>gi|26553936|ref|NP_757870.1| signal recognition particle GTPase FtsY [Mycoplasma penetrans HF-2] >gi|26453944|dbj|BAC44274.1| signal recognition particle GTPase FtsY [Mycoplasma penetrans HF-2] (354 aa)
Score = 1588, Expect = 9.1e-175, Identities = 354/354 (100%), Positives = 354/354 (100%)
  Q:     1 MAFGFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELVI 354
           MAFGFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELVI
  S:     1 MAFGFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELVI 354
>gi|13357698|ref|NP_077972.1| SRP family GTP-binding protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762333|ref|YP_001752224.1| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920430|ref|ZP_02931745.1| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508691|ref|ZP_02689930.2| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701943|ref|ZP_02554397.2| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11279276|pir||D82930 SRP family of GTP-binding proteins, cell division protein UU141 [imported] - Ureaplasma urealyticum >gi|6899100|gb|AAF30547.1|AE002114_14 SRP family of GTP-binding proteins - cell division protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827910|gb|ACA33172.1| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902878|gb|EDT49167.1| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675613|gb|EDT87518.1| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700694|gb|EDU18976.1| signal recognition particle-docking protein FtsY [Ureaplasma parvum serovar 6 str. ATCC 27818] (351 aa)
Score = 1014, Expect = 3.2e-108, Identities = 233/345 (67%), Positives = 283/345 (82%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFKKI NK+ GKK+   E +S +I +KN E +  IL++      KF+EGL+KSSS L+ AI E+  K+  +DE +YE++EE+LISYDVG +ATNKI ++IR E+ +Q V DPDLIK II+DKIF YYIQDT+ NT +++K+++TN++L++GVNGVGKTTSIAKI   FI ++KKVLLVAGDTFRAGAVEQL +W+QRL  DI LP+KEGQDPASVI+ GVKKG ++ YDLVICDTSGRL NKINLM EL+KIH VIHKFD+ APHE LLVLDAT GQSGI QAKAF E+T I+GIILTKMD TS+GGIVL+IKD FNIPVK IGLGEKLEDLS FDLE +VD I
  S:     2 GFFKKIFNKILGKKD--TEQISQEISQKNEENR--ILKLEDNSINKFNEGLRKSSSALTDAINELAVKYIDIDERWYEHLEEVLISYDVGYVATNKIIESIRNEMIYQKVNDPDLIKSIIIDKIFIYYIQDTEINTAINLKENQTNVVLVVGVNGVGKTTSIAKITKKFIDENKKVLLVAGDTFRAGAVEQLKVWAQRLGVDIELPNKEGQDPASVIYAGVKKGYEQKYDLVICDTSGRLQNKINLMNELKKIHDVIHKFDEYAPHETLLVLDATQGQSGINQAKAFNEVTKISGIILTKMDSTSRGGIVLAIKDAFNIPVKLIGLGEKLEDLSVFDLEMYVDSI 342
