi|152978352|ref|YP_001343981.1| DNA methylase N-4/N-6 domain-containing protein [Actinobacillus succinogenes 130Z] >gi|150840075|gb|ABR74046.1| DNA methylase N-4/N-6 domain protein [Actinobacillus succinogenes 130Z] (611 aa)
Score = 207, Expect = 1.6e-14, Identities = 99/319 (31%), Positives = 162/319 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN------WKNFKINQVFEINKKKGQLI-----QMTIGANEDGLLVN--RKNMGWTLYFNPATNE-----KIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIE-RIEKIIPKMTKNGYSL-FYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFP---NPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDICFE 319
           MM  RL  AK LL DDG+IFISIDDNEQA LK+L D++FGE+NF++ +  +     + ++KYI  ++++ L Y+KN       +N   N+      + G  +     ++ +G NE    V     +  +++YFN   ++     +I ++D D      D+ I   Y        + FV      K+ +L  +    D+A+E   +KI  K   +   +    + + YK +S   ++ +      +D  ++S G+        + P    PK +  +K LI    ++  I LDFFAGS +  H+V++LN      G RKFI     EE      N  +A   C E
  S:   121 MMLPRLHLAKNLLTDDGVIFISIDDNEQAQLKLLCDEVFGEENFVAILSTENNPKGRKNSKYISISNDFCLIYAKNKEQGCFIENIPKNEKDMKQDENGNYVHSSGKRVLVGENEFNNFVTDFSSDKHYSIYFNKDEDDFIIRTEINILDKD------DNLINQGYIRYVSFFGEHFVE-NTYTKSRILELYE---DEALEFSADKIYEKNFSDTVRMKSMLNNRSYKAISDGKLIDYK-----LDLKTTSAGTFLKELFNTKIPVFSAPKNINFLKHLITLFEDKYFIALDFFAGSSSFPHSVLDLNY--SDGGQRKFIAVQYPEEIDITTKNGKVANKFCKE 447
>gi|18450312|ref|NP_569183.1| hypothetical protein pli0029 [Listeria innocua Clip11262] >gi|16415813|emb|CAC42027.1| pli0029 [Listeria innocua] (355 aa)
Score = 207, Expect = 1.6e-14, Identities = 46/95 (48%), Positives = 64/95 (67%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLI 95
           M+  RLK A+ LL D GIIF+SID+NE A L++L+ +IFGE+N    IVWDKRN + D+K +   HEYI+A +KN   F   + F+  KK  ++I
  S:   158 MIYPRLKLARNLLSDSGIIFVSIDENEIANLELLLTEIFGENNLAGTIVWDKRNPKGDSKGVSMQHEYIVAAAKNINIFSEFKEFKRPKKNAEII 252
>gi|46133258|ref|ZP_00203112.1| COG2189: Adenine specific DNA methylase Mod [Haemophilus influenzae R2866] >gi|145638132|ref|ZP_01793742.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae PittII] >gi|145272461|gb|EDK12368.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae PittII] (396 aa)
Score = 206, Expect = 1.9e-14, Identities = 87/283 (30%), Positives = 128/283 (45%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKN----------WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLF--YADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ AK LL DD +IF+  DD EQAYLK+LMDDIF  +NFI+ IVW K ++A+  +  + +  EYIL Y K+            N K  +++    K G++ +++           +K  G   YF                        ENL              I PP        W W+ +K  E ++  +   +KNG      + DEKE   +S       ++ +     I SS  S        +F   KP  LIK +I   +NE+ I+LD+  GSGTT     ++N
  S:     1 MKNRLEIAKTLLADDSVIFVQCDDKEQAYLKILMDDIFKRENFINTIVWRKVKSAKIQSGNLPRVKEYILVYKKSKLSLHNIFLPRNNEKDKKLYRFQDKNGRVYRLSD--------FTQKGQGEARYFG-----------------------ENL--------------IEPPKGK----HWIWTQEKIDEGMKNDLIVFSKNGMPSVKRFLDEKEGIPLS-------DLWEDDFVQIVSSTSSERQ-----DFDGQKPEALIKRIIELTTNESDIVLDYHLGSGTTAAVAHKMN 235
>gi|145632421|ref|ZP_01788156.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae 3655] >gi|115289034|gb|ABI85525.1| M.Hin1056ModP-7B [Haemophilus influenzae] >gi|144987328|gb|EDJ93858.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae 3655] (687 aa)
Score = 206, Expect = 1.9e-14, Identities = 93/283 (32%), Positives = 138/283 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-----AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTL---YFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSII----DNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ AK LL DDG+IF+  D NE  YL+VL+D+IF EDNF++NI     +      Q+  K I KN + IL Y KN  + KIN  + I K+K       I  +EDG L  +K +   +      P  NEKI    +  +K  R+  IEN+       I +    I   +K               E +++    + KN   + YA   +     +K+I+  N    ++    D  S     NT  + G+ FP   KP  L++ +I+  + E  IILD+  GSGTT     ++N
  S:   256 MKNRLEIAKTLLADDGVIFVHCDYNEDGYLRVLLDEIFTEDNFVANIAIRSNSISGNKTQHKEKTILKNKDTILVYKKN--SLKINPQYTI-KQKWDTHYNAILISEDGELKPKKLLDHLIENKILKP--NEKITENSWGNEKF-RNFCIENM-----NFIYQIVNSISDSLKQ--------------ESLKQKDTVIIKNDGDITYALNGKRLSTLNKTILNMNGKMELVQLLGDLWSDIDFQNTQNEGGVSFPTGKKPEALLRRIIDMTTKEGDIILDYHLGSGTTAAVAHKMN 526
>gi|57242065|ref|ZP_00370005.1| type III restriction/modification enzyme, methylase subunit [Campylobacter upsaliensis RM3195] >gi|57017257|gb|EAL54038.1| type III restriction/modification enzyme, methylase subunit [Campylobacter upsaliensis RM3195] (455 aa)
Score = 206, Expect = 2.1e-14, Identities = 59/154 (38%), Positives = 83/154 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN------DNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVE--RDSTIENLYKDDKEIID 155
           M  RLK A+ LLKDDG+IFISIDDNEQA LK+L D+IFGEDNF++N+  +    Q           I KN EYIL Y+K+ +NFK  +     K+                        +++Y +P +  +  L+++   K        IE LY +DK+  D
  S:   187 MLPRLKLARDLLKDDGVIFISIDDNEQANLKILCDEIFGEDNFMANLCVELSTTQGMKVASAQKGQIVKNAEYILCYAKDNQNFKFERPLYTAKEWDD--------------------HYSVYIDPESKNRTTLLEFLKDKYPDITKQKIEELYNNDKDFRD 328
>gi|126724447|ref|ZP_01740290.1| Site-specific DNA-methyltransferase (adenine-specific) [Rhodobacterales bacterium HTCC2150] >gi|126705611|gb|EBA04701.1| Site-specific DNA-methyltransferase (adenine-specific) [Rhodobacterales bacterium HTCC2150] (662 aa)
Score = 204, Expect = 3.3e-14, Identities = 93/296 (31%), Positives = 140/296 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN------------QVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKN---------------GYSLFYADEKEYKQVSHKSIVRFNINQSII--DNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN-SDPKTKGNRKFI 296
           MM  RL  AK LL  DG+I ISID+ E   L+ + + IFG +NF++   V      +ND   +   HEY+L + KN   F+              ++ + N +K +L  +      D    +R  M + L++    NEK  ++ +     ER S  +              V I P    GV  RW W  DK  E ++ +  K  K                G +    +E   +     +    ++ +SI      SS  GS  L+ L  G     PK VEL+K  I   + ++ I+LDFF GSGT G A+ E+   +P+    RKFI
  S:   173 MMYPRLFAAKTLLSQDGVIMISIDEKECCNLRQICEQIFGSENFVAQFSVVTNYKGRNDKTNVAMAHEYVLVFRKN--EFETAGLPLTEAQRAEYKLTDENGRKYKLRDLRKRGGPDN-RSDRPRMWFPLFY----NEKTKVLSF-----ERGSEAD--------------VEITPLKSGGVDGRWRWGKDKTKENLDILEAKYVKKSDKWNVSYRIYLDAAGPTPIEGEEDLDEDEFDDTSSTGSLPKSIWMGGEFSSDAGSRALKALIPGTSLEYPKSVELLKRCIYYGTKKDDIVLDFFFGSGTLGQALFEVERENPR---GRKFI 472
>gi|28198738|ref|NP_779052.1| methyltransferase, type III restriction-modification system [Xylella fastidiosa Temecula1] >gi|182681431|ref|YP_001829591.1| site-specific DNA-methyltransferase (adenine-specific) [Xylella fastidiosa M23] >gi|28056829|gb|AAO28701.1| methyltransferase, type III restriction-modification system [Xylella fastidiosa Temecula1] >gi|182631541|gb|ACB92317.1| Site-specific DNA-methyltransferase (adenine-specific) [Xylella fastidiosa M23] (542 aa)
Score = 204, Expect = 3.4e-14, Identities = 37/74 (50%), Positives = 57/74 (77%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKN---WKN 78
           RL+ AK+LL DDG+IF+SIDDNE   L +LMD +FG D+FI+N++W K  + +N  ++   +HEYIL +++N   W++
  S:   126 RLQLAKELLADDGVIFVSIDDNELFRLGMLMDRVFGHDHFIANVIWQKIFSPKNTAQHFSDDHEYILVFARNRTLWRS 203
Score = 187, Expect = 3.1e-12, Identities = 37/79 (46%), Positives = 53/79 (67%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           F  PKPV+L++ ++   SN    +LDFFAGSGT G AV +LN++    G+RKFIL +N E T+   +K + +D+C ERL
  S:   335 FSTPKPVQLMERILRIASNPGDTVLDFFAGSGTFGQAVAKLNAE--DGGHRKFILISNTEATQAQPDKNLCRDVCAERL 411
>gi|120536948|ref|YP_957006.1| DNA methylase N-4/N-6 domain-containing protein [Marinobacter aquaeolei VT8] >gi|120326782|gb|ABM21091.1| DNA methylase N-4/N-6 domain protein [Marinobacter aquaeolei VT8] (657 aa)
Score = 204, Expect = 3.4e-14, Identities = 41/100 (41%), Positives = 68/100 (68%)
  Q:   222 SIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           ++I   ++ +G+N  +++    +FP PKP  L++ L+ +    + I LDFFAGSGTTG AV+ELN++    GNR+FILC+N E + +  ++ I +D+C ER+
  S:   408 TVITVGATGEGTNNYKQILNNKDFPYPKPPSLMRELLRQAMRPDDIALDFFAGSGTTGQAVLELNAE--DDGNRRFILCSNAEASNKAPDRNICRDVCAERV 507
Score = 116, Expect = 5.6e-04, Identities = 27/79 (34%), Positives = 46/79 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK--YIEKNHEYILAYSKNWKNFK 80
           M +RL  A+ LL  DG+I + I+D  ++ L+++MD++      + + VW  R+  ND K   +  NHE++L Y     +FK
  S:   133 MYQRLLIARDLLTPDGVIMVCINDENRSKLELMMDEVMPGLR-VGSFVWRVRSGGNDTKGALLSMNHEHVLVYGNPAFSFK 212
>gi|53712435|ref|YP_098427.1| type III DNA modification enzyme [Bacteroides fragilis YCH46] >gi|52215300|dbj|BAD47893.1| type III DNA modification enzyme [Bacteroides fragilis YCH46] (668 aa)
Score = 202, Expect = 5.3e-14, Identities = 99/314 (31%), Positives = 152/314 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWS-FDKAIERIEKI-IP--KMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           MM  RL  A+ LL D+GIIFISIDD+E A L  + +++F   NFI    W K    +N +K  ++  EYI+ Y K   + K    F+  KK+          + +GLL N+ N    L F PA      + D   K     +   ++   +   +  G      P+K     +WS +  DK I++   I IP  K++ +   L Y  E     +++K  V  N             G++ L+    +  N PKPV LI++L       N++ I++DFF+GSGTT  AVM +N  P+ K   K+IL     +  +D+ +TI K
  S:   189 MMYARLMLARTLLNDNGIIFISIDDHELANLIKIGNEVFNASNFIDVFNWAKTETPENLSKKSKQIIEYIVCYQKKKNDMK----FQGLKKE--------SVSSNGLL-NQPNSVGILTF-PANKVVTSIPDGVIKAGMYGTDAYDVELLEDTTVRGGL--FTAPVKLKAKFKWSQANLDKEIQKGTTIKIPTLKLSPSYEKLEYDPEVPPNLINYKVGVETN----------EQAGNHQLQFFDKKVFNFPKPVSLIQYLCEFIDTKNKDCIVMDFFSGSGTTAEAVMRMNMKPR-KNKVKYILV----QLPEDVTETIKK 479
>gi|148262672|ref|YP_001229378.1| DNA methylase N-4/N-6 domain-containing protein [Geobacter uraniireducens Rf4] >gi|146396172|gb|ABQ24805.1| DNA methylase N-4/N-6 domain protein [Geobacter uraniireducens Rf4] (1073 aa)
Score = 202, Expect = 6.7e-14, Identities = 89/302 (29%), Positives = 143/302 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGAN-------EDGLLVNRKNMGWTLYF---NPATNEK-IPLMD----YDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL-----GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           MM +R+      L ++G+I   ID+NE     ++++++FG DN   ++VW K +++ND  Y+   HEY+L   K  K F      E N++K  L ++    N        D   ++ + + W   F   NP T+ K    MD    Y P  +   +  +  Y     +  K     + P          W F       E+ + K   +G   F  DE      ++K+ ++    QS+  +I    G    + L     G  F NPK V++   L+     +N  +LDFFAG+GT GHAV+ LN + KT+  RK+IL    E
  S:   547 MMFDRISACHGFLTNEGLICHYIDENEHTIASLVLNEVFGTDNRCGDVVW-KNSSKNDQDYVSMQHEYLLLAVKG-KAFNKG---EWNERKEGLEEIYAAFNGFRKKHETDWKAIHSEALKWYRQFPESNPITDSKHYSWMDERGVYFPADISGPNYGQYRYDVLHPVTGK---TCKEPAS-------GWRFP------EETMKKRIVDGLVHFGDDEATIP--NNKTYLKDTETQSLT-SIKYRDGRVASKLLAAMFGGKTFSNPKDVDISMRLLRAFQTQNEWVLDFFAGTGTAGHAVLALNREDKTR--RKYILVEQGE 842
>gi|67153570|ref|ZP_00415315.1| DNA methylase N-4/N-6 [Azotobacter vinelandii AvOP] >gi|67087703|gb|EAM07169.1| DNA methylase N-4/N-6 [Azotobacter vinelandii AvOP] (560 aa)
Score = 202, Expect = 6.7e-14, Identities = 50/134 (37%), Positives = 78/134 (58%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKN--WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDP 134
           +M +RL+  K+LL DDG ++I+IDDNE  YLKVL D++FG +NF+SN++W+K ++ +N  +    +H++IL +SKN  W          I KK    +Q T  AN             ++Y NP  + + P +  DP
  S:    98 LMRDRLEIIKRLLSDDGSLWITIDDNECHYLKVLCDEVFGRNNFVSNLIWEKADSPRNSARQFSTDHDHILIFSKNPDW----------IPKK----LQRTEQAN-------------SIYSNPDNDPRGPWLPGDP 207
>gi|60680597|ref|YP_210741.1| putative modification enzyme of type III restriction-modification system [Bacteroides fragilis NCTC 9343] >gi|60492031|emb|CAH06793.1| putative modification enzyme of type III restriction-modification system [Bacteroides fragilis NCTC 9343] (664 aa)
Score = 202, Expect = 6.8e-14, Identities = 99/314 (31%), Positives = 152/314 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWS-FDKAIERIEKI-IP--KMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           MM  RL  A+ LL D+GIIFISIDD+E A L  + +++F   NFI    W K    +N +K  ++  EYI+ Y K   + K    F+  KK+          + +GLL N+ N    L F PA      + D   K     +   ++   +   +  G      P+K     +WS +  DK I++   I IP  K++ +   L Y  E     +++K  V  N             G++ L+    +  N PKPV LI++L       N++ I++DFF+GSGTT  AVM +N  P+ K   K+IL     +  +D+ +TI K
  S:   185 MMYARLMLARTLLNDNGIIFISIDDHELANLIKIGNEVFNASNFIDVFNWAKTETPENLSKKSKQIIEYIVCYQKKKNDMK----FQGLKKE--------SVSSNGLL-NQPNSVGILTF-PANKVVTSIPDGVIKAGMYGTDAYDVELLEDTTVRGGL--FTAPVKLKAKFKWSQANLDKEIQKGTTIKIPTLKLSPSYEKLEYDPEVPPNLINYKVGVETN----------EQAGNHQLQFFDKKVFNFPKPVSLIQYLCEFIDTKNKDCIVMDFFSGSGTTAEAVMRMNMKPR-KNKVKYILV----QLPEDVTETIKK 475
>gi|116513198|ref|YP_812105.1| adenine specific DNA methylase Mod [Lactococcus lactis subsp. cremoris SK11] >gi|116108852|gb|ABJ73992.1| Adenine specific DNA methylase Mod [Lactococcus lactis subsp. cremoris SK11] (692 aa)
Score = 201, Expect = 7.7e-14, Identities = 115/387 (29%), Positives = 201/387 (51%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-----AQNDNKYIEKNHEYILAYSKNWK---NF-------KINQVFE---------------INKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKI--IPKMTKNG---YSLFYADE--------KEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN----------SDPKTKGNR--KFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKK-YQDVSLKTFNINYADVSINSNIDKL--LEEIKKSMRLIHRDFDIN 388
           M  RL+ A++ L++DG IFI  DD+EQAYLKVLMD IFG   +++ I    +N        ++K ++KN EYI  YSKN +   NF       KI+++ E               +N+   + +  TI  + D + + R+N       NP       LM       E + + E  Y    +   +  +P +  I+  V+ +W    +     +  I  IPK  KN    Y  FY  +        ++  +    S+ + +++ +  + +  +K  N  ++  + FPN  KP  L+  +I   S+E  I+LDFF GSG+T  A M++N          +  + + +R    I   ++    QD+N        +  L+   KN+    +      +DELK  Y+ +   T  +  AD+S  ++++K+  +E   ++ RL+ +  D N
  S:   232 MKNRLEIAREFLQEDGYIFIQTDDSEQAYLKVLMDSIFGSRQYVNTISVLFKNIAGASGGGEDKRLKKNVEYITVYSKNREHSSNFHAVYEYKKISELVEEMRQEGVSWKYTSVLVNEGTEEYVGSTIDGSGDEIKIYRQN-------NPIIKSISALMK------EENLSEEQAYDKYAKFAFQTAMP-QSSIRPRVMDKWQ-ELELGANSLMSIRYIPKSGKNKGVEYRQFYKGDNFRLFAWLRDVSEEIDGSLYKRDVSGTFWNFVGETKNVN--KEGQVVFPNGKKPERLLGKIIEMASDEGDIVLDFFGGSGSTAAAAMKMNRTFISLEQIENQVQLELDRLNNVISGNDKNGLTQDVNWQGGGSFVYAELF--PKNMGYLQDIIYAKDLDELKTVYERMISGTDTVEPADISFRADLNKIDWMEGFVENKRLLIKLLDKN 658
>gi|194336230|ref|YP_002018024.1| Site-specific DNA-methyltransferase (adenine-specific) [Pelodictyon phaeoclathratiforme BU-1] >gi|194308707|gb|ACF43407.1| Site-specific DNA-methyltransferase (adenine-specific) [Pelodictyon phaeoclathratiforme BU-1] (643 aa)
Score = 201, Expect = 7.9e-14, Identities = 38/83 (45%), Positives = 57/83 (68%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQ 83
           MM  RLK A+ LL++DG+IFISIDD E   L+ L  ++FG++NF+  I+W KR+   ++K I  NH+YIL ++KN  + K+  
  S:   182 MMYPRLKLARNLLREDGVIFISIDDGELDNLRKLCAEVFGDENFVVQIIWRKRSTPPNDKIIGANHDYILCFAKNAISVKLQH 264
Score = 140, Expect = 8.8e-07, Identities = 41/93 (44%), Positives = 53/93 (56%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC---------TNEERTKQDINKTIAK-----DICFERLYCLIKNIKTSGESF 335
           F +PKPV LI+ L+      N ++LDFFAGSGTTGHA+M  N      GNR++IL           NE+R   D    I K     ++  ERL    + IK     F
  S:   393 FESPKPVGLIQELVALGCEPNGVVLDFFAGSGTTGHALMAQNV--IDGGNRRYILVQLPEQLYLENNEQRVSGDYCDQIGKPRTIVELTKERLRRAARKIKDENPLF 497
>gi|78221896|ref|YP_383643.1| DNA methylase N-4/N-6 [Geobacter metallireducens GS-15] >gi|78193151|gb|ABB30918.1| DNA methylase N-4/N-6 [Geobacter metallireducens GS-15] (520 aa)
Score = 201, Expect = 8.1e-14, Identities = 76/277 (27%), Positives = 120/277 (43%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLL--VNRKNMGWTLYFNP-ATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPP-IKNGVLLRWSWSFDKAIERIEKI---------IPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           MM  RL   ++LLK+DG ++IS DDNE  Y+KV++D+IFG  NFI ++ W KR+   +++ I   HE+IL + K             N KK      T+      L+    + N  + ++  P   +E+ P    D        T  N        +   F PI+ P     V  R    +  + E +E++         +    K      + DE +    +        +NQ     I    G          F  PKP  L++ +I+  +N   ++LD F GSGTT 
  S:    89 MMYPRLVLLRELLKEDGSLWISCDDNEAHYIKVIVDEIFGRLNFIIDVSWQKRDGPPNDRKIGAIHEHILVWGKGKSG---------NSKK------TLAEEAFNLMPRTEKANSQYDVFKEPDGPDERGPFRKID--------TTAN--GKGGRFVTSLFYPIKNPYTAEEVWPRQGTCWRHSKEEMERLQAEKRLYWGVNGTAKTPMRKLFLDEAKQGMTTPSIWSDTGLNQHASSEIEKLFGEKA------AFETPKPEALLQRIIHIATNPGDLVLDSFLGSGTTA 347
>gi|116494139|ref|YP_805873.1| adenine specific DNA methylase Mod [Lactobacillus casei ATCC 334] >gi|116104289|gb|ABJ69431.1| Adenine specific DNA methylase Mod [Lactobacillus casei ATCC 334] (462 aa)
Score = 201, Expect = 8.4e-14, Identities = 85/283 (30%), Positives = 137/283 (48%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQL--------IQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDS--TIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ +K+LL DDG+IF+SID NE A LKVLMD++F E++++  ++        D     + H+YI  Y+KN    K N   ++++ K +L        +     +N      NR N+ +  Y +   +EK     Y    V++D+  TIE ++    +  D  FV             W W  +K  E  E  +    K+  S   A +   K+   ++I++           S+ +G+  L+KL  G  F  PKP  L+K +I   SN    +LDF  GS TT    M+++
  S:    46 MKNRLEVSKELLTDDGVIFVSIDRNEFAELKVLMDEVF-ENSYLGTMINVSTPNGRDYGSFAQTHDYIHVYAKNIDMVKTN-TLDVSEDKFKLQDEISKFYLHPLFNSNSAFSKDNRPNLYYPFYISEREDEK----GYRSVSVKKDTLHTIE-VFPPKSKTDDTQFV-------------WRWGRNKGQELGETELVGQQKSDGSFRIAQKMRPKKQIPRTILQ-------DAKYSNRRGTEELQKLFDGKVFSFPKPENLLKTIIEIGSNAGDTVLDFHMGSATTQAVAMKMH 313
>gi|77411475|ref|ZP_00787820.1| adenine specific DNA methyltransferase (mod) [Streptococcus agalactiae CJB111] >gi|77162478|gb|EAO73444.1| adenine specific DNA methyltransferase (mod) [Streptococcus agalactiae CJB111] (481 aa)
Score = 200, Expect = 1.1e-13, Identities = 85/280 (30%), Positives = 127/280 (45%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSL--FYADEKE---------YKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           RL  A +LL + G I+++IDD+E  YLKVL D++FG +NFI NI+W+K+ + QND  +    H++IL Y KN           I+K K  L+  T   NE              Y NP  + + P           D T+    K+    I+     I  P K         +  K I +      +   N   L  F  D K+         +++VSH    R  I++   D                +F  PKP +L++ +I+  SNE  ++LDFF GS TT    M++N
  S:    83 RLSIANELLSEVGSIWLNIDDDESHYLKVLCDELFGRENFIGNIIWEKKFSPQNDATFFSDMHDHILVYCKN-----------IDKFKINLLARTEKMNER-------------YKNPDNDPRGPWS-------SSDLTVRTYSKEYDYPIETPSGKIINPPKGRCWRTSKENLSKLISQNRIWFGESGDNVPRLKRFLTDVKQGLTPGTIWKHQEVSHNQEARKEISRLFEDT-------------EYDFSTPKPEKLLQRIIHIGSNEGDLVLDFFMGSATTQAVAMKMN 330
>gi|163868805|ref|YP_001610029.1| type III restriction system methylase [Bartonella tribocorum CIP 105476] >gi|161018476|emb|CAK02034.1| type III restriction system methylase [Bartonella tribocorum CIP 105476] (610 aa)
Score = 200, Expect = 1.1e-13, Identities = 42/84 (50%), Positives = 57/84 (67%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           MM  RLK A+ LL+DDG+IFISIDDNE   L+ L D++FGE+NFI+   W K + Q +   I +  EYI+ YSK  K  K+N++
  S:   170 MMYPRLKLARNLLRDDGVIFISIDDNEVHNLRKLCDEVFGEENFIAQFTWRKTDNQANIGNIARVKEYIILYSKESKTLKLNKM 253
Score = 117, Expect = 4.5e-04, Identities = 25/44 (56%), Positives = 34/44 (77%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           F  PKP+ LIK  +   +N++ +ILDFFAGSGTT HAVM+LN++
  S:   368 FDFPKPLSLIKHFLTIATNDD-LILDFFAGSGTTAHAVMQLNAE 410
>gi|15828867|ref|NP_326227.1| type III restriction-modification system: methylase [Mycoplasma pulmonis UAB CTIP] >gi|14089810|emb|CAC13569.1| TYPE III RESTRICTION-MODIFICATION SYSTEM: METHYLASE [Mycoplasma pulmonis] (573 aa)
Score = 199, Expect = 1.5e-13, Identities = 86/275 (31%), Positives = 138/275 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN--AQNDNKYIEKNHEYILAYSKNWKN-------------FKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQV----SHKSIVRFNINQ-SIIDNISSSKGSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           M  RL+ A++LLK+DG+IF+  D NE AYLK++MD+IF  +N +S I+W  +    ++D+K+  + HEYIL ++KN+KN             +K    +   + K QLI++     + G L   KN+ + +  N  T        Y     +R    EN       I D G               W WS +K    I        KN + +F  D    KQ        +I+   I    II+  S+++ +  +++L   + F   KP  +I  ++N  + +N ++LDF  GSGTT
  S:   227 MKNRLELARKLLKEDGVIFVQCDKNEMAYLKIIMDEIFYRENELSTIIWLNKEGGGKSDSKFFRQKHEYILCFAKNYKNASIYPQEVQDKDRYKEEDKYLSTRGKFQLIKL-----DSGSLGYSKNLDYPIKHNGKT--------YYAGGNKR--KWENRQNGGSNIKDWG---------------WRWSKEKLDWGI--------KNDFIVFKNDNVYTKQYLNCDKDGNIIERKIQPLPIIEKYSNTQSNKHMKELFSKVPFNYSKPEGIIFEILNWTTKKNDLVLDFHLGSGTT 485
>gi|145629607|ref|ZP_01785404.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae 22.1-21] >gi|144978118|gb|EDJ87891.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae 22.1-21] (351 aa)
Score = 196, Expect = 2.8e-13, Identities = 42/73 (57%), Positives = 54/73 (73%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEK---NHEYILAYSK 74
           M  RL  A++LL+DDG+IFISIDDNEQA LK+L D++FGE+NF++  VW  R    DN+ I     +HEYI  YSK
  S:   180 MYPRLYIARELLRDDGVIFISIDDNEQAQLKILCDEVFGEENFVAEFVWKSRQ-NKDNRNITGASIDHEYIFCYSK 254
>gi|42630128|ref|ZP_00155672.1| COG2189: Adenine specific DNA methylase Mod [Haemophilus influenzae R2846] (414 aa)
Score = 196, Expect = 3.1e-13, Identities = 81/283 (28%), Positives = 133/283 (46%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDS-----TIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKE------YKQVSHKSIVRFNINQSII--DNISSSK-GSNTLRKLGI--EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ AKQL+ +DG+IF+SID++ QAYL++LMD+IFG +N+I++++   +++ ND N      HE  L ++   +N  +                 +G  +D           + Y NP  +        DP     +       +EN Y    +   +G                 W F K        I K  +NG  +F  + KE      YK+  +K   +     S+I  DN   ++ G+  L +L +  +  NPKP   IK +I   ++E+ I+LD+  GSGTT     ++N
  S:     1 MKNRLEIAKQLMTEDGLIFVSIDEDGQAYLRILMDEIFGRENYITDLIRKTKSSTNDANTGANVQHENCLIFALQKENTDV-----------------LGGEKD----------LSSYSNPDNDPNGDWKSSDPSAKSGNQENNWFAVENPYTGQIDYPPQGRF---------------WLFSK------NSIKKHLENGTIVFKKEIKEGERGFIYKKYKNKLKTQLKTLNSLIATDNTCMNQVGTKELSELDLPDDLKNPKPENFIKLIIEHATDESDIVLDYHLGSGTTAAVAHKMN 252
>gi|167717505|ref|ZP_02400741.1| DNA methylase N-4/N-6 domain protein [Burkholderia pseudomallei DM98] (370 aa)
Score = 195, Expect = 3.5e-13, Identities = 33/78 (42%), Positives = 52/78 (66%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNF 79
           ++ R+++  +LL +DG ++ISIDD E  YLKV +D + G  NFI+ I+W +R  + + K    NHEY+L Y+KN + F
  S:    69 VTARVRQTWELLAEDGSVWISIDDCEVHYLKVALDRVIGRGNFITTIIWQQRTTRENRKVFSNNHEYLLVYAKNPRKF 146
>gi|4584114|emb|CAB40611.1| type III restriction-modification system enzyme Mod [Bacillus cereus ATCC 10987] (669 aa)
Score = 195, Expect = 4.4e-13, Identities = 89/303 (29%), Positives = 135/303 (44%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDK-AIERIEKIIPKMTKNGYSLFYADEK-EYKQVSHKSIVRFNINQSIIDN--ISSSKGSNTLRKLGIE-FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           M  RL  AK+LLK++G+I +SIDDNEQA L +L+++IFGE N +    W                                     NKK G      +    + +LV  KN+        + N      +Y  +  E D+     +   K    K + PI  P  +G +L++    ++ +  R E    +  +NG   F  +   E+     + I      +SI+ +   ++S     L     E F NPKP  LI++ I   +++ AIILDFFAGS TT  AVM+LN+    + +RKFIL    E T
  S:   188 MYPRLWLAKRLLKENGVILLSIDDNEQANLTLLLNEIFGEGNKLPPFTWQ------------------------------------NKKGGGNDSTHVAEETEVVLVYAKNINLVPKLFESYNS-----EYVKRYKEEDAYGRFYWDTFKRKSGKQYYPIEAP--DGTILQYDEQGNEISWLRSEGRFYQDLENGEVKFVKNRAGEWNVHFKQRIPNGKKPRSILSDKGTTASGSQEILNYFSKEVFSNPKPTTLIEYFIEVFTDDKAIILDFFAGSATTADAVMKLNA--AQQCDRKFILAQLNELT 450
>gi|42780094|ref|NP_977341.1| type III restriction-modification system enzyme, M subunit [Bacillus cereus ATCC 10987] >gi|42736012|gb|AAS39949.1| type III restriction-modification system enzyme, M subunit [Bacillus cereus ATCC 10987] (669 aa)
Score = 194, Expect = 4.8e-13, Identities = 89/303 (29%), Positives = 135/303 (44%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDK-AIERIEKIIPKMTKNGYSLFYADEK-EYKQVSHKSIVRFNINQSIIDN--ISSSKGSNTLRKLGIE-FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           M  RL  AK+LLK++G+I +SIDDNEQA L +L+++IFGE N +    W                                     NKK G      +    + +LV  KN+        + N      +Y  +  E D+     +   K    K + PI  P  +G +L++    ++ +  R E    +  +NG   F  +   E+     + I      +SI+ +   ++S     L     E F NPKP  LI++ I   +++ AIILDFFAGS TT  AVM+LN+    + +RKFIL    E T
  S:   188 MYPRLWLAKRLLKENGVILLSIDDNEQANLTLLLNEIFGEGNKLPPFTWQ------------------------------------NKKGGGNDSTHVAEETEVVLVYAKNINLVPKLFESYNS-----EYVKRYKEEDAYGRFYWDTFKRKSGKQYYPIEAP--DGTILQYDEQGNEISWLRSEGRFYQDLENGEVKFVKNRAGEWNVHFKQRIPNGKKPRSILSDKGTTASGSQEILNYFSKEVFSNPKPTTLIEYFIEVFTDDKAIILDFFAGSATTADAVMKLNA--AQQCDRKFILAQLNELT 450
>gi|71275849|ref|ZP_00652133.1| methyltransferase [Xylella fastidiosa Dixon] >gi|71899345|ref|ZP_00681505.1| methyltransferase [Xylella fastidiosa Ann-1] >gi|71163427|gb|EAO13145.1| methyltransferase [Xylella fastidiosa Dixon] >gi|71730859|gb|EAO32930.1| methyltransferase [Xylella fastidiosa Ann-1] (140 aa)
Score = 194, Expect = 5.1e-13, Identities = 37/79 (46%), Positives = 56/79 (70%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           F  PKPV LI+ +++  +++ A +LDFFAGSGTT HAV +LN++    G+R+FIL +N E T+   +K + +D+C ERL
  S:     2 FNTPKPVSLIERILSVTTDKEAWVLDFFAGSGTTAHAVAKLNAE--DGGHRRFILISNTEATQAQPDKNLCRDVCAERL 78
>gi|71275850|ref|ZP_00652134.1| methyltransferase [Xylella fastidiosa Dixon] >gi|71899346|ref|ZP_00681506.1| methyltransferase [Xylella fastidiosa Ann-1] >gi|71163428|gb|EAO13146.1| methyltransferase [Xylella fastidiosa Dixon] >gi|71730860|gb|EAO32931.1| methyltransferase [Xylella fastidiosa Ann-1] (316 aa)
Score = 194, Expect = 5.3e-13, Identities = 35/81 (43%), Positives = 52/81 (64%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           M  RL+ AK+LL DDG+I +SIDDNE   L +LMD +FGE NF++N +W+ R +  ++  +   H Y L Y++    F +N
  S:   123 MYRRLQLAKELLADDGVISVSIDDNELFRLGMLMDRVFGEQNFVANFIWNHRKSSQNDTDVSLAHNYTLCYARTRDRFSLN 203
>gi|150401989|ref|YP_001329283.1| DNA methylase N-4/N-6 domain-containing protein [Methanococcus maripaludis C7] >gi|159906220|ref|YP_001549882.1| DNA methylase N-4/N-6 domain-containing protein [Methanococcus maripaludis C6] >gi|150033019|gb|ABR65132.1| DNA methylase N-4/N-6 domain protein [Methanococcus maripaludis C7] >gi|159887713|gb|ABX02650.1| DNA methylase N-4/N-6 domain protein [Methanococcus maripaludis C6] (1019 aa)
Score = 194, Expect = 5.5e-13, Identities = 94/349 (26%), Positives = 165/349 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWS----FDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSS-KGSNTLRK-LGIEF-PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDV 349
           ++ +RL  +K L++++G I ISIDD+E+  L  L D   G +N ++ ++W+ RN      + +  HEY+L YSKN   F        N   G   ++  GA +     ++++      F   T  +           E + T   +  +  E+I+   +     +   V L+  W+     +K     E++     +     F++   + K V  K+     I  ++++ + ++ + SN L   LG      PK ++L++F+IN  ++E++++LDFFAGSGTTGHAV+ LN +    G RKFIL    +     +   I K I  E       N K      NN S +++ KY  +
  S:   532 LIYDRLALSKNLIRENGSISISIDDDEEHNLTALADMCLGNENRLAKLIWN-RNHSAQAGFFKLYHEYVLCYSKNRTQF--------NAILGADGKIIAGAQKKE---SKRHKLQEFTFPKGTRFEAE------DGFELNGTWGGV--ESTELINGRMMCKGNKLAEDVTLKAGWTQLNQMNKYFYSDEEVFDTKNQKVLEFFFSSTGKLKYVKEKT---HEIPSTVLNEMGTAGQASNDLTNILGYSIDSTPKSIKLMEFIINYLADESSLVLDFFAGSGTTGHAVINLNKE--DNGKRKFILVEMGQYFDTVLKPRIQKAIYSE-------NWKDGKPLDNNGSTNQIIKYHKL 855
