>gi|26553500|ref|NP_757434.1| ribosomal protein S20 [Mycoplasma penetrans HF-2] >gi|81748114|sp|Q8EX02|RS20_MYCPE 30S ribosomal protein S20 >gi|26453506|dbj|BAC43838.1| ribosomal protein S20 [Mycoplasma penetrans HF-2] (78 aa)
Score = 198, Expect = 2.8e-14, Identities = 78/78 (100%), Positives = 78/78 (100%)
  Q:     1 MANIKSNLKRNKQNRARHTVVHSQTSAVKTQIKKTQASKSQKDLSLAYKKIDSALAKGIIKQNKADRLKSRLALNVAR 78
           MANIKSNLKRNKQNRARHTVVHSQTSAVKTQIKKTQASKSQKDLSLAYKKIDSALAKGIIKQNKADRLKSRLALNVAR
  S:     1 MANIKSNLKRNKQNRARHTVVHSQTSAVKTQIKKTQASKSQKDLSLAYKKIDSALAKGIIKQNKADRLKSRLALNVAR 78