>gi|188524093|ref|ZP_02557344.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530850|ref|ZP_02546611.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568713|ref|ZP_02828750.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 2] >gi|195659882|gb|EDX53262.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 12 str. ATCC 33696] (351 aa)
Score = 1001, Expect = 1.1e-106, Identities = 229/345 (66%), Positives = 282/345 (81%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFKKI NK+ GKK+     +S +I +KN E +  IL++      KF+EGL+KSSS L+ AI E+  K+  ++EE+YE++EE+LI YDVG +ATNKI ++IR E+ +Q V DP+LIK II+DKIF YYIQDT+ NT +++K+++TN++L++GVNGVGKTTSIAKI   FI ++KKVLLVAGDTFRAGAVEQL +W+QRL  DI LP+KEGQDPASVI+ GVKKG ++ YDLVICDTSGRL NKINLM EL+KIH VIHKFD+ APHE LLVLDAT GQSGI QAKAF E+T I+GIILTKMD TS+GGIVL+IKD FNIPVK IGLGEKL+DLS FDLE +VD I
  S:     2 GFFKKIFNKILGKKDTG--QVSEEISQKNEENR--ILKLEDNSINKFNEGLRKSSSALTNAINELATKYIDINEEWYEHLEEVLIGYDVGYVATNKIIESIRNEMIYQKVNDPELIKSIIIDKIFIYYIQDTEINTAINLKENQTNVVLVVGVNGVGKTTSIAKITKKFIDENKKVLLVAGDTFRAGAVEQLKVWAQRLGVDIELPNKEGQDPASVIYAGVKKGYEQKYDLVICDTSGRLQNKINLMNELKKIHDVIHKFDEHAPHETLLVLDATQGQSGINQAKAFNEVTKISGIILTKMDSTSRGGIVLAIKDAFNIPVKLIGLGEKLDDLSVFDLEMYVDSI 342
>gi|185178762|ref|ZP_02554787.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188039632|ref|ZP_02528961.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 8] >gi|188518543|ref|ZP_02556795.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188592525|ref|ZP_02694085.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 10] >gi|184209374|gb|EDU06417.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188997922|gb|EDU67019.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 11 str. ATCC 33695] (351 aa)
Score = 997, Expect = 3.3e-106, Identities = 229/345 (66%), Positives = 281/345 (81%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFKKI NK+ GKK+     +S +I +KN E +  IL++      KF+EGL+KSSS L+ AI E+  K+  ++EE+YE++EE+LI YDVG +ATNKI ++IR E+ +Q V DP+LIK II+DKIF YYIQDT+ NT +++K+++TN++L++GVNGVGKTTSIAKI   FI ++KKVLLVAGDTFRAGAVEQL +W+QRL  DI LP KEGQDPASVI+ GVKKG ++ YDLVICDTSGRL NKINLM EL+KIH VIHKFD+ APHE LLVLDAT GQSGI QAKAF E+T I+GIILTKMD TS+GGIVL+IKD FNIPVK IGLGEKL+DLS FDLE +VD I
  S:     2 GFFKKIFNKILGKKDTG--QVSEEISQKNEENR--ILKLEDNSINKFNEGLRKSSSALTNAINELATKYIDINEEWYEHLEEVLIGYDVGYVATNKIIESIRNEMIYQKVNDPELIKSIIIDKIFIYYIQDTEINTEINLKQNQTNVVLVVGVNGVGKTTSIAKITKKFINENKKVLLVAGDTFRAGAVEQLKVWAQRLNVDIELPIKEGQDPASVIYAGVKKGYEQKYDLVICDTSGRLQNKINLMNELKKIHDVIHKFDEHAPHETLLVLDATQGQSGINQAKAFNEVTKISGIILTKMDSTSRGGIVLAIKDAFNIPVKLIGLGEKLDDLSVFDLEMYVDSI 342
>gi|188024295|ref|ZP_02570025.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188018969|gb|EDU57009.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 7 str. ATCC 27819] (351 aa)