>gi|15646208|ref|NP_208161.1| adenine-specific DNA methylase [Helicobacter pylori 26695] (809 aa)
Score = 193, Expect = 6.6e-13, Identities = 47/86 (54%), Positives = 63/86 (73%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIF---GEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNW-KNFKINQVFE 86
           MM  RL+ A++LL D G +F+SIDDNEQAYLKVLMD++F   G DNF+++I W +  + +ND     KN EYIL Y KN+ KN   N+ F+
  S:   428 MMENRLELARKLLNDKGAMFVSIDDNEQAYLKVLMDEVFNGGGGDNFVASISWKQFHSVKNDAANFSKNIEYILCYCKNFSKNLISNEPFD 518
>gi|85716202|ref|ZP_01047177.1| DNA methylase N-4/N-6 [Nitrobacter sp. Nb-311A] >gi|85697035|gb|EAQ34918.1| DNA methylase N-4/N-6 [Nitrobacter sp. Nb-311A] (513 aa)
Score = 191, Expect = 1.2e-12, Identities = 36/80 (45%), Positives = 54/80 (67%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           MM  RL+  + LL +DG I++SIDD E +Y+KV++D+IFG   FI+  VW KR ++ + + I   HEYI  Y+ N ++FK
  S:    91 MMWPRLELLRDLLAEDGSIWVSIDDAEGSYMKVILDEIFGRSRFIATNVWQKRYSRENREAIGDVHEYIYVYAINPESFK 170
>gi|33599901|ref|NP_887461.1| type III restriction-modification system methyltransferase [Bordetella bronchiseptica RB50] >gi|33567498|emb|CAE31411.1| type III restriction-modification system methyltransferase [Bordetella bronchiseptica RB50] (613 aa)
Score = 191, Expect = 1.2e-12, Identities = 32/75 (42%), Positives = 53/75 (70%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           M+  R+K A+ LL +DG+IF+S DD+E A L  + D+IFGE NF++N +W+KR  + + K +   H+Y++ Y++N
  S:   175 MLYPRIKLARTLLSEDGVIFVSADDSEIANLIRICDEIFGEANFVANFIWEKRTNRENRKVVSSRHDYVVCYARN 249
Score = 122, Expect = 1.3e-04, Identities = 49/133 (36%), Positives = 68/133 (51%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN--KTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNI---NYADVSIN------SNIDKLLEEIK 375
           F  PKPV LI+ LI    +E  IILDFFAGSGTT  A+ ELN+    +  R+FIL    E    D    K   +DI     +  ++ I+ +G+SF            D   +   I   N ADV  +      +N+D  ++ IK
  S:   387 FDTPKPVGLIQTLIQLSCDE-GIILDFFAGSGTTAEAIFELNTMDGRE--RRFILVQLPEALTADSEAYKAGYRDIA----HVGMERIRLAGKSFKG----------DTGFRVLKIDTSNMADVYYSPDALDKANLDLFVDNIK 513
>gi|4321654|gb|AAD15792.1| modification methylase LlaFI [Lactococcus lactis] (680 aa)
Score = 191, Expect = 1.3e-12, Identities = 88/283 (31%), Positives = 146/283 (51%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-----QNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKK--KGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEI--IDKGFVPIRPPIKNGVLLRWSWSF---------DKAIERIEKIIPKMTKNGYSLFYADEKE----YKQVSHKSIVRFNINQSIIDN-ISSSKGS--NTLRKLGIE------FPNP-KPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           M  RL+ AK+LL ++G+IF+  DDN+QAYLKVL+D IF ++NF+SNIV     A      + NK + K  EYIL+Y KN  N +IN   ++ KK    +   + +G +ED                    +K+  +     + E+D ++ N Y +  E   +   F   + P       +W+ S+         +K  E+++  +          +Y   +      K +S+    +  I   +  N + ++ G   N ++  G++      F N  KP E+IK +I   +N N  +LDFF GS TT    M++N
  S:   226 MRNRLEIAKELLSEEGLIFVQCDDNQQAYLKVLLDSIFSKENFMSNIVIKMSEASGVKMSHANKRLPKLKEYILSYKKN-SNSEIN-TLKVKKKYWDSEYNSILVGIDEDEF------------------QKLDKIINKDIRDEKDFSLLNNYMEKLEFQGLPDYFRDNKIPKNEQEAFKWNNSYRIFQTAATSEKFTEQVKNFVKDNEIRSSIFYYVTPQNRLYLLKNISNNENKKPRIQILLAKNYLETNPGDFWNDIKTTGLDNEGIVSFKNAKKPEEIIKRIITIATNTNDTVLDFFMGSATTQAVAMKMN 520
>gi|168819047|ref|ZP_02831047.1| DNA methylase [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (652 aa)
Score = 190, Expect = 1.3e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 2.8e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|168240164|ref|ZP_02665096.1| DNA methylase; restriction system [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194451308|ref|YP_002044388.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194409612|gb|ACF69831.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (652 aa)
Score = 190, Expect = 1.3e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 2.8e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|16763737|ref|NP_459352.1| DNA methylase [Salmonella typhimurium LT2] >gi|167543368|ref|ZP_02338942.1| DNA methylase [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167559787|ref|ZP_02352792.1| DNA methylase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] >gi|167992192|ref|ZP_02573290.1| DNA methylase [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|20141750|sp|P40814|T3MO_SALTY Type III restriction-modification system StyLTI enzyme mod (M.StyLTI) (StyLTI methyltransferase) >gi|16418858|gb|AAL19311.1| DNA methylase; restriction system [Salmonella typhimurium LT2] (652 aa)
Score = 190, Expect = 1.3e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 2.8e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|168261225|ref|ZP_02683198.1| Type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (652 aa)
Score = 190, Expect = 1.3e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 2.8e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|62178968|ref|YP_215385.1| DNA methylase; restriction system [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|62126601|gb|AAX64304.1| DNA methylase; restriction system [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] (652 aa)
Score = 190, Expect = 1.4e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 2.8e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|168476111|ref|ZP_02705134.1| hypothetical protein Salmoentericaenterica_15716 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] (652 aa)
Score = 190, Expect = 1.4e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYTK 261
Score = 153, Expect = 3.2e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|168465433|ref|ZP_02699315.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195631678|gb|EDX50198.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Newport str. SL317] (652 aa)
Score = 190, Expect = 1.5e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 3.0e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|194443439|ref|YP_002039595.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194402102|gb|ACF62324.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Newport str. SL254] (652 aa)
Score = 190, Expect = 1.5e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 3.2e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|168227009|ref|ZP_02652240.1| Type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (652 aa)
Score = 190, Expect = 1.5e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 3.2e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|300193|gb|AAB26533.1| StyLT1 restriction-modification system methylase subunit, StyLT1 Mod [Salmonella typhimurium, Peptide, 651 aa] (651 aa)
Score = 190, Expect = 1.5e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   187 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 260
Score = 153, Expect = 3.2e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   369 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 456
>gi|16759336|ref|NP_454953.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29142892|ref|NP_806234.1| Type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|168221911|ref|ZP_02647143.1| Type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|25347390|pir||AD0546 site-specific DNA-methyltransferase (adenine-specific) (EC 2.1.1.72) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16501627|emb|CAD08812.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Typhi] >gi|29138524|gb|AAO70094.1| Type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Typhi Ty2] (652 aa)
Score = 190, Expect = 1.5e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 3.2e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|171326169|ref|ZP_02914658.1| DNA methylase N-4/N-6 domain protein [Geobacillus sp. WCH70] >gi|171087855|gb|EDT34217.1| DNA methylase N-4/N-6 domain protein [Geobacillus sp. WCH70] (999 aa)
Score = 190, Expect = 1.5e-12, Identities = 84/297 (28%), Positives = 139/297 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK----IIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           ++  RL  +K LLKD G+I I+IDD E  +L  L+D+I    ++  NI+    + Q    K I + HEY +  +    +     V E   +      M  G  E+     R N  + +  + AT        ++ K +E+  T  +  K   E   +G+V + P  ++G    W  S++ A   +E       P +T   Y +   ++K     S+    ++N      + IS   G N L      F  PK +  +  +++   +  E A+I+D+FAGSGTTGHAV+ LN +    GNRK++L
  S:   494 LIENRLNISKNLLKDKGVIIIAIDDYELVHLCQLVDNIL--PSYERNIIVVNHHPQGSGGKNISRTHEYAVVLTPKGMDILRGSVKEDYVEHRSF--MRSGTAENNFRYGRPNSFYAILVDEAT--------FEIKGIEKPPTGSDYPKGKTE---EGWVRVYPLSRDGSERVWRLSYEGACRALENNGLYCSPNLTI--YQVINHNKKRVTLFSNWIDKKYNAGTHGTNLISDLFGVNGL------FSYPKSLYTVSDIVDASTYDEEGALIIDYFAGSGTTGHAVISLNRE--DNGNRKYVL 772
>gi|134298735|ref|YP_001112231.1| DNA methylase N-4/N-6 domain-containing protein [Desulfotomaculum reducens MI-1] >gi|134051435|gb|ABO49406.1| DNA methylase N-4/N-6 domain protein [Desulfotomaculum reducens MI-1] (505 aa)
Score = 190, Expect = 1.5e-12, Identities = 37/80 (46%), Positives = 53/80 (66%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           ++  RL+  ++ L  DG I++SIDD+E AYLKV+MD+IFG   FI+  VW KR ++ + + I   HEYI  Y+KN   FK
  S:    90 LIYPRLELLREFLSQDGSIWVSIDDSEAAYLKVIMDEIFGRKRFIACNVWQKRYSRENREAIGDVHEYIFTYAKNPDLFK 169
>gi|168237461|ref|ZP_02662519.1| DNA methylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194735291|ref|YP_002113386.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194710793|gb|ACF90014.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (652 aa)
Score = 190, Expect = 1.5e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 3.2e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|161615469|ref|YP_001589434.1| hypothetical protein SPAB_03240 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167551843|ref|ZP_02345596.1| hypothetical protein Sentente_15223 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] >gi|161364833|gb|ABX68601.1| hypothetical protein SPAB_03240 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (652 aa)
Score = 190, Expect = 1.6e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 153, Expect = 3.3e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|168232316|ref|ZP_02657374.1| hypothetical protein Sententerica_15143 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194469113|ref|ZP_03075097.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194455477|gb|EDX44316.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (652 aa)
Score = 190, Expect = 1.7e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 152, Expect = 3.4e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|56414486|ref|YP_151561.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56128743|gb|AAV78249.1| type III restriction-modification system StyLTI enzyme mod [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (652 aa)
Score = 189, Expect = 1.7e-12, Identities = 39/73 (53%), Positives = 52/73 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSK 74
           M  RL  A++LLKD G IFISIDDNE A LK++MD+IFGE  F++N++W  K+   ND+  +    EYIL Y+K
  S:   188 MYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMDEIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAK 261
Score = 152, Expect = 3.4e-08, Identities = 41/90 (45%), Positives = 56/90 (62%)
  Q:   225 DNISSSK-GSNTLRKLGIE--FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           DN++S+K G   +  L  +  F  PKP  L+K +I    +++ ++LDFFAGSGTT HAVM LN +    G R FILCT ++      N TIAK
  S:   370 DNVASNKEGKKEILDLFGDNVFDTPKPTALLKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEE--DGGQRTFILCTIDQALS---NNTIAK 457
>gi|188990456|ref|YP_001902466.1| restriction-modification system DNA-methyltransferase [Xanthomonas campestris pv. campestris] >gi|167732216|emb|CAP50408.1| restriction-modification system DNA-methyltransferase [Xanthomonas campestris pv. campestris] (505 aa)
Score = 189, Expect = 1.8e-12, Identities = 35/80 (43%), Positives = 52/80 (65%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           MM  RL+  ++ L   G I+I+IDDNE  YLKV+MD+IFG  NF++  +W KR ++ + + I   H+YIL Y+ +   FK
  S:    91 MMYPRLELLREFLSKSGSIWITIDDNEGHYLKVIMDEIFGRKNFVATCIWQKRYSRENREAIGDVHDYILVYANDPDAFK 170
>gi|115289075|gb|ABI85553.1| M.Hin1056ModP-2 [Haemophilus influenzae] (411 aa)
Score = 189, Expect = 2.0e-12, Identities = 43/89 (48%), Positives = 60/89 (67%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN------DNKYIEKNHEYILAYSKN-WKNFKINQVFEINKK 90
           M  RL+ AK LL DDG+IF+  DDNEQAYLK+LMD++FG +NF++ I       Q        +  I KN EYI+ +SKN  KN  IN ++++  +
  S:   276 MKNRLEIAKTLLADDGVIFVQCDDNEQAYLKILMDEVFGRENFVTTIHCQMSTTQGMKVKAAQDGNIVKNAEYIIVFSKNGHKNIAINPLYDLRSE 371
>gi|115289042|gb|ABI85531.1| M.Hin1056ModP-2 [Haemophilus influenzae] (409 aa)
Score = 189, Expect = 2.1e-12, Identities = 43/89 (48%), Positives = 60/89 (67%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN------DNKYIEKNHEYILAYSKN-WKNFKINQVFEINKK 90
           M  RL+ AK LL DDG+IF+  DDNEQAYLK+LMD++FG +NF++ I       Q        +  I KN EYI+ +SKN  KN  IN ++++  +
  S:   272 MKNRLEIAKTLLADDGVIFVQCDDNEQAYLKILMDEVFGRENFVTTIHCQMSTTQGMKVKAAQDGNIVKNAEYIIVFSKNGHKNIAINPLYDLRSE 367
>gi|59801068|ref|YP_207780.1| putative type III restriction/modification system modification methylase [Neisseria gonorrhoeae FA 1090] >gi|59717963|gb|AAW89368.1| putative type III restriction/modification system modification methylase [Neisseria gonorrhoeae FA 1090] (756 aa)
Score = 188, Expect = 2.3e-12, Identities = 93/308 (30%), Positives = 145/308 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNH------EYILAYSKNWKNFKINQVFEINKKKGQLIQMTIG--ANED----GLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEII----DKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRF-----NINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN 309
           M  RL+ AK+LLKDDG+IF+  DD EQAYLKVL+D+ F  +NFI N +  K +  + NK    +H      EYIL Y    KN K+N + E   +      + +     ED     L+VN +     +  N      I L    P  V  +  +  L   D E+I    D  +  +R    + V        +   ++   +I K  K    L Y  + +Y + +    V+       ++ S+ D  ++   +    +  +E  N  KP  LI+ +I   +NEN I+LD+  GSGTT     ++N          +I     ER K+ I+
  S:   300 MKNRLEIAKELLKDDGLIFVQCDDKEQAYLKVLLDETFTRENFI-NCIAVKMSEPSGNKMAHTSHRLPKIKEYILIYKN--KNIKLNPIREQKSEWDNEYNIFLENFTQEDKKFIDLIVNSQTENKEINGNTLKEIDILLKKISPISV--NQKLAQLNIKDNEVIKWKLDNAYRIVRTAASSSVKKLADEKKEICQQQFFSVISKRDK----LLYIVKSDYSKDAKAPRVQVLFAEDYLSISLCDLWTNINTTGLEAEGNVELKNGKKPESLIETIIKLATNENDIVLDYHLGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERMKKVID 620
>gi|121596379|ref|YP_988275.1| DNA methylase N-4/N-6 domain-containing protein [Acidovorax sp. JS42] >gi|120608459|gb|ABM44199.1| DNA methylase N-4/N-6 domain protein [Acidovorax sp. JS42] (545 aa)
Score = 188, Expect = 2.4e-12, Identities = 35/80 (43%), Positives = 53/80 (66%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN---WKNFK 80
           MM  RL+  ++LL +DG I+++IDDNE  YLKVLMD++FG  NFI+ ++W+    ++    I   H YI  YS +   WK+ +
  S:    91 MMLPRLQLLRELLSEDGSIWVTIDDNEGHYLKVLMDEVFGRRNFIATVIWENFYGRSGTAAISPAHNYIHCYSPSGDAWKHIR 173
>gi|148266400|ref|YP_001233106.1| site-specific DNA-methyltransferase (adenine-specific) [Geobacter uraniireducens Rf4] >gi|146399900|gb|ABQ28533.1| Site-specific DNA-methyltransferase (adenine-specific) [Geobacter uraniireducens Rf4] (531 aa)
Score = 188, Expect = 2.7e-12, Identities = 38/77 (49%), Positives = 53/77 (68%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWK 77
           MM  RL   ++ L+DDG IFISIDDNE  +L+++MD+IFG +NF+ +  W+KR +   D K I   HE +LAY K+ K
  S:   112 MMYPRLALLREFLRDDGAIFISIDDNEVHFLRMMMDEIFGANNFLCSFAWEKRYSPPPDTKDIGYLHETLLAYRKSSK 189
Score = 144, Expect = 3.2e-07, Identities = 35/80 (43%), Positives = 49/80 (61%)
  Q:   229 SSKGSNTLRKLGIEFP-NPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI 308
           + + +  LR L  E    PKP  LI+ L+   S+++A+ILD FAGSGTTGHAV+  N+     GNR+FIL   +E   + I
  S:   308 TDEAAKELRALVPEVKFTPKPTRLIRHLMQISSDKDALILDSFAGSGTTGHAVLAQNA--SDGGNRRFILVEMDEHICRKI 386
>gi|57234105|ref|YP_181827.1| type III restriction-modification system, methylase subunit [Dehalococcoides ethenogenes 195] >gi|57224553|gb|AAW39610.1| type III restriction-modification system, methylase subunit [Dehalococcoides ethenogenes 195] (587 aa)
Score = 187, Expect = 3.3e-12, Identities = 84/297 (28%), Positives = 129/297 (43%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-------KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTI---ENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RL  A+ LL DDG IFISID NE   LK +MD++FG +NF   IVW        K  A N      +NH+ IL YSKN    +  + +  NK                                   +  PL+  D K   +  ++   +   K+  E I+ G  P R PI++      +W                          +  EY  ++  +IV F          S  K S  L  +  +F   K V+++  +I   + E+ I++DFF+G+G+T HAVM++N++     +RK+I+
  S:   185 MMYSRLMLARNLLTDDGSIFISIDFNEVENLKKIMDEVFGAENFQREIVWRIGWLSGYKTMAPN----FIRNHDTILFYSKNSSKIEFIKKYIENK-----------------------------------DFKPLLKKDAKVTAKLKSLGLSDEQQKELLEFINHGNRPERYPIED------TW--------------------------NSNEYDDLNSIAIVSF----------SGEKISKIL-DVDQDFKGQKSVKMLMRIIEATTKEDDIVMDFFSGTGSTAHAVMQMNAEDGC--HRKYIM 407
>gi|161506656|ref|YP_001576604.1| DNA methylase [Lactobacillus helveticus DPC 4571] >gi|160347645|gb|ABX26319.1| DNA methylase [Lactobacillus helveticus DPC 4571] (608 aa)
Score = 186, Expect = 3.9e-12, Identities = 88/297 (29%), Positives = 127/297 (42%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR----NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGL-LVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RLK A++LLK+ G+IFISIDD+EQA L  +M++IFGE N++  +VW  R    N        + + EY+L Y K   +    Q + +   K +    ++   +  L  + + N G     N           Y P   +R       ++  KE I + +   +   KNG   R                          F  +E E  Q        F +        S  K  N L      F   KPV LI+ LI   + +N +I+DFFAGS TT  AV++ N   K   NRK+IL
  S:   175 MMYPRLKLARRLLKESGVIFISIDDHEQANLVKIMNEIFGERNYLGMLVWKSRVKPSNQGESAVRPQGDVEYVLVYGK---DINETQFYGLKSDKERKYPYSLNGRKYRLATILKSNRG----INSRKTMNFEFHGYKPSDTQR-------WQAGKEKIQELWDRNQIEFKNGTPFR------------------------RYFKDEENEISQ----PFYNFMLPSVTGTAESGKKRLNDLLGNKHGFDTVKPVPLIQRLIAATTKDNDLIMDFFAGSSTTAEAVLQQNL--KDNFNRKYIL 432
>gi|114566985|ref|YP_754139.1| adenine specific DNA methylase Mod-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337920|gb|ABI68768.1| Adenine specific DNA methylase Mod-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (633 aa)
Score = 184, Expect = 7.4e-12, Identities = 41/64 (64%), Positives = 47/64 (73%)
  Q:   239 LGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           LG EF   KPVELIK LI  H N+N IILDFFAGSGTT  AV+ELN +    G+R+FILCTN +
  S:   378 LGDEFEYSKPVELIKRLIKNHYNKNGIILDFFAGSGTTAQAVLELNVE--DGGHRQFILCTNNQ 439
Score = 182, Expect = 1.3e-11, Identities = 38/77 (49%), Positives = 52/77 (67%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKN 78
           M +RL+ A QLL +DG++F+SIDDNEQA LK L+DDIF EDNFI  +    + +        KNH+Y+L Y+K  K+
  S:   144 MEKRLRIAYQLLSEDGLMFVSIDDNEQAALKNLIDDIFSEDNFIIAMPRITKKSGKTTGSFSKNHDYVLVYTKQNKD 220
>gi|16272988|ref|NP_439215.1| type III restriction-modification system methyltransferase-like protein [Haemophilus influenzae Rd KW20] >gi|12230654|sp|P71366|T3MH_HAEIN Putative type III restriction-modification system HindVIP enzyme mod (M.HindVIP) (HindVIP methyltransferase) >gi|1574609|gb|AAC22721.1| predicted coding region HI1056 [Haemophilus influenzae Rd KW20] (629 aa)
Score = 183, Expect = 9.2e-12, Identities = 95/308 (30%), Positives = 147/308 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-----NAQNDNKYIEKNHEYILAYSKNWKNFKINQVF---EINK---------KKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSI-----------IDNISSSKGSNTLRKLG--IEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN 309
           M  RL+ AK LL DDG+IF+  DD EQAYLK+LMDDIF  DNF+ NIV  K      +  ++ K ++ + E+I  +SKN +   +N V+   E+N+         K  +  Q+ I   E  LL  +    +  Y N    +   ++ +   +      I   Y             IR  I   +     +S    I  IE  IP+  KN  +L     + +   S+K +  F  +  I           ++ +      N L K G  I+F N  KP  L++ +I+  + E  I+LD+  GSGTT     ++N          +I     ER K+ I+
  S:   174 MKNRLEIAKTLLADDGVIFVQCDDIEQAYLKILMDDIFDRDNFL-NIVTVKTKIGGVSGSSEGKSLKDSTEFINVFSKNRERLFLNPVYQKTEVNEFIKNYEDSGKSWKYTQVLIDLGEKILLEEKDGFKYYHYPNA---QMTSIVKFSQDQNLSKEIIYTEYSHKVYRTTNAQSSIRSKIIEDL-----YSIKNGIVSIE-YIPQKGKNAGNLI----EVFYNASNKDMFMFLSDMLIKEKNKYFYLQKVNTLWDDIQYNNLNKEGGYIDFKNGKKPEALLRRIIDMTTKEGDIVLDYHLGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERLKKVID 498
>gi|194098835|ref|YP_002001898.1| Twin-argninine leader-binding protein DmsD [Neisseria gonorrhoeae NCCP11945] >gi|193934125|gb|ACF29949.1| Twin-argninine leader-binding protein DmsD [Neisseria gonorrhoeae NCCP11945] (457 aa)
Score = 182, Expect = 1.3e-11, Identities = 93/308 (30%), Positives = 147/308 (47%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNH------EYILAYSKNWKNFKINQVFEINKKKGQLIQMTIG--ANED----GLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEI---IDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRF-----NINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN 309
           M  RL+ AK+LLKDDG+IF+  DD EQAYLKVL+D+ F  +NFI N +  K +  + NK    +H      EYIL Y    KN K+N + E   +      + +     ED     L+VN +     +  N      I L    P  V +     N+ KD++ I   +D  +  +R    + V        +   ++   +I K  K    L Y  + +Y + +    V+       ++ S+ D  ++   +    +  +E  N  KP  LI+ +I   +NEN I+LD+  GSGTT     ++N          +I     ER K+ I+
  S:     1 MKNRLEIAKELLKDDGLIFVQCDDKEQAYLKVLLDETFTRENFI-NCIAVKMSEPSGNKMAHTSHRLPKIKEYILIYKN--KNIKLNPIREQKSEWDNEYNIFLENFTQEDKKFIDLIVNSQTENKEINGNTLKEIDILLKKISPISVNQKLAQLNI-KDNEVIKWKLDNAYRIVRTAASSSVKKLADEKKEICQQQFFSVISKRDK----LLYIVKSDYSKDAKAPRVQVLFAEDYLSISLCDLWTNINTTGLEAEGNVELKNGKKPESLIETIIKLATNENDIVLDYHLGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERMKKVID 321
>gi|104779992|ref|YP_606490.1| adenine specific DNA methylase [Pseudomonas entomophila L48] >gi|95108979|emb|CAK13675.1| putative Adenine specific DNA methylase [Pseudomonas entomophila L48] (505 aa)
Score = 182, Expect = 1.3e-11, Identities = 33/90 (36%), Positives = 58/90 (64%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKK 90
           MM  RL+  ++LL  DG +++++DDNE  Y KV+ D+IFG  NFI++++W K  + +N  ++   +H+YI  Y+KN + +  N +    K+
  S:    91 MMYPRLELIRELLAPDGSLWVTLDDNEAHYFKVICDEIFGRPNFIASVIWQKIYSPKNSARHFSVDHDYIFVYAKNAEKWVPNPMPRTEKQ 181
>gi|147676486|ref|YP_001210701.1| adenine specific DNA methylase Mod [Pelotomaculum thermopropionicum SI] >gi|146272583|dbj|BAF58332.1| adenine specific DNA methylase Mod [Pelotomaculum thermopropionicum SI] (620 aa)
Score = 181, Expect = 1.5e-11, Identities = 36/75 (48%), Positives = 54/75 (72%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN 75
           MM  RLK A+ LL++DG+IFISIDDNE   L+ + D++FGE NF++ I+W +  +  N  +   +NH++I+ YSKN
  S:   180 MMYPRLKLARNLLREDGVIFISIDDNEVHNLRKICDEVFGERNFVATIIWQRAFSPVNLKRTFSENHDFIICYSKN 255
Score = 139, Expect = 1.2e-06, Identities = 31/62 (50%), Positives = 42/62 (67%)
  Q:   246 PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           PKPV L+K L+   +  N IILDFF+GS TT HAVM+LN++   +GNRK+I+    E   +D
  S:   392 PKPVRLLKRLLELTTENNDIILDFFSGSATTAHAVMQLNAE--DEGNRKYIMVQLPEPCPED 451
>gi|60680649|ref|YP_210793.1| putative modification enzyme of type III restriction-modification system [Bacteroides fragilis NCTC 9343] >gi|60492083|emb|CAH06846.1| putative modification enzyme of type III restriction-modification system [Bacteroides fragilis NCTC 9343] (635 aa)
Score = 181, Expect = 1.7e-11, Identities = 36/75 (48%), Positives = 53/75 (70%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKN 75
           M+  RL  A+ LL +DG+IFISIDDNEQ  LK + D++FG  NF++ IVW++  +  N  K+   +H+Y+L Y+KN
  S:   185 MIYSRLLVARSLLTEDGVIFISIDDNEQRNLKNICDEVFGSSNFLAQIVWERAYSPINLMKHFSPSHDYVLCYAKN 260
Score = 150, Expect = 6.7e-08, Identities = 34/60 (56%), Positives = 43/60 (71%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           F  PKPVELIK +I+ +S+ N+IILDFF+GS TT HAVME N+     G R+FI+   EE
  S:   395 FDYPKPVELIKRIISLYSDSNSIILDFFSGSATTAHAVMEQNA--LDGGCRQFIMVQLEE 452
>gi|30250236|ref|NP_842306.1| adenine specific DNA methylase Mod [Nitrosomonas europaea ATCC 19718] >gi|30181031|emb|CAD86221.1| Adenine specific DNA methylase Mod [Nitrosomonas europaea ATCC 19718] (567 aa)
Score = 180, Expect = 2.0e-11, Identities = 77/277 (27%), Positives = 127/277 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTL--YFNPATNEKIPLMDYD-------------PKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNG---YSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           +M +RL+  K+LL +DG ++I+IDDNE  YLKVL D+IFG  N+ + I W ++ + ++N + I    +++L YSK+ + FK N +    +   +        N D    N     W    Y N AT EK P + YD              K  + D T    + D+K I                   W      ++  + K+     ++G   ++ +  +E  +   S K ++     + + D                    PKP  L+K ++   +N   ++LD FAGSGTTG
  S:    99 LMRDRLEIIKRLLSNDGSLWITIDDNECHYLKVLCDEIFGRANYKTTITWQRKYSVSNNFQGIASICDFVLVYSKS-EAFKNNLLPRSEESAARY------NNPD----NDPRGPWKAVDYLNQATPEKRPNLCYDIVNPNTGVVIKNTKKAWKYDPTTHQRHVDEKRIW------------------WGRDGGNSVPAL-KLFLSEVRDGMTPHNWWSHEEVGHTDESKKEMIGLYGPRDVFD-------------------TPKPERLLKRILEIATNPGDLVLDSFAGSGTTG 345
>gi|169836906|ref|ZP_02870094.1| adenine specific DNA methylase Mod [candidate division TM7 single-cell isolate TM7a] (358 aa)
Score = 180, Expect = 2.1e-11, Identities = 33/80 (41%), Positives = 56/80 (70%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           MM  RL  A+ LL+ DG+IF+SIDDNE   L+++M++IFGE+NF++ ++W+K    +N  +Y   NH+Y++  ++    +K
  S:   169 MMYPRLFLARNLLRQDGVIFVSIDDNEVHNLRLMMNEIFGEENFVAQVIWEKVHTRKNSAQYFSYNHDYVVTIARKKDEWK 249
>gi|145634213|ref|ZP_01789924.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae PittAA] >gi|115289038|gb|ABI85528.1| M.Hin1056ModP-3 [Haemophilus influenzae] >gi|145268657|gb|EDK08650.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae PittAA] (681 aa)
Score = 179, Expect = 2.6e-11, Identities = 94/308 (30%), Positives = 139/308 (45%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN----KYIEKNHEYILAYSKNWK----------NFKINQVFEINKKKGQLI------QMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDST-IENLYKDDKEIIDKG-FVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN 309
           M  RL+ AK LL DDG+IF+  DDNEQAYLK+LMD++F     I  +          N    + + K  EYIL YSK+ K           F  N  +E+  + G+ +      +M     E+  L N KN+      N    EKI  +    K   ++    EN +     + D G F+P++                      E+I+ +  KN Y +  +D                I++  +   SSS+G  T +K        KP +LIK +I   +NEN IILD+  GSGTT     ++N          +I     ER K+ I+
  S:   260 MKNRLEIAKTLLADDGVIFVQCDDNEQAYLKILMDELFHHRETIVALTSTASGVNAVNVKRGEQMFKLKEYILFYSKSPKFRFNPLLIKSPFNSNYKYEVIFENGEYVITDLKSKMNNTELEEYCLNNPKNIFSLEKNNSKAGEKIKQVIEISKTNNKEVIEFENSFGKTILVYDGGVFIPLQ----------------------ERILTEENKNFYGVLISD--------------LWIDE--VFQTSSSEGGVTFKK------GKKPEKLIKRIIELTTNENDIILDYHLGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERLKKVID 545
>gi|15341563|gb|AAK95340.1| truncated type III restriction-modification system methyltransferase [Moraxella catarrhalis] (331 aa)
Score = 179, Expect = 2.7e-11, Identities = 68/211 (32%), Positives = 106/211 (50%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKNWKNFKINQVFEINKKKGQLI----QMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHK 212
           M  RL+ AK+ L D G+IFISIDD+  AYLKVLMD+IFG DNFI+N+        N+++Y     HEY L Y+K+ +    +  +E    + +L+    Q  IG  + G   N K+ G       A  EK P + + P  ++ D+ +   + D++ +   G +    PI +   + W WS  K +     +I     N  SL+     E  ++  K
  S:   125 MKNRLEVAKEFLSDTGVIFISIDDDGLAYLKVLMDEIFGIDNFIANLPTIMNLKGNNDEYAFAGTHEYTLVYAKDKEK---SVFYEFPVDEDELLKDWEQDEIGLYKQG--ANLKSTGVN-----APREKRPNL-FFPVFIDNDNNVYVTHDDEEPLNYVGDLVKIYPITDNQEMSWRWSKKKFMSNNHDLIVSRQGNNVSLYKKQRPELNELPTK 329
>gi|163858554|ref|YP_001632852.1| type III restriction system methylase [Bordetella petrii DSM 12804] >gi|163262282|emb|CAP44585.1| type III restriction system methylase [Bordetella petrii] (632 aa)
Score = 179, Expect = 2.8e-11, Identities = 54/139 (38%), Positives = 77/139 (55%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYI---EKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLV--NRKNMGWTLYFNPAT--NEKIPLMD--YDPKKVER 139
           M+  RLK A+ LL+ DG IFISIDD E   L+V  DDIFGE+NF++  +W  R    DN+ +     +HEYI+ Y  + +    ++  + +   G        AN  G+     R N+ + L  NP T  N   P M   Y+PK +ER
  S:   179 MIYPRLKLARNLLRRDGTIFISIDDGELPRLRVAADDIFGEENFLACFIWKSRQ-NKDNRTVTGASVDHEYIVCYGNSIRGAARDRS-QYSNPDGDPRGDWTSANMVGIATADRRPNLHYDL-VNPETGINYGCPDMGWRYEPKTMER 323
Score = 134, Expect = 5.0e-06, Identities = 34/75 (45%), Positives = 42/75 (56%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-NEERTKQDINKTIAKDIC 317
           F  PKPVEL+  LI + S  + IILDFFAGSGT+ HA M  N+     GNR++I     E     D  +  A D C
  S:   382 FNFPKPVELVAGLIEQGSEGDDIILDFFAGSGTSAHASMYQNA--ADGGNRRYITVQLPEPLDPADREQKTAADFC 455
>gi|171920243|ref|ZP_02931612.1| type III restriction-modification system methylation subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902642|gb|EDT48931.1| type III restriction-modification system methylation subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] (622 aa)
Score = 179, Expect = 3.1e-11, Identities = 94/315 (29%), Positives = 155/315 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN------DNKYIEKNHEYILAYSKNWK-NFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVE-RDST---IENLYKDDKE-----------IIDKGFVPIR--------PPIKNGVLLRWS--WSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN---KTIAKDI 316
           M  RL+ AK+LL+DDG+IF+  DDNEQAYLKVLMD++FG +NF + +  +    Q           I KN EYIL Y KN+   F  N +F+                            +++Y +P TN++  L+++  +  + +D T   IE LY+ D +           I     + I+          +KN  ++++     F  +   I +++P     G +  +  +   +++       F       D ++ +K +N + K G      KP  LIK +I   + +N I+LDF  GSGTT     ++N          +I     ER K+ I+     I+KD+
  S:   192 MKNRLELAKKLLRDDGVIFVQCDDNEQAYLKVLMDEVFGRENFSTTLHVELSTTQGMKVGAAQKGQIVKNGEYILIYHKNYNLKFFTNLIFDSKSWDSH---------------------YSIYIDPITNKRTSLLNFIKENTKYKDITKEKIEELYEFDDDFRSLIHNHSNNIFQDAMIDIKFNLSEEDNFKLKNNEIIKFKDYLIFKTSTNVIRQLLPLEKAIGPTDDFDSKFGLRKIRGNWWPNF-----YKDMMNINKEANFVWKSG-----KKPERLIKDIIKLSTKQNDIVLDFHLGSGTTCAVAHKMNRQYIGIEQMDYIENITIERLKKVIDGEQSGISKDV 510
>gi|167933130|ref|ZP_02520217.1| DNA methylase N-4/N-6 [candidate division TM7 single-cell isolate TM7b] (282 aa)
Score = 177, Expect = 4.9e-11, Identities = 33/80 (41%), Positives = 56/80 (70%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           MM  RL  A+ LL+ DG+IF+SIDDNE   L+++M++IFGE+NF++ ++W+K    +N  +Y   NH+Y++  ++    +K
  S:   169 MMYPRLFLARNLLRQDGVIFVSIDDNEVHNLRLMMNEIFGEENFVAQVIWEKVHTRKNSAQYFSYNHDYVVTIARKKDEWK 249
>gi|114775609|ref|ZP_01451177.1| Site-specific DNA-methyltransferase (adenine-specific) [Mariprofundus ferrooxydans PV-1] >gi|114553720|gb|EAU56101.1| Site-specific DNA-methyltransferase (adenine-specific) [Mariprofundus ferrooxydans PV-1] (392 aa)
Score = 176, Expect = 6.5e-11, Identities = 40/80 (50%), Positives = 59/80 (73%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-ND-NKYIEKNHEYILAYSKNWKNFK 80
           MM  RLK A+ LL++DG+IFISIDD E + LK ++++I+GE+NF  +I W +R+ Q ND NK +    E+IL Y+KN + +K
  S:   182 MMYPRLKLARNLLREDGLIFISIDDAEVSNLKSILNEIYGEENFEGHIHWRRRHNQPNDKNKMLALVAEHILCYAKNKEAYK 263
>gi|115289054|gb|ABI85539.1| M.Hin1056ModP-6 [Haemophilus influenzae] (351 aa)
Score = 174, Expect = 1.1e-10, Identities = 39/83 (46%), Positives = 54/83 (65%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA---QNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           M  RL+ A++LL DDG+IF+  DDNEQAYLKVLMD+IFG +NFI  I    ++A     D +      EY + YSK+  + + N +
  S:   256 MKNRLEVARELLSDDGVIFVQCDDNEQAYLKVLMDEIFGRENFICCITCKVKSAGGLTTDTEMFFDCAEYFIVYSKSIDSLQYNSI 341
>gi|145627986|ref|ZP_01783787.1| TYPE III RESTRICTION-MODIFICATION SYSTEM: METHYLASE [Haemophilus influenzae 22.1-21] >gi|144979761|gb|EDJ89420.1| TYPE III RESTRICTION-MODIFICATION SYSTEM: METHYLASE [Haemophilus influenzae 22.1-21] (207 aa)
Score = 174, Expect = 1.2e-10, Identities = 39/74 (52%), Positives = 52/74 (70%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK-RNAQNDNKYIEKNHEYILAYSKN 75
           M  RL+ AK LL DD +IF+  DD EQAYLK+LMDDIF  +NFI+ IVW K ++A+  +  + +  EYIL Y K+
  S:     1 MKNRLEIAKTLLADDSVIFVQCDDKEQAYLKILMDDIFKRENFINTIVWRKVKSAKIQSGNLPRVKEYILVYKKS 75
>gi|119715324|ref|YP_922289.1| DNA methylase N-4/N-6 domain-containing protein [Nocardioides sp. JS614] >gi|119535985|gb|ABL80602.1| DNA methylase N-4/N-6 domain protein [Nocardioides sp. JS614] (540 aa)
Score = 174, Expect = 1.2e-10, Identities = 27/83 (32%), Positives = 56/83 (67%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-AQNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           M +RL++ ++LL  DG +++ +DD E  +++VL+D++FG  NF+ N+ W +RN  +N  ++I  +H+ +L Y ++    + N++
  S:   118 MRDRLRQIRELLTPDGSVWVHLDDAEAHHMRVLLDEVFGPANFLGNVAWKRRNDPRNTAQFISADHDQLLIYGRDAARARFNKL 201
>gi|148826327|ref|YP_001291080.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae PittEE] >gi|148716487|gb|ABQ98697.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae PittEE] (713 aa)
Score = 173, Expect = 1.4e-10, Identities = 39/83 (46%), Positives = 55/83 (66%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA---QNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           M  RL+ A++LL DDG+IF+  DDNEQAYLKVLMD+IFG +NFI  I    ++A     D +      EY++ YSK+  + + N +
  S:   256 MKNRLEVARELLSDDGVIFVQCDDNEQAYLKVLMDEIFGRENFICCITCKVKSAGGLTTDTEMFFDCAEYLIVYSKSIDSLQYNSI 341
Score = 109, Expect = 3.4e-03, Identities = 35/85 (41%), Positives = 47/85 (55%)
  Q:   224 IDNISSSKGSNTLRKLG-IEFPNPK-PVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDI 308
           I NI S      + K G I+F N K P  L++ +I   +NEN I+LDFFAGSGTT    M++N    T     +I    +ER K+ I
  S:   490 ISNIISDDLWQGISKEGQIQFKNAKKPETLLQRIIEISTNENDIVLDFFAGSGTTAAVAMKMNRQFITIEQMDYIETITKERLKKVI 576
>gi|148828222|ref|YP_001292975.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae PittGG] >gi|115289027|gb|ABI85520.1| M.Hin1056ModP-8 [Haemophilus influenzae] >gi|148719464|gb|ABR00592.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae PittGG] (724 aa)
Score = 173, Expect = 1.4e-10, Identities = 40/74 (54%), Positives = 53/74 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-------KYIEKNHEYILAYSKN 75
           M  RL+ AK+LL DDG+IF+  DDNEQAYLK+LMD+IF  +NFI+ I+ +  NA  +        K   K  EYIL Y+K+
  S:   256 MKNRLEIAKKLLADDGVIFVQCDDNEQAYLKILMDEIFERENFINTIIPEMSNASGNKIKHAIKGKKFPKLKEYILLYAKD 336
>gi|38234465|ref|NP_940232.1| putative DNA methylase [Corynebacterium diphtheriae NCTC 13129] >gi|38200728|emb|CAE50429.1| Putative DNA methylase [Corynebacterium diphtheriae] (613 aa)
Score = 173, Expect = 1.6e-10, Identities = 32/80 (40%), Positives = 52/80 (65%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYS---KNWKNFK 80
           MM +RL   K+LL +DG I++ +DD E   ++VLMD++FG D FI+ + W+K   + ++  I   H+ IL Y+   + WKN +
  S:   131 MMRDRLIHMKKLLTNDGSIWVHLDDVEVHRMRVLMDEVFGADRFIATVAWEKDKGRRNDTDISGAHDLILIYAPSGRQWKNVR 213
Score = 91, Expect = 4.5e-01, Identities = 22/62 (35%), Positives = 32/62 (51%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           F  PKP  L++ +I+  SN   I+LD FAGSGTT     ++         R+++ C   E T
  S:   343 FSTPKPERLLERIIHIGSNPGDIVLDVFAGSGTTAAVAQKM--------GRRWVTCELLEST 396
>gi|78356786|ref|YP_388235.1| adenine specific DNA methylase Mod-like [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78219191|gb|ABB38540.1| Adenine specific DNA methylase Mod-like [Desulfovibrio desulfuricans G20] (445 aa)
Score = 172, Expect = 2.0e-10, Identities = 38/74 (51%), Positives = 52/74 (70%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKN 75
           M  RLK A+ LL  DG+IFISIDD EQ  L+ + D+IFGE+NFIS I+   K+   +D+K +    EY+LAY+K+
  S:     1 MYPRLKIARSLLTHDGVIFISIDDGEQPNLRKICDEIFGEENFISCIMRKRKKEISSDSKNVSIQGEYVLAYAKS 75
Score = 122, Expect = 1.1e-04, Identities = 44/119 (36%), Positives = 60/119 (50%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL------CTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADV 361
           F  PKP  L++ LI   S E  IILDFF+GS  T HAVM+ N   KTK  RKFI+      C       +    TIA ++  ER+  +I          + LS D L    D+  K F +  +++
  S:   204 FDTPKPTALLQRLIALVSKEEDIILDFFSGSCATAHAVMKGNVYEKTK--RKFIMVQLPEPCDKNSSAFKSGFSTIA-ELGKERIRRVI----------SQLSEDNLSYSGDLGFKVFKLESSNI 315
>gi|48243679|gb|AAT40808.1| type III restriction-modification system methyltransferase-like protein [Haemophilus influenzae] (518 aa)
Score = 170, Expect = 3.1e-10, Identities = 40/74 (54%), Positives = 53/74 (71%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-------KYIEKNHEYILAYSKN 75
           M  RL+ AK+LL DDG+IF+  DDNEQAYLK+LMD+IF  +NFI+ I+ +  NA  +        K   K  EYIL Y+K+
  S:   256 MKNRLEIAKKLLADDGVIFVQCDDNEQAYLKILMDEIFERENFINTIIPEMSNASGNKIKHAIKGKKFPKLKEYILLYAKD 336
>gi|115522589|ref|YP_779500.1| DNA methylase N-4/N-6 domain-containing protein [Rhodopseudomonas palustris BisA53] >gi|115516536|gb|ABJ04520.1| DNA methylase N-4/N-6 domain protein [Rhodopseudomonas palustris BisA53] (596 aa)
Score = 170, Expect = 3.5e-10, Identities = 82/277 (29%), Positives = 136/277 (49%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA---QNDNKYIEKNHEYILAYSKNWKNFKINQVF----EINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIR--PPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYS----------LFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           ++  RL+   +L++DDG +F+ IDDNE  Y+  ++D+IFG  N  S + + + +A   ++ N  +     +IL YSK    +K  ++F    E +K+ GQ I+            NR        F   T      +D   K ++++   E   K  + + +     IR   P  N V        D + +R  +++  + ++  S          LFY D  + K V  K +    +  +I D+I S   +N   + GIEFP   KP  LIK  ++  S+   ++LD FAGSGTTG
  S:    99 LIRNRLELIHKLMRDDGTLFVHIDDNELGYIITVLDEIFGRTNRASIVTFKQGSATGHKSINPGVVTTSNFILIYSKKKLEWKPKRIFTARGERDKRYGQFIE------------NRTARYAKWRFITLTRAFAASLDLPEKGLKKELGDEFEAKLTEFVHENAESVIRLARPDYNAVSAAARLVIDDSKKRPGEVL-LLERDELSDMYFVGGERILFYQD--KLKIVDGKRVAGEPLT-TIWDDILS---NNLHNEGGIEFPKGKKPEALIKRCLDLASDPGDLVLDSFAGSGTTG 376
>gi|189460175|ref|ZP_03008960.1| hypothetical protein BACCOP_00811 [Bacteroides coprocola DSM 17136] >gi|189433036|gb|EDV02021.1| hypothetical protein BACCOP_00811 [Bacteroides coprocola DSM 17136] (634 aa)
Score = 170, Expect = 3.5e-10, Identities = 37/80 (46%), Positives = 51/80 (63%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK---NWKNFK 80
           MM  RL  AK LL D G IF+++DD+E    + LMD+IFGE +FIS ++W+    +++   I   H YIL YSK    WKN +
  S:   183 MMYPRLMVAKSLLSDSGSIFLTLDDHEIVNGRKLMDEIFGEKSFISTVIWENFYGRSNAAAISLAHNYILIYSKAGEEWKNIR 265
Score = 134, Expect = 4.9e-06, Identities = 29/67 (43%), Positives = 41/67 (61%)
  Q:   241 IEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           + F  PKP++LIK +I        +I+DFF+GS TT HAVM+ N++    GNRK+I+    E T  D
  S:   392 MPFDTPKPLKLIKQIIQISCRNTDVIMDFFSGSATTAHAVMQQNAE--DDGNRKYIMVQLPEETPDD 456
>gi|126661692|ref|ZP_01732691.1| Site-specific DNA-methyltransferase (adenine-specific) [Flavobacteria bacterium BAL38] >gi|126625071|gb|EAZ95760.1| Site-specific DNA-methyltransferase (adenine-specific) [Flavobacteria bacterium BAL38] (624 aa)
Score = 169, Expect = 3.6e-10, Identities = 35/83 (42%), Positives = 53/83 (63%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQ 83
           MM  RL+ A+ LLK+DG+IF+SIDDNE   L+ + D+IFGE NF+  I+W+   +  +   I  +H Y L ++K+   F  N+
  S:   177 MMYPRLRLARNLLKEDGVIFVSIDDNEVDNLRKICDEIFGESNFMGCIMWNSTKSVTNTALISVSHNYNLVFAKDINYFVKNR 259
Score = 110, Expect = 3.2e-03, Identities = 48/157 (30%), Positives = 82/157 (52%)
  Q:   205 EYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIE----FPNPKPVELIKFLIN-KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKN-IKTSGESFNNLSVDELKKYQDVSLKTFNINYADV 361
           + K+   +++ R  + ++  D++ ++    TL K        F NPKPV+LI+ +I      +NAIILDFF GS TT HAV  +N       N KFIL    E   +   K +A    F+++  + K  I+ +G+     + D+ K   D+  K F ++ +++
  S:   344 QRKRFLSEALDRGKVTKTWWDDVGATTNGTTLVKNLFNNSSVFTNPKPVDLIEKMIQLGDHTKNAIILDFFGGSSTTAHAVFNVNI--NYNRNNKFILVQLPELINE---KEVAYQQGFKKITEIGKERIRRAGKKIAEENPDKAKDL-DLGFKVFKLDSSNI 500
>gi|109947284|ref|YP_664512.1| methyltransferase fragment 2 [Helicobacter acinonychis str. Sheeba] >gi|109714505|emb|CAJ99513.1| methyltransferase fragment 2 [Helicobacter acinonychis str. Sheeba] (186 aa)
Score = 169, Expect = 3.7e-10, Identities = 46/79 (58%), Positives = 56/79 (70%)
  Q:   243 FPNPKPVELIKFLINK-HSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           F NPKPV LI  L+    ++EN IILDFFAGSGTTGHAV+ELN   +  GNR+FIL TN E T+ + N  IA D+  +RL
  S:    28 FKNPKPVTLIINLLKMIKTDENDIILDFFAGSGTTGHAVLELNR--QDGGNRQFILATNNEITEMNPNG-IAYDVTTKRL 104
>gi|145640734|ref|ZP_01796317.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae R3021] >gi|145274660|gb|EDK14523.1| twin-argninine leader-binding protein DmsD [Haemophilus influenzae 22.4-21] (381 aa)
Score = 169, Expect = 4.6e-10, Identities = 50/110 (45%), Positives = 66/110 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-----AQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRK 111
           M  RL+ AK LL DDG+IF+  D NE  YL+VL+D+IF EDNF++NI     +      Q+  K I KN + IL Y KN  + KIN  + I K+K       I  +EDG L  +K
  S:   256 MKNRLEIAKTLLADDGVIFVHCDYNEDGYLRVLLDEIFTEDNFVANIAIRSNSISGNKTQHKEKTILKNKDTILVYKKN--SLKINPQYTI-KQKWDTHYNAILISEDGELKPKK 367
>gi|170766114|ref|ZP_02900925.1| DNA methylase N-4/N-6 domain protein [Escherichia albertii TW07627] >gi|170125260|gb|EDS94191.1| DNA methylase N-4/N-6 domain protein [Escherichia albertii TW07627] (709 aa)
Score = 168, Expect = 5.2e-10, Identities = 82/310 (26%), Positives = 155/310 (50%)
  Q:     1 MMSERLKKAKQLLKD-DGIIFISIDDNEQAYLKVLMDDIFGED--NFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNR-KNMGWTLYFNPATNE-----KIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIE----KIIPKMTKNGY-SLFYADEKEYKQVSHKSIVRFNINQ---------------------SIIDNISSSKGSNTLRKL--GIEFPNPKPV----ELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINK 310
           MM  RL+ AK LL   D ++ ++ID+ E   L +L++ +F E     IS+++  K +A+      +++   Y+         ++ + + E+++    +    +  N +G   +R  +M + ++ +  T +     + P +D  P  V                + +G V I P   NG  L W  S     E +     K  P+  K G  S++Y      +++    I+    +                      +++ + +S  G+  L+++  G  FP PK +    + ++F+++K   ENA+++DFF+GSGTT HAVM LN   +  G R+ I  TN E +  +  K
  S:   197 MMERRLEVAKLLLNPADSVLIVTIDEKEFLRLGLLLEQMFPEATIQMISSVINPKGSARTGRFSRVDEYIYYVFFGDAKVVPWRTDMLREVSENGRNVRWAGLMRNGEGSRRSRIPSMFFPIFIDKETGDYHSTGEPPPLDMKPSDVP---------------VPEGTVAIFPIDGNGQELMWRLSPSSFREYLSIGHAKFGPRNKKTGLRSVYYLQSGIRQKIKSGEIIATGRDSEGALELEFADSVGTRSPGTLWNMVSHSASEHGAGLLKRMIPGRRFPYPKSLYAVEDCLRFVLSK--KENAVVVDFFSGSGTTAHAVMRLNR--QDGGRRQCISITNNEVSADEQKK 529
>gi|163783394|ref|ZP_02178386.1| Adenine-specific DNA methylase [Hydrogenivirga sp. 128-5-R1-1] >gi|159881316|gb|EDP74828.1| Adenine-specific DNA methylase [Hydrogenivirga sp. 128-5-R1-1] (908 aa)
Score = 168, Expect = 5.2e-10, Identities = 85/297 (28%), Positives = 142/297 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLI----QMTIGANE-------DGLLVNRKNMGWTLYFNPATNE-KIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKL----GIEFPNPKPVELIKFLINKHS--NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           +M  RL  AK  L  DGII +SIDDNE   LK ++   F E+   + ++      ++  K +  +HEY + ++K+ K      V ++ + + Q+     Q   GA E        GL      M + +Y N      +IP M +     E++   E L + + +      V + P  ++G   RW W+ ++ +    ++     + G    Y   +  + ++  +           +  ++  G+  L+ L    GI F  PK V L+   I   S  ++NA +LDFFAGSGTT HAV+ LN +    G RK+IL
  S:   450 LMDNRLALAKDFLCHDGIICVSIDDNEVIRLKEILGLYFSEE-VATCVIRSNPAGRSTPKGVSVSHEYAVFFAKSEKVV----VGKLQRNENQIARYREQDEKGAFEWVNFRKHGGLKEEAPRMYYPIYINKTGRTWRIPRMRW----CEKNKVWEILEEPNPDE-----VVVWPTDEHGQPRRWKWTPERLMASRNEVKVDYDRFGQLTLYIKSRMPEGITPSTW------WDRPEYSATDYGTRGLKDLFGYHGI-FSYPKAVNLVMDCIRVSSGNSDNAFVLDFFAGSGTTAHAVINLNRE--DGGKRKYIL 741
>gi|170017230|ref|YP_001728149.1| site-specific DNA-methyltransferase [Leuconostoc citreum KM20] >gi|169804087|gb|ACA82705.1| Site-specific DNA-methyltransferase [Leuconostoc citreum KM20] (610 aa)
Score = 168, Expect = 5.7e-10, Identities = 34/77 (44%), Positives = 51/77 (66%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKN 78
           + +RL   +++L DDG IF+ +D ++  Y+KVLMD+IFGE NF+++IVW  R  +  N    K H+ IL YSK  K+
  S:   148 LRKRLILLREILADDGNIFVHLDWHKMHYVKVLMDEIFGEANFVNDIVWSYRTGRGGNSEFNKQHDDILFYSKQQKH 224
>gi|188994727|ref|YP_001928979.1| DNA methylase N-4/N-6 [Porphyromonas gingivalis ATCC 33277] >gi|188594407|dbj|BAG33382.1| DNA methylase N-4/N-6 [Porphyromonas gingivalis ATCC 33277] (544 aa)
Score = 167, Expect = 7.3e-10, Identities = 74/262 (28%), Positives = 116/262 (44%)
  Q:    16 DGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKG-QLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKD--DKEIIDKGFVPIRPPIKNGVLLRWSWSFDKA-----IERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSK----GSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           DG+IFISIDD+E  YLKV+ D++F   N+  + +W+ KR     N  +    EY+L Y+++ K       F I    G +   +    N  G+LV   +   +LYF       I   D+     E ++++  L  D   K+  +           N V +   W + +A     I+  E  I K  K      ++  K   +  H  + R ++N S  ++ +       G N        F  PKP  LI  LI   +    ++LD F GSGTT 
  S:   106 DGVIFISIDDDECHYLKVICDEVFLRVNYCGSFIWEKKRKPSFLNSQMGSVTEYVLCYARDRKRL---SPFSIETTSGDETYPLYNSGNSRGILVFPPH---SLYFPKLNVGVIKAQDF-----EEETSLVTLLNDCEVKQYWN----------TNEVQIEGEWRYSQASINEQIQNGEHYIIKSKKFRPRRVFSTSK--AKTMHNLLSRAHVNMSTYEDATKESINLFGDNA-------FDYPKPEMLISVLIQCATQPGDLVLDSFLGSGTTA 350
>gi|189461561|ref|ZP_03010346.1| hypothetical protein BACCOP_02220 [Bacteroides coprocola DSM 17136] >gi|189431671|gb|EDV00656.1| hypothetical protein BACCOP_02220 [Bacteroides coprocola DSM 17136] (281 aa)
Score = 166, Expect = 1.0e-09, Identities = 37/80 (46%), Positives = 51/80 (63%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK---NWKNFK 80
           MM  RL  AK LL D G IF+++DD+E    + LMD+IFGE +FIS ++W+    +++   I   H YIL YSK    WKN +
  S:   183 MMYPRLMVAKSLLSDSGSIFLTLDDHEIVNGRKLMDEIFGEKSFISTVIWENFYGRSNAAAISLAHNYILIYSKAGEEWKNIR 265
>gi|115289051|gb|ABI85537.1| M.Hin1056ModP-6 [Haemophilus influenzae] (351 aa)
Score = 165, Expect = 1.2e-09, Identities = 38/83 (45%), Positives = 53/83 (63%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA---QNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           M  RL+ A++LL DDG+IF+  DDNEQAYLKVLMD+IFG +NFI  I    ++A     D +      E  + YSK+  + + N +
  S:   256 MKNRLEVARELLSDDGVIFVQCDDNEQAYLKVLMDEIFGRENFICCITCKVKSAGGLTTDTEMFFDCAENFIVYSKSIDSLQYNSI 341
>gi|194335498|ref|YP_002017292.1| DNA methylase N-4/N-6 domain protein [Pelodictyon phaeoclathratiforme BU-1] >gi|194307975|gb|ACF42675.1| DNA methylase N-4/N-6 domain protein [Pelodictyon phaeoclathratiforme BU-1] (581 aa)
Score = 164, Expect = 1.6e-09, Identities = 87/277 (31%), Positives = 134/277 (48%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIE----KNHEYILAYSKNWKNFKINQVFEINKKK----GQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYS----------LFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           ++ +R+   + L+ +DG +F+ IDDNE  YL VL+D+IFG  N I+ +V  K+ A   +K I         +I+ Y+KN   +K N+VF    K+    GQ I      N D      + +  T  F  + N  I  +    KK   DS  E L  D         V +  P  + V        D + +  E  I ++ +  +S          LFY+D  + K +  K +    +  +I D++ S   +N   + GIEFP   KP  LIK      + +  ++LD FAGSGTTG
  S:    99 LIRDRIDIIRNLISEDGTLFVHIDDNELGYLIVLLDEIFGRQNRIT-VVSFKQGAATGHKAINPGVVSTSNFIVLYAKNKTLWKPNRVFTARNKRDTRYGQFID-----NFDAPYAQWRFITLTQAFARSLNLPIRGL----KKAVGDS-YEALLSDFVVANAPRVVRLARPDYDAVSGDARSMIDASHKTSE--ILRLEREEFSDMFFVAGERILFYSD--KLKLIDGKYVAGEPLT-TIWDDLLS---NNIHNEGGIEFPKGKKPEALIKRCFELATIDGDLVLDSFAGSGTTG 375
>gi|115289081|gb|ABI85557.1| M.Hin1056ModP-5 [Haemophilus influenzae] (422 aa)
Score = 163, Expect = 2.0e-09, Identities = 38/74 (51%), Positives = 50/74 (67%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY-IEKNHEYILAYSKN 75
           M  RL  AK+LL DDGII ISIDD+  AYLK+L+D+IFG +NFI N+        N+++Y     HEY L ++KN
  S:   280 MKNRLLIAKELLTDDGIIVISIDDDGNAYLKILLDEIFGFENFIGNLPTIMNLKGNNDEYAFSGTHEYTLVFAKN 354
>gi|154148728|ref|YP_001406581.1| adenine specific DNA methyltransferase [Campylobacter hominis ATCC BAA-381] >gi|153804737|gb|ABS51744.1| adenine specific DNA methyltransferase [Campylobacter hominis ATCC BAA-381] (227 aa)
Score = 162, Expect = 2.8e-09, Identities = 46/81 (56%), Positives = 56/81 (69%)
  Q:   241 IEFPNPKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           + F  PKPV+LIK +IN   +SN+N IILDFFAGSGTT HAVMELN++    GNRKFIL    E+  +  +KT A D C   L
  S:     6 VVFDYPKPVKLIKQMINLYTNSNDNDIILDFFAGSGTTVHAVMELNAE--DGGNRKFILMQINEKIDEQKSKT-AYDFCKNEL 85
>gi|168135202|ref|ZP_02578431.1| adenine specific DNA methylase [Bacillus cereus B4264] (531 aa)
Score = 161, Expect = 3.2e-09, Identities = 38/94 (40%), Positives = 63/94 (67%)
  Q:     1 MMSERLKKAKQLL-KDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFK-INQVFEINKKKGQL 94
           M+  RLK   +LL    G+IFISID+NE A LK++ ++IFG + +++ I W KR ++ + + I   HEYIL Y+K+ K FK    + E+++K+ ++
  S:   117 MIYPRLKLLNKLLDTKKGVIFISIDENEYANLKLICNEIFGSNCYVATIAWQKRYSRENRQAIGDVHEYILIYAKDKKYFKETRNLIEMDEKQSKV 212
Score = 130, Expect = 1.5e-05, Identities = 32/63 (50%), Positives = 42/63 (66%)
  Q:   240 GIEFPNPKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           G +F  PKP +LI+ +I      +EN IILD F+G+GTT HAV+ +N   K  GNRKFIL   E+
  S:   326 GTQFDTPKPSQLIERIIRIATSKDENDIILDSFSGTGTTAHAVLNINK--KDGGNRKFILVEMED 388
>gi|169173492|ref|ZP_02835436.1| DNA methylase N-4/N-6 domain protein [Arthrobacter chlorophenolicus A6] >gi|169017732|gb|EDS64208.1| DNA methylase N-4/N-6 domain protein [Arthrobacter chlorophenolicus A6] (622 aa)
Score = 161, Expect = 3.5e-09, Identities = 31/74 (41%), Positives = 50/74 (67%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           M +RL  AK LLK  G+I ++I D+E   L+ L D I GE+NFIS++VW     +ND+++I  + +Y+L Y+++
  S:   142 MEKRLLIAKTLLKPTGVIVMAIGDDEHHRLRSLSDQIIGEENFISSVVWSG-GRKNDSRFISNSADYMLVYARS 214
Score = 128, Expect = 2.1e-05, Identities = 29/68 (42%), Positives = 41/68 (60%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINK 310
           FP PK   ++   I   + ++A++LDFF GSGTT  AV+ LN++    G R+ IL TN E +K D  K
  S:   386 FPFPKDRTVLSRWIGLIAPKDAVVLDFFGGSGTTAEAVIRLNAE--DGGTRQTILVTNNELSKADDTK 451
>gi|115289045|gb|ABI85533.1| M.Hin1056ModP-7A [Haemophilus influenzae] (342 aa)
Score = 160, Expect = 4.2e-09, Identities = 41/81 (50%), Positives = 53/81 (65%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-----AQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           M  RL+ AK LL DDG+IF+  D NE  YL+VL+D+IF EDNF++NI     +      Q+  K I KN + IL Y KN  + KIN
  S:   256 MKNRLEIAKTLLADDGVIFVHCDYNEDGYLRVLLDEIFTEDNFVANIAIRSNSISGNKTQHKEKTILKNKDTILVYKKN--SLKIN 339
>gi|38233404|ref|NP_939171.1| putative DNA methylase [Corynebacterium diphtheriae NCTC 13129] >gi|38199664|emb|CAE49323.1| Putative DNA methylase [Corynebacterium diphtheriae] (667 aa)
Score = 160, Expect = 4.6e-09, Identities = 31/75 (41%), Positives = 51/75 (68%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN 75
           MM +RL   K+LL +DG I++ +DD E   +++LMD++FG  NF++ +VW+K  + +ND+K I    + IL Y K+
  S:   132 MMRDRLLHMKKLLSEDGSIWVHLDDVENHRMRLLMDEVFGAGNFVAEVVWEKTYSPRNDSKGIPAVTDTILVYRKS 207
>gi|192360125|ref|YP_001982060.1| hypothetical protein CJA_1580 [Cellvibrio japonicus Ueda107] >gi|190686290|gb|ACE83968.1| hypothetical protein CJA_1580 [Cellvibrio japonicus Ueda107] (280 aa)
Score = 159, Expect = 5.3e-09, Identities = 35/75 (46%), Positives = 47/75 (62%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           MM  RLK A+ LL DDG+IFISIDDNE   LK L +++FGE NFI       + + N   +   N +Y+L Y++N
  S:   148 MMYPRLKLARNLLTDDGVIFISIDDNEVDNLKKLCNEVFGEKNFIGCAGRITKKSNNKGDFWAPNFDYLLTYTRN 222
>gi|54296174|ref|YP_122543.1| hypothetical protein lpp0197 [Legionella pneumophila str. Paris] >gi|53749959|emb|CAH11344.1| hypothetical protein [Legionella pneumophila str. Paris] (646 aa)
Score = 159, Expect = 6.1e-09, Identities = 102/379 (26%), Positives = 179/379 (47%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ--NDNKYIEKNHEYILAYSKNWKNFKINQVF---EINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERI---EKIIPKMTKNG--YSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKT--IAKDIC-FERLYCLIKNIKTSG------ESFNNLSVDELKKYQDVSLKTFNINYADVSIN-SNIDK--LLEEIKKSMR 379
           MM +RL   K LL ++G +++  D      L+ ++++IFGE+NFI+ I+W ++ AQ  + N++   N + IL Y+K  K++  N  F   + N KK  L                              E+    D D +K  +   +  L + +   +   F  ++PP K G    W +S ++  E     E ++P+  KN   Y   Y D  + + +           Q+I  +I      N + K  + +P  KP+ L++ +I   SN   +I DFF GSGT G A  +L          +F + T+ +R   DIN T  I +++  +ER + +  N + +G      E +     +EL +    + KT +    DV I+  N+D    L EI+++++
  S:   123 MMYDRLSIMKDLLAENGCLYVHCDWRVNYLLRFILNEIFGEENFINEIIWRRKQAQSWSANQFGVTN-DSILLYTKG-KDYIFNPSFSKDDENTKKYIL------------------------------ERFKFDDGDGRKYMKSPLVNPLNRPN---LRYEFHGVKPP-KTG----WLYSMERMEEMFANNELVMPE-DKNARIYRKIYEDTYQGQMI-----------QNIWLDIPI---VNPMAKERVNYPTQKPIALLERIITTSSNTGDLIADFFCGSGTAGLAAEKLGRRWIMVDLGRFAIHTSRKRL-LDINSTPFIVQNLGKYERQHWVKMNGQYTGYLKFILELYGAGVTEELVRQFRQAFKTLHGKKGDVYIHIGNVDAPVTLLEIREALQ 467
>gi|82703297|ref|YP_412863.1| site-specific DNA-methyltransferase (adenine-specific) [Nitrosospira multiformis ATCC 25196] >gi|82411362|gb|ABB75471.1| Site-specific DNA-methyltransferase (adenine-specific) [Nitrosospira multiformis ATCC 25196] (673 aa)
Score = 158, Expect = 6.7e-09, Identities = 34/104 (32%), Positives = 63/104 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGA----NEDG 105
           + +RL   + LL D+G++++ +D  +  Y+KV++D+IFGE NF++ + W     +   ++  + H+ IL Y+KN+K+ +   VF   +  GQ  Q T+      +EDG
  S:   141 LRKRLILIRDLLSDNGLLYVHLDYRKSHYIKVILDEIFGEQNFMNEVAWCYGERELATRHWNRKHDNILVYAKNFKSDQ--HVFNWKEAAGQYSQGTLAKYEHIDEDG 246
>gi|196235080|ref|ZP_03133884.1| Site-specific DNA-methyltransferase (adenine-specific) [Thermus aquaticus Y51MC23] >gi|196221036|gb|EDY15651.1| Site-specific DNA-methyltransferase (adenine-specific) [Thermus aquaticus Y51MC23] (530 aa)
Score = 158, Expect = 7.8e-09, Identities = 28/63 (44%), Positives = 44/63 (69%)
  Q:    16 DGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKN 78