Score = 996, Expect = 4.5e-106, Identities = 228/345 (66%), Positives = 281/345 (81%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFKKI NK+ GKK+     +S +I +KN E +  IL++      KF+EGL+KSSS L+ AI E+  K+  ++EE+YE++EE+LI YDVG +ATNKI ++IR E+ +Q V DP+LIK II+DKIF YYIQDT+ NT +++K+++TN++L++GVNGVGKTTSIAKI   FI ++KKVLLVAGDTFRAGAVEQL +W+QRL  DI LP KEGQDPASVI+ GVKKG ++ YDLVICDTSGRL NKINLM EL+KIH +IHKFD+ APHE LLVLDAT GQSGI QAKAF E+T I+GIILTKMD TS+GGIVL+IKD FNIPVK IGLGEKL+DLS FDLE +VD I
  S:     2 GFFKKIFNKILGKKDTG--QVSEEISQKNEENR--ILKLEDNSINKFNEGLRKSSSALTNAINELATKYIDINEEWYEHLEEVLIGYDVGYVATNKIIESIRNEMIYQKVNDPELIKSIIIDKIFIYYIQDTEINTEINLKQNQTNVVLVVGVNGVGKTTSIAKITKKFINENKKVLLVAGDTFRAGAVEQLKVWAQRLNVDIELPIKEGQDPASVIYAGVKKGYEQKYDLVICDTSGRLQNKINLMNELKKIHDIIHKFDEHAPHETLLVLDATQGQSGINQAKAFNEVTKISGIILTKMDSTSRGGIVLAIKDAFNIPVKLIGLGEKLDDLSVFDLEMYVDSI 342
>gi|171920824|ref|ZP_02932001.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|195867735|ref|ZP_03079736.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903592|gb|EDT49881.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|195660590|gb|EDX53846.1| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (351 aa)
Score = 992, Expect = 1.2e-105, Identities = 228/345 (66%), Positives = 281/345 (81%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFKKI NK+ GKK+     +S +I +KN E +  IL++      KF+EGL+KSSS L+ AI E+  K+  ++EE+YE++EE+LI YDVG +ATNKI ++IR E+ +Q V DP+LIK II+DKIF YYIQDT+ +T +++K+++TN++L++GVNGVGKTTSIAKI   FI ++KKVLLVAGDTFRAGAVEQL +W+QRL  DI LP KEGQDPASVI+ GVKKG ++ YDLVICDTSGRL NKINLM EL+KIH VIHKFD+ APHE LLVLDAT GQSGI QAKAF E+T I+GIILTKMD TS+GGIVL+IKD FNIPVK IGLGEKL+DLS FDLE +VD I
  S:     2 GFFKKIFNKILGKKDTG--QVSEEISQKNEENR--ILKLEDNSINKFNEGLRKSSSALTNAINELATKYIDINEEWYEHLEEVLIGYDVGYVATNKIIESIRNEMIYQKVNDPELIKSIIIDKIFIYYIQDTEISTEINLKQNQTNVVLVVGVNGVGKTTSIAKITKKFINENKKVLLVAGDTFRAGAVEQLKVWAQRLNVDIELPIKEGQDPASVIYAGVKKGYEQKYDLVICDTSGRLQNKINLMNELKKIHDVIHKFDEHAPHETLLVLDATQGQSGINQAKAFNEVTKISGIILTKMDSTSRGGIVLAIKDAFNIPVKLIGLGEKLDDLSVFDLEMYVDSI 342
>gi|188039734|ref|ZP_02529166.2| signal recognition particle-docking protein FtsY [Ureaplasma urealyticum serovar 8] (337 aa)
Score = 983, Expect = 1.2e-104, Identities = 226/341 (66%), Positives = 278/341 (81%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           FFKKI NK+ GKK+     +S +I +KN E +  IL++      KF+EGL+KSSS L+ AI E+  K+  ++EE+YE++EE+LI YDVG +ATNKI ++IR E+ +Q V DP+LIK II+DKIF YYIQDT+ NT +++K+++TN++L++GVNGVGKTTSIAKI   FI ++KKVLLVAGDTFRAGAVEQL +W+QRL  DI LP KEGQDPASVI+ GVKKG ++ YDLVICDTSGRL NKINLM EL+KIH VIHKFD+ APHE LLVLDAT GQSGI QAKAF E+T I+GIILTKMD TS+GGIVL+IKD FNIPVK IGLGEKL+DLS FDLE +V