           DG +++SIDDNE    ++L+D+IFG  NF++ ++W K+ + QND  Y    H+YIL Y+K  K+
  S:   125 DGSLWMSIDDNEVHRARMLLDEIFGSQNFVATLIWQKKYSTQNDAIYFSDMHDYILVYAKRKKS 188
Score = 140, Expect = 8.4e-07, Identities = 34/82 (41%), Positives = 50/82 (60%)
  Q:   240 GIEFPNPKPVELIKFLINKHSN--ENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERL 321
           G +FP PKP  L++ ++   +N  +  I+LD FAGSGTTGHAV++ N+     GNR+FIL         +++  IA+ I   RL
  S:   326 GEDFPTPKPTRLLQRILQIATNPHDGDIVLDSFAGSGTTGHAVLKQNA--ADGGNRRFILV--------ELDPHIARSITRRRL 399
>gi|108563753|ref|YP_628069.1| putative type III restriction enzyme M protein [Helicobacter pylori HPAG1] >gi|107837526|gb|ABF85395.1| putative type III restriction enzyme M protein [Helicobacter pylori HPAG1] (569 aa)
Score = 158, Expect = 7.8e-09, Identities = 46/110 (41%), Positives = 68/110 (61%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD----KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQM-TIGANEDGLLVNRK 111
           M  RL+ A++ L DDG I+I++D NE  Y KVLMD+IFG +NF   I+W          + N +I +NH+ IL YSKN      N+ +  NK   +LI++  I +N D L ++R+
  S:   218 MKNRLEVAREFLSDDGSIYINLDYNEVHYCKVLMDEIFGVENFQREIIWRIGWLSGYKTSINNFI-RNHDTILFYSKNADKLFFNKKYIENKDFKELIKIEKIQSNLDNLGIDRE 331
>gi|153833514|ref|ZP_01986181.1| type III restriction-modification system methylation subunit [Vibrio harveyi HY01] >gi|148870165|gb|EDL69106.1| type III restriction-modification system methylation subunit [Vibrio harveyi HY01] (1030 aa)
Score = 158, Expect = 8.4e-09, Identities = 70/284 (24%), Positives = 128/284 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATN---EKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTL--RKLGIE-FPNPKPVELIK--FLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           +M+ RL+ +  LL DDG+  ++IDD+E   L  +M+ +  +++ ++ +        +  K   + HEY L  +       I +  E N    ++ +      E+ L   R+   + +Y          K+P  D+ P+        +N+ KDD      G + + P  +NG+  RW++  D   + + ++        Y LF   E+   +                    + K  N+L    LG + F  PK + L+K    I+  + ++ +I+D+FAGSGTT HAV+E N
  S:   519 LMANRLELSMSLLSDDGVKAVAIDDSEVMNLSKIMESL-SDEHRLTRVTVVHNPKGSITKDFNRTHEYCLFLTNENDKEAIGRTLEKNDTPRKMRRW----GENSLRTERRLSFYPIYVRDGEVVGIGKVPHDDFHPEG-------KNVLKDD------GVIEVWPIDQNGIERRWNFGLDSIEQNLSRVAVIEKSGEYDLFLTHEQSVPKTVWSG-----------GEYDAGKWGNSLLISMLGEKRFDFPKSINLVKRCIEISTQNKKSPLIIDYFAGSGTTAHAVIEHN 781
>gi|163845918|ref|YP_001633962.1| DNA methylase N-4/N-6 domain-containing protein [Chloroflexus aurantiacus J-10-fl] >gi|163667207|gb|ABY33573.1| DNA methylase N-4/N-6 domain protein [Chloroflexus aurantiacus J-10-fl] (400 aa)
Score = 157, Expect = 9.3e-09, Identities = 51/138 (36%), Positives = 73/138 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQM--TIGANEDGLLVNRKNMGWTLYFNPATNEK--IPLMD------YDPKKVER 139
           M E L + K++LKD G IF+  D +   +L+VL+D IFG ++F S I+W  R   N  K +   H+ I  YSK  +NFK N +F        + Q+      NE G  V R++    +    A  EK  +PL D       +PK  ER
  S:    62 MREVLIQCKRVLKDTGSIFVHCDRSASHHLRVLLDQIFGPEHFQSEIIWTYRRWSNSKKGLLPAHQTIYFYSKT-ENFKFNVLFTDYSPTTNIDQILQARARNEKGKSVYRRDQHGNIV---AGKEKKGVPLSDVWYIPFLNPKAKER 205
>gi|74318294|ref|YP_316034.1| adenine specific DNA methylase [Thiobacillus denitrificans ATCC 25259] >gi|74057789|gb|AAZ98229.1| adenine specific DNA methylase [Thiobacillus denitrificans ATCC 25259] (559 aa)
Score = 157, Expect = 1.1e-08, Identities = 27/60 (45%), Positives = 43/60 (71%)
  Q:    15 DDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSK 74
           DDG I++SIDDN    L+ L+D+IFG  NF++ ++W+K ++ +N  +    +H+YIL YSK
  S:   153 DDGSIWVSIDDNASGLLRPLLDEIFGGANFVATVIWEKADSPRNSARQFSTDHDYILVYSK 213
Score = 137, Expect = 2.1e-06, Identities = 31/81 (38%), Positives = 47/81 (58%)
  Q:   221 QSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNE 301
           +++  N SS      +      F  PKP  LI+ +I   ++ + I+LD FAGSGTTGHAVM+LN+  +  G R+F++   E
  S:   324 EAVGSNRSSKNEQRAIFAGTASFDTPKPSALIERVIQIAASSSDIVLDSFAGSGTTGHAVMKLNA--QDSGARRFVMIETE 402
>gi|68535597|ref|YP_250302.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium jeikeium K411] >gi|68263196|emb|CAI36684.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium jeikeium K411] (614 aa)
Score = 156, Expect = 1.4e-08, Identities = 29/78 (37%), Positives = 50/78 (64%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYS---KNWKN 78
           MM +RL   ++LL  DG I++ +DD E   ++VLMD++FG  +F+  +VW+K   + ++  I   +++IL Y+     WKN
  S:   134 MMRDRLIHLRKLLSADGSIWVHLDDVENHRMRVLMDEVFGAGSFVGEMVWEKDKGRRNDTGISGANDFILVYAPMGNQWKN 214
>gi|148264781|ref|YP_001231487.1| DNA methylase N-4/N-6 domain-containing protein [Geobacter uraniireducens Rf4] >gi|146398281|gb|ABQ26914.1| DNA methylase N-4/N-6 domain protein [Geobacter uraniireducens Rf4] (609 aa)
Score = 156, Expect = 1.5e-08, Identities = 34/75 (45%), Positives = 49/75 (65%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIF-GEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKN 75
           MM  RL    +LL DDG++F++IDDNEQ  L+ ++D++F  ED F S+I W K+ A  ND K      ++IL Y K+
  S:   118 MMWPRLNLLHELLADDGVLFVTIDDNEQHRLRDILDEVFHSEDAFYSHIAWQKKYATSNDAKGFSTMFDHILVYRKS 194
Score = 148, Expect = 1.1e-07, Identities = 32/63 (50%), Positives = 41/63 (65%)
  Q:   240 GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           G EF  PKP  L+  ++   ++EN+IILD FAGSGTT HAV+  N   K  GNR+F+L   EE
  S:   330 GTEFFTPKPTRLLSRILEIATDENSIILDSFAGSGTTAHAVLAANQ--KDGGNRRFMLIECEE 390
>gi|161870247|ref|YP_001599417.1| type III restriction/modification system modification methylase [Neisseria meningitidis 053442] >gi|161595800|gb|ABX73460.1| type III restriction/modification system modification methylase [Neisseria meningitidis 053442] (371 aa)
Score = 155, Expect = 1.6e-08, Identities = 42/96 (43%), Positives = 60/96 (62%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-------KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQM 97
           M  RL+ A++LL DDG I+I++D +E  Y KVLMD+IFGE NF   I+W        K    N   YI +NH+ IL YSK++ +   N+ +  NK    L+ +
  S:     1 MKNRLEIARELLADDGAIYINLDYHEVHYCKVLMDEIFGEYNFQREIIWRIGWVSGYKTTVSN---YI-RNHDTILFYSKDYNHLNFNKYYIDNKHFKVLVDL 99
>gi|163785315|ref|ZP_02179963.1| DNA methylase N-4/N-6 domain protein [Hydrogenivirga sp. 128-5-R1-1] >gi|159879418|gb|EDP73274.1| DNA methylase N-4/N-6 domain protein [Hydrogenivirga sp. 128-5-R1-1] (386 aa)
Score = 155, Expect = 1.6e-08, Identities = 34/55 (61%), Positives = 45/55 (81%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           F NPKP+ELI+ ++   SN N++ILDFFAGSGTT HAVM+LN++   +G+RKFIL
  S:   115 FDNPKPIELIEKVLRISSNPNSLILDFFAGSGTTAHAVMKLNNE--DRGDRKFIL 167
>gi|167851675|ref|ZP_02477183.1| Site-specific DNA-methyltransferase (adenine-specific) [Burkholderia pseudomallei B7210] (663 aa)
Score = 155, Expect = 1.6e-08, Identities = 29/79 (36%), Positives = 47/79 (59%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNF 79
           M+  RL  AK LL  DG+   SIDD E   L++L D+IFGE+NF++ + W      ++   ++  HEY++ Y+++   F
  S:   179 MLYPRLILAKSLLSTDGLFICSIDDCEAPRLRMLCDEIFGEENFLAQLTWRSDGNFDNQAKVKVCHEYVVMYARDLDAF 257
Score = 151, Expect = 5.7e-08, Identities = 50/142 (35%), Positives = 76/142 (53%)
  Q:   231 KGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCT-----NEERTKQD----------INKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYADVS--INSNIDKLLE 372
           K +  L  LG+ F   PKPVEL+ +LI    + + I LDFFAGSGT GHAV+  N+     G R+F++       N E+  Q           + K IA +I  ER     K +KT    F       + K    +++ +N   +D +  + S+ + L+E
  S:   400 KAAGQLSDLGVAFDGYPKPVELLSYLIQMVESRDGIFLDFFAGSGTLGHAVLRQNA--LDGGKRRFVMAQLPEPLNSEQESQKEAAALCASLGVPKNIA-EITKERTRRAAKKVKTENPLFGGDLGFRVYKLDSSNIRAWNPRQSDTTAALLSHAEHLIE 556
>gi|167457157|ref|ZP_02323372.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter dehalogenans 2CP-1] >gi|167416606|gb|EDR83319.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter dehalogenans 2CP-1] (520 aa)
Score = 154, Expect = 2.2e-08, Identities = 33/73 (45%), Positives = 47/73 (64%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK 74
           M+ RL   ++L+KD G+IF+SI+D E   L +LMD+IF E N I  + W K +A N+   I   HEY+L Y+K
  S:    63 MAPRLAMIRELMKDTGVIFVSINDIELFRLGMLMDEIFDEKNRIGIVCW-KGSADNNPSRIAIEHEYVLCYAK 134
Score = 147, Expect = 1.5e-07, Identities = 35/72 (48%), Positives = 48/72 (66%)
  Q:   226 NISSSKGSNTLRKLGIE----FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           ++ + KG+ TL+ L  +    F  PKPVELI+ L+     ++A++LD FAGSGTT HAVM LN      G R+FIL
  S:   279 SLDARKGAYTLKALFGDKFDGFDYPKPVELIELLVGAAGGKDALVLDAFAGSGTTAHAVMRLNK--IDGGRRRFIL 352
>gi|192362123|ref|YP_001982061.1| type III restriction-modification system methyltransferase [Cellvibrio japonicus Ueda107] >gi|190688288|gb|ACE85966.1| type III restriction-modification system methyltransferase [Cellvibrio japonicus Ueda107] (278 aa)
Score = 154, Expect = 2.3e-08, Identities = 38/76 (50%), Positives = 48/76 (63%)
  Q:   232 GSNTLRKLGIEFPNPKPVELIKFLIN-KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD 307
           GS+ L +L I F   KP  LIK+L+       N IILDFFAGS TT HAVM+LN++    GNR+FI+    E T +D
  S:    21 GSHELGELNIPFDYSKPSTLIKYLMEVSKVRNNDIILDFFAGSATTAHAVMQLNAE--DNGNRRFIMVQLPEPTPED 95
>gi|170783324|ref|YP_001711658.1| putative restriction-modification system methyltransferase [Clavibacter michiganensis subsp. sepedonicus] >gi|169157894|emb|CAQ03103.1| putative restriction-modification system methyltransferase [Clavibacter michiganensis subsp. sepedonicus] (391 aa)
Score = 153, Expect = 2.7e-08, Identities = 26/69 (37%), Positives = 46/69 (66%)
  Q:    12 LLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYS----KNWKNFK 80
           LL  D  +++ +DD+EQ   +V+MD++FG + F+S I+W KR ++++ K     H+YI  Y+    K+WK  +
  S:   114 LLAPDASVWLHLDDSEQHRARVVMDEVFGREAFVSTIIWQKRKSRDNRKAFSSMHDYIHVYALSGPKSWKRVR 186
>gi|145629606|ref|ZP_01785403.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae 22.1-21] >gi|144978117|gb|EDJ87890.1| putative type III restriction-modification system methyltransferase [Haemophilus influenzae 22.1-21] (298 aa)
Score = 153, Expect = 2.8e-08, Identities = 55/159 (34%), Positives = 83/159 (52%)
  Q:   243 FPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIK-NIKTSGESFNNLSVDELKKYQDVSLKTFNIN-YADVSINSNIDKLLEEIKKSMRLIHRDFDINNESIIKQLYSLFT 401
           F  PK ++LIK LI +   N N +ILDFFAGSGTT HAVM+LN++ +  GNRKFI     E T +   K+ A    ++ ++ + K  I+ S         D  +   D+  K F    +   ++N++ D  ++ + K         D+NNE    QL+ L T
  S:    57 FDFPKSIQLIKQLIEQAILNPNDLILDFFAGSGTTAHAVMQLNAEDEDNGNRKFICVQLPEPTDE---KSEAYKAGYKTIFDITKARIEKSAVKIRQ---DFKETTADLGFKIFKTEPHFQTTLNTDFDPQIDFLPK--------IDLNNE----QLHQLLT 200
>gi|116334205|ref|YP_795732.1| adenine specific DNA methylase Mod [Lactobacillus brevis ATCC 367] >gi|116099552|gb|ABJ64701.1| Adenine specific DNA methylase Mod [Lactobacillus brevis ATCC 367] (289 aa)
Score = 152, Expect = 3.6e-08, Identities = 37/74 (50%), Positives = 45/74 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKN 75
           M  RL  AKQLL D GIIFISIDDNE + L +LM+ IFGE  F    +W K       +KY  +  EY+L + KN
  S:   176 MYPRLVLAKQLLSDKGIIFISIDDNENSDLGLLMNTIFGERQFKVQFIWTKTETPPALSKYSRRTTEYVLTFEKN 250
>gi|162450105|ref|YP_001612472.1| hypothetical protein sce1834 [Sorangium cellulosum 'So ce 56'] >gi|161160687|emb|CAN91992.1| hypothetical protein [Sorangium cellulosum 'So ce 56'] (611 aa)
Score = 152, Expect = 4.0e-08, Identities = 28/75 (37%), Positives = 46/75 (61%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           MM+ER+ +  ++LK  G +++  D     YLK+++D IFG DNF + IVW +  A+ND     + H+ I  Y+K+
  S:   155 MMAERIVELHRVLKRTGSLYLHCDPTASHYLKLVLDAIFGPDNFRNEIVWQRSTAKNDPSRYGRCHDIIFFYTKS 229
>gi|116334202|ref|YP_795729.1| adenine specific DNA methylase Mod [Lactobacillus brevis ATCC 367] >gi|116099549|gb|ABJ64698.1| Adenine specific DNA methylase Mod [Lactobacillus brevis ATCC 367] (283 aa)
Score = 152, Expect = 4.2e-08, Identities = 38/78 (48%), Positives = 53/78 (67%)
  Q:   227 ISSSKGSNTLRKLGIE--FPNPKPVELIKFLIN--KHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           +++  G+  L +L ++  F NPKP  LIK+LIN   H + +  ILDFFAGS TT  AVM+LN++    GNRKFI+    E+T
  S:     1 MTNEDGAKRLVELDLKDMFTNPKPTSLIKYLINIVGHEHPDITILDFFAGSSTTADAVMQLNAE--DGGNRKFIMVQLPEKT 80
>gi|172041475|ref|YP_001801189.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium urealyticum DSM 7109] >gi|171852779|emb|CAQ05755.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium urealyticum DSM 7109] (664 aa)
Score = 151, Expect = 5.0e-08, Identities = 31/89 (34%), Positives = 51/89 (57%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINK 89
           MM +RL   K+LL DDG I++ +DD E   ++VLMD++FG  NF + IVW K ++         + ++++ Y +       ++ FE NK
  S:   132 MMRDRLLHMKKLLADDGSIWVHLDDVEVHRMRVLMDEVFGAGNFQAEIVWQKADSPRRGLGFSVDQDFVIVYRR-------SEAFEPNK 213
Score = 91, Expect = 5.1e-01, Identities = 22/62 (35%), Positives = 32/62 (51%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           F  PKP  L++ +I+  SN   I+LD FAGSGTT     ++         R+++ C   E T
  S:   394 FDTPKPERLLERIIHIGSNPGDIVLDVFAGSGTTAAVAQKM--------GRRWVTCELLEST 447
>gi|74317509|ref|YP_315249.1| adenine specific DNA-methyltransferase [Thiobacillus denitrificans ATCC 25259] >gi|74057004|gb|AAZ97444.1| adenine specific DNA-methyltransferase [Thiobacillus denitrificans ATCC 25259] (779 aa)
Score = 150, Expect = 6.8e-08, Identities = 86/347 (24%), Positives = 140/347 (40%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN----KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYD-PKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ 347
           M+ ERL   + LL DDG I++ +      Y+++  +++FG  N ++ I W + +A  D      +  +  E IL + K+              +KG          +D L  + K      Y    T E+  LM  D P    +     N Y D        F+        GV   W +SF+   +  E+    ++  G SL  + +K  K      +V      + I   SS +         +++P  KP  L++ +I   SNE  ++ DFF GSGTT  AV E       K  RK+I          D+ K        +R+  + + +K SG+ F    V  L +Y+
  S:   177 MVYERLILMRDLLADDGSIYVHMGKTVAHYVRLACEEVFGSANIVNEITWKRSHAHGDTGQGASHFGRTTETILLFRKS--------------EKGIWNPQHKPYTDDVLARDYK------YTEEKTGERYRLMPVDGPGGAAKG----NPYYD--------FL--------GVKGYWRYSFETMTKLYEQGEIVLSSTGKSL--SRKKFLKDAEGTPVVDLWDEVNRISPTSSER---------LDYPTQKPEALLERIIKASSNEGDLVADFFCGSGTTA-AVAE-------KLGRKWI--------ATDLGK-FGVHTTRKRMIGVQRQLKDSGKPFRAFEVLNLGRYE 460
>gi|62424591|ref|ZP_00379735.1| COG2189: Adenine specific DNA methylase Mod [Brevibacterium linens BL2] (406 aa)
Score = 150, Expect = 7.0e-08, Identities = 37/76 (48%), Positives = 46/76 (60%)
  Q:   227 ISSSKGSNTLRKLGIE--FPNPKPVELIKFLINKHS--NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           I +  G N L  LG+   F  PKPVEL+K L+   +  +  AI+LDFFAGSGTT  AVM  N   +  G+R FIL    E
  S:   278 IKALGGQNDLEDLGLGGIFSYPKPVELVKTLVASQTFFDPGAIVLDFFAGSGTTAQAVMAANE--RDAGSRTFILIQTPE 355
Score = 145, Expect = 2.3e-07, Identities = 24/73 (32%), Positives = 47/73 (64%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK 74
           M+ RL  A++L+++DG+IFI +DD E A+ ++L  +IFGEDN +  ++  +     ++    + H+Y+  ++K
  S:   102 MTPRLMLARELMREDGVIFIHLDDGESAWAQLLGHEIFGEDNSLGTLIHQRAKGGGNSPSFVRGHDYVHVWAK 174
>gi|149007299|ref|ZP_01830957.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP18-BS74] >gi|147761103|gb|EDK68071.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP18-BS74] (325 aa)
Score = 149, Expect = 8.5e-08, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|148993008|ref|ZP_01822602.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP9-BS68] >gi|169834116|ref|YP_001694863.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae Hungary19A-6] >gi|147928209|gb|EDK79226.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP9-BS68] >gi|168996618|gb|ACA37230.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae Hungary19A-6] (396 aa)
Score = 149, Expect = 9.1e-08, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|168493334|ref|ZP_02717477.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC3059-06] >gi|183576799|gb|EDT97327.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC3059-06] (392 aa)
Score = 149, Expect = 9.6e-08, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|148984771|ref|ZP_01818024.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP3-BS71] >gi|149011671|ref|ZP_01832867.1| nicotinate phosphoribosyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|168483942|ref|ZP_02708894.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC1873-00] >gi|168486127|ref|ZP_02710635.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC1087-00] >gi|182684389|ref|YP_001836136.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae CGSP14] >gi|194398500|ref|YP_002038079.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae G54] >gi|18699604|gb|AAL78652.1|AF469000_1 XbaI methylase [Streptococcus pneumoniae] >gi|147764102|gb|EDK71034.1| nicotinate phosphoribosyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|147922793|gb|EDK73909.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP3-BS71] >gi|172042720|gb|EDT50766.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC1873-00] >gi|182629723|gb|ACB90671.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae CGSP14] >gi|183570735|gb|EDT91263.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC1087-00] >gi|194358167|gb|ACF56615.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae G54] (396 aa)
Score = 149, Expect = 9.6e-08, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|168491335|ref|ZP_02715478.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC0288-04] >gi|183574390|gb|EDT94918.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae CDC0288-04] (392 aa)
Score = 148, Expect = 9.8e-08, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|15903330|ref|NP_358880.1| type II DNA modification (methyltransferase [Streptococcus pneumoniae R6] >gi|116516980|ref|YP_816726.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae D39] >gi|15458929|gb|AAL00091.1| DNA modification methyltransferase [Streptococcus pneumoniae R6] >gi|116077556|gb|ABJ55276.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae D39] (392 aa)
Score = 148, Expect = 1.0e-07, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|148997514|ref|ZP_01825119.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP11-BS70] >gi|168489597|ref|ZP_02713796.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae SP195] >gi|168575894|ref|ZP_02721809.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae MLV-016] >gi|147756569|gb|EDK63610.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP11-BS70] >gi|183571882|gb|EDT92410.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae SP195] >gi|183578247|gb|EDT98775.1| DNA modification methyltransferase M.XbaI [Streptococcus pneumoniae MLV-016] (396 aa)
Score = 148, Expect = 1.0e-07, Identities = 39/113 (34%), Positives = 64/113 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMG 114
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F          + +   N D +LV RK  G
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIF---------TEYSSTTNIDQILVERKRNG 163
>gi|3211755|gb|AAC23743.1| unknown [Streptococcus pneumoniae] (92 aa)
Score = 148, Expect = 1.0e-07, Identities = 33/84 (39%), Positives = 54/84 (64%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           MS RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F
  S:     1 MSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIF 83
>gi|149019387|ref|ZP_01834749.1| nicotinate phosphoribosyltransferase [Streptococcus pneumoniae SP23-BS72] >gi|147931257|gb|EDK82236.1| nicotinate phosphoribosyltransferase [Streptococcus pneumoniae SP23-BS72] (332 aa)
Score = 148, Expect = 1.0e-07, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|189500097|ref|YP_001959567.1| Site-specific DNA-methyltransferase (adenine-specific) [Chlorobium phaeobacteroides BS1] >gi|189495538|gb|ACE04086.1| Site-specific DNA-methyltransferase (adenine-specific) [Chlorobium phaeobacteroides BS1] (644 aa)
Score = 148, Expect = 1.1e-07, Identities = 37/75 (49%), Positives = 50/75 (66%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEK---NHEYILAYSKN 75
           MM ERL  A+ LLKDDG+IFISID++E   L  +M++IFG +N +  ++W K   Q + K I +    HEYIL   KN
  S:   180 MMYERLVVARDLLKDDGVIFISIDEHELVSLAKIMEEIFGSNN-MDFLIWRKNGKQGNTKKINRFKITHEYILVGYKN 256
Score = 120, Expect = 1.9e-04, Identities = 28/55 (50%), Positives = 38/55 (69%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           F  PKP +++K L    + ++ IILDFF+GS TT  AVM+LNS+    GNRKFI+
  S:   387 FDTPKPTKILKELSRCSTEKDDIILDFFSGSATTAQAVMQLNSE--DGGNRKFIM 439
>gi|163756940|ref|ZP_02164047.1| DNA methylase N-4/N-6 domain protein [Kordia algicida OT-1] >gi|161323059|gb|EDP94401.1| DNA methylase N-4/N-6 domain protein [Kordia algicida OT-1] (639 aa)
Score = 148, Expect = 1.1e-07, Identities = 39/85 (45%), Positives = 55/85 (64%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN----HEYILAYSKNWKNFKINQVF 85
           +M +RL   K+ L+D G IFISID+ E  YL VLMDDIFG++N   NI+  KR +    K I        E+IL YS + +N+K N+++
  S:   166 LMRDRLTILKKTLQDSGTIFISIDNEELPYLMVLMDDIFGKENR-KNIITLKRGSATGAKVINPGLVNISEFILVYSNDIENWKPNKLY 253
>gi|149002824|ref|ZP_01827750.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP14-BS69] >gi|147759118|gb|EDK66112.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP14-BS69] (325 aa)
Score = 148, Expect = 1.1e-07, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGADMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|154244393|ref|YP_001415351.1| DNA methylase N-4/N-6 domain-containing protein [Xanthobacter autotrophicus Py2] >gi|154158478|gb|ABS65694.1| DNA methylase N-4/N-6 domain protein [Xanthobacter autotrophicus Py2] (696 aa)
Score = 148, Expect = 1.2e-07, Identities = 29/75 (38%), Positives = 47/75 (62%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           M++ RL   ++LL D G I+I ID +   Y+KV+ D+IFG  NF + I+W +  ++  ++Y    H+ IL Y+KN
  S:   148 MITPRLSLMRELLSDVGSIYIHIDRSVGPYVKVIADEIFGRYNFENEIIWRRTTSRGGSEYYNHVHDNILFYTKN 222
>gi|118578680|ref|YP_899930.1| DNA methylase N-4/N-6 domain-containing protein [Pelobacter propionicus DSM 2379] >gi|118501390|gb|ABK97872.1| DNA methylase N-4/N-6 domain protein [Pelobacter propionicus DSM 2379] (626 aa)
Score = 148, Expect = 1.2e-07, Identities = 38/94 (40%), Positives = 58/94 (61%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR----NAQNDNKYIEKNHEYILAYSKNWKNFKINQVF---------EINKKKGQL 94
           M+  RLK A+ LL +DG++FISI+  E A++  L D+IFGE+NF+ N+ W  R    N        +   EY++ Y K+ K  K   ++         EIN +K +L
  S:   169 MVYPRLKLARNLLSEDGVLFISINYRELAHVLRLCDEIFGEENFVGNVTWKARVKPVNIGEAKYRPQGETEYVVIYQKSDKEGKFQPLYTGGVRSYPHEINGRKYRL 275
Score = 128, Expect = 2.5e-05, Identities = 30/55 (54%), Positives = 37/55 (67%)
  Q:   243 FPNPKPVELIKFLINKHSN--ENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           F   KP  L+K LI   +N   N I++DFFAGSGTTGHAVM  NS     GNR+++L
  S:   374 FDTVKPTRLLKTLIQSITNPGNNEIVVDFFAGSGTTGHAVMAQNS--ADGGNRRYVL 428
>gi|148990531|ref|ZP_01821666.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP6-BS73] >gi|147924219|gb|EDK75317.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae SP6-BS73] (325 aa)
Score = 147, Expect = 1.3e-07, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGVDMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|15901283|ref|NP_345887.1| type II DNA modification methyltransferase, putative [Streptococcus pneumoniae TIGR4] >gi|14972920|gb|AAK75527.1| putative type II DNA modification methyltransferase [Streptococcus pneumoniae TIGR4] (396 aa)
Score = 147, Expect = 1.5e-07, Identities = 35/104 (33%), Positives = 60/104 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDG 105
           +S RL++ K++LK+ G IF+  D     ++++++D+IFG D F S I+W+ +   N  K +  NH+ I  YSK+ K+FK N +F        + Q+ +    DG
  S:    61 LSVRLEECKRVLKNSGSIFVHCDKIANHHIRLILDNIFGVDMFQSEIIWNYKRWSNSKKGLLNNHQNIYFYSKS-KDFKFNTIFTEYSSTTNIDQILVERKRDG 163
>gi|169173875|ref|ZP_02835819.1| DNA methylase N-4/N-6 domain protein [Arthrobacter chlorophenolicus A6] >gi|169018115|gb|EDS64591.1| DNA methylase N-4/N-6 domain protein [Arthrobacter chlorophenolicus A6] (374 aa)
Score = 147, Expect = 1.6e-07, Identities = 67/276 (24%), Positives = 119/276 (43%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPA--TNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEK--------IIPK-MTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTL-RKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           M+   L   +  L +DG IF+ +DD     ++ +MDD+FG+ N++  ++W+K+N  +  + ++    ++IL Y+K+              K   L+  +    +   + N+ N    L F PA       P        +   + + +L   D  I++ G         N    R +  F    E I K        I P+ M +  Y       +E K     ++  F +N S  +  + ++       ++G  F  PKP  L++ LI   +     +LD FAGSGTT
  S:    52 MLERTLTGVRDTLTEDGSIFVHLDDQYIHRVRCIMDDVFGDRNYVGTMIWEKKNRGSFLHAHLADVTDHILIYAKD------------KSKMAPLVHSSTEVGKRIPIHNKGNKPSVLEF-PAGCMTFNFPDQTIAAGPMNTPTIVSDLL--DDLIVENG--------TNKNSFRMTGPFRYGQEAINKMAETPGAFICPRQMLRPSYL-----SQESKGKVLTNLQSFRVNGSPTNEDARAESEAIFGTEMGSAFDTPKPEALLERLIAAATEPGDTVLDCFAGSGTT 312
>gi|150009567|ref|YP_001304310.1| adenine-specific DNA methylase [Parabacteroides distasonis ATCC 8503] >gi|149937991|gb|ABR44688.1| adenine-specific DNA methylase [Parabacteroides distasonis ATCC 8503] (654 aa)
Score = 145, Expect = 2.6e-07, Identities = 30/77 (38%), Positives = 45/77 (58%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWK 77
           M+  RL   ++LL D G I++ ID +  AY+KVLMDD+FG+DNF++NI+W             + ++ I  Y K  K
  S:   148 MLYPRLVLMRELLSDKGSIYVHIDWHVGAYVKVLMDDVFGKDNFVNNIIWHYGGPSPIKTAFARKYDIIYLYGKTLK 224
>gi|91215021|ref|ZP_01251993.1| type III restriction-modification system: methylase [Psychroflexus torquis ATCC 700755] >gi|91186626|gb|EAS72997.1| type III restriction-modification system: methylase [Psychroflexus torquis ATCC 700755] (652 aa)
Score = 145, Expect = 2.6e-07, Identities = 77/272 (28%), Positives = 128/272 (47%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRN-----AQNDNKYIEKNHEYILAYSKNWK-----------NFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           RL+ AK+LL DDG+IFI +D  E+AY+K++ D++F  +N+++ I             + +K I K  ++IL Y K  K           N+  +  + +N+ KG +        E+ +L  ++++      N  T+ K  L + +     +    E+L    K             +KN VL      F    E  E     M  NG  L    +  ++ + + SI++ +    + D        NT  +  + F N  KP EL+  +I   +NE  I+LDFF GSGTT
  S:   232 RLEIAKELLTDDGLIFIHLDQIEEAYMKIVCDEVFERENYVNTITVKSSTPSGTKTAHKDKTIIKQKDFILVYRKTNKARFNPQYKRKSNWDTHFNYFLNRDKGTVSSFLEILKENKILSQKESIR-DFNINNKTHRKFYLDNMELICQTQSHKNEDLKFKSKN------------LKNQVL------FVNKDEENE----AMFYNGRQLTPLSKSVHEVIYNGSIIK-DFGMLLCDFWDDIDFQNTQNEGSVSFTNGKKPEELLYRIIKMATNEGDIVLDFFVGSGTT 496
>gi|159900577|ref|YP_001546824.1| site-specific DNA-methyltransferase (adenine-specific) [Herpetosiphon aurantiacus ATCC 23779] >gi|159893616|gb|ABX06696.1| Site-specific DNA-methyltransferase (adenine-specific) [Herpetosiphon aurantiacus ATCC 23779] (281 aa)
Score = 144, Expect = 2.9e-07, Identities = 32/78 (41%), Positives = 43/78 (55%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           RL +A +LLK  G  F  ID  E  Y KVL+D IFG D+FI+ I+W         K     H+ IL Y+K+ +N+  N
  S:    83 RLLEAYRLLKPQGSFFFHIDYREVHYCKVLIDQIFGRDSFINEIIWAYDYGARSRKKWSTKHDTILWYAKDPENYTFN 160
Score = 95, Expect = 1.5e-01, Identities = 17/37 (45%), Positives = 25/37 (67%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHA 279
           +P  KP+ ++  ++  HSN N  +LDFFAGSG+ G A
  S:   205 YPTQKPLAILNRIVRVHSNPNDQLLDFFAGSGSFGEA 241
>gi|114566374|ref|YP_753528.1| site-specific DNA-methyltransferase (adenine-specific) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337309|gb|ABI68157.1| Site-specific DNA-methyltransferase (adenine-specific) [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (459 aa)
Score = 144, Expect = 3.3e-07, Identities = 29/79 (36%), Positives = 46/79 (58%)
  Q:     4 ERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           +RLK  K LL + G IF+ +D +   Y+K+L+D+IF  DNFI+ I+W         ++  + H+ IL Y K  K++  N
  S:   134 KRLKIMKMLLSEQGSIFVHLDWHSSHYVKILLDEIFSSDNFINEIIWCYGGGSGTRRHFHRKHDQILWYGKG-KDYTFN 211
Score = 105, Expect = 9.9e-03, Identities = 20/44 (45%), Positives = 29/44 (65%)
  Q:   241 IEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           ++FP  KP+ L+K +I   SN   ++ DF+AGSGTT  A  E+N
  S:   262 LKFPTQKPLALLKRIIASASNPGDLVADFYAGSGTTAEACEEMN 305
>gi|148927652|ref|ZP_01811108.1| type III restriction-modification system methylation subunit [candidate division TM7 genomosp. GTL1] >gi|147887001|gb|EDK72513.1| type III restriction-modification system methylation subunit [candidate division TM7 genomosp. GTL1] (299 aa)
Score = 143, Expect = 4.3e-07, Identities = 34/82 (41%), Positives = 52/82 (63%)
  Q:   240 GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC-----TNEERTKQDINKTIAKDICFERL 321
           G  F NPK V L+K+L+    +E+ ++LDFF+GSGTT HAV +LN++    GNR++I       T+E+        T+  D+  ER+
  S:    61 GALFDNPKSVRLMKYLLEFGCDEDGLVLDFFSGSGTTAHAVSQLNAE--DGGNRRWICVQLPELTSEKTEAYKAGYTVISDLTRERI 145
>gi|50843079|ref|YP_056306.1| putative type III restriction-modification system [Propionibacterium acnes KPA171202] >gi|50840681|gb|AAT83348.1| putative type III restriction-modification system [Propionibacterium acnes KPA171202] (663 aa)
Score = 143, Expect = 4.4e-07, Identities = 27/73 (36%), Positives = 47/73 (64%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYS 73
           MM +RL   K+LL DDG I++ +D  E   +++L+D++FG  NFI+  VW K ++ + D + +  + + IL Y+
  S:   132 MMRDRLHHMKKLLADDGSIWVHLDYAENHRMRLLLDEVFGCSNFIAEFVWQKADSPRGDAQRVSVDQDVILCYA 205
Score = 92, Expect = 3.4e-01, Identities = 22/62 (35%), Positives = 32/62 (51%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           F  PKP  L++ +I+  SN   I+LD FAGSGTT     ++         R+++ C   E T
  S:   393 FSTPKPERLLERIIHIGSNPGDIVLDVFAGSGTTAAVAQKM--------GRRWVTCELLEST 446
>gi|124520464|ref|ZP_01695606.1| DNA methylase N-4/N-6 [Bacillus coagulans 36D1] >gi|124497598|gb|EAY45154.1| DNA methylase N-4/N-6 [Bacillus coagulans 36D1] (556 aa)
Score = 142, Expect = 5.1e-07, Identities = 35/79 (44%), Positives = 50/79 (63%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD----KRNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           M  RL  A++LL  +G I++ +D ++  Y KVLMD+IFGE NF   I+W           DN +I +NH+ IL YSK++K  K
  S:   228 MKNRLDIAQKLLSPEGAIYVQLDYHQVHYAKVLMDEIFGESNFQREIIWRIGWLSGYKTTDNNWI-RNHDTILFYSKDYKRLK 309
Score = 104, Expect = 1.4e-02, Identities = 52/171 (30%), Positives = 87/171 (50%)
  Q:   200 YADEKEYKQVSHKSIVRFNI----NQSIIDNISS----SKGSNTLRKLGI---EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQDVSLKTFNINYAD-VSINSNIDKL 370
           Y  + E+K++++ +I R+ I    N +  D+++S    S    T+ K+     E    K  +LI+ +I  H+NE  I+LDFF G+GTT     +L         R++I+C       + ++K I  DIC  R+  +I+  ++     NN        Y    L   N NYAD + I  N ++L
  S:   314 YIPKSEFKEIANTNIERYPIEDVWNANEYDDLNSIAIVSFSGETVSKMLTPQDEVKGQKSEKLIERIIKAHTNEGDIVLDFFGGTGTTAAVAHKL--------RRRYIVC-------EQLDKHI--DICIRRMNKVIEGEQSGISKKNNWQGGGSFVY--CELVKLNQNYADKIQIAENDNEL 477
>gi|115289048|gb|ABI85535.1| M.Hin1056ModP-5 [Haemophilus influenzae] (322 aa)
Score = 142, Expect = 5.2e-07, Identities = 30/47 (63%), Positives = 37/47 (78%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI 48
           M  RL  AK+LL DDGII ISIDD+  AYLK+L+D+IFG +NFI N+
  S:   268 MKNRLLIAKELLTDDGIIVISIDDDGNAYLKILLDEIFGFENFIGNL 314
>gi|160943496|ref|ZP_02090729.1| hypothetical protein FAEPRAM212_00987 [Faecalibacterium prausnitzii M21/2] >gi|158445175|gb|EDP22178.1| hypothetical protein FAEPRAM212_00987 [Faecalibacterium prausnitzii M21/2] (587 aa)
Score = 142, Expect = 5.4e-07, Identities = 82/297 (27%), Positives = 138/297 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKINQV-FEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFN---------PATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSW-------SFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSI-----------VRFNINQSI---IDNISSSK------GSNTLRKLGIEFPN----PKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           MM  RLK  ++LL DDG + ISI  +E   L  L+ +IFG    ++  V       +    Y+++   +++       +F  N + F     +     +T+   +      R N  + ++ +          +  E+I    Y  +K +        +  D  I  +G V + P    G    W          ++K   +I K      +N YS+ Y      K++    +           + F  NQ++   +  I + K      G+ TL+ +  E P     PK V LI+ ++   + +  IILD FAGSGTT HAV+ +N      G+RKFIL
  S:   117 MMYPRLKLLQKLLADDGCLIISISYHELHNLVNLLREIFGTKQIVTVTVQTSGGKPSGGFNYVQEYLVFVVP-----ADFHANALDFCGGNNRTPFEGLTLSTFDK---TQRPNQTYPIFIDENGVFAGVGKSLQEQIDDGSYTGEKAD--------FPYDYSIAPQGKVAVWPVTAKGKQCVWRQISGRLQVDWEKGYIKISKNKSGSNQNQYSVQYLPSGVIKKIKDGELEVLGHEDGVPTLLFGENQTVGGQVPTIWAEKAFFTVNGTQTLKNIFPESPKTFDYPKSVALIESVVQAITKDADIILDSFAGSGTTAHAVLNMNK--ADGGHRKFIL 437
>gi|145636495|ref|ZP_01792163.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae PittHH] >gi|145270320|gb|EDK10255.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae PittHH] (146 aa)
Score = 142, Expect = 5.7e-07, Identities = 27/47 (57%), Positives = 36/47 (76%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI 48
           M  RL+ AK LL DDG+IF+  D NE  YL+VL+D+IF EDNF++N+
  S:    38 MKNRLEVAKDLLADDGVIFVHCDYNEDGYLRVLLDEIFTEDNFVANV 84
>gi|109947283|ref|YP_664511.1| methyltransferase fragment 1 [Helicobacter acinonychis str. Sheeba] >gi|109714504|emb|CAJ99512.1| methyltransferase fragment 1 [Helicobacter acinonychis str. Sheeba] (213 aa)
Score = 142, Expect = 5.8e-07, Identities = 30/48 (62%), Positives = 36/48 (75%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI 48
           M+  RL+ AKQLLKDDG+IF SIDD   AY+K L D++FGE NFI  I
  S:   148 MLYNRLQLAKQLLKDDGVIFCSIDDRNHAYVKCLFDEVFGEANFIFAI 195
>gi|153810297|ref|ZP_01962965.1| hypothetical protein RUMOBE_00678 [Ruminococcus obeum ATCC 29174] >gi|149833476|gb|EDM88557.1| hypothetical protein RUMOBE_00678 [Ruminococcus obeum ATCC 29174] (658 aa)
Score = 142, Expect = 5.8e-07, Identities = 27/85 (31%), Positives = 50/85 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFE 86
           M E L   K ++ +   I++ +D +   Y+K+L+D+IFGEDNF + I+W +  A +D ++   N + I  Y+K+   +  N V++
  S:   145 MYENLMAIKSVMSESASIYVHLDYHIGHYVKILLDEIFGEDNFRNEIIWKRATAHSDAEFYGNNFDCIYFYTKSQTEYVFNTVYQ 229
Score = 97, Expect = 9.3e-02, Identities = 24/56 (42%), Positives = 32/56 (57%)
  Q:   241 IEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI 296
           +++   KP  LI+ +I+  SNEN I+ DFFAGSG T     +L        NRKFI
  S:   331 VDYATQKPEALIERIISASSNENDIVADFFAGSGVTAAVSHKL--------NRKFI 378
>gi|189485129|ref|YP_001956070.1| type III restriction-modification system methylase subunit [uncultured Termite group 1 bacterium phylotype Rs-D17] >gi|170287088|dbj|BAG13609.1| type III restriction-modification system methylase subunit [uncultured Termite group 1 bacterium phylotype Rs-D17] (866 aa)
Score = 141, Expect = 6.6e-07, Identities = 77/297 (25%), Positives = 137/297 (46%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNP-----ATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           ++  R++ +++LLKD+GI   +IDD E  YL VL D++FG++N+I+ I+            I K  E+ + +SKN     I ++F     + +   +  G   +   V R N  + +          T+E+   +    K++  D+ +E+L K+  E   +GF  I P  +    + W   F++  E  E  I    KN      + + E  +   +   +F+  Q     +    G N       +F  PK +  IK  ++   +   I LD+F GSGTT  A++  N +    G+RK+I+
  S:   423 IIHNRMELSRKLLKDNGINITAIDDIELRYLTVLQDNVFGKNNYITTIITKCNPQGRVADKISKTTEFHILHSKNLAT--IGKLFIKKNDEKKPFPLKRGGT-NSKRVERPNRYYPILVKDNKIYMITDEEYSKIYNREKQLFNDNFVESL-KNKYE--SQGFSFILPINQRDEKVVWQRKFERVKEEKETYI---VKNNIIYTSSSDVEIPKTLWQD-AKFSNPQYGSSYLKDILGHN-------KFETPKSINTIKQFLSMFES-TGIYLDYFGGSGTTAEAIISANKE--DDGDRKYII 704
>gi|126173814|ref|YP_001049963.1| DNA methylase N-4/N-6 domain-containing protein [Shewanella baltica OS155] >gi|125997019|gb|ABN61094.1| DNA methylase N-4/N-6 domain protein [Shewanella baltica OS155] (570 aa)
Score = 141, Expect = 7.4e-07, Identities = 34/74 (45%), Positives = 44/74 (59%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKY---IEKNHEYILAYSKN 75
           M  RL  AK+LL  DG I   IDDNE AYL+VLMD++FG DNF++      R A+   K      K  EY+  Y ++
  S:   236 MKNRLSCAKELLSPDGFICCHIDDNESAYLRVLMDEVFGRDNFLTTFNIRVRYAEKTLKQDMNFHKEIEYVHIYQRS 312
>gi|188528172|ref|YP_001910859.1| putative type III restriction enzyme M protein [Helicobacter pylori Shi470] >gi|188144412|gb|ACD48829.1| putative type III restriction enzyme M protein [Helicobacter pylori Shi470] (572 aa)
Score = 141, Expect = 8.0e-07, Identities = 41/94 (43%), Positives = 57/94 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD----KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLI 95
           M  RL+ A++ L DDG I+I++D NE  Y KVLMD+IF  +N  S I+W             KYI +NH+ IL YSK+  N+  N+ +  NK   QL+
  S:   221 MKNRLEVAREFLSDDGSIYINLDYNEVHYCKVLMDEIFKRENLRSEIIWRMGFLSGYKTAAKKYI-RNHDTILFYSKS-DNYLFNKTYIENKDFLQLL 316
>gi|169838646|ref|ZP_02871834.1| Site-specific DNA-methyltransferase (adenine-specific) [candidate division TM7 single-cell isolate TM7a] (284 aa)
Score = 140, Expect = 1.0e-06, Identities = 43/97 (44%), Positives = 58/97 (59%)
  Q:   225 DNISSSKGSNTLRKLGIEFPNPKPVELIKFL--INKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN------KTIAKDICFERL 321
           DN  ++     + K+   F  PKP +LIK L  I+  +N   +ILDFFAGSGTT HAV ELN++    GNR++I     E T +         +TIA DI  ER+
  S:    29 DNALANTELKNILKMESLFDYPKPTQLIKRLMQISTDTNNGDVILDFFAGSGTTAHAVDELNAE--DGGNRRWICVQLPELTDEKSEAHKAGYRTIA-DIARERI 130
>gi|25053799|gb|AAN71898.1| putative type III DNA methyltransferase [Helicobacter pylori] (261 aa)
Score = 139, Expect = 1.1e-06, Identities = 27/43 (62%), Positives = 34/43 (79%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNF 44
           M  RL+ A++ L DDG+IF+  DDNEQAYLKVLMD+IF  +NF
  S:   219 MKNRLEAAREFLSDDGVIFVQCDDNEQAYLKVLMDEIFLRENF 261
>gi|169830412|ref|YP_001716394.1| DNA methylase N-4/N-6 domain-containing protein [Candidatus Desulforudis audaxviator MP104C] >gi|169637256|gb|ACA58762.1| DNA methylase N-4/N-6 domain protein [Candidatus Desulforudis audaxviator MP104C] (896 aa)
Score = 139, Expect = 1.2e-06, Identities = 32/92 (34%), Positives = 51/92 (55%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ 93
           + +RL  A+ LL D G IF+ I D     ++ LMD++FGED FIS I+  K +       + + ++YIL Y K+  + K  Q+F+     G+
  S:   215 LRDRLTVARDLLADSGSIFVQIGDENVHRVRALMDEVFGEDCFISEIIVVKSSGLGSTT-LPRQNDYILFYGKSPDSIKYRQLFKDKALDGE 305
>gi|56476791|ref|YP_158380.1| adenine specific DNA methylase MOD [Azoarcus sp. EbN1] >gi|56312834|emb|CAI07479.1| Adenine specific DNA methylase MOD [Azoarcus sp. EbN1] (601 aa)
Score = 139, Expect = 1.2e-06, Identities = 30/85 (35%), Positives = 51/85 (60%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND---NKYIEKNHEYILAYSKNWKNFKINQVF 85
           ++ +R +  ++LL DDG +F+ IDDNE  YL  L+D++FG  N I  + + + +A      N  +   + YIL Y+KN   +  N+V+
  S:    99 LIRDRAESLRRLLSDDGTLFVHIDDNELGYLIALLDEVFGRRNRIGVVTFKQSSASGPKAINPGLVTTNNYILYYAKNKDVWSPNRVY 186
Score = 89, Expect = 8.0e-01, Identities = 30/76 (39%), Positives = 43/76 (56%)
  Q:   202 DEKEYKQVSHKSIVRFNINQSIIDNISSSKG----------SNTLR-KLGIEFPN-PKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           D+ +Y  +  + +V +     IID  S++            SN L  + G+ FPN  KP  LIK  +   +    I+LD FAGSGTTG
  S:   289 DKDDYYFLGGEQLVFYKAKTRIIDGKSTTASPLTNLWDDLLSNNLHNEGGVSFPNGKKPEALIKRCLELSTTIGDIVLDSFAGSGTTG 376
>gi|88854936|ref|ZP_01129602.1| DNA methyltransferase [marine actinobacterium PHSC20C1] >gi|88816097|gb|EAR25953.1| DNA methyltransferase [marine actinobacterium PHSC20C1] (286 aa)
Score = 139, Expect = 1.3e-06, Identities = 28/81 (34%), Positives = 44/81 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           +  RL +A +LL D G +++ +D  E  Y KV +D +FG ++F++ I+W         K     H+ IL Y KN KN+  N
  S:    89 LEPRLHEAWRLLDDRGTLYLHLDYREVHYAKVALDALFGRESFLNEIIWAYDYGARATKKWPSKHDTILVYVKNPKNYYFN 169
>gi|115289060|gb|ABI85543.1| M.Hin1056ModP-3 [Haemophilus influenzae] (361 aa)
Score = 139, Expect = 1.4e-06, Identities = 38/81 (46%), Positives = 49/81 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN----KYIEKNHEYILAYSKNWKNFKIN 82
           M  RL+ AK LL DDG+IF+  DDNEQAYLK+LMD++F     I  +          N    + + K  EYIL YSK+ K F+ N
  S:   260 MKNRLEIAKTLLADDGVIFVQCDDNEQAYLKILMDELFHHRETIVALTSTASGVNAVNVKRGEQMFKLKEYILFYSKSPK-FRFN 343
>gi|190150016|ref|YP_001968541.1| putative methylation subunit, type III restriction-modification system [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|189915147|gb|ACE61399.1| putative methylation subunit, type III restriction-modification system [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (960 aa)
Score = 138, Expect = 1.5e-06, Identities = 81/302 (26%), Positives = 137/302 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFIS-NIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATN---EKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNI-------SSSKGSNTLRK-LGIE----FPNPKPVELIKFLINKH--SNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           +MS R++  K LL  +    ++ID+ EQ  L  L+   F +   ++  IV + R  Q  N      + Y++  + + K     +  EI+ +  +      G   D    + KN  +  Y           IP  D+ PK                 ++D G + I P  ++G   +W +    A + +EKI+ K+             E K       + FN +  ++ ++       +S  G+  L+  LG+E    F  PK +  +K +++    SNE+  +LD+FAGSGTT HAV+ LN +    GNRK+IL    E
  S:   452 LMSNRIELGKNLLARESSQAVAIDEVEQELLGQLLSLTFTDWTKVALPIVHNPRGQQGKNISYVHEYFYLIYPTDSEKYIADVKRAEIDSRNLR----DSGTESD--RTDAKNCFYPFYVKDGKIIGIGDIPDDDFHPKTA-------------NVLLDDGVIAIYPLNEDGNEKKWRY----ARQSVEKILDKL-------------EAKSGRSSIQIIFNKDTGVMRSLWIDPKYDASEYGTKVLQAVLGVEDAKNFSYPKSIHTVKEIVSAQLGSNEDNFVLDYFAGSGTTAHAVINLNRE--DNGNRKYILVEQGE 733
>gi|163839947|ref|YP_001624352.1| adenine specific DNA methylase [Renibacterium salmoninarum ATCC 33209] >gi|162953423|gb|ABY22938.1| adenine specific DNA methylase [Renibacterium salmoninarum ATCC 33209] (285 aa)
Score = 138, Expect = 1.5e-06, Identities = 27/74 (36%), Positives = 43/74 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           +  RL +A +LL +DG +++ +D  E  Y KV++D IFG ++F++ I+W        NK     H+ IL Y KN
  S:    90 LEPRLVEAWRLLSEDGTLYLHLDYREVHYAKVMLDAIFGRESFLNEIIWAYDFGARANKRWPTKHDNILVYVKN 163
>gi|15828869|ref|NP_326229.1| type III restriction-modification system: methylase [Mycoplasma pulmonis UAB CTIP] >gi|14089812|emb|CAC13571.1| TYPE III RESTRICTION-MODIFICATION SYSTEM: METHYLASE [Mycoplasma pulmonis] (652 aa)
Score = 138, Expect = 1.7e-06, Identities = 34/73 (46%), Positives = 49/73 (67%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-----NDNKYIEKNHEYILAYSK 74
           M  RL+  K LL++DG IF+ I D+  AYLKV+MD+IFG   +I+ IV   + +       ++K ++KN EYIL Y K
  S:   196 MKNRLEITKMLLREDGFIFVQISDDGFAYLKVIMDEIFGNKKYINTIVVKTKASSGASGGGEDKKLKKNIEYILVYGK 273
>gi|13488060|ref|NP_085633.1| DNA methyltransferase [Mesorhizobium loti MAFF303099] >gi|14027882|dbj|BAB54474.1| DNA methyltransferase [Mesorhizobium loti MAFF303099] (614 aa)
Score = 137, Expect = 2.0e-06, Identities = 22/74 (29%), Positives = 46/74 (62%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK 74
           MM++RL + +++L+  G +++  D     YLK+++D IFG  NF++ ++W + +A +  +     H+ +L YS+
  S:   143 MMAQRLHELRRVLRPTGSLYLHCDPTASHYLKIILDAIFGPTNFLNEVIWKRTSAHSSARRYGPIHDVLLFYSR 216
>gi|22299025|ref|NP_682272.1| adenine specific DNA methylase [Thermosynechococcus elongatus BP-1] >gi|22295207|dbj|BAC09034.1| Adenine specific DNA methylase [Thermosynechococcus elongatus BP-1] (385 aa)
Score = 137, Expect = 2.0e-06, Identities = 29/75 (38%), Positives = 46/75 (61%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKN 75
           MM ERL   ++LL + G I++  D    A+L+ ++DDIFG D F+++I+W  K     +N    K H+ IL Y+K+
  S:   159 MMYERLTLMRELLSERGSIYVHCDWRMNAFLRQVLDDIFGRDRFLNHIIWAYKTGGIPENVGFSKKHDDILIYTKS 234
>gi|163783520|ref|ZP_02178510.1| probable methylation subunit, type III restriction-modification system [Hydrogenivirga sp. 128-5-R1-1] >gi|159881140|gb|EDP74654.1| probable methylation subunit, type III restriction-modification system [Hydrogenivirga sp. 128-5-R1-1] (1108 aa)
Score = 137, Expect = 2.1e-06, Identities = 73/285 (25%), Positives = 133/285 (46%)
  Q:     1 MMSERLKKAKQLLKD-DGIIFISIDDNEQAYLKVLMDDIFGE-DNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPAT----NEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNI---SSSKGSNTLRKLGI-EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNS 285
           +M  RL   K+ L++ DG+  ++ID+NEQ  L +L++++F E    +  +V +    Q +N     +  Y + Y    +     +  E      Q +    G  ++ L  +  N  + +           E +PL  + P          N+ + D      G + + P   +GV  +W +    A + +EKI  ++    Y+ +   +K++  +  K ++ +    +I DN    +   G+  ++ +G  EF  PK V  +   I   SN +++ILDFFAGSGTT HAV  LN+
  S:   601 LMENRLALGKEFLREEDGVFVVAIDENEQERLGLLIEELFPEYKKTMVAVVHNPSGIQGENFRYTNDFAYFI-YPDKGRIMHPEERSEDEADVRQFMNTAKGNTKNYLRESGTNCFYPILVKDGEIVGFGEPLPLDIHPPHA--------NIPRQD------GVIEVYPIDDDGVERKWVY----ARQSVEKIKDEL----YAKYDERKKKWVIMRTKKLINY---ATIWDNKKYNAKKYGTELIKNMGTDEFKFPKSVWTVHDSIKISSNPDSLILDFFAGSGTTAHAVALLNT 869
>gi|156740418|ref|YP_001430547.1| DNA methylase N-4/N-6 domain-containing protein [Roseiflexus castenholzii DSM 13941] >gi|156231746|gb|ABU56529.1| DNA methylase N-4/N-6 domain protein [Roseiflexus castenholzii DSM 13941] (1028 aa)
Score = 137, Expect = 2.1e-06, Identities = 32/52 (61%), Positives = 38/52 (73%)
  Q:   246 PKPVELIKFLINKH-SNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           PKPVELI+ L  +   NE  ++LD+FAGSGTTGHAV+ LN   K  G RKFIL
  S:   741 PKPVELIESLARQTLMNEADVVLDYFAGSGTTGHAVINLNR--KDGGRRKFIL 791
Score = 97, Expect = 9.3e-02, Identities = 27/71 (38%), Positives = 43/71 (60%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN----DNKYIEKNHEYILA 71
           MMS+RL  +   L+  G +FISIDD E   L+ ++  +F ED  IS +VW KR+  +        +  +H+Y++A
  S:   521 MMSQRLSLSSSYLESQGCLFISIDDIEFPALRYMLQHLFREDTIISELVWKKRSGGDMTAGRGARLSVDHDYVVA 595
>gi|194173088|ref|YP_002003732.1| putative adenine methyltransferase [Escherichia phage rv5] >gi|114796126|gb|ABI79300.1| putative adenine methyltransferase [Escherichia coli bacteriophage rv5] (441 aa)
Score = 137, Expect = 2.2e-06, Identities = 30/85 (35%), Positives = 51/85 (60%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA---QNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           +M +RL+  + LL DDG+IF+ +DD E AYLKVLMD+IFG  N ++ I     +    +     +     ++L Y+K+     +N+++
  S:    97 LMRDRLEIIRNLLSDDGVIFVHLDDCEMAYLKVLMDEIFGRANQLNTISMTTNSPSGFKATGATVFSTANFLLVYAKDRTQKPLNKIY 184
>gi|115289057|gb|ABI85541.1| M.Hin1056ModP-3 [Haemophilus influenzae] (404 aa)
Score = 136, Expect = 2.6e-06, Identities = 38/81 (46%), Positives = 49/81 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN----KYIEKNHEYILAYSKNWKNFKIN 82
           M  RL+ AK LL DDG+IF+  DDNEQAYLK+LMD++F     I  +          N    + + K  EYIL YSK+ K F+ N
  S:   260 MKNRLEIAKTLLADDGVIFVQCDDNEQAYLKILMDELFHHRETIVALTSTASGVNAVNVKRGEQMFKLKEYILFYSKSPK-FRFN 343
>gi|50954042|ref|YP_061330.1| DNA methyltransferase [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50950524|gb|AAT88225.1| DNA methyltransferase [Leifsonia xyli subsp. xyli str. CTCB07] (285 aa)
Score = 136, Expect = 2.9e-06, Identities = 30/78 (38%), Positives = 48/78 (61%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKNWKNF 79
           +  RL +A +LL DDG +++ +D  E  Y KVL+D +FG + F++ IVW     A+  N++  K H+ IL Y KN + +
  S:    88 LEPRLIEAWRLLADDGTLYLHLDYREAHYAKVLLDALFGRECFLNEIVWAYDYGAKAKNRWPAK-HDTILVYVKNPRGY 165
Score = 90, Expect = 5.8e-01, Identities = 16/35 (45%), Positives = 23/35 (65%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           +P  KP  +++ ++   S E   +LDFFAGSGTTG
  S:   213 YPTQKPEGILRRIVQASSREGDWVLDFFAGSGTTG 247
>gi|154500150|ref|ZP_02038188.1| hypothetical protein BACCAP_03811 [Bacteroides capillosus ATCC 29799] >gi|150271106|gb|EDM98375.1| hypothetical protein BACCAP_03811 [Bacteroides capillosus ATCC 29799] (244 aa)
Score = 135, Expect = 3.2e-06, Identities = 24/45 (53%), Positives = 36/45 (80%)
  Q:     9 AKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR 53
           A+ LL +DGIIFISIDD E   L+ + D+IFG +NF++N++W+K+
  S:   187 ARNLLSEDGIIFISIDDGEVGNLRKMCDEIFGANNFLANLIWEKK 231
>gi|149923216|ref|ZP_01911628.1| putative DNA methylase [Plesiocystis pacifica SIR-1] >gi|149815932|gb|EDM75449.1| putative DNA methylase [Plesiocystis pacifica SIR-1] (324 aa)
Score = 135, Expect = 3.5e-06, Identities = 27/78 (34%), Positives = 42/78 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNF 79
           +  RL +A +LL   G  F+ ID  E  Y KVL+DDIFG  +F++ ++W         K     H+ I  Y+++ KN+
  S:   112 LEPRLVEAHRLLAPTGSFFLHIDYREAHYCKVLLDDIFGRASFMNELIWAYDYGARSKKRWSSKHDTIFWYARDPKNY 189
Score = 100, Expect = 4.3e-02, Identities = 18/44 (40%), Positives = 28/44 (63%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           +P  KP+ +++ ++  HS     +LDFFAGSGTTG A  +L  +
  S:   237 YPTQKPLGILERIVKVHSRPGDRVLDFFAGSGTTGEACAKLGRN 280
>gi|83591581|ref|YP_425333.1| DNA methylase N-4/N-6 [Rhodospirillum rubrum ATCC 11170] >gi|83574495|gb|ABC21046.1| DNA methylase N-4/N-6 [Rhodospirillum rubrum ATCC 11170] (939 aa)
Score = 135, Expect = 3.5e-06, Identities = 33/90 (36%), Positives = 52/90 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKK 91
           + +RL  A+ LL D G IF+ I D     +++LMD++FG++NFIS I   K +  +  +YI    ++IL YSK+    K  +   +NK K
  S:   213 LRDRLTVARDLLTDSGSIFVQIGDENVHRVRMLMDEVFGDENFISQIS-TKTSGGSTGEYISNVVDFILWYSKSRSYIKFRK---LNKSK 298
>gi|28493738|ref|NP_787899.1| DNA modification methyltransferase [Tropheryma whipplei str. Twist] >gi|28572924|ref|NP_789704.1| DNA methylase [Tropheryma whipplei TW08/27] >gi|28411057|emb|CAD67442.1| putative DNA methylase [Tropheryma whipplei TW08/27] >gi|28476780|gb|AAO44868.1| DNA modification methyltransferase [Tropheryma whipplei str. Twist] (293 aa)
Score = 135, Expect = 3.7e-06, Identities = 26/78 (33%), Positives = 45/78 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNF 79
           +  RL +A +LLK +G+ ++ +D  E  Y K+L+D IFG D+FI+ I+W         +     H+ IL Y+K+ + +
  S:    92 LKPRLHEAWRLLKPEGMFYLHLDYREVHYAKILLDSIFGRDSFINEIIWAYDYGAKTKRRWPAKHDNILVYAKDPRKY 169
Score = 96, Expect = 1.1e-01, Identities = 27/80 (33%), Positives = 46/80 (57%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT----KQDINKTIAKD-ICFERLY 322
           +P  KP  +++ +I   S  N  +LDFFAGSGTTG    +L         RKF+L  N  +     K  I+++++++ + + +LY
  S:   217 YPTQKPEGVLRRIIQASSRPNDWVLDFFAGSGTTGIVAGKL--------GRKFVLIDNSPQAVKIMKLRIDRSLSENPVRYTKLY 293
>gi|56962596|ref|YP_174322.1| adenine-specific DNA methylase [Bacillus clausii KSM-K16] >gi|56908834|dbj|BAD63361.1| adenine-specific DNA methylase [Bacillus clausii KSM-K16] (403 aa)
Score = 134, Expect = 4.3e-06, Identities = 30/81 (37%), Positives = 47/81 (58%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           RL++  ++LK  G IF+  D +   YL+V +D++FG D F S I+W  +   N    +  NH+ I  YSK  K FK N+++
  S:    65 RLEECHRVLKKTGSIFLHCDKSASHYLRVALDEVFGMDKFQSEIIWAYKRWSNSKVGLLNNHQTIYFYSKT-KKFKFNKIY 144
>gi|21674545|ref|NP_662610.1| DNA methylase, putative [Chlorobium tepidum TLS] >gi|21647740|gb|AAM72952.1| DNA methylase, putative [Chlorobium tepidum TLS] (1122 aa)
Score = 134, Expect = 4.9e-06, Identities = 29/88 (32%), Positives = 53/88 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINK 89
           + +RL  A++LL + G IF+ I D    +++ LMD++FG  NF   I   KR+ Q D K++    +Y++ +SK+    K NQ++ +++
  S:   223 LRDRLLLARELLTESGSIFVQISDENVHHVRELMDEVFGARNFQRVITIKKRSPQPD-KFLSGVADYLIWFSKDRDRSKYNQLYWLSE 309
>gi|13540955|ref|NP_110643.1| adenine specific DNA methylase [Thermoplasma volcanium GSS1] >gi|14324340|dbj|BAB59268.1| modification methylase [Thermoplasma volcanium GSS1] (337 aa)
Score = 134, Expect = 5.2e-06, Identities = 32/84 (38%), Positives = 50/84 (59%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQV 84
           M+  RL   K+LL + G I++ ID +   Y+KV+MD+IFG +NF++ IVW K N+ +  +K     H+ +  Y K    F  NQ+
  S:   158 MIVPRLVLMKELLSEKGSIYVHIDWHVGHYVKVIMDEIFGRENFVNEIVWKKTNSPKAQSKGFGTQHDVLYIYRKT-PQFIFNQI 241
>gi|2995646|gb|AAC08984.1| DNA modification methyltransferase M.XbaI [Xanthomonas campestris] (423 aa)
Score = 133, Expect = 6.0e-06, Identities = 26/74 (35%), Positives = 43/74 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           M +RL++A ++LK  G IF+  D +    L+ L+++IFG   F S I+W  +   N  + +   H+ IL YSK+
  S:    69 MEQRLREAHRVLKHSGSIFVHCDTSANFLLRTLLNNIFGASQFRSEIIWSYKRWSNSARNLLPAHQTILFYSKS 142
>gi|118462638|ref|YP_879564.1| adenine specific DNA methylase Mod [Mycobacterium avium 104] >gi|118163925|gb|ABK64822.1| adenine specific DNA methylase Mod [Mycobacterium avium 104] (662 aa)
Score = 133, Expect = 6.4e-06, Identities = 71/302 (23%), Positives = 140/302 (46%)
  Q:     1 MMSERLKKAKQLLKD-DGIIFISIDDNEQAYLKVLMDDIFGED--NFISNIVWDKRNAQNDNKYIEKNHEYIL-------AYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRW-----SWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNI----------------------SSSKGSNTLRKL--GIEFPNPKPV----ELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           MM  RL  A++LL   D ++ ++ID+ E   L +L++ +F E     +S+++       +      +  EYI        A +K+  +     V E ++ +  + +  +      L  +  +  + +  +  T   +   +  P  V+R +               G   + P  + GV  RW     ++ F ++   +    P       +++Y    E +++    ++   +N     ++                      ++  GSN L+ +    +FP PK +    + ++F I+     +A++LDFF+GSGTT HAVM LN   +  G R+ I  TN E
  S:   147 MMERRLLIARELLNPADSVLIVTIDEKEYLRLGLLVEQMFPEARIQMVSSVI--NPGGASRTAAFTRVDEYIFFVKIGSAAPAKHSNDMLFTDVSEPDENRSPIWRGMLRGGSGPLRSDSPSKFYPVLVDRTTGAVVGAGEALPLGVDRATYTP----------PDGLDAVWPLKRGGVEGRWELNAATFEFRRSQGYVRAGDPNRRTGVRTIYYLRNAEIERLESGELISRGMNDRGFLDVDYNPERERTLPAKTVWNRQSHNATEYGSNLLKAILPNRKFPYPKSLYAVEDTLRFFID--DKPDAVVLDFFSGSGTTAHAVMRLNK--QDGGRRQCISVTNNE 475
>gi|53729200|ref|ZP_00134051.2| COG2189: Adenine specific DNA methylase Mod [Actinobacillus pleuropneumoniae serovar 1 str. 4074] (992 aa)
Score = 133, Expect = 6.4e-06, Identities = 79/302 (26%), Positives = 137/302 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNF--ISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQ------------VFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKM--TKNGYSLFYADEKEYKQVSHKSIVRFN--INQSIIDNISSSK-------GSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           ++  R+  +++LL ++G    +ID  E      ++D+ FGE +   I +I+ + +  Q++ ++   + EY++ Y+ +  + + NQ            +F+ +KK+   +          L   +    + +Y +P              KV   S I+            G+VP+ P  +NG    W            K+IP+     N   L+ A   E        I  FN    Q +  N+   K       G+N L+ +     F  PK +  ++  I   S ++  ILD+FAGSGTT HAV+ LN +    GNRK+IL    E
  S:   482 LIENRVSLSRKLLSNEGFFAGTIDYAELFSFGKILDEEFGELSRVGIVSILINPKGRQHE-RFFSASSEYMIVYTPSPNSARFNQTTIDAEKRKTFNLFDEDKKERYRLDEFARIRSSTLRKEKPKFFYPIYVSPDL------------KVITSSNID------------GYVPVYPVDRNGTEYSW------------KVIPETFEENNKLGLYVAQNTE------DGIRIFNKFYEQQVFQNVWIDKKYYPEFNGTNLLKGILGNSIFSYPKSIYAVQDYIKITSKKDDYILDYFAGSGTTAHAVINLNRE--DGGNRKYILVEQGE 765
>gi|167933084|ref|ZP_02520171.1| DNA methylase N-4/N-6 domain protein [candidate division TM7 single-cell isolate TM7b] (176 aa)
Score = 132, Expect = 8.6e-06, Identities = 34/72 (47%), Positives = 46/72 (63%)
  Q:   225 DNISSSKGSNTLRKLGIEFPNPKPVELIKFL--INKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI 296
           DN  ++     + K+   F  PKP +LIK L  I+  +N   +ILDFFAGSGTT HAV ELN++    GNR++I
  S:   100 DNALANTELKNILKMESLFDYPKPTQLIKRLMQISTDTNNGDVILDFFAGSGTTAHAVDELNAE--DGGNRRWI 171
>gi|126208185|ref|YP_001053410.1| putative methylation subunit, type III restriction-modification system [Actinobacillus pleuropneumoniae L20] >gi|126096977|gb|ABN73805.1| putative methylation subunit, type III restriction-modification system [Actinobacillus pleuropneumoniae L20] (962 aa)
Score = 131, Expect = 1.1e-05, Identities = 79/302 (26%), Positives = 137/302 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNF--ISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQ------------VFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKM--TKNGYSLFYADEKEYKQVSHKSIVRFN--INQSIIDNISSSK-------GSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           ++  R+  +++LL ++G    +ID  E      ++D+ FGE +   I +I+ + +  Q++ ++   + EY++ Y+ +  + + NQ            +F+ +KK+   +          L   +    + +Y +P              KV   S I+            G+VP+ P  +NG    W            K+IP+     N   L+ A   E        I  FN    Q +  N+   K       G+N L+ +     F  PK +  ++  I   S ++  ILD+FAGSGTT HAV+ LN +    GNRK+IL    E
  S:   452 LIENRVSLSRKLLSNEGFFAGTIDYAELFSFGKILDEEFGELSRVGIVSILINPKGRQHE-RFFSASSEYMIVYTPSPNSARFNQTTIDAEKRKTFNLFDEDKKERYRLDEFARIRSSTLRKEKPKFFYPIYVSPDL------------KVITSSNID------------GYVPVYPVDRNGTEYSW------------KVIPETFEENNKLGLYVAQNTE------DGIRIFNKFYEQQVFQNVWIDKKYYPEFNGTNLLKGILGNSIFSYPKSIYAVQDYIKITSKKDDYILDYFAGSGTTAHAVINLNRE--DGGNRKYILVEQGE 735
>gi|165976122|ref|YP_001651715.1| methylation subunit, type III restriction-modification system [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|165876223|gb|ABY69271.1| probable methylation subunit, type III restriction-modification system [Actinobacillus pleuropneumoniae serovar 3 str. JL03] (962 aa)
Score = 131, Expect = 1.2e-05, Identities = 79/302 (26%), Positives = 137/302 (45%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNF--ISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQ------------VFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKM--TKNGYSLFYADEKEYKQVSHKSIVRFN--INQSIIDNISSSK-------GSNTLRKL--GIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           ++  R+  +++LL ++G    +ID  E      ++D+ FGE +   I +I+ + +  Q++ ++   + EY++ Y+ +  + + NQ            +F+ +KK+   +          L   +    + +Y +P              KV   S I+            G+VP+ P  +NG    W            K+IP+     N   L+ A   E        I  FN    Q +  N+   K       G+N L+ +     F  PK +  ++  I   S ++  ILD+FAGSGTT HAV+ LN +    GNRK+IL    E
  S:   452 LIENRVSLSRKLLSNEGFFAGTIDYAELFSFGKILDEEFGELSRVGIVSILINPKGRQHE-RFFSASSEYMIVYTPSPNSARFNQTTIDAEKRKTFNLFDEDKKERYRLDEFARIRSSTLRKEKPKFFYPIYVSPDL------------KVITSSNID------------GYVPVYPVDRNGAEYSW------------KVIPETFEENNKLGLYVAQNTE------DGIRIFNKFYEQQVFQNVWIDKKYYPEFNGTNLLKGILGNSIFSYPKSIYAVQDYIKITSKKDDYILDYFAGSGTTAHAVINLNRE--DGGNRKYILVEQGE 735
>gi|115289078|gb|ABI85555.1| M.Hin1056ModP-3 [Haemophilus influenzae] (324 aa)
Score = 130, Expect = 1.2e-05, Identities = 25/38 (65%), Positives = 31/38 (81%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIF 39
           M  RL+ AK LL DDG+IF+  DDNEQAYLK+LMD++F
  S:   260 MKNRLEIAKTLLADDGVIFVQCDDNEQAYLKILMDELF 297
>gi|119961011|ref|YP_948482.1| adenine specific DNA methylase [Arthrobacter aurescens TC1] >gi|119947870|gb|ABM06781.1| adenine specific DNA methylase [Arthrobacter aurescens TC1] (304 aa)
Score = 130, Expect = 1.3e-05, Identities = 28/74 (37%), Positives = 46/74 (62%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKN 75
           +  +L +A +LL DDG +++ +D  E  Y KV++D IFG + F++ I+W     A+  N++  K H+ IL Y KN
  S:    92 LEPKLVEAWRLLADDGTLYLHLDYREVHYAKVMLDSIFGRECFLNEIIWAYDYGARAKNRWPTK-HDNILVYVKN 165
Score = 92, Expect = 3.7e-01, Identities = 23/78 (29%), Positives = 35/78 (44%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFER 320
           +P  KP  L++ +++  S E    LDFFAGSGT G    +L         R F+     E+  + + K +     F R
  S:   217 YPTQKPEGLVRRIVSASSREGDWCLDFFAGSGTLGAVAAKL--------GRNFVCVDQNEQAIEVMRKRLGTKADFRR 286
>gi|21230526|ref|NP_636443.1| DNA methylase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|21112097|gb|AAM40367.1| possible DNA methylase [Xanthomonas campestris pv. campestris str. ATCC 33913] (972 aa)
Score = 130, Expect = 1.3e-05, Identities = 27/84 (32%), Positives = 48/84 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           + +RL  A+ LL + G IF+ I D     ++ ++D++FGEDNF+S I   K  +Q  N  +    +++L Y++  K  K  Q++
  S:   247 LRDRLMVARDLLTESGSIFVQIGDENVHRVRAVLDEVFGEDNFVSMIQVQKTGSQASN-LLANTVDFVLWYARTKKKVKYRQLY 329
>gi|189346973|ref|YP_001943502.1| DNA methylase N-4/N-6 domain protein [Chlorobium limicola DSM 245] >gi|189341120|gb|ACD90523.1| DNA methylase N-4/N-6 domain protein [Chlorobium limicola DSM 245] (906 aa)
Score = 130, Expect = 1.3e-05, Identities = 28/84 (33%), Positives = 49/84 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           + +RL  A+ LL + G IF+ I D     ++ LMD++FG++NF+S + +     +  +K ++   +YIL Y+KN    K  Q+F
  S:   216 LRDRLTVARDLLTESGSIFVQIGDENVHRVRALMDEVFGDENFLSLVSFQTSTGRT-SKTLDTVSDYILWYAKNSDVVKFRQLF 298
>gi|147921746|ref|YP_684432.1| putative type III restriction-modification system, methylation subunit [uncultured methanogenic archaeon RC-I] >gi|110619828|emb|CAJ35106.1| putative type III restriction-modification system, methylation subunit [uncultured methanogenic archaeon RC-I] (834 aa)
Score = 129, Expect = 1.7e-05, Identities = 29/84 (34%), Positives = 51/84 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           + +RL  AK+LL D G IF+ I D    +++ ++D+IFG +NFI+ I + K    + N  +    ++IL Y+K+ KN K  +++
  S:   205 LRDRLLLAKELLSDSGSIFVQISDENLHHVREILDEIFGYNNFINIITFQKTGGISSN-LLGCTIDFILWYAKDIKNVKFRRLY 287
>gi|53805208|ref|YP_113069.1| DNA methyltransferase [Methylococcus capsulatus str. Bath] >gi|53758969|gb|AAU93260.1| DNA methyltransferase [Methylococcus capsulatus str. Bath] (1192 aa)
Score = 129, Expect = 1.8e-05, Identities = 25/85 (29%), Positives = 50/85 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFE 86
           + +RL  A++LL + G +F+ I D    +++ +MD+IFG +NFI+ I + K +    N ++    +Y+L Y K+ +  K   +++
  S:   141 LRDRLLLARELLSESGSVFVQISDENLHHVREVMDEIFGSENFIAQITFSKTSGAT-NLFLPGTADYLLWYGKSKEQTKYRSLYK 224
>gi|116671332|ref|YP_832265.1| site-specific DNA-methyltransferase (adenine-specific) [Arthrobacter sp. FB24] >gi|116611441|gb|ABK04165.1| Site-specific DNA-methyltransferase (adenine-specific) [Arthrobacter sp. FB24] (290 aa)
Score = 129, Expect = 1.8e-05, Identities = 28/89 (31%), Positives = 47/89 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKK 90
           +  RL +A +LL DDG +++ +D  E  Y KV++D IFG + F++ I+W               H+ IL Y KN   +  N   E++++
  S:    92 LEPRLVEAWRLLADDGTLYLHLDYREVHYAKVMLDAIFGRECFLNEIIWAYDYGARAKFRWPTKHDNILVYVKNPAKYHFNSA-EVDRE 179
>gi|169830888|ref|YP_001716870.1| DNA methylase N-4/N-6 domain-containing protein [Candidatus Desulforudis audaxviator MP104C] >gi|169637732|gb|ACA59238.1| DNA methylase N-4/N-6 domain protein [Candidatus Desulforudis audaxviator MP104C] (545 aa)
Score = 129, Expect = 2.0e-05, Identities = 27/74 (36%), Positives = 44/74 (59%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN-DNKYIEKNHEYILAYSK 74
           M++ RL    ++LK  G I++  D     YLK++MD IFG  +F + I+W + NA N  ++   + H+ +L YSK
  S:   108 MLAIRLLDMHRVLKSTGSIYLHCDPTASHYLKLIMDSIFGARHFRNEIIWRRTNAHNMKSRQFPRIHDVLLFYSK 182
Score = 92, Expect = 3.7e-01, Identities = 20/45 (44%), Positives = 28/45 (62%)
  Q:   232 GSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           G+ +  +LG  +P  KP  L+K +IN  SNE  ++LD F G GTT
  S:   293 GNTSKERLG--YPTQKPEALLKRIINASSNEGDLVLDPFCGCGTT 335
>gi|166367164|ref|YP_001659437.1| putative type III restriction-modification system, methylation subunit [Microcystis aeruginosa NIES-843] >gi|166089537|dbj|BAG04245.1| putative type III restriction-modification system, methylation subunit [Microcystis aeruginosa NIES-843] (360 aa)
Score = 128, Expect = 2.1e-05, Identities = 26/84 (30%), Positives = 50/84 (59%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           +  RL  +++ L D G +F+ I D    +++ LMD++FG +NF++NI +  K+    +   IE   ++I+ Y+K  +N K + +F
  S:   144 LRNRLLLSREFLTDSGSVFVQISDENVHHVRELMDEVFGGENFVANITYKTKKMTMGNTSTIETIGDHIIFYAKCIRNLKCHSLF 228
>gi|148655960|ref|YP_001276165.1| DNA methylase N-4/N-6 domain-containing protein [Roseiflexus sp. RS-1] >gi|148568070|gb|ABQ90215.1| DNA methylase N-4/N-6 domain protein [Roseiflexus sp. RS-1] (460 aa)
Score = 128, Expect = 2.1e-05, Identities = 27/84 (32%), Positives = 47/84 (55%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN--WKNFKINQVF 85
           M ERL   + LL DDG I++  D  +   L+ LMD++FG +  ++ I+W   +  +  +   + H+ IL Y+++  W  F  +QV 
  S:   119 MYERLIALRDLLADDGSIYLHCDFRKAHLLRCLMDEVFGAERMLNEIIWFYPSGGDGERQFNRKHDTILLYARSDRW-TFNYDQVL 203
>gi|156742487|ref|YP_001432616.1| DNA methylase N-4/N-6 domain-containing protein [Roseiflexus castenholzii DSM 13941] >gi|156233815|gb|ABU58598.1| DNA methylase N-4/N-6 domain protein [Roseiflexus castenholzii DSM 13941] (464 aa)
Score = 128, Expect = 2.6e-05, Identities = 23/73 (31%), Positives = 41/73 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK 74
           M ERL   + LL DDG I++  D  +  +L+ LMD++FG +  ++ I+W      +  +   + H+ IL Y++
  S:   130 MYERLIALRDLLADDGCIYLHCDFRKAHHLRCLMDEVFGAERMLNEIIWFYPRGGDGERQFNRKHDTILLYAR 202
>gi|11499004|ref|NP_070238.1| modification methylase, type III R/M system [Archaeoglobus fulgidus DSM 4304] >gi|2649165|gb|AAB89839.1| modification methylase, type III R/M system [Archaeoglobus fulgidus DSM 4304] (969 aa)
Score = 127, Expect = 3.1e-05, Identities = 29/75 (38%), Positives = 48/75 (64%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKN 75
           M+  R++  ++LL + G IF+  D N  AYLK+L+++IFG+DN+ + I+ + KR +       E   EY+L YSK+
  S:   479 MLENRIRLGRELLNERGSIFVRCDYNGNAYLKLLLNEIFGKDNYRNEIIVNRKRQSIGTPNKFEVESEYLLFYSKS 554
>gi|148654309|ref|YP_001274514.1| site-specific DNA-methyltransferase (adenine-specific) [Roseiflexus sp. RS-1] >gi|148566419|gb|ABQ88564.1| Site-specific DNA-methyltransferase (adenine-specific) [Roseiflexus sp. RS-1] (303 aa)
Score = 127, Expect = 3.3e-05, Identities = 26/64 (40%), Positives = 38/64 (59%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQ 306
           +P  KP+ +++ +I   S+  A++LDFFAGSGTTG A +EL         R+FIL  N +   Q
  S:   216 YPTQKPLGILRRIIQASSHPGAVVLDFFAGSGTTGIAALEL--------GRRFILVDNSQEALQ 271
Score = 98, Expect = 6.2e-02, Identities = 22/73 (30%), Positives = 36/73 (49%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK 74
           +  RL +A ++L   G +++ +D  E  Y KVL+D IF    F++ I+W               H+ IL Y+K
  S:    91 LEPRLVEAHRILAPHGCLYVHLDYREVHYCKVLLDAIFDRACFLNEIIWAYDYGGRPRDRWPPKHDTILLYAK 163
>gi|145630147|ref|ZP_01785929.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae 22.4-21] >gi|144984428|gb|EDJ91851.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae R3021] (108 aa)
Score = 127, Expect = 3.3e-05, Identities = 29/73 (39%), Positives = 50/73 (68%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNH---EYILAYSK 74
           M  RL+ A++LL  +G I +SI+++  AYLK+LM++IF ++NF+   +W  +N  N +   +K+    EYI+A+ K
  S:    34 MKNRLEVARELLAPNGTILVSINESGNAYLKILMNEIFNKENFVETFIW--KNTDNPDSLSKKSRASVEYIIAFEK 107
>gi|163753955|ref|ZP_02161078.1| DNA methylase N-4/N-6 domain protein [Kordia algicida OT-1] >gi|161326169|gb|EDP97495.1| DNA methylase N-4/N-6 domain protein [Kordia algicida OT-1] (596 aa)
Score = 126, Expect = 3.5e-05, Identities = 29/71 (40%), Positives = 41/71 (57%)
  Q:     4 ERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSK 74
           ER+   K+LL D G I++  D  +  YL+++MD+IFG  NF + I+W    A N      K H+ IL YSK
  S:   137 ERVILLKELLSDKGTIYVHADYRKIHYLQLIMDEIFGASNFRNEIIWCYTGASNVGSDFPKKHDNILRYSK 207
>gi|33594038|ref|NP_881682.1| putative modification methylase [Bordetella pertussis Tohama I] >gi|33564112|emb|CAE43384.1| putative modification methylase [Bordetella pertussis Tohama I] (983 aa)
Score = 126, Expect = 3.9e-05, Identities = 30/92 (32%), Positives = 53/92 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ 93
           + +RL  A+ LL + G IF+ I D     ++ L+D++FG+DN +S IV+ K ++   + +I    + +L Y++N K  K  + F + K  GQ
  S:   246 LRDRLMVARDLLTESGSIFVQIGDENVHRVRALLDEVFGDDNCVSTIVFAKTSSSTGD-FIGPTFDTLLWYARNKKAVKYRK-FLLKKAPGQ 335
>gi|7465428|pir||A64691 type III restriction enzyme M protein - Helicobacter pylori (strain 26695) (474 aa)
Score = 126, Expect = 3.9e-05, Identities = 27/46 (58%), Positives = 35/46 (76%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFIS 46
           MM  RL+ A++LL D G +F+SIDDNEQAYLKVLMD++F     I+
  S:   428 MMENRLELARKLLNDKGAMFVSIDDNEQAYLKVLMDEVFNGGGVIT 473
>gi|189466780|ref|ZP_03015565.1| hypothetical protein BACINT_03156 [Bacteroides intestinalis DSM 17393] >gi|189435044|gb|EDV04029.1| hypothetical protein BACINT_03156 [Bacteroides intestinalis DSM 17393] (631 aa)
Score = 125, Expect = 4.5e-05, Identities = 28/81 (34%), Positives = 47/81 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKIN 82
           M E L   K ++ D   I++ +D +   Y+KVLMD++FGEDNF++ IVW      +   ++  K H+ I  Y K+ +++  N
  S:   148 MYENLMAIKSVMSDTASIYVHLDWHIGHYVKVLMDEVFGEDNFVNEIVWCYNGPGSPGMQHFNKKHDTIFWYCKDKQDYIFN 229
>gi|187602389|ref|ZP_02988614.1| DNA methylase N-4/N-6 domain protein [Chloroflexus sp. Y-400-fl] >gi|187485598|gb|EDU23574.1| DNA methylase N-4/N-6 domain protein [Chloroflexus sp. Y-400-fl] (133 aa)
Score = 125, Expect = 5.1e-05, Identities = 25/59 (42%), Positives = 36/59 (61%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK 60
           M E L + K++LKD G IF+  D +   +L+VL+D IFG ++F S I+W  R   N  K
  S:    62 MREVLIQCKRVLKDTGSIFVHCDRSASHHLRVLLDQIFGPEHFQSEIIWTYRRWSNSKK 120
>gi|188528158|ref|YP_001910845.1| Adenine-specific DNA methylase [Helicobacter pylori Shi470] >gi|188144398|gb|ACD48815.1| Adenine-specific DNA methylase [Helicobacter pylori Shi470] (480 aa)
Score = 125, Expect = 5.8e-05, Identities = 25/39 (64%), Positives = 33/39 (84%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIF 39
           MM+ RL+ A +LL D G++F+SIDDNEQAYLK LMD++F
  S:   428 MMANRLELAHKLLNDKGVMFVSIDDNEQAYLKALMDEVF 466
>gi|57505716|ref|ZP_00371642.1| adenine specific DNA methyltransferase (mod) [Campylobacter upsaliensis RM3195] >gi|57015989|gb|EAL52777.1| adenine specific DNA methyltransferase (mod) [Campylobacter upsaliensis RM3195] (650 aa)
Score = 124, Expect = 5.9e-05, Identities = 41/86 (47%), Positives = 55/86 (63%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIV-----------WDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEI 87
           M  RL+ A++ L+DDG+IFI  DDNEQAYLKVL D+IF      +N V             KR   N  K+I KN EY+L Y K  +   IN ++++
  S:   214 MKNRLEIAREFLRDDGVIFIQCDDNEQAYLKVLCDEIFNGGGGGNNFVGCVAVKMTPSSGVKRRFANI-KFI-KNKEYLLIYKK--REININPLYDV 306
>gi|188535906|ref|YP_001909392.1| DNA recognition and methylase subunit Mod (type III restriction and modification system), similar to LlaFI [Erwinia tasmaniensis] >gi|188027010|emb|CAO94796.1| DNA recognition and methylase subunit Mod (type III restriction and modification system), similar to LlaFI [Erwinia tasmaniensis] (663 aa)
Score = 124, Expect = 6.8e-05, Identities = 32/67 (47%), Positives = 41/67 (61%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-------NKYIEKNHEY 68
           +  RL+ AK+LL DD  I   IDD+E  YLKVLMD +FG DN+I+      R A          +K IE+ H Y
  S:   227 IKNRLESAKELLSDDAFICCHIDDSESHYLKVLMDMVFGADNYINTFYIQVRYANKTLKQDMSFHKQIEQVHIY 300
>gi|13542307|ref|NP_111995.1| adenine specific DNA methylase [Thermoplasma volcanium GSS1] (681 aa)
Score = 124, Expect = 6.8e-05, Identities = 31/75 (41%), Positives = 49/75 (65%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD--KRNAQNDN--KYIEKNHEYILAYSKN 75
           M+  RL   ++LL + G +++ ID +   Y+KV++DDIFG+DNF + ++    K+N Q  +  K I   H+ IL YSKN
  S:   168 MLVPRLVLMRELLSEQGFLYVHIDWHIGHYVKVIIDDIFGKDNFRNEVIVRRIKKNVQEYDTVKQINYGHDTILFYSKN 246
Score = 99, Expect = 5.4e-02, Identities = 39/126 (30%), Positives = 57/126 (45%)
  Q:   173 WSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC 298
           W WS D+A   I+  + +   N        + EYK  + +S VR  I + I           T       +   K  +L+  ++   S+ N++I DFFAGSGTTG AV E       K  RK+I+C
  S:   291 WRWSKDRADGAIKTGMLRPNPN------TGKPEYKVEASESEVRDTIWEDI-----------TAYSFQFNYQTEKNEDLLDLILEHSSSSNSVIADFFAGSGTTG-AVAE-------KLGRKWIMC 391
>gi|14325741|dbj|BAB60644.1| DNA adenine modification methylase [Thermoplasma volcanium GSS1] (703 aa)
Score = 124, Expect = 6.8e-05, Identities = 31/75 (41%), Positives = 49/75 (65%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD--KRNAQNDN--KYIEKNHEYILAYSKN 75
           M+  RL   ++LL + G +++ ID +   Y+KV++DDIFG+DNF + ++    K+N Q  +  K I   H+ IL YSKN
  S:   190 MLVPRLVLMRELLSEQGFLYVHIDWHIGHYVKVIIDDIFGKDNFRNEVIVRRIKKNVQEYDTVKQINYGHDTILFYSKN 268
Score = 99, Expect = 5.4e-02, Identities = 39/126 (30%), Positives = 57/126 (45%)
  Q:   173 WSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC 298
           W WS D+A   I+  + +   N        + EYK  + +S VR  I + I           T       +   K  +L+  ++   S+ N++I DFFAGSGTTG AV E       K  RK+I+C
  S:   313 WRWSKDRADGAIKTGMLRPNPN------TGKPEYKVEASESEVRDTIWEDI-----------TAYSFQFNYQTEKNEDLLDLILEHSSSSNSVIADFFAGSGTTG-AVAE-------KLGRKWIMC 413
>gi|58865222|emb|CAA65779.2| site-specific DNA-methyltransferase [Geobacillus stearothermophilus] (226 aa)
Score = 124, Expect = 7.3e-05, Identities = 27/43 (62%), Positives = 32/43 (74%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           P  KPV+LI++LI  HSNEN IILD F GSGTTG A + LN +
  S:   158 PTQKPVKLIEYLIRIHSNENDIILDPFMGSGTTGVASLNLNRN 200
>gi|84685896|ref|ZP_01013792.1| DNA methylase, putative [Rhodobacterales bacterium HTCC2654] >gi|84665989|gb|EAQ12463.1| DNA methylase, putative [Rhodobacterales bacterium HTCC2654] (1059 aa)
Score = 123, Expect = 8.7e-05, Identities = 25/88 (28%), Positives = 51/88 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINK 89
           + +RL  +++LL   G +F+ I D     ++ LMD++FG +NF+ NI+  +       KY+   ++YI+ ++K+    K  ++++I K
  S:   343 LRDRLVLSRELLDPTGSVFVQISDENLHSVRALMDEVFGAENFM-NIIAYRTKIPLGTKYLASIYDYIVWFAKDKSQIKFRKLYDIRK 429
>gi|167630946|ref|YP_001681445.1| DNA methylase, putative [Heliobacterium modesticaldum Ice1] >gi|167593686|gb|ABZ85434.1| DNA methylase, putative [Heliobacterium modesticaldum Ice1] (770 aa)
Score = 123, Expect = 9.6e-05, Identities = 26/80 (32%), Positives = 45/80 (56%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFK 80
           MM +RL+ AK++L DDG++ ++IDDNE A+L +L+++IF +    S  +          K+   +   I   SK  + +K
  S:   186 MMQKRLRIAKRILADDGVLIVTIDDNEHAHLTMLLNEIFPDRKLFSVPIQHNPRGTQGEKFAVTHETAIFVVSKTSEIYK 265
Score = 104, Expect = 1.3e-02, Identities = 25/40 (62%), Positives = 29/40 (72%)
  Q:   263 NAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           NA+I+DFFAGSGTT HAV  LN +    GNR+ IL TN E
  S:   426 NALIVDFFAGSGTTLHAVNLLNIE--DNGNRRCILVTNNE 463
>gi|145630146|ref|ZP_01785928.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae 22.4-21] >gi|144984427|gb|EDJ91850.1| putative type III restriction/modification system modification methylase [Haemophilus influenzae R3021] (277 aa)
Score = 123, Expect = 9.9e-05, Identities = 29/82 (35%), Positives = 43/82 (52%)
  Q:   228 SSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDIN 309
           ++   +  L+K+GI+F NPKP  LI F I   +    I+LDFF+GSGTT     ++N          +I     ER K+ I+
  S:    60 TNEDATTHLKKMGIDFSNPKPETLISFFIKAITTPKDIVLDFFSGSGTTAAVAHKMNRQYIGIEQMDYIETLAVERMKKVID 141
>gi|121596365|ref|YP_988261.1| DNA methylase N-4/N-6 domain-containing protein [Acidovorax sp. JS42] >gi|120608445|gb|ABM44185.1| DNA methylase N-4/N-6 domain protein [Acidovorax sp. JS42] (1103 aa)
Score = 122, Expect = 1.0e-04, Identities = 34/113 (30%), Positives = 60/113 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQL--IQMTIGANEDGLLVNRKNMG 114
           + +RL  A++LL D G +F+ I D    +++ LMD++FG DNF+  I + K+        +   ++ ++ Y++N    K  Q++ + K  G+    Q T     DG   +RKN G
  S:   374 LRDRLLLARELLSDSGSVFVQISDENLHHVRELMDEVFGSDNFLGLIAY-KKTTSAATLGLASVYDMLVWYARNKTQTKYRQLY-LEKIAGEDGGTQYTWAQLPDG---SRKNYG 483
>gi|119513181|ref|ZP_01632229.1| DNA methyltransferase [Nodularia spumigena CCY9414] >gi|119462168|gb|EAW43157.1| DNA methyltransferase [Nodularia spumigena CCY9414] (558 aa)
Score = 122, Expect = 1.0e-04, Identities = 69/286 (24%), Positives = 113/286 (39%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN----WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           MM+ RL +  ++LK  G +++  D     YLK+++D IF   N+ + I W + ++ +D K   +  + I  Y K+    W   K+    E  K+    I       + G L N K      Y          L+D DP     D+         ++ + +G + I P  K                      P+  +      Y DE   K +S            I D+I      N+  K  + +P  KP  L++ +I   SN++ I+LD F G GT  HA  +L  +
  S:   102 MMAIRLIELHRVLKSTGSLYLHCDTTASHYLKMILDLIFDARNYRNQITWKRTSSHSDAKKYARVTDIIFYYVKSNQFTWNPLKLPYTDEYIKQYYCNIDSDGRRFQFGDLTNTKTSRGYFY---------KLLDCDPP----DNGWRMPESRAQQWLSEGRIAIPPTGKT---------------------PRYKR------YLDEVAGKGIS-----------DIWDDIPP---VNSQAKEALGYPTQKPQSLLERIIQVSSNKDDIVLDPFCGCGTAIHAAEKLGRN 337
>gi|56475783|ref|YP_157372.1| methylation subunit, type III restriction-modification system [Azoarcus sp. EbN1] >gi|56311826|emb|CAI06471.1| probable methylation subunit, type III restriction-modification system [Azoarcus sp. EbN1] (1121 aa)
Score = 122, Expect = 1.2e-04, Identities = 75/297 (25%), Positives = 131/297 (44%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNI-VWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKI---PLMDYDPKKVERDS--TIENLYKDDKEIIDKGFVPIRPPIKNGVLL-----------RWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGI---EFPNPKPVELIKFLINKHS-NENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           ++++RL     L+  DG++  +IDD +Q  L  L++  FG+D+ +  I +    + +     + + HEY +     +       + E++K      Q     +EDG      N  W L+    +  +    P + Y P  V+ ++    +  + DD+ I    +  I PP +NG L+           RW    +      E    K+  NG    Y     YK       V    N       ++  G+  L+   I    F  PK +  ++  +      ++  +LD+F GSGTTGHAV+ LN +    G RK++L
  S:   559 LIADRLAATPPLMSIDGVLCATIDDYQQRELSYLLEQQFGQDSLLGTIAIRINPSGRPVPSGLAQAHEYAIFARATY-------LGELDKLPRSDKQAARYKHEDG----DGNFMWELFRKRGSGSERKDRPSLFY-PLYVKGETIRVPQMRWDDDRRI----WTDITPP-ENGELVAYPLDEIGTERRWRGKPESIRTSPENYKAKVDTNGSITIY-----YKFRPGSEGVLPPTNWIDAKYSATEHGTGVLKHFFIGTCPFTYPKSIYAVEDCLRVSGMGKSHFVLDYFGGSGTTGHAVINLNRE--DGGRRKYVL 852
>gi|134300088|ref|YP_001113584.1| DNA methylase N-4/N-6 domain-containing protein [Desulfotomaculum reducens MI-1] >gi|134052788|gb|ABO50759.1| DNA methylase N-4/N-6 domain protein [Desulfotomaculum reducens MI-1] (396 aa)
Score = 122, Expect = 1.2e-04, Identities = 30/75 (40%), Positives = 49/75 (65%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT--KQDINKTIAKDIC 317
           F   KP++L++ L+   + +N I+LDFF+GS +T  A++ L+++ + KGNRKFI+    E T  K +  K   K+IC
  S:   161 FEYTKPIKLLQKLMLIATKKNDIVLDFFSGSASTADALLSLSAE-ENKGNRKFIMVQLPEETDEKSEAFKAGYKNIC 236
>gi|68536318|ref|YP_251023.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium jeikeium K411] >gi|68263917|emb|CAI37405.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium jeikeium K411] (671 aa)
Score = 121, Expect = 1.7e-04, Identities = 29/81 (35%), Positives = 52/81 (64%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN--WKNFKI 81
           MM +RL   + LL +DG I++ +DD E   ++VL+D++FG  NF++  +W K  + +ND      + + I+ YSK+  W++ K+
  S:   133 MMRDRLLHLRDLLSEDGSIWVHLDDVENHRMRVLLDEVFGSGNFVAEAIWQKAYSPRNDALAFSVDQDVIIVYSKSPGWQSNKL 216
Score = 91, Expect = 4.2e-01, Identities = 25/86 (29%), Positives = 41/86 (47%)
  Q:   219 INQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERT 304
           +++ +  N +S    N L      F  PKP  L++ +I+  +N   I+LD FAGSGTT     ++         R+++ C   E T
  S:   377 LHEEVGHNRTSKAEMNALFPNTAAFATPKPERLLERIIHIATNPGDIVLDVFAGSGTTAAVAQKM--------GRRWVTCELVEDT 454
>gi|86169484|gb|ABC86981.1| MseI methylase [Micrococcus sp. NEB 446] (300 aa)
Score = 120, Expect = 1.8e-04, Identities = 27/81 (33%), Positives = 50/81 (61%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           +  RL +A +LL  DG +++ +D  E  Y KV++D +FG ++F++ ++W     A++ +K+  K H+ IL Y K+  N+  N
  S:    91 LEPRLLEAWRLLTPDGALYLHLDYREVHYAKVVLDAMFGRESFLNELIWAYDYGARSKSKWPTK-HDNILVYVKDPNNYVWN 171
Score = 108, Expect = 4.4e-03, Identities = 24/55 (43%), Positives = 32/55 (58%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFIL 297
           +   KPV +I+ +I   SNE   +LDFFAGSGTTG A  +L         R+F+L
  S:   216 YATQKPVGIIRRMIQASSNEGDWVLDFFAGSGTTGAAARQL--------GRRFVL 262
>gi|108563738|ref|YP_628054.1| type III restriction enzyme M protein [Helicobacter pylori HPAG1] >gi|107837511|gb|ABF85380.1| type III restriction enzyme M protein [Helicobacter pylori HPAG1] (474 aa)
Score = 120, Expect = 1.9e-04, Identities = 25/39 (64%), Positives = 31/39 (79%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIF 39
           MM  RL+ A  LL D G++F+SIDDNEQAY KVLMD++F
  S:   432 MMENRLELAHALLNDKGVMFVSIDDNEQAYCKVLMDEVF 470
>gi|124003829|ref|ZP_01688677.1| adenine-specific DNA methylase [Microscilla marina ATCC 23134] >gi|123990884|gb|EAY30351.1| adenine-specific DNA methylase [Microscilla marina ATCC 23134] (403 aa)
Score = 120, Expect = 2.1e-04, Identities = 26/80 (32%), Positives = 45/80 (56%)
  Q:     6 LKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           L +++++LK+ G +F+  D     +++ ++D +FG  NF S I+W  +   N  K +   H+ I  YSK  K FK NQ +
  S:    69 LIESRRVLKNSGSVFLHCDKTVSHHIRTVLDKVFGVKNFRSEIIWSYKRWSNSKKGLLNAHQNIYFYSKT-KEFKFNQYY 147
>gi|127512192|ref|YP_001093389.1| DNA methylase N-4/N-6 domain-containing protein [Shewanella loihica PV-4] >gi|126637487|gb|ABO23130.1| DNA methylase N-4/N-6 domain protein [Shewanella loihica PV-4] (719 aa)
Score = 119, Expect = 2.3e-04, Identities = 32/75 (42%), Positives = 49/75 (65%)
  Q:   228 SSSKGSNTLRKL--GIEFPNPKPV----ELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           ++S+G+  L ++    +FP PK +    + ++F ++     +AIILDFF+GSGTT HAVM LN   +  G R+ I  TN E
  S:   458 ATSQGTKLLGRILPRRKFPYPKSLYAVEDALRFFVS--DKPDAIILDFFSGSGTTAHAVMRLNR--QDGGRRQCISVTNNE 534
>gi|118575846|ref|YP_875589.1| adenine specific DNA methylase [Cenarchaeum symbiosum A] >gi|118194367|gb|ABK77285.1| adenine specific DNA methylase [Cenarchaeum symbiosum A] (786 aa)