  S:     1 FFKKIFNKILGKKDTG--QVSEEISQKNEENR--ILKLEDNSINKFNEGLRKSSSALTNAINELATKYIDINEEWYEHLEEVLIGYDVGYVATNKIIESIRNEMIYQKVNDPELIKSIIIDKIFIYYIQDTEINTEINLKQNQTNVVLVVGVNGVGKTTSIAKITKKFINENKKVLLVAGDTFRAGAVEQLKVWAQRLNVDIELPIKEGQDPASVIYAGVKKGYEQKYDLVICDTSGRLQNKINLMNELKKIHDVIHKFDEHAPHETLLVLDATQGQSGINQAKAFNEVTKISGIILTKMDSTSRGGIVLAIKDAFNIPVKLIGLGEKLDDLSVFDLEMYV 337
>gi|12045153|ref|NP_072964.1| signal recognition particle-docking protein FtsY [Mycoplasma genitalium G37] >gi|1346049|sp|P47539|FTSY_MYCGE Cell division protein ftsY homolog >gi|1045995|gb|AAC71519.1| signal recognition particle-docking protein FtsY [Mycoplasma genitalium G37] >gi|166078691|gb|ABY79309.1| signal recognition particle-docking protein FtsY [synthetic Mycoplasma genitalium JCVI-1.0] (346 aa)
Score = 863, Expect = 1.1e-90, Identities = 189/342 (55%), Positives = 248/342 (72%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           GF  K++ KLK KK        AK  ++ +EKQ+    +     K + +GLKKS++T +K I E+ K++  VDE+F EN+ E L+  DVG  A NKI DAI E+I    + D  LIKE+I+D+I  YYIQD   +T L +K + TN+ L +GVNGVGKTT++AKIA+ FIK++K+VLLVAGDTFRAGA+EQLN W++ L CDIVLP+ + Q PA VIF GVKKG D+ YD V+CDTSGRL NK+NLM EL+KI+ +I K   + P E LLVLD T+GQ+G+ QAK F E + +TGI+LTKMDG++KGGI+L+IKD FN+PVK IG GEK  DL+ FDLEK+V
  S:     2 GFLSKLIAKLKPKKS------VAKQLKEEVEKQS----LFQTNNKTYYQGLKKSATTFAKTINELSKRYVNVDEQFKENLFEGLVLLDVGYHAANKICDAIIEQIKLNRITDFQLIKELIIDQIIVYYIQDKLFDTDLIVKPNFTNVYLFVGVNGVGKTTTLAKIADFFIKQNKRVLLVAGDTFRAGAIEQLNQWAKLLNCDIVLPNPKEQTPA-VIFRGVKKGIDDKYDFVLCDTSGRLQNKLNLMNELQKIYQIIQKVSGSEPSETLLVLDGTVGQTGLSQAKVFNEFSKLTGIVLTKMDGSAKGGIILAIKDMFNLPVKLIGFGEKTSDLAIFDLEKYV 332
>gi|31544375|ref|NP_852953.1| hypothetical protein MGA_0919 [Mycoplasma gallisepticum R] >gi|31541219|gb|AAP56521.1| FtsY [Mycoplasma gallisepticum R] (349 aa)
Score = 838, Expect = 7.8e-88, Identities = 185/348 (53%), Positives = 255/348 (73%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           F K++ +K K KK  ++E++  K +E ++             Q+KFD+GLKKSS++ S  I ++  K+  ++E FYE++ +  +  D+G  AT KI DAI EEI +Q V DP LIK+II+DK+F YYIQD++ N  L+ +  R N+ L++GVNGVGKTTSIAK+AN++ K +KK+LL+A DTFRAGA++QLNIW++RL+ DI   D+  +DPA+VI+ G+   K  +YDLVICDTSGRL NK+NLM EL+KI++VI KF      E LLVLDAT GQSG++QAK F E++ ITGIIL+KMD +SKGGI+L IKD FNIPVK IGLGE+L+DL +FDL+K++  +T  L
  S:     4 FIKRLFSKFK-KKPDTVEEIKKKNQENSL---------FETTQEKFDDGLKKSSNSFSDIINQLSTKYVSLNEAFYEDLFDAFVQLDIGYNATKKIVDAIVEEIKYQKVVDPTLIKQIIIDKLFVYYIQDSEVNIDLNYQDHRQNVFLVVGVNGVGKTTSIAKLANYYKKLNKKILLIAADTFRAGAIQQLNIWAERLEVDI-YKDESKKDPAAVIYEGLNFAKQRDYDLVICDTSGRLQNKVNLMNELKKINNVIEKFIGRNVDETLLVLDATTGQSGLIQAKVFHEVSKITGIILSKMDSSSKGGIILGIKDLFNIPVKLIGLGEQLDDLVSFDLQKYLISLTANL 340