Score = 119, Expect = 2.3e-04, Identities = 27/85 (31%), Positives = 46/85 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFE 86
           + +RL  +++LLK  G I + I D    Y+++LMD++FG+ NF+  I +           I    +YI+ Y+KN    K N ++E
  S:   156 LRDRLVLSRELLKVSGSIGVQISDENMHYVRMLMDEVFGKKNFVGIIQYRTTATSITKSSIPIVCDYIIWYAKNKSELKYNPIYE 240
>gi|42560738|ref|NP_975189.1| DNA methylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492234|emb|CAE76831.1| DNA methylase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (662 aa)
Score = 119, Expect = 2.4e-04, Identities = 42/137 (30%), Positives = 75/137 (54%)
  Q:     5 RLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQV---FEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMD------YDPKKVERDS 141
           RL + K++LK  G +F+  D      ++VL+D+IFG  NF S I+W  +   N  K +  +H+ I  YSK   +FK N +   + +     Q++Q+ +  +++  +V +K+    + F+    + +PL D       +PK  ER S
  S:    78 RLIEIKRVLKSTGSVFVHCDKTANHIIRVLLDEIFGSINFRSEIIWVYKRWSNSKKGLLDSHQNIYHYSKT-NDFKFNVIYTDYSLTTNIDQILQLRV-KDKNNKIVYKKDKNNNVVFSD-LKKGVPLSDVWNIPFLNPKAKERTS 220
>gi|94268294|ref|ZP_01291133.1| DNA methylase N-4/N-6 [delta proteobacterium MLMS-1] >gi|93451668|gb|EAT02451.1| DNA methylase N-4/N-6 [delta proteobacterium MLMS-1] (622 aa)
Score = 119, Expect = 2.8e-04, Identities = 23/77 (29%), Positives = 46/77 (59%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWK 77
           M+ ER+   + LL ++G I++  D    ++++V+MD++FG DN    I+W + +A +D+    + H+ +  +SK  K
  S:   174 MIYERMILLRDLLAENGSIYVHCDWRVNSFIRVVMDEVFGVDNNRGEIIWKRASAHSDSSAYGQVHDSLYYFSKARK 250
Score = 91, Expect = 4.8e-01, Identities = 46/156 (29%), Positives = 71/156 (45%)
  Q:   192 TKNGYSLF--YADEKEYKQVSHKSIVRFNINQSIIDNISS----SKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ 347
           TKNG      + DE E + V           QS+ D+I S    ++ + T       +P  KP  +++ +I   SNE  ++ DFF GSGTT  AV E       K  R++I CT       D+ K  A     +R+  + + +K  G  +    +  L KY+
  S:   324 TKNGVPRLKRFIDEMEGRPV-----------QSVWDDIQSVVSWARETET-------YPTQKPEAILERIIKASSNEGDLVADFFCGSGTTA-AVAE-------KLGRRWI-CT-------DLGK-FAVHTTRKRMIGVQRQLKKDGRDYRAFEILNLGKYE 450
>gi|170079551|ref|YP_001736185.1| DNA methylase [Synechococcus sp. PCC 7002] >gi|169887220|gb|ACB00930.1| DNA methylase [Synechococcus sp. PCC 7002] (937 aa)
Score = 118, Expect = 3.3e-04, Identities = 29/92 (31%), Positives = 48/92 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ 93
           + +RL  A++LL + G  F+ I D     ++ LMD++FG DNFI N++   +        +    +Y++ Y+K   N K  Q+F   K  GQ
  S:   218 LRDRLVVARELLTETGSCFVQIGDENVHLVRCLMDEVFGSDNFI-NLITVVKTTSATTSLLSGVCDYVVWYAKEKNNVKYRQLFFEKKIGGQ 308
>gi|90425626|ref|YP_533996.1| DNA methylase N-4/N-6 [Rhodopseudomonas palustris BisB18] >gi|90107640|gb|ABD89677.1| DNA methylase N-4/N-6 [Rhodopseudomonas palustris BisB18] (544 aa)
Score = 118, Expect = 3.5e-04, Identities = 22/60 (36%), Positives = 37/60 (61%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK 60
           MM+ RL +  ++LK  G +++  D     YLK+L+D +FG+  F + I W +++A ND K
  S:   115 MMAVRLLELHRVLKPTGSLYLHCDPTASHYLKILLDAVFGKRQFKTEISWRRQSAHNDAK 174
Score = 102, Expect = 2.5e-02, Identities = 21/50 (42%), Positives = 31/50 (62%)
  Q:   237 RKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           RK  + +   KPV L++ +I+  SNE  ++LD F G GTT HA  +LN +
  S:   302 RKENLGYGTQKPVALLERIISASSNEGDVVLDPFCGCGTTVHAAQKLNRN 351
>gi|184200490|ref|YP_001854697.1| putative methyltransferase [Kocuria rhizophila DC2201] >gi|183580720|dbj|BAG29191.1| putative methyltransferase [Kocuria rhizophila DC2201] (289 aa)
Score = 118, Expect = 3.6e-04, Identities = 24/81 (29%), Positives = 42/81 (51%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           +  RL  A+++L   G +++ +D  E  Y+KVL+D +FG + F++ IVW         +     H+ IL Y K+   +  N
  S:    95 LEPRLAHARRVLARHGTLYVHLDYREVHYVKVLLDAMFGRECFLNEIVWAYDFGGRTTRRWPAKHDTILVYVKDPAAYHFN 175
>gi|67154600|ref|ZP_00416345.1| Site-specific DNA-methyltransferase (adenine-specific) [Azotobacter vinelandii AvOP] >gi|67088733|gb|EAM08199.1| Site-specific DNA-methyltransferase (adenine-specific) [Azotobacter vinelandii AvOP] (677 aa)
Score = 118, Expect = 3.7e-04, Identities = 30/76 (39%), Positives = 42/76 (55%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN----DNKYIEKNHEYILAYSKNW 76
           M+  RL   ++LL   G I I I      Y+K + D+IFG+ NF + IVW            NK + K HEY+L Y+KN+
  S:   172 MLVPRLILMRELLSKSGSICIHIGMQVSHYVKAVADEIFGKANFNTEIVWSYGTPSGGRAAGNKMV-KAHEYLLWYAKNY 250
>gi|127450|sp|P14827|MTEC_ENTCL Modification methylase EcaI (M.EcaI) (Adenine-specific methyltransferase EcaI) >gi|41315|emb|CAA34968.1| unnamed protein product [Enterobacter cloacae] (452 aa)
Score = 117, Expect = 3.9e-04, Identities = 30/76 (39%), Positives = 44/76 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-HEYILAYSKNWK 77
           M  RL   +++L DDG I++ I       LK L+D+IFG + FI+ I   K +++N  K    N ++YIL YSK  K
  S:   130 MRRRLILMREILDDDGTIYVHIGHQMLGELKCLLDEIFGRERFINLITRRKCSSKNSTKNNFANLNDYILCYSKGKK 206
>gi|84489281|ref|YP_447513.1| hypothetical protein Msp_0470 [Methanosphaera stadtmanae DSM 3091] >gi|84372600|gb|ABC56870.1| partially conserved hypothetical protein [Methanosphaera stadtmanae DSM 3091] (393 aa)
Score = 117, Expect = 3.9e-04, Identities = 34/93 (36%), Positives = 52/93 (55%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYI----EKNHEYILAYSKNWKNFKINQVFEINKKKGQ 93
           M+   L+ A+ LL ++G++ ISIDDNE + L V+  +IFGE+N I N++W K +  +    I       HEY+L   KN      N+  E    K +
  S:   169 MIYPLLRLARNLLSEEGVLLISIDDNEFSNLIVMCKEIFGEEN-IDNLIWQKVDNDSGKMKITYRVRLEHEYVLICYKNKNKTYFNKFIEERNYKNE 264
>gi|2735920|gb|AAC46044.1| Tsp45I methyltransferase [Thermus sp. YS45] (413 aa)
Score = 117, Expect = 4.3e-04, Identities = 25/73 (34%), Positives = 43/73 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQN-DNKYIEKNHEYILAYSK 74
           + ERL   ++L+ D G+IF+ ID+     +K+++D++FG  NF+++I     N +N   K      + IL YSK
  S:   145 LRERLILLRELMADSGLIFVHIDEKYGFEVKLILDEVFGRRNFVNHIARIASNPKNFSRKAFGSQKDMILVYSK 218
>gi|147677858|ref|YP_001212073.1| adenine specific DNA methylase Mod [Pelotomaculum thermopropionicum SI] >gi|146273955|dbj|BAF59704.1| adenine specific DNA methylase Mod [Pelotomaculum thermopropionicum SI] (697 aa)
Score = 117, Expect = 4.4e-04, Identities = 26/73 (35%), Positives = 43/73 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSK 74
           M E L   K ++ +   I++ +D +   Y+K+LMD++FGEDNFI+ I+W K  + +  +      H+ IL Y K
  S:   145 MYENLMAIKSVMSEMASIYVHLDWHIGHYVKILMDEVFGEDNFINEIIWQKTTSPKAQSGKFSNVHDTILFYKK 218
>gi|196229823|ref|ZP_03128687.1| DNA methylase N-4/N-6 domain protein [Chthoniobacter flavus Ellin428] >gi|196226149|gb|EDY20655.1| DNA methylase N-4/N-6 domain protein [Chthoniobacter flavus Ellin428] (1058 aa)
Score = 117, Expect = 4.5e-04, Identities = 26/84 (30%), Positives = 46/84 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           + +RL  A++LL D G IF+ I D     ++ +MD++FG +NFI  I   K    + + ++    +Y+L Y+K     K  Q++
  S:   270 LKQRLLLARELLTDTGSIFVQISDENLHRVRAVMDEVFGPENFIGQIGVQKTGGLSAD-FLITTVDYLLWYAKERTRAKYRQLY 352
>gi|186901058|ref|ZP_02974012.1| DNA methylase N-4/N-6 domain protein [Cyanothece sp. PCC 7424] >gi|186691865|gb|EDU16487.1| DNA methylase N-4/N-6 domain protein [Cyanothece sp. PCC 7424] (438 aa)
Score = 116, Expect = 5.2e-04, Identities = 36/99 (36%), Positives = 57/99 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-HEYILAYSKNWKNFKINQVFE-----INKKKGQLIQMTIG 100
           + +RL   ++LL D+G I++ +D+     +K++MD+IFG  NF + I   K N +N  +    N  +YIL Y+K   N+  NQ FE       KK+ Q I+   G
  S:   117 LRQRLILLRELLSDEGSIYVHLDEKMAFPIKIIMDEIFGSKNFRNWITRKKCNPKNYTRRQYGNISDYILFYTKT-DNYIWNQPFESWTEVTAKKEYQYIEEETG 220
>gi|156741069|ref|YP_001431198.1| site-specific DNA-methyltransferase (adenine-specific) [Roseiflexus castenholzii DSM 13941] >gi|156232397|gb|ABU57180.1| Site-specific DNA-methyltransferase (adenine-specific) [Roseiflexus castenholzii DSM 13941] (305 aa)
Score = 116, Expect = 5.3e-04, Identities = 30/88 (34%), Positives = 48/88 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWD-KRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINK 89
           +  RL +A ++L   G  +  +D  E  Y KVL+D IFG ++F++ I+W      +  N++  K H+ IL Y KN   +  N V EI +
  S:    93 LEPRLVEAHRVLAPSGSFYFHVDYREVHYCKVLLDAIFGRESFLNEIIWAYDYGGRPKNRWPPK-HDNILLYVKNLSRYVFN-VDEIER 179
Score = 116, Expect = 5.5e-04, Identities = 26/68 (38%), Positives = 39/68 (57%)
  Q:   233 SNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTN 300
           +N   K G  +P  KP+ +++ ++   S   +++LDFFAGSGTTG A +EL         R+FIL  N
  S:   210 TNGAEKTG--YPTQKPLGILRRIVQASSKPGSLVLDFFAGSGTTGIAALEL--------GRRFILVDN 267
>gi|167459270|ref|ZP_02325459.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter dehalogenans 2CP-1] >gi|167414451|gb|EDR81200.1| DNA methylase N-4/N-6 domain protein [Anaeromyxobacter dehalogenans 2CP-1] (599 aa)
Score = 116, Expect = 5.5e-04, Identities = 21/60 (35%), Positives = 36/60 (60%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK 60
           MM+ RL + +++L   G I++  D     YLK+LMD IFG + F + I+W + ++  D +
  S:   112 MMAPRLIELRRVLARSGSIYLHCDPTASHYLKLLMDAIFGPEQFRNEIIWKRTHSHGDPR 171
>gi|86160046|ref|YP_466831.1| DNA methylase N-4/N-6 [Anaeromyxobacter dehalogenans 2CP-C] >gi|85776557|gb|ABC83394.1| DNA methylase N-4/N-6 [Anaeromyxobacter dehalogenans 2CP-C] (599 aa)
Score = 116, Expect = 5.5e-04, Identities = 21/60 (35%), Positives = 36/60 (60%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK 60
           MM+ RL + +++L   G I++  D     YLK+LMD IFG + F + I+W + ++  D +
  S:   112 MMAPRLIELRRVLARSGSIYLHCDPTASHYLKLLMDAIFGPEQFRNEIIWKRTHSHGDPR 171
>gi|159027337|emb|CAO90522.1| unnamed protein product [Microcystis aeruginosa PCC 7806] (437 aa)
Score = 115, Expect = 6.7e-04, Identities = 30/85 (35%), Positives = 50/85 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-HEYILAYSKNWKNFKINQVFE 86
           + ERL    +LL DDG +++ +D+    + +V++D+IFGE NF + I   K N +N  +    N  +YIL Y+K+  N+  N+  E
  S:   118 LRERLILIHRLLADDGSLYLHLDERMIFHFRVVLDEIFGEKNFRNCITRKKCNPKNYTRKTYGNVADYILFYTKS-DNYVWNRPIE 202
>gi|119508956|ref|ZP_01628108.1| putative type II DNA modification enzyme (methyltransferase) [Nodularia spumigena CCY9414] >gi|119466485|gb|EAW47370.1| putative type II DNA modification enzyme (methyltransferase) [Nodularia spumigena CCY9414] (437 aa)
Score = 115, Expect = 7.5e-04, Identities = 30/85 (35%), Positives = 51/85 (60%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-HEYILAYSKNWKNFKINQVFE 86
           + +RL   ++LL ++G I++ +D N    +K++MD+IFG  NF + I   K N +N  +    N  +YIL Y+K  +N+  NQ F+
  S:   115 LRQRLILLRELLSEEGSIYVHLDQNMACAVKIIMDEIFGTKNFRNWITRKKCNPKNYTRNQYGNIADYILFYTKT-ENYVWNQQFD 199
>gi|116750281|ref|YP_846968.1| DNA methylase N-4/N-6 domain-containing protein [Syntrophobacter fumaroxidans MPOB] >gi|116699345|gb|ABK18533.1| DNA methylase N-4/N-6 domain protein [Syntrophobacter fumaroxidans MPOB] (938 aa)
Score = 115, Expect = 7.7e-04, Identities = 26/84 (30%), Positives = 46/84 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND----NKYIEKNHEYILAYSKNWKNFKINQVF 85
           + +RL  A+ LL D G IF+ I D     ++ LMD++FGE+NF S I + K             +    +YI+ +++  ++ K  Q++
  S:   216 LRDRLTVARDLLADTGSIFVQIGDENVHRIRALMDEVFGEENFCSLIGYKKTTGAGSPAIGTDVLASVKDYIVWFARKKRDVKYRQLY 303
>gi|183398031|gb|ACC62481.1| adenine specific DNA methylase Mod [Lactobacillus reuteri] (668 aa)
Score = 115, Expect = 7.9e-04, Identities = 32/74 (43%), Positives = 44/74 (59%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISN----IVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           M  RL+ AK L+ D+G+I I +DD+E  YLKVL D IFG DN +      + +  +  ++D  Y  K  E I  Y KN
  S:   234 MKSRLEIAKTLMSDNGVIAIQLDDSEGPYLKVLTDSIFGRDNELFTQYVLVRYANKTLKSDMDY-HKQIEQIHYYKKN 310
>gi|153818467|ref|ZP_01971134.1| DNA methylase [Vibrio cholerae NCTC 8457] >gi|126511026|gb|EAZ73620.1| DNA methylase [Vibrio cholerae NCTC 8457] (351 aa)
Score = 114, Expect = 8.8e-04, Identities = 32/86 (37%), Positives = 42/86 (48%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIK 329
           P  KP +L++ +I   S EN ++LD F GSG+TG A + L        NR+FI    EE T             FE+    IKNIK
  S:   286 PCEKPQDLLQHIIAASSRENDVVLDAFMGSGSTGKACLSL--------NRRFIGIEMEEET-------------FEQALASIKNIK 350
>gi|159044646|ref|YP_001533440.1| DNA methylase N-4/N-6 domain-containing protein [Dinoroseobacter shibae DFL 12] >gi|157912406|gb|ABV93839.1| DNA methylase N-4/N-6 domain protein [Dinoroseobacter shibae DFL 12] (485 aa)
Score = 114, Expect = 9.0e-04, Identities = 28/63 (44%), Positives = 38/63 (60%)
  Q:   240 GIEFPNPKPVELIKFLINK--HSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           G  FP PK +  ++  +      N++AIILDFF+GSGT+ HA M LN   +  G R+ I  TN E
  S:   238 GRTFPFPKSLYAVEDALRPIVRGNKSAIILDFFSGSGTSLHATMRLNR--QDDGRRQCICVTNNE 300
>gi|78777552|ref|YP_393867.1| site-specific DNA-methyltransferase (adenine-specific) [Sulfurimonas denitrificans DSM 1251] >gi|78498092|gb|ABB44632.1| Site-specific DNA-methyltransferase (adenine-specific) [Sulfurimonas denitrificans DSM 1251] (378 aa)
Score = 114, Expect = 9.2e-04, Identities = 24/75 (32%), Positives = 40/75 (53%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           M+  RL   ++LL + G I++ ID +   Y+K+L+DDIFG+  F + I+W             + H+ I  Y K+
  S:   147 MIYPRLVLMRELLSEKGSIYVHIDWHVGHYVKILLDDIFGKGKFRNEIIWHYSTLGRPKDKFAQKHDQIFVYGKS 221
>gi|47092614|ref|ZP_00230402.1| type III restriction system methylase [Listeria monocytogenes str. 4b H7858] >gi|47019042|gb|EAL09787.1| type III restriction system methylase [Listeria monocytogenes str. 4b H7858] (209 aa)
Score = 113, Expect = 1.4e-03, Identities = 38/85 (44%), Positives = 50/85 (58%)
  Q:   265 IILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQD-----INKTIAKDICFERLYCLIKNI-KTSGESFNNLSVDELKKYQDV 349
           +ILDFFAGSGTT  AVM+ NS+    GNRKFI+ T +E T ++     +  +    I  ER+    + I  TSG  F  L VD     +DV
  S:     1 MILDFFAGSGTTADAVMQTNSE--DGGNRKFIVATLDEETPENSEARKVGYSTIDQISRERIRRAAEKIGDTSG--FRTLKVDSTGLKEDV 87
>gi|187251377|ref|YP_001875859.1| DNA methylase N-4/N-6 domain-containing protein [Elusimicrobium minutum Pei191] >gi|186971537|gb|ACC98522.1| DNA methylase N-4/N-6 domain protein [Elusimicrobium minutum Pei191] (222 aa)
Score = 112, Expect = 1.6e-03, Identities = 26/55 (47%), Positives = 34/55 (61%)
  Q:   242 EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI 296
           + P  KP+ELI+ LI+ ++NE  ++LD F GSGTTG A   L        NRKFI
  S:   150 QHPTQKPLELIEELISLYTNEGQLVLDPFMGSGTTGVACARL--------NRKFI 196
>gi|167730054|emb|CAO80966.1| Modification methylase, type III R/M system [Candidatus Cloacamonas acidaminovorans] (998 aa)
Score = 111, Expect = 2.0e-03, Identities = 70/283 (24%), Positives = 115/283 (40%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMEL 283
           ++  RL  AK ++KD   IF+  D N    L+ +M+ IF EDNF + I+ +K    + + K +   H+ IL Y KN  N     + E N++K +   + +   +           W +  N   N       + P  ++ D    N+    K I+ K  +P           R    F   +     II KM  +G  L     +   Q+    I+       + D+ +   G +       +FP      L+K +I   S+E  I++DFF GSGTT     +L
  S:   529 LLENRLSLAKNIMKDSASIFVRCDYNGNWVLRPVMNYIFYEDNFRNEIIVNKSVRMKTEGKVLLSWHDVILCYCKNSNNVFFCHITE-NREKQEWRALDMEGEK-----------WDIVPNDMINM------FSPNNLKYDEK-GNVLSRAKIILGKEIIP-----------RQGRRFPNQV-----IINKMENDG--LLRYSSRGNPQMLKPDII------YLTDDWTGFYGYS----FNWDFPTENSEILLKRVIESTSDERNIVMDFFLGSGTTTAVAQKL 765
>gi|126734814|ref|ZP_01750560.1| adenine specific DNA methylase MOD [Roseobacter sp. CCS2] >gi|126715369|gb|EBA12234.1| adenine specific DNA methylase MOD [Roseobacter sp. CCS2] (574 aa)
Score = 111, Expect = 2.1e-03, Identities = 74/262 (28%), Positives = 119/262 (45%)
  Q:    16 DGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-------NKYIEKNHEYILAY-SKNWKNFKINQVFEIN---KKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKI----PLMDYDPKKVERDSTIEN-----LYKD--DKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPK---MTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGS--NTLRKLGIEF-PNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           DG +   IDD+E  YLKVL+D++FG +N+ + I    R  Q         +K IE  H Y  ++ +K W   K + + + N     +G+  ++ +G  +            T+ F P  N KI    P +D   +     S ++       ++D  D  + + G          G L +     D   +      PK    TK  Y         ++ V    +   N     I+N     G+  N   + G+EF    KP  L++ ++   S+EN +ILD FAGSGTT 
  S:   115 DGFLCAHIDDSEGHYLKVLLDEVFGRENYQTTIYLQVRYPQKTLKQDMSYHKQIEMIHIYRNSFDAKPWLTPKSSGLDKFNFYVSTQGEGKEIELGGKK------------TIVFEPG-NYKIEKGEPSVDGRKEIWATGSILDGNSSGRFFRDYLDGRVKEDGL---------GALYKVYGIGDDKFDHRFFTGPKKATATKGKY---------FQGVPTSKLENANSGNQPIENFLDLAGAFGNCRHEGGVEFRSGKKPEVLLQKILTHFSDENDLILDSFAGSGTTA 373
>gi|149914819|ref|ZP_01903349.1| DNA methylase N-4/N-6 [Roseobacter sp. AzwK-3b] >gi|149811612|gb|EDM71447.1| DNA methylase N-4/N-6 [Roseobacter sp. AzwK-3b] (975 aa)
Score = 110, Expect = 2.6e-03, Identities = 24/74 (32%), Positives = 43/74 (58%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           + +RL  A++LL D G  F+ I D     ++ LMD++FGE+NF S I + K +    ++ ++    Y++ Y K+
  S:   210 LRDRLVVARELLTDSGSCFVQIGDENVHRVRALMDEVFGEENFCSLIAY-KTSVGLGSQGLDNTANYLVWYCKD 282
>gi|188528159|ref|YP_001910846.1| adenine-specific DNA methylase [Helicobacter pylori Shi470] >gi|188144399|gb|ACD48816.1| adenine-specific DNA methylase [Helicobacter pylori Shi470] (358 aa)
Score = 110, Expect = 2.9e-03, Identities = 59/237 (24%), Positives = 104/237 (43%)
  Q:    40 GEDNFISNIVWDKRNA-QNDNKYIEKNHEYILAYSKNWKNFKINQVFE--------INKKKGQLIQMTIGANEDGLLVNRKNMGWTLYF---NPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           G DNF+++++W K+     D++   K HEYIL Y K   N    ++          IN K+ +++++    N   L  +R     TLY+   +P  N+  P+           +  E  ++   E +D   +  +   K G L+ +   +   I+  +K+I   T       + +     + + + +  FN  +                     F  PKP  L+K +I   + EN ++LDFFAGSGTT
  S:     6 GVDNFVASLIWQKKKGGSQDSENFAKEHEYILCYQKEKFNIIDTEIDHDIQDFNKTINGKQAKILKLEKWGNHS-LRTDRP----TLYYAIKDPNGNDFYPIAP---------NGEEGCWRKKPENLDNEHIFWQENSK-GRLIPYEVIYYDEIKNAKKVIKTRT------IFTEYGTTTEATKEILALFNGTKL--------------------FDTPKPEALLKRIIEISTQENDLVLDFFAGSGTT 213
>gi|119356767|ref|YP_911411.1| DNA methylase N-4/N-6 domain-containing protein [Chlorobium phaeobacteroides DSM 266] >gi|119354116|gb|ABL64987.1| DNA methylase N-4/N-6 domain protein [Chlorobium phaeobacteroides DSM 266] (884 aa)
Score = 110, Expect = 3.0e-03, Identities = 24/84 (28%), Positives = 48/84 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVF 85
           + +R+  A++LL + G  F+ I D     ++ LMD++FG +NF+S I + K  A      ++  +++I+ Y K+  + K  Q++
  S:   222 LRDRMLIARELLTESGSCFVQISDENVHLVRCLMDEVFGSENFVSTISFIK-TAGKMGGLLDNVNDFIIWYGKSKSSIKFRQLY 304
>gi|170780698|ref|YP_001709030.1| putative DNA methylase [Clavibacter michiganensis subsp. sepedonicus] >gi|169155266|emb|CAQ00367.1| putative DNA methylase [Clavibacter michiganensis subsp. sepedonicus] (334 aa)
Score = 110, Expect = 3.0e-03, Identities = 23/74 (31%), Positives = 39/74 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           +  RL +A +LL   G +++ +D  E  Y KV++D +FG  +F++ IVW         +     H+ IL Y K+
  S:   131 LEPRLIEAWRLLDPTGTLYLHLDYREVHYAKVVLDALFGRRSFLNEIVWAYDYGAKSRRRWPAKHDTILVYVKD 204
>gi|148271668|ref|YP_001221229.1| putative adenine-specific DNA-modification methylase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] >gi|147829598|emb|CAN00513.1| putative adenine-specific DNA-modification methylase [Clavibacter michiganensis subsp. michiganensis NCPPB 382] (348 aa)
Score = 110, Expect = 3.0e-03, Identities = 23/74 (31%), Positives = 39/74 (52%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKN 75
           +  RL +A +LL   G +++ +D  E  Y KV++D +FG  +F++ IVW         +     H+ IL Y K+
  S:   143 LEPRLIEAWRLLDPTGTLYLHLDYREVHYAKVVLDALFGRRSFLNEIVWAYDYGAKSRRRWPAKHDTILVYVKD 216
>gi|114326568|ref|YP_743727.1| DNA methylase N-4/N-6 domain-containing protein [Nitrosomonas eutropha C91] >gi|114326627|ref|YP_743785.1| DNA methylase N-4/N-6 domain-containing protein [Nitrosomonas eutropha C91] >gi|114309507|gb|ABI60749.1| DNA methylase N-4/N-6 domain protein [Nitrosomonas eutropha C91] >gi|114309566|gb|ABI60807.1| DNA methylase N-4/N-6 domain protein [Nitrosomonas eutropha C91] (662 aa)
Score = 110, Expect = 3.0e-03, Identities = 72/296 (24%), Positives = 127/296 (42%)
  Q:    17 GIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNK-YIEKNHEYILAYSKN-WKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLY---KDDKEIIDKGFVPIRPPIKNGVLLRWSWS----FDKAIERIEKII--PKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFI-----LCTNEERTKQDINKTI 312
           G I++  D +   +++ L+++IFG  NF++ + W + +  ND K  +   H+ I   +KN  K F   Q    +     L + ++   +DG +V+                       + + + R   +EN     KD K   +   V    P  N V   W+++     D+A+ER E  +  P+       +F+ ++   + +           QSI  +    KG       G ++P  KP +L++ +I        ++LD F GSGTT  A  +L         RKFI     L   +  TK+ IN  +
  S:   156 GSIWVQCDWHRSHHIRCLLEEIFGSSNFLNEVAWQRTDPHNDAKSRLGIIHDTIFWVAKNKEKVFYDWQAAAGDLSDSALSEYSLVLLDDGSVVDYSE--------------------ETENLGRRFKVENTTYKGKDSKRQFEWRGV---KPSPNRV---WAYASPKEMDQALERGELYLRDPRKGSTRCKVFFLEKSNGRLL-----------QSIWTDCGRMKG-------GSDYPTRKPEQLLERIITAGCPAGGVVLDTFVGSGTTAVAAQKL--------GRKFIVADINLGAVQSSTKRLINSAV 415
>gi|159896851|ref|YP_001543098.1| site-specific DNA-methyltransferase (adenine-specific) [Herpetosiphon aurantiacus ATCC 23779] >gi|159889890|gb|ABX02970.1| Site-specific DNA-methyltransferase (adenine-specific) [Herpetosiphon aurantiacus ATCC 23779] (282 aa)
Score = 109, Expect = 3.2e-03, Identities = 22/81 (27%), Positives = 43/81 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKIN 82
           + +RL  A++++ + G +F+ +D     Y KVL+D  +G + F + I+W         +     H+ IL YSK+ +++  N
  S:    63 LEQRLVAARRIVAEHGSLFLHLDRRAVHYAKVLLDQTWGFECFRNEIIWHYTGGGRARRSFSHKHDTILWYSKHPQHWTFN 143
>gi|192359023|ref|YP_001984102.1| possible DNA methylase [Cellvibrio japonicus Ueda107] >gi|190685188|gb|ACE82866.1| possible DNA methylase [Cellvibrio japonicus Ueda107] (1004 aa)
Score = 109, Expect = 3.3e-03, Identities = 21/51 (41%), Positives = 33/51 (64%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDK 52
           + +RL  A+ LL + G IF+ I D     ++ +MD++FGE+NFI +IV  K
  S:   264 LRDRLTVARDLLTESGSIFVQIGDENVHRVRAVMDEVFGEENFIVSIVAQK 314
>gi|169181672|ref|ZP_02842194.1| DNA methylase N-4/N-6 domain protein [Thauera sp. MZ1T] >gi|169011182|gb|EDS57942.1| DNA methylase N-4/N-6 domain protein [Thauera sp. MZ1T] (1039 aa)
Score = 109, Expect = 3.4e-03, Identities = 30/87 (34%), Positives = 47/87 (54%)
  Q:   228 SSSKGSNTLRKLGIE--FPNPKPVELIK--FLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAK 314
           + + G+N L  LG+   F  PK V+ ++  F +      N  +LD+FAGSGTT HA + LN   +   +RK++L    E  +  +   I K
  S:   731 AGTNGTNVLDNLGLGGIFDYPKSVKTLEQSFWMQSFGKTNFTVLDYFAGSGTTAHATISLNR--QDNASRKYVLVEQGEYFETVLKPRIQK 819
>gi|85717134|ref|ZP_01048093.1| possible DNA methylase [Nitrobacter sp. Nb-311A] >gi|85696025|gb|EAQ33924.1| possible DNA methylase [Nitrobacter sp. Nb-311A] (897 aa)
Score = 109, Expect = 3.5e-03, Identities = 27/92 (29%), Positives = 50/92 (54%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ 93
           M +R + A+ LL D G IF+ I D     ++ ++D++FGE+NF++ I +         K IE   +Y+  Y+K+    K + ++ + K  G+
  S:   262 MRDRCRLARDLLTDTGSIFVQISDENLHLVRAVLDEVFGEENFVAVINFKTMMPLESGK-IESVVDYLCWYAKSKPIMKYHNIW-VKKNVGK 351
>gi|195867551|ref|ZP_03079554.1| adenine specific DNA methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|195660795|gb|EDX54049.1| adenine specific DNA methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (134 aa)
Score = 109, Expect = 3.5e-03, Identities = 43/122 (35%), Positives = 61/122 (50%)
  Q:   270 FAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGES---FNNLSVDELKKYQDVSLKTFNINYADVSINSNIDKLLEEIKKSMRLIHRDFDINNES 391
           + GSGTTGHAV+ELN +    GNR F L TN E         I  ++C+ERLY +   + T  E+   + N +   L       LK FN N  ++  N        EIK++   +  DF+  N+S
  S:     3 WEGSGTTGHAVLELNKE--DGGNRTFTLITNNE-------NQIGTNVCYERLYRINNGVGTKNEADFDWINKNKPYLNNLNVYDLKYFNTNPIEIDNN--------EIKEAFTKMLVDFNNTNQS 110
>gi|153890727|ref|ZP_02011790.1| Site-specific DNA-methyltransferase (adenine-specific) [Opitutaceae bacterium TAV2] >gi|151583189|gb|EDN46679.1| Site-specific DNA-methyltransferase (adenine-specific) [Opitutaceae bacterium TAV2] (653 aa)
Score = 109, Expect = 4.2e-03, Identities = 25/75 (33%), Positives = 44/75 (58%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNA---QNDNKYIEKNHEYILAYSKN 75
           MM ERL   K+LL + G I++  D    + ++ +MD+IF  + F + ++W  RN+      +K+  K H+ +  Y+KN
  S:   166 MMYERLSLMKELLSERGSIYVHCDHRVDSLVRRVMDEIFSPERFRNQMIWWYRNSGMKAASDKFHHK-HDVLYFYAKN 242
Score = 101, Expect = 3.1e-02, Identities = 37/121 (30%), Positives = 57/121 (47%)
  Q:   162 RPPIKNG-VLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVME 282
           R P+K+G    R ++ FD    +++K +P   K G  ++Y    +   +   S+    I Q   +NI               +P  KP  L++ +I   SNE  ++ DFF GSGTTG AV E
  S:   251 REPLKDGDSGKRRAYKFD---SKLKKPLPVYDKEGKPVYY----QVGDILAGSVWDVPILQGGDENIG--------------YPTQKPEALLERIIKASSNEGDLVADFFCGSGTTG-AVAE 350
>gi|150009836|ref|YP_001304579.1| putative DNA-methyltransferase [Parabacteroides distasonis ATCC 8503] >gi|149938260|gb|ABR44957.1| putative DNA-methyltransferase [Parabacteroides distasonis ATCC 8503] (315 aa)
Score = 108, Expect = 5.1e-03, Identities = 31/85 (36%), Positives = 48/85 (56%)
  Q:   200 YADEKEYKQVSHKSIVRFNI----NQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           Y++E +   +  K +   NI    N + +  I    G++T R   +  P  KP E+I+ L+   S E +++LDFFAGSGTTG   +E N
  S:   176 YSEEAKKAALKDKRLRPENIEKGKNPTNVWEIGRLNGNSTER---VGHPTQKPTEIIRRLVKALSYEGSLVLDFFAGSGTTGRVCIEEN 261
>gi|146338458|ref|YP_001203506.1| putative site-specific DNA-methyltransferase (adenine-specific) [Bradyrhizobium sp. ORS278] >gi|146191264|emb|CAL75269.1| putative Site-specific DNA-methyltransferase (adenine-specific) [Bradyrhizobium sp. ORS278] (733 aa)
Score = 107, Expect = 6.2e-03, Identities = 28/60 (46%), Positives = 37/60 (61%)
  Q:   243 FPNPKPVELIK--FLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           FP PK +   +   L    S  NA++LDFFAGSGTT HA   LN+  +  G+R+ IL +N E
  S:   479 FPFPKSLYATRDALLTVIGSRPNALVLDFFAGSGTTLHATALLNA--QLGGSRRCILVSNNE 538
>gi|154249196|ref|YP_001410021.1| DNA methylase N-4/N-6 domain-containing protein [Fervidobacterium nodosum Rt17-B1] >gi|154153132|gb|ABS60364.1| DNA methylase N-4/N-6 domain protein [Fervidobacterium nodosum Rt17-B1] (846 aa)
Score = 106, Expect = 8.9e-03, Identities = 29/82 (35%), Positives = 47/82 (57%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-KYIEKNHEYILAYSKNWKNFKIN 82
           M+  R +  + L+ + G IF+  D N  AYLK+L++DIFG+DNF + I   + + Q+   K      + +  +SK+  NFK N
  S:   444 MLENRTRLGRDLMDEKGSIFVRCDYNGNAYLKMLLNDIFGKDNFRNEINVSRISKQDPKVKRFNTAADSLYLFSKS-DNFKFN 525
>gi|150377536|ref|YP_001314131.1| site-specific DNA-methyltransferase (adenine-specific) [Sinorhizobium medicae WSM419] >gi|150032083|gb|ABR64198.1| Site-specific DNA-methyltransferase (adenine-specific) [Sinorhizobium medicae WSM419] (707 aa)
Score = 105, Expect = 9.7e-03, Identities = 44/139 (31%), Positives = 76/139 (54%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN---KYIEKNHEYILAYSKNWK--------NFKINQVFEINKK-KGQLIQMTIGANEDGLLV-----NRKNMG--WTL-YFNPATNEKIPLMDYDPKK-VER 139
           M+ ERL   + LL D+G IF+  D      ++ +M++IFG + F + I+W   N        K  +  H+ +L +SK  K          K+ ++  + KK +G+ I +    N+DG L+       + +G  WT+   NP   E++      P+K +ER
  S:   174 MIYERLILCRDLLADEGSIFVHCDWRVNWAIRSVMNEIFGANFFRNEIIWHYENKLGTGWGAKTFDTRHDVLLRFSKGKKYVHNEIAEKVKVEKMQPVTKKVEGERIWLR---NDDGSLMYAEGAKERPVGDVWTIPIINPVATERLNYPTQKPEKLIER 330
Score = 92, Expect = 3.7e-01, Identities = 33/107 (30%), Positives = 52/107 (48%)
  Q:   241 IEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDICFERLYCLIKNIKTSGESFNNLSVDELKKYQ 347
           + +P  KP +LI+ +I   SNE  +I DFF GSGTT  AV E       K  RK+I+         D+ K  A     +R+  + + +K  G+ +    +  L +Y+
  S:   317 LNYPTQKPEKLIERIILSGSNEGDLIADFFVGSGTTA-AVAE-------KLGRKWIV--------SDLGK-FAVHTTRKRMIGVQRGLKAEGKDYRAFEILNLGRYE 406
>gi|67921543|ref|ZP_00515061.1| DNA methylase N-4/N-6 [Crocosphaera watsonii WH 8501] >gi|67856655|gb|EAM51896.1| DNA methylase N-4/N-6 [Crocosphaera watsonii WH 8501] (319 aa)
Score = 105, Expect = 1.1e-02, Identities = 28/72 (38%), Positives = 41/72 (56%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKD 315
           P  KPV+LI+ +I   S++N I+LD F GSG+T  A + L        NR +I    E++  + IN  IA+D
  S:   230 PTQKPVKLIERIIRASSHKNMIVLDPFMGSGSTAIACLNL--------NRYYIGIEKEDKYIEKINSRIAQD 293
>gi|118576082|ref|YP_875825.1| DNA modification methylase [Cenarchaeum symbiosum A] >gi|118194603|gb|ABK77521.1| DNA modification methylase [Cenarchaeum symbiosum A] (252 aa)
Score = 104, Expect = 1.5e-02, Identities = 24/57 (42%), Positives = 34/57 (59%)
  Q:   247 KPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEER 303
           KP+++IK +I   SNE  +++D FAGSGTT  A  +L        NR FI C + E+
  S:   188 KPLDMIKRIITASSNEGDLVIDCFAGSGTTALACKQL--------NRNFIGCDSNEQ 236
>gi|60202514|gb|AAX14643.1| DNA methyltransferase [Geobacillus stearothermophilus] (447 aa)
Score = 103, Expect = 1.7e-02, Identities = 30/70 (42%), Positives = 37/70 (52%)
  Q:   247 KPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDI 316
           KP+ELIK+LIN  + E  +ILD F GSGTT  A  EL        NR FI     E      NK + ++I
  S:   376 KPIELIKYLINIMTREGQVILDPFVGSGTTAVAAKEL--------NRNFIAFEINEHYHSLANKRLNQEI 437
>gi|121611088|ref|YP_998895.1| DNA methylase N-4/N-6 domain-containing protein [Verminephrobacter eiseniae EF01-2] >gi|121555728|gb|ABM59877.1| DNA methylase N-4/N-6 domain protein [Verminephrobacter eiseniae EF01-2] (972 aa)
Score = 103, Expect = 1.8e-02, Identities = 26/93 (27%), Positives = 48/93 (51%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND----NKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQL 94
           + +RL  A+ LL + G IF+ I +     ++ ++D++FG+ NF+S I +             + +   + +IL Y+KN    K  Q + +   KG L
  S:   249 LRDRLTVARDLLTESGSIFVQIGEENVHRVRTVLDEVFGDANFVSQINFKTTGGAGSPTGGTETLASVNNFILWYAKNGAAIKYRQPYRV---KGDL 342
>gi|17225519|gb|AAL37449.1|AF328915_3 type II DNA modification enzyme [Helicobacter pylori] (343 aa)
Score = 102, Expect = 2.6e-02, Identities = 87/315 (27%), Positives = 129/315 (40%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEIIDKGFVPIRPP--IKNGVLLRW----------SWSFDKA-IERIEK---IIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE---RTKQDINKTIAKDI 316
           + +RL   K+LL + G I++  D     Y+KV++D+IFG  NF + I   K N                      KNFK               +M  G  +D +L   K        NP  NE  P + Y P+ +E+        K DK+      VPI  P  +++G   +            W  D A +ER +K   I      N     YA E+  K+V  + I  F   Q                     +P  K  +L+  +I   SN+N+I+LD F GSGTT  +   L         RKFI   N +   +  ++  +TI KD+
  S:    75 LKQRLVLLKELLSEQGSIYVHTDCKIGHYVKVMLDEIFGIQNFRNEITRIKCNP---------------------KNFK---------------RMGYGNIKDMILFYSKGK------NPIFNE--PKIPYTPQDLEK-----RFPKIDKDKRRYTTVPIHAPGEVESGECSKAFKGMLPPKGRHWRTDIATLERWDKEGLIEYSNNNNPRKKIYALEQVGKRV--QDIWEFKDPQYP------------------SYPTEKNAQLLDLIIKTSSNKNSIVLDCFCGSGTTLKSAFLL--------QRKFIGIDNSDLAIKACKNKLETITKDL 331
>gi|48477657|ref|YP_023363.1| type II restriction modification system, methylation subunit [Picrophilus torridus DSM 9790] >gi|48430305|gb|AAT43170.1| type II restriction modification system, methylation subunit [Picrophilus torridus DSM 9790] (314 aa)
Score = 102, Expect = 2.6e-02, Identities = 24/44 (54%), Positives = 29/44 (65%)
  Q:   241 IEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           I  P P PVEL K LI  +S E+ ++LD F GSGTT  A +ELN
  S:   229 IGHPAPFPVELPKRLIKLYSFEDEVVLDPFIGSGTTAIAAIELN 272
>gi|59711656|ref|YP_204432.1| putative DNA methylase [Vibrio fischeri ES114] >gi|59479757|gb|AAW85544.1| putative DNA methylase [Vibrio fischeri ES114] (285 aa)
Score = 101, Expect = 2.9e-02, Identities = 24/59 (40%), Positives = 32/59 (54%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           P  KP  L++ +I   S E A++LD F GSG+TG A + L        NRKF+    EE
  S:   223 PCEKPANLLEHIIASSSREGAVVLDAFMGSGSTGKACLAL--------NRKFVGIEMEE 273
>gi|171060953|ref|YP_001793302.1| DNA methylase N-4/N-6 domain-containing protein [Leptothrix cholodnii SP-6] >gi|170778398|gb|ACB36537.1| DNA methylase N-4/N-6 domain protein [Leptothrix cholodnii SP-6] (447 aa)
Score = 100, Expect = 3.9e-02, Identities = 28/85 (32%), Positives = 48/85 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-HEYILAYSKNWKNFKINQVFE 86
           +  RL    +LL D G I++ I       +K+++D++FG  NF + I   K +++N  K+   N ++YIL YSK+  ++  NQ  E
  S:   131 IRRRLILMLELLSDQGSIYVHIGHQMLGEMKLILDEVFGAKNFRNIITRRKCSSKNFTKHQYANLNDYILFYSKS-DSYTWNQPME 215
>gi|150401965|ref|YP_001329259.1| DNA methylase N-4/N-6 domain-containing protein [Methanococcus maripaludis C7] >gi|150032995|gb|ABR65108.1| DNA methylase N-4/N-6 domain protein [Methanococcus maripaludis C7] (325 aa)
Score = 99, Expect = 4.7e-02, Identities = 66/280 (23%), Positives = 114/280 (40%)
  Q:     7 KKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKI----PLMDYDPKKVERDSTIENLYKDDKEI--IDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           K+ K++LK +G I +       AY +V+ DD+F  +N   N+VW K + Q                    KN K  + F    ++          N + L             NP   E +    P+++Y  ++ E+   + NL  +   I  +D+      P   +    +WS+  +K   +++ I   + +  Y LF    +E K    +S  R+ +N    D +  S+ S+  RK     P  KP +L K LI   +   +++L  F GSG       EL  +
  S:    57 KEFKRVLKLNGSILLYGHARNIAYQQVIFDDLFFLEN---NLVWHKTDCQTR------------------KNIKGYRCFAPVTERILFYSNEFRKNNNSL------------NNPMYREYVETFKPIIEYFMEEKEKIMKLHNLSTNGDFIRFMDEYMQSTTPARHHFSWSQWSFPSEKTYAKLQHIGDGILEKEYPLFRKHYEELKN-QFESSRRYFVNSEHTDVLFFSQESHITRKY--NHPTQKPPKLTKMLIEATTKPESLVLVPFVGSGVECVTCKELERN 306
>gi|71911257|ref|YP_282807.1| adenine-specific methyltransferase [Streptococcus pyogenes MGAS5005] >gi|94989076|ref|YP_597177.1| adenine-specific methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94992967|ref|YP_601066.1| adenine-specific methyltransferase [Streptococcus pyogenes MGAS2096] >gi|71854039|gb|AAZ52062.1| adenine-specific methyltransferase [Streptococcus pyogenes MGAS5005] >gi|94542584|gb|ABF32633.1| adenine-specific methyltransferase [Streptococcus pyogenes MGAS9429] >gi|94546475|gb|ABF36522.1| Adenine-specific methyltransferase [Streptococcus pyogenes MGAS2096] (283 aa)
Score = 99, Expect = 4.8e-02, Identities = 23/53 (43%), Positives = 35/53 (66%)
  Q:   242 EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVM---------ELNSDPKTKGNRK 294
           + P  KPV L+K +I +H+ + A++LD F GSG+TG A +         ELN D     N++
  S:   159 QHPTQKPVALMKDIITRHTTKGAVVLDPFMGSGSTGVACLLTGRDFIGYELNKDYFNIANKR 220
>gi|108563739|ref|YP_628055.1| adenine-specific DNA methylase [Helicobacter pylori HPAG1] >gi|107837512|gb|ABF85381.1| adenine-specific DNA methylase [Helicobacter pylori HPAG1] (367 aa)
Score = 99, Expect = 4.8e-02, Identities = 21/55 (38%), Positives = 37/55 (67%)
  Q:    40 GEDNFISNIVWDKR-NAQNDNKYIEKNHEYILAYSKN---WKNFKINQVFEINKKKGQL 94
           G DNF++ I+W+K+ + QND K+   NH++IL Y+K+   W+   + +  E+N +   L
  S:    19 GGDNFVNTIIWEKKYSPQNDAKWFSDNHDFILLYAKDKGIWRPNLLPRTSEMNARYKNL 77
>gi|167757886|ref|ZP_02430013.1| hypothetical protein CLOSCI_00217 [Clostridium scindens ATCC 35704] >gi|167664540|gb|EDS08670.1| hypothetical protein CLOSCI_00217 [Clostridium scindens ATCC 35704] (417 aa)
Score = 99, Expect = 5.2e-02, Identities = 21/41 (51%), Positives = 27/41 (65%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           P  KP++L+ + I   S ENAIILD F GSG+T  A  +LN
  S:   327 PTSKPLDLLGYPICNSSQENAIILDTFGGSGSTLMACEQLN 367
>gi|154244502|ref|YP_001415460.1| DNA methylase N-4/N-6 domain-containing protein [Xanthobacter autotrophicus Py2] >gi|154158587|gb|ABS65803.1| DNA methylase N-4/N-6 domain protein [Xanthobacter autotrophicus Py2] (752 aa)
Score = 99, Expect = 5.4e-02, Identities = 24/86 (27%), Positives = 48/86 (55%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGED------NFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQVFE 86
           M+ ERL   + LL  DG +++ +      Y++V++D+IFG+        F + I W   +A +D+     N + I  Y+K   ++ +N+ ++
  S:   171 MLYERLCLIRDLLSPDGSLYVHVGWQVSGYVRVILDEIFGKGGAPGLPGFRNEIAWKCTSAHSDSGRYGINWQTIFYYTKG-GSYTLNETYQ 261
>gi|167585152|ref|ZP_02377540.1| putative modification methylase [Burkholderia ubonensis Bu] (963 aa)
Score = 98, Expect = 6.2e-02, Identities = 24/92 (26%), Positives = 51/92 (55%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND----NKYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQ 93
           + +RL  A+ LL + G IF+ I D     ++ ++D++FG++N    I + K           + I    +Y++ Y+K+ ++ K  Q++ + K+ G+
  S:   227 LRDRLMVARDLLTESGSIFVQIGDENVHRVRAVLDEVFGDENACGLIGYKKTTGAGSPAIGTQVIASVTDYLIWYAKDKRSVKYRQLY-LAKEAGE 321
>gi|3687316|emb|CAA05163.1| methylase [Lactococcus lactis] (296 aa)
Score = 98, Expect = 6.8e-02, Identities = 27/61 (44%), Positives = 35/61 (57%)
  Q:   224 IDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           I N+SS +G +         P  KP+ L+K LI   + EN I+LD F+GSGTT  A  ELN
  S:   221 IPNLSSDRGLH---------PTQKPLVLMKALIELTTQENQIVLDPFSGSGTTLVAAKELN 272
>gi|17225550|gb|AAL37471.1|AF328924_4 type II DNA modification enzyme [Helicobacter pylori] (343 aa)
Score = 98, Expect = 7.2e-02, Identities = 28/73 (38%), Positives = 42/73 (57%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-HEYILAYSK 74
           + +RL   K+LL + G I++  D     Y+KV++D+IFG  NFI+ I   K N +N  +    N  + IL YSK
  S:    75 LKQRLVLLKELLSEQGSIYVHTDCKIGHYVKVMLDEIFGIQNFINEITRIKCNPKNFKRMGYGNIKDMILFYSK 148
>gi|153870157|ref|ZP_01999614.1| type II DNA modification enzyme [Beggiatoa sp. PS] >gi|152073377|gb|EDN70386.1| type II DNA modification enzyme [Beggiatoa sp. PS] (526 aa)
Score = 98, Expect = 7.5e-02, Identities = 27/64 (42%), Positives = 35/64 (54%)
  Q:   221 QSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           QS+ D+I     S  + +LG  +P  KP  L++ +I   SNE  IILD F G GTT  A   LN
  S:   270 QSLWDDIPPIN-SQAIERLG--YPTQKPKALLERIIQASSNEGDIILDAFCGCGTTVDAAESLN 330
Score = 93, Expect = 2.4e-01, Identities = 22/75 (29%), Positives = 41/75 (54%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQ-NDNKYIEKNHEYILAYSKN 75
           MM+ R+ +  ++LK  G  ++  D     YLK + D +FG  NF + I W +   + N +K +  + + +L Y+K+
  S:    99 MMTLRIIELHKVLKPTGSFYLHCDPTASHYLKTVCDAVFGVKNFRNEISWKRSTPRGNASKKLAVSCDVVLFYTKS 174
>gi|190890732|ref|YP_001977274.1| putative helicase/DNA methylase hybrid protein [Rhizobium etli CIAT 652] >gi|190696011|gb|ACE90096.1| putative helicase/DNA methylase hybrid protein [Rhizobium etli CIAT 652] (1324 aa)
Score = 98, Expect = 7.6e-02, Identities = 21/38 (55%), Positives = 26/38 (68%)
  Q:   240 GIE-FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTG 277
           GIE FP PKP  L+  ++   +N   +ILD FAGSGTTG
  S:  1069 GIEPFPTPKPERLLHRILTIATNPGDLILDSFAGSGTTG 1107
>gi|61805940|ref|YP_214300.1| possible N6A methyltransferase [Prochlorococcus phage P-SSM2] >gi|61374449|gb|AAX44446.1| possible N6A methyltransferase [Cyanophage P-SSM2] (306 aa)
Score = 98, Expect = 7.6e-02, Identities = 33/119 (27%), Positives = 55/119 (46%)
  Q:   185 EKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEER 303
           E I P     G++L     K Y Q +H S+ +++ +   + +++                 PKP+EL+K +I   ++E   +LD F GSG+T  A +E N D        +IL   EE+
  S:   183 ETIKPITKHLGFTLDDLVPKFYNQRTHHSVWQYDFDSKKMGHLT-----------------PKPIELLKNVILHCTDEGDTVLDCFGGSGSTAVACIETNRD--------YILIEREEK 276
>gi|57242064|ref|ZP_00370004.1| adenine specific DNA methyltransferase (mod) [Campylobacter upsaliensis RM3195] >gi|57017256|gb|EAL54037.1| adenine specific DNA methyltransferase (mod) [Campylobacter upsaliensis RM3195] (204 aa)
Score = 98, Expect = 7.7e-02, Identities = 26/52 (50%), Positives = 34/52 (65%)
  Q:   266 ILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTIAKDIC 317
           +LDFFAGSGT   AVMELN++    GNR+FIL   +E   +  +K +A D C
  S:     1 MLDFFAGSGTIAQAVMELNAE--DGGNRQFILVQLDEPIDEAKSK-VAYDFC 49
>gi|153817361|ref|ZP_01970028.1| haemagglutinin associated protein [Vibrio cholerae NCTC 8457] >gi|126512110|gb|EAZ74704.1| haemagglutinin associated protein [Vibrio cholerae NCTC 8457] (241 aa)
Score = 97, Expect = 8.7e-02, Identities = 24/56 (42%), Positives = 33/56 (58%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC 298
           +P  KPVEL++ LI + S+EN I+ D F GSG+T  A   L        +RK+I C
  S:   180 YPTEKPVELLEVLIRQSSSENEIVADSFFGSGSTLIAANNL--------SRKYIGC 227
>gi|15601210|ref|NP_232841.1| haemagglutinin associated protein [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121586498|ref|ZP_01676285.1| haemagglutinin associated protein [Vibrio cholerae 2740-80] >gi|121726174|ref|ZP_01679472.1| haemagglutinin associated protein [Vibrio cholerae V52] >gi|147672291|ref|YP_001215657.1| haemagglutinin associated protein [Vibrio cholerae O395] >gi|153220964|ref|ZP_01952046.1| haemagglutinin associated protein [Vibrio cholerae MAK 757] >gi|153820932|ref|ZP_01973599.1| haemagglutinin associated protein [Vibrio cholerae B33] >gi|194533024|ref|YP_002068444.1| haemagglutinin associated protein [Vibrio cholerae MO10] >gi|48357|emb|CAA45727.1| haemagglutinin associated protein [Vibrio cholerae] >gi|9657850|gb|AAF96353.1| haemagglutinin associated protein [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121549323|gb|EAX59354.1| haemagglutinin associated protein [Vibrio cholerae 2740-80] >gi|121631393|gb|EAX63765.1| haemagglutinin associated protein [Vibrio cholerae V52] >gi|124120192|gb|EAY38935.1| haemagglutinin associated protein [Vibrio cholerae MAK 757] >gi|125619076|gb|EAZ47607.1| haemagglutinin associated protein [Vibrio cholerae MO10] >gi|126521515|gb|EAZ78738.1| haemagglutinin associated protein [Vibrio cholerae B33] >gi|146314674|gb|ABQ19214.1| haemagglutinin associated protein [Vibrio cholerae O395] (230 aa)
Score = 97, Expect = 8.9e-02, Identities = 24/56 (42%), Positives = 33/56 (58%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC 298
           +P  KPVEL++ LI + S+EN I+ D F GSG+T  A   L        +RK+I C
  S:   169 YPTEKPVELLEVLIRQSSSENEIVADSFFGSGSTLIAANNL--------SRKYIGC 216
>gi|118047702|ref|ZP_01516332.1| site-specific DNA-methyltransferase (adenine-specific) [Chloroflexus aggregans DSM 9485] >gi|117995766|gb|EAV09977.1| site-specific DNA-methyltransferase (adenine-specific) [Chloroflexus aggregans DSM 9485] (172 aa)
Score = 97, Expect = 9.1e-02, Identities = 17/40 (42%), Positives = 30/40 (75%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGE 41
           + +RL   ++LL DDG I++ +D+N   ++KV+MD+IFG+
  S:   121 LRQRLIFLRELLADDGSIYVHLDENMAFHVKVIMDEIFGK 160
>gi|157952314|ref|YP_001497206.1| hypothetical protein NY2A_B010R [Paramecium bursaria Chlorella virus NY2A] >gi|155122541|gb|ABT14409.1| hypothetical protein NY2A_B010R [Paramecium bursaria Chlorella virus NY2A] (303 aa)
Score = 96, Expect = 1.2e-01, Identities = 25/71 (35%), Positives = 37/71 (52%)
  Q:   214 IVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           + +FN+   + D  S     N  R +    P  KP+ELI+ LI   SNEN ++ D F GSG T +   ++N
  S:   200 VYKFNVKFGLTDVWSDINFYN--RSVQKIHPTQKPIELIQRLIESSSNENDVVCDPFGGSGVTWYVCQKMN 268
>gi|168697888|ref|ZP_02730165.1| ParB domain protein nuclease [Gemmata obscuriglobus UQM 2246] (681 aa)
Score = 95, Expect = 1.6e-01, Identities = 21/47 (44%), Positives = 27/47 (57%)
  Q:   242 EFPNPKPVELIKFLINKHSNENAIILDFFAGSGT-------TGHAVMELNSDPK 288
           + P PKP EL  +L+N       ++LD FAGSGT       TG     L  DP+
  S:   606 DHPTPKPAELFAYLLNNSCPPGGLVLDPFAGSGTALAAAEQTGRNAALLELDPR 659
>gi|396849|emb|CAA45447.1| unnamed protein product [Vibrio cholerae] >gi|746236|prf||2017285G hemagglutinin (217 aa)
Score = 95, Expect = 1.6e-01, Identities = 24/56 (42%), Positives = 32/56 (57%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILC 298
           +P  KPVEL++ LI + S+EN I+ D F GSG T  A   L        +RK+I C
  S:   156 YPTEKPVELLEVLIRQSSSENEIVADSFFGSGATLIAANNL--------SRKYIGC 203
>gi|151569480|gb|EDN35134.1| predicted protein [Francisella tularensis subsp. tularensis FSC033] (147 aa)
Score = 94, Expect = 1.9e-01, Identities = 23/38 (60%), Positives = 28/38 (73%)
  Q:   265 IILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEE 302
           IILDFFAGSGT G AVM+LN++    G RK+IL   +E
  S:    12 IILDFFAGSGTIGDAVMQLNAE--DGGKRKYILAQLDE 47
>gi|115375188|ref|ZP_01462455.1| DNA methylase [Stigmatella aurantiaca DW4/3-1] >gi|115367839|gb|EAU66807.1| DNA methylase [Stigmatella aurantiaca DW4/3-1] (289 aa)
Score = 94, Expect = 1.9e-01, Identities = 19/40 (47%), Positives = 27/40 (67%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMEL 283
           P  KPV L++ +I   + E+A +LD F GSGTTG A ++L
  S:   224 PTQKPVALLERIIEASTPEDATVLDPFNGSGTTGVAALKL 263
>gi|172039381|ref|YP_001805882.1| putative DNA methylase N-4/N-6 [Cyanothece sp. ATCC 51142] >gi|171700835|gb|ACB53816.1| putative DNA methylase N-4/N-6 [Cyanothece sp. ATCC 51142] (295 aa)
Score = 94, Expect = 2.2e-01, Identities = 26/69 (37%), Positives = 36/69 (52%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNEERTKQDINKTI 312
           P  KPV+L++ +I   S EN I+LD F GSG+T  A + L        NR +I    E++    IN  I
  S:   230 PTQKPVKLMERIIRASSQENMIVLDPFMGSGSTAIACLNL--------NRHYIGIEKEKKYIDKINSRI 290
>gi|159904415|ref|YP_001548077.1| DNA methylase N-4/N-6 domain-containing protein [Methanococcus maripaludis C6] >gi|159885908|gb|ABX00845.1| DNA methylase N-4/N-6 domain protein [Methanococcus maripaludis C6] (327 aa)
Score = 94, Expect = 2.3e-01, Identities = 62/274 (22%), Positives = 114/274 (41%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDN-----KYIEKNHEYILAYSKNWKNFKINQVFEINKKKGQLIQMTIGANEDGLLVNRKNMGWTLYFNPATNEKIPLMDYDPKKVERDSTIENLYKDDKEI--IDKGFVPIRPPIKNGVLLRWSWSFDKAIERIEKIIPKMTKNGYSLFYADEKEYKQVSHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSG 274
           M  +  K+ K++LK +G I +       AY +V+ DD+F  +N   N+VW K + Q        +      E IL YS  ++                               N  ++   +Y     N K P+++Y  ++ E+   + NL  +   I  +D+      P   +    +W++   K   ++++I   + +  Y LF    ++ K+   +S  R+ +N    D +   + S+  RK     P  KP +L K LI   +   +++L  F GSG
  S:    51 MHEKMAKEFKRVLKLNGSILLYGHAKNIAYQQVIFDDLFFLEN---NLVWHKTDCQTRKNIKGYRCFAPVTERILFYSNEYRK------------------------------NNNSLNNPMYREYVENFK-PIIEYFMEEKEKIMKLHNLNTNGDFIRFMDEYMESTTPARHHFSWSQWTFPSAKTYAKLQRIGNGILEKEYPLFKTHYEDLKK-QFESSRRYFVNSEHTDVLFFPQESHITRKY--NHPTQKPPKLSKMLIEATTKPESLVLVPFVGSG 294
>gi|23428395|gb|AAL15431.1| DNA methyltransferase B [Moraxella nonliquefaciens] >gi|52788778|gb|AAU87369.1| MnlI m6A-methyltransferase [Moraxella nonliquefaciens] (239 aa)
Score = 94, Expect = 2.3e-01, Identities = 21/41 (51%), Positives = 26/41 (63%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           P  KP+ L+  +I  H+NEN IILD F G G+TG A   LN
  S:   177 PTQKPLALMSEIIQIHTNENEIILDPFMGVGSTGVACQGLN 217
>gi|57234145|ref|YP_181807.1| DNA methylase [Dehalococcoides ethenogenes 195] >gi|57224593|gb|AAW39650.1| DNA methylase [Dehalococcoides ethenogenes 195] (421 aa)
Score = 93, Expect = 2.5e-01, Identities = 17/43 (39%), Positives = 28/43 (65%)
  Q:   242 EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           + P  KP++L+ + I   S EN++++D F GSG+T  A  +LN
  S:   323 DHPTSKPLDLLGYPIKNSSQENSVVIDTFGGSGSTLMACEQLN 365
>gi|194015228|ref|ZP_03053844.1| DNA methylase [Bacillus pumilus ATCC 7061] >gi|194012632|gb|EDW22198.1| DNA methylase [Bacillus pumilus ATCC 7061] (253 aa)
Score = 93, Expect = 2.5e-01, Identities = 21/43 (48%), Positives = 27/43 (62%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSD 286
           P  KPV+L ++LI   +NE  IILD   GSGTT  A  +LN +
  S:   177 PTQKPVKLFEWLIKTFTNEGDIILDSCIGSGTTAVAATQLNRN 219
>gi|15612349|ref|NP_224002.1| type II DNA modification (methyltransferase [Helicobacter pylori J99] >gi|4155888|gb|AAD06858.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter pylori J99] (649 aa)
Score = 93, Expect = 2.6e-01, Identities = 26/87 (29%), Positives = 44/87 (50%)
  Q:     1 MMSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQND-NKYIEKNHEYILAYSKNWKNFKINQVFEI 87
           +M  RL+ A   L   G  ++ +D       ++L++DIF ++NF + I+W  R  Q        + H+ +L YSKN     +N  F+I
  S:   300 LMHNRLQLAYDFLSPQGNFYLHLDYRANYLGRMLLNDIFSKENFRNEIIWHFRTYQGQIQSNFPRKHDSLLWYSKNC---NVNNFFKI 384
>gi|113474753|ref|YP_720814.1| hypothetical protein Tery_0950 [Trichodesmium erythraeum IMS101] >gi|110165801|gb|ABG50341.1| hypothetical protein Tery_0950 [Trichodesmium erythraeum IMS101] (501 aa)
Score = 93, Expect = 2.8e-01, Identities = 23/63 (36%), Positives = 37/63 (58%)
  Q:   212 KSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSG 274
           K +  FN+N + I+++++ KG   +     ++   KP+E + FLI   + EN IILD F GSG
  S:     9 KQLSLFNLNSTNIEDLATPKGYKGIAAFH-KYWGKKPIECLSFLIESLTTENDIILDPFLGSG 70
>gi|41057660|ref|NP_958114.1| gp10 [Burkholderia phage Bcep43] >gi|40737647|gb|AAR89300.1| gp10 [Burkholderia cepacia phage Bcep43] (262 aa)
Score = 93, Expect = 2.9e-01, Identities = 26/74 (35%), Positives = 43/74 (58%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRK----FILCTNEERTKQDINKTIAKDIC 317
           P  KPV L+++LI  +++E   +LD   GSGTTG A   +N+  +  G  K     ++ T   R ++ I++ I  D+C
  S:   189 PTAKPVALMEYLIRTYTSEGDTVLDNCMGSGTTGVAC--INTGRRFIGMEKDADYALIATG--RMREAIDRDIPIDLC 262
>gi|23752321|ref|NP_705636.1| gp10 [Burkholderia phage Bcep781] >gi|23507188|gb|AAN38011.1| gp10 [Burkholderia cepacia phage Bcep781] (262 aa)
Score = 93, Expect = 2.9e-01, Identities = 26/74 (35%), Positives = 43/74 (58%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRK----FILCTNEERTKQDINKTIAKDIC 317
           P  KPV L+++LI  +++E   +LD   GSGTTG A   +N+  +  G  K     ++ T   R ++ I++ I  D+C
  S:   189 PTAKPVALMEYLIRTYTSEGDTVLDNCMGSGTTGVAC--INTGRRFIGMEKDADYALIATG--RMREAIDRDIPIDLC 262
>gi|1171051|sp|P43871|MTH3_HAEIN Modification methylase HindIII (M.HindIII) (Adenine-specific methyltransferase HindIII) >gi|290943|gb|AAA61959.1| HindIII modification methyltransferase (309 aa)
Score = 92, Expect = 3.2e-01, Identities = 28/75 (37%), Positives = 40/75 (53%)
  Q:   210 SHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           +  S+  +NI Q  +++ +  K   T    G      KP+ L+K LI+  + E  I+LD FAGSGTT  A  ELN
  S:   202 NENSLTHWNIQQGALNHSNILKVRITSEDKGYHVAQ-KPLNLMKLLIDLVTKEEQIVLDPFAGSGTTLLAAKELN 275
>gi|16273302|ref|NP_439546.1| modification methylase [Haemophilus influenzae Rd KW20] >gi|1574226|gb|AAC23039.1| modification methylase (hindIIIM) [Haemophilus influenzae Rd KW20] (309 aa)
Score = 92, Expect = 3.4e-01, Identities = 28/75 (37%), Positives = 40/75 (53%)
  Q:   210 SHKSIVRFNINQSIIDNISSSKGSNTLRKLGIEFPNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           +  S+  +NI Q  +++ +  K   T    G      KP+ L+K LI+  + E  I+LD FAGSGTT  A  ELN
  S:   202 NENSLTHWNIQQGALNHSNILKVRITSEDKGYHVAQ-KPLNLMKLLIDLVTKEEQIVLDPFAGSGTTLLAAKELN 275
>gi|124005746|ref|ZP_01690585.1| chromosome partitioning protein [Microscilla marina ATCC 23134] >gi|123988814|gb|EAY28420.1| chromosome partitioning protein [Microscilla marina ATCC 23134] (494 aa)
Score = 92, Expect = 3.5e-01, Identities = 33/78 (42%), Positives = 42/78 (53%)
  Q:   199 FYADEKEYKQVSHKSIV-RFNINQSIIDNISSSKGSNTLRK----LGI--EFPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           F     E K +SH  +  RF  N  + D  S++  SN  RK    LG     P PKPV +I   +   +NE  I+LD F GSGTT
  S:   353 FIFKSGEAKHLSHLELKDRFRSN--VWDYKSANDFSNEERKEFGKLGALENHPTPKPVRMIADALLDTTNEGDIVLDCFLGSGTT 435
>gi|17225510|gb|AAL37443.1|AF328912_2 type II DNA modification enzyme [Helicobacter pylori] (315 aa)
Score = 92, Expect = 3.7e-01, Identities = 27/73 (36%), Positives = 41/73 (56%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKN-HEYILAYSK 74
           + +RL   K+LL + G I++  D     Y+KV++D+IFG  NF + I   K N +N  +    N  + IL YSK
  S:    47 LKQRLVLLKELLSEQGSIYVHTDYKIGHYVKVMLDEIFGIQNFRNEITRIKCNPKNFKRIGYGNIKDMILFYSK 120
>gi|2314540|gb|AAD08413.1| type III restriction enzyme M protein (mod) [Helicobacter pylori 26695] (288 aa)
Score = 92, Expect = 3.7e-01, Identities = 18/34 (52%), Positives = 25/34 (73%)
  Q:   243 FPNPKPVELIKFLINKHSNENAIILDFFAGSGTT 276
           F NPKP  L++ ++   + EN ++LDFFAGSGTT
  S:   110 FNNPKPEALLQRILEISTKENDLVLDFFAGSGTT 143
>gi|168694979|ref|ZP_02727256.1| putative site-specific DNA-methyltransferase [Clostridium difficile QCD-37x79] >gi|168712281|ref|ZP_02744558.1| putative site-specific DNA-methyltransferase [Clostridium difficile QCD-63q42] (269 aa)
Score = 92, Expect = 3.8e-01, Identities = 22/41 (53%), Positives = 27/41 (65%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELN 284
           P  KPV L+K LI  +SNE  +ILDF AG  +TG A +E N
  S:   184 PTEKPVPLLKDLIMTYSNEGDVILDFTAGVISTGVAALETN 224
>gi|167621143|ref|ZP_02389774.1| putative modification methylase [Burkholderia thailandensis Bt4] (963 aa)
Score = 92, Expect = 3.9e-01, Identities = 18/82 (21%), Positives = 44/82 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQ 83
           + +R+   + LL + G +F+ I       ++ ++D++FGE NF++ I + +      +  I+   ++IL ++K+ +  K  +
  S:   246 LRDRVIVFRDLLNESGSVFVQIGVENVHRVRAVLDEVFGESNFVAQIAF-RTTTGKASAAIDTTQDFILWFAKDLQKLKFRR 326
>gi|167560981|ref|ZP_02353897.1| putative modification methylase [Burkholderia oklahomensis EO147] (963 aa)
Score = 92, Expect = 3.9e-01, Identities = 18/82 (21%), Positives = 44/82 (53%)
  Q:     2 MSERLKKAKQLLKDDGIIFISIDDNEQAYLKVLMDDIFGEDNFISNIVWDKRNAQNDNKYIEKNHEYILAYSKNWKNFKINQ 83
           + +R+   + LL + G +F+ I       ++ ++D++FGE NF++ I + +      +  I+   ++IL ++K+ +  K  +
  S:   246 LRDRVIVFRDLLNESGSVFVQIGVENVHRVRAVLDEVFGESNFVAQIAF-RTTTGKASAAIDTTQDFILWFAKDLQKLKFRR 326
>gi|116622013|ref|YP_824169.1| DNA methylase N-4/N-6 domain-containing protein [Solibacter usitatus Ellin6076] >gi|116225175|gb|ABJ83884.1| DNA methylase N-4/N-6 domain protein [Solibacter usitatus Ellin6076] (296 aa)
Score = 92, Expect = 3.9e-01, Identities = 24/64 (37%), Positives = 36/64 (56%)
  Q:   244 PNPKPVELIKFLINKHSNENAIILDFFAGSGTTGHAVMELNSDPKTKGNRKFILCTNE------------ERTKQD 307
           P  KPV LI++L+ +++ E   +LD F G+GTT  A  ++         R FI   N+             R+KQD
  S:   132 PTQKPVRLIRYLLEQYTKEGDTVLDPFVGTGTTAVACKQM--------RRHFIAIDNDPAYIKMATARLTTRSKQD 199