>gi|13508164|ref|NP_110113.1| cell division protein FtsY [Mycoplasma pneumoniae M129] >gi|2500880|sp|P75362|FTSY_MYCPN Cell division protein ftsY homolog >gi|1674100|gb|AAB96064.1| cell division protein FtsY [Mycoplasma pneumoniae M129] (348 aa)
Score = 834, Expect = 2.4e-87, Identities = 176/348 (50%), Positives = 239/348 (68%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           F  K++ K K KK+  ++ +   ++EK+              QK + +GL KS+++ +  I ++   +  V+E+F E++ E L+  D+G  A  KI DAI +E+  Q V DP LI+EIIVDK+  YYIQD    T L ++ ++TN+ L +GVNGVGKTTS+AK+A+   K++K+VL+VAGDTFRAGAV QL  W+QR+ CDIVLP+ + + PA VIF GV++G    YD V+CDTSGRL NK NLM EL+KI+ ++ K     P E LLVLD T GQSG+ QAK F E T +TGIILTKMD +SKGGI+L+IKD FN+PVK IG GE   DL+AFDLE++V G+TK L
  S:     3 FIHKLIQKFKPKKK-LVDQVQQAVQEKSF---------FQANQKSYYQGLNKSANSFANTINKLAANYVTVNEQFQESLFEELVLLDIGYHAATKICDAIVQELKLQRVSDPQLIQEIIVDKLIVYYIQDKLFETDLTVEANKTNVYLFVGVNGVGKTTSLAKLADQLTKQNKRVLMVAGDTFRAGAVAQLAEWAQRIGCDIVLPNPKEETPA-VIFRGVQQGIQNEYDFVLCDTSGRLQNKTNLMNELKKIYQIVQKVSSAKPQETLLVLDGTTGQSGLAQAKVFNEFTELTGIILTKMDSSSKGGIILAIKDLFNLPVKLIGFGETTADLAAFDLEQYVLGLTKNL 339
>gi|148377470|ref|YP_001256346.1| cell division protein FtsY [Mycoplasma agalactiae PG2] >gi|148291516|emb|CAL58902.1| Cell division protein FtsY [Mycoplasma agalactiae PG2] (354 aa)
Score = 802, Expect = 1.3e-83, Identities = 181/350 (51%), Positives = 253/350 (72%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           GFF  + +KL G K+ S E+  A+ ++  +EK+ +   +  +K +K+  GL KSSS L   + ++  K+KK+DEE+++ +EE+LI  D+       I   I+ E+  + +     I E+I D++F  Y   +  +T L+++ DR NIL+ +GVNG GKTTSIAK+A+ +IK+ KKVL+ A DTFRAGAV+Q+ IWS+R+  DIV P KEG DPASV+++ ++K K ENYDL++ DT+GRL NKINLM EL+K++S+I+KF + APHE LLVLDAT GQ+G+ QAKAF E+ N TGIILTKMDGTSKGGIVLSIKD FNI VKY+GLGE L+DL  FDL+ F+  +TK+L+
  S:     2 GFFSYLKDKLFGWKKKSKEEKLAQ-KQAELEKKEQEELLRSQKLEKYQAGLSKSSS-LGAKLLDLSNKYKKIDEEYFDELEEILIMSDISAKLVYAIITYIKNEVKIRELTSTKDIGELIADQMFVVYTNKSVVDTTLNVEDDRLNILIFIGVNGSGKTTSIAKVAHKYIKEGKKVLIAAADTFRAGAVDQIAIWSERVGADIVKPIKEGADPASVVYSALEKAKAENYDLLLIDTAGRLQNKINLMNELKKMYSIINKFQEGAPHECLLVLDATTGQNGVSQAKAFSEVANPTGIILTKMDGTSKGGIVLSIKDEFNINVKYLGLGEGLDDLQEFDLDNFIYEMTKDLI 349
>gi|71894168|ref|YP_278276.1| cell division protein FtsY [Mycoplasma synoviae 53] >gi|71850956|gb|AAZ43565.1| cell division protein FtsY [Mycoplasma synoviae 53] (350 aa)
Score = 801, Expect = 1.6e-83, Identities = 186/350 (53%), Positives = 253/350 (72%)
  Q:     4 GFFKKIVNKL-KGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
            FFKKI+NKL    KE  +++   K++EK++      L +  EK +K+++GL ++S    K + E+  K  ++DEE++EN+EE+LI  D+ V   + I + I++EI    + D  LI EII DKIF  Y  ++  +T LD K ++TN+  I+GVNG GKTTSIAK+AN++   DKK+L+ A DTFRAGAVEQL IWS+++ CDIV+P K   DP+SVI+   KK KDE YDL+I DT+GRL NK+NLM EL+K++ V+ +F   AP+E+LLVLDAT GQSGIMQAK FKE+ N++GIILTKMDGTSKGGIVLSIKD  ++ VK +GLGEKL+DL  FDLE F+  +TK L+
  S:     2 AFFKKIINKLFHSNKENEIDEKKKKLKEKHLN-----LVLKSEKFQKYEKGLSQASD-FGKQLLELQNKHLELDEEYFENLEEILIMSDINVSLVDVIIEQIKKEIRINKITDIKLIGEIIADKIFEIYTNNSIIDTSLDYKNNQTNVFFIVGVNGSGKTTSIAKLANYYKSLDKKILIAAADTFRAGAVEQLRIWSEKIGCDIVMPKKANADPSSVIYEAAKKAKDEAYDLLIIDTAGRLQNKVNLMNELKKMYEVLKRFLPEAPNESLLVLDATNGQSGIMQAKVFKEVVNLSGIILTKMDGTSKGGIVLSIKDELDLNVKLVGLGEKLDDLQEFDLELFIYQMTKSLL 346
>gi|47458973|ref|YP_015835.1| cell division protein ftsY [Mycoplasma mobile 163K] >gi|47458301|gb|AAT27624.1| cell division protein ftsY [Mycoplasma mobile 163K] (426 aa)
Score = 795, Expect = 7.9e-83, Identities = 182/349 (52%), Positives = 249/349 (71%)
  Q:     6 FKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELVI 354
           F KI ++ K   + S+     K+ E+  EK    LE    K  K+  GL KSSS LS  + E+  ++ K+D++F+E +EE+LI  D+ V     I + I++ +  +NV DP LI EII DK+F  Y  ++  +T L I+K R N++L++GVNG GKTT+IAK+AN + +K  K+L+ AGDTFRAGAVEQL IW+ RL+ DIV PDKEGQDP+SV+F  ++K KDE YDL+I DT+GRL NK+NLM EL KI+  I +F   APHE+LLVLDAT GQ+ + QA AFKE+T ++GI+LTKMDGTSKGGI++SIKD  NI VK +GLGEK++DL  FDL+ F+ G+TK++V+
  S:    74 FTKIFSR-KTNNDDSISKKELKLNEREKEKNLTKLEK-ENKINKYIAGLDKSSSALSTRVMELQNRYNKIDDDFFEELEEILIMSDISVNLVFTIIEEIKKVVKIENVSDPKLIGEIIADKLFVIYTNNSIVDTNLKIEKGRLNVILMVGVNGSGKTTTIAKLANMYKQKSYKILIAAGDTFRAGAVEQLGIWANRLEVDIVKPDKEGQDPSSVVFKAMQKAKDEIYDLLIIDTAGRLQNKVNLMNELAKINQTISRFLPEAPHESLLVLDATNGQNALSQASAFKEVTPLSGIVLTKMDGTSKGGIIISIKDLVNIDVKLLGLGEKMDDLQEFDLDAFIYGLTKDMVL 420
>gi|167756880|ref|ZP_02429007.1| hypothetical protein CLORAM_02429 [Clostridium ramosum DSM 1402] >gi|167703055|gb|EDS17634.1| hypothetical protein CLORAM_02429 [Clostridium ramosum DSM 1402] (327 aa)
Score = 764, Expect = 3.5e-79, Identities = 159/328 (48%), Positives = 238/328 (72%)
  Q:    26 AKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKD-KKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++I+EK + K A+       + +K+  GL +S+ST S  I E+  +F+++++E++E +E +LI  DVGV    KI + I+ E+  QN+ DP  I EIIVDK+F  Y  D+   T ++  ++   ++L++GVNG GKTT+I K+AN  +  + KKV++ AGDTFRAGA++QL +W+QR+  DIV   KEG DP++V+F  +K+ K++N D++ICDT+GRL NK+NLM ELEK++ +I +    APHE LLV+DAT GQ+G+ QA  F +IT+++G++LTKMDGT+KGGIVLSIKD  NIPVK+IGLGE ++DL  FDL++++ G+ K LV
  S:     5 SQIKEKFVGKSAK-------QNEKYVAGLDRSNSTFSDRINELAARFREINDEYFEELENILIMSDVGVSMVMKIVEEIKNEVRLQNITDPKEINEIIVDKMFVIYANDSVMTTKINYAEEGLTVILMVGVNGAGKTTTIGKLANRIVNDEGKKVMVAAGDTFRAGAIDQLAVWAQRVGVDIV-KGKEGGDPSAVVFDALKQAKEKNVDVLICDTAGRLQNKVNLMNELEKMNRIIKREVPDAPHETLLVIDATTGQNGVSQAVEFSKITDVSGLVLTKMDGTAKGGIVLSIKDQLNIPVKFIGLGESVDDLQEFDLDQYIYGLCKNLV 325
>gi|169350200|ref|ZP_02867138.1| hypothetical protein CLOSPI_00944 [Clostridium spiroforme DSM 1552] >gi|169292983|gb|EDS75116.1| hypothetical protein CLOSPI_00944 [Clostridium spiroforme DSM 1552] (327 aa)
Score = 758, Expect = 1.7e-78, Identities = 159/327 (48%), Positives = 236/327 (72%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKD-KKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KI+EK + K A+       + +K+  GL +S+ T S  I E+  +F++++E+++E +E +LI  DVGV    KI D I+ E+  QN+ DP  I +IIVDK+F  Y  D+   T ++   +   ++L++GVNG GKTT+I K+AN  ++ + KKV++ AGDTFRAGA++QL +W+ R+  +IV   +EG DP++V+F  +K+ K++N D++ICDT+GRL NK+NLMKELEK++ +I +    APHE LLV+DAT GQ+G+ QA  F +IT+ITG++LTKMDGT+KGGIVLSIKD  NIPVK+IGLGE ++DL  FDL++++ G+ K LV
  S:     6 KIKEKFVGKSAK-------QNEKYVAGLDRSNVTFSDRINELAARFREINEDYFEELENILIMSDVGVSMVMKIVDEIKNEVRIQNITDPKQINDIIVDKMFVIYANDSVMTTKINYASEGLTVILMVGVNGAGKTTTIGKLANRIVQDEGKKVMVAAGDTFRAGAIDQLAVWADRVGVEIV-KGREGGDPSAVVFDALKQAKEKNVDVLICDTAGRLQNKVNLMKELEKMNRIIKREVPDAPHETLLVIDATTGQNGVSQAVEFSKITDITGLVLTKMDGTAKGGIVLSIKDQLNIPVKFIGLGEGVDDLQEFDLDQYIYGLCKNLV 325
>gi|15829145|ref|NP_326505.1| cell division protein FTSY [Mycoplasma pulmonis UAB CTIP] >gi|14090089|emb|CAC13847.1| CELL DIVISION PROTEIN FTSY [Mycoplasma pulmonis] (373 aa)
Score = 738, Expect = 3.6e-76, Identities = 163/309 (52%), Positives = 226/309 (73%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E  +KF  GL KS+S  SKAI E+     K+D++F+E +EE+LI  D+       I D I+ E+  QN++DP +I EIIVDK+F  Y   +  +  L+ ++ R N+ L++GVNG GKTTSIAKIA  +    KK+L++AGDTFRA A EQL IW+ R+  +I    ++ Q+PASV++ G++  K+ N+DLVI DT+GRL NKINLM ELEKI+ +I+KF   +  E+LLV+DAT GQ+G+ QA++FKE+TN+TGI+LTKMDGTSKGGIVLSIKD F++ VK IGLGEK++DL  FDL+ F+ G+TK+L+
  S:    59 ESVQKFVTGLNKSNSNFSKAILELQNNHVKLDDDFFEELEEILIMSDISAKLALLIIDEIQREVKIQNIDDPKIISEIIVDKMFLIYANKSFIDINLNYQEQRMNVFLMVGVNGSGKTTSIAKIAKRYKDLQKKILIIAGDTFRAAASEQLEIWANRVGVEIFKASQKNQEPASVVYQGLEYAKNNNFDLVIIDTAGRLQNKINLMNELEKINKIINKFIGRSVDESLLVIDATTGQNGVSQARSFKEVTNLTGIVLTKMDGTSKGGIVLSIKDEFDLNVKLIGLGEKMDDLVDFDLDSFIYGMTKDLI 367
>gi|27467828|ref|NP_764465.1| signal recognition particle [Staphylococcus epidermidis ATCC 12228] >gi|27315373|gb|AAO04507.1|AE016747_4 signal recognition particle [Staphylococcus epidermidis ATCC 12228] (408 aa)
Score = 737, Expect = 4.2e-76, Identities = 143/305 (46%), Positives = 226/305 (74%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++KVDE+F+E +EE+LI+ DVG     K+TD +R E   +N+++ + ++E+IV+KI   Y Q+ D +  ++I+  R N++L++GVNGVGKTT+I K+A  + ++ KKV+L AGDTFRAGA++QLN+W +R+  ++V    EG DPA+V++  +   K++  D++ICDT+GRL NK NLM+EL+K+  VI++    APHE LL LDAT GQ+ + QA++FKE+TN++GI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGEK++DL  F+ E +V G+  +++
  S:    83 KFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEALEEMLITADVGFNTVMKLTDELRTEAQRRNIQETEDLREVIVEKIVEIYHQEDDHSEAMNIEDGRLNVILMVGVNGVGKTTTIGKLAYRYQQEGKKVMLAAGDTFRAGAIQQLNVWGERVGVEVV-SQNEGSDPAAVVYDAINAAKNKGVDILICDTAGRLQNKSNLMQELDKMKRVINRAIPDAPHEALLCLDATTGQNALSQARSFKEVTNVSGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEKMDDLQPFNPESYVYGLFADMI 386
>gi|3334189|sp|O32861|FTSY_MYCHO Cell division protein ftsY homolog >gi|2292927|emb|CAA72412.1| FtsY protein [Mycoplasma hominis] (351 aa)
Score = 737, Expect = 5.0e-76, Identities = 174/347 (50%), Positives = 244/347 (70%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           GF+  + +KL G KE  +    AKIE K  ++Q E   +   K   +  GL KS+S+ ++ I E+  K  K+DEEF+E++EE+LI  D+ +     I +  ++E+  +N+ DP LI EII DK+FT Y  ++  +T L+IK +R N++L++GVNG GKTTSI+KIA   I + KKVL+ AGDTFRA AVEQL IW++R+  DIV P++   DPA+V++  +   K + YD++I DT+GRL NK+NLM EL KI+ V+      APHE+LLVLDAT GQ+G++QA+ FKE T +TGIILTKMDGTSKGGIVL+IKD   + VKYIGLGEK++DL+ FDL+ ++ G+TK
  S:     2 GFWSNLKDKLFGTKEERIAKKQAKIEAKE-QRQLEKELIKKNKLNTYIAGLSKSNSSFNEHIKELQNKHNKIDEEFFEDLEEMLIMSDISIKLVQIIINECKKEVRNENITDPKLINEIIADKLFTIYTSNSVVDTTLNIKDNRLNVILVVGVNGSGKTTSISKIAKKLIDEGKKVLIAAGDTFRAAAVEQLEIWAKRVGADIVTPNENEVDPAAVVYRAIDIAKSKKYDILIVDTAGRLQNKVNLMNELAKINRVLASKIPDAPHESLLVLDATTGQNGVIQARVFKESTPLTGIILTKMDGTSKGGIVLTIKDEIGLFVKYIGLGEKVDDLAEFDLDSYIYGLTK 347
>gi|57866686|ref|YP_188384.1| cell division protein FtsY [Staphylococcus epidermidis RP62A] >gi|57637344|gb|AAW54132.1| cell division protein FtsY [Staphylococcus epidermidis RP62A] (408 aa)
Score = 736, Expect = 6.7e-76, Identities = 143/305 (46%), Positives = 226/305 (74%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++KVDE+F+E +EE+LI+ DVG     K+TD +R E   +N+++ + ++E+IV+KI   Y Q+ D +  ++I+  R N++L++GVNGVGKTT+I K+A  + ++ KKV+L AGDTFRAGA++QLN+W +R+  ++V    EG DPA+V++  +   K+++ D++ICDT+GRL NK NLM+EL+K+  VI++    APHE LL LDAT GQ+ + QA++FKE+TN++GI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGEK++DL  F  E +V G+  +++
  S:    83 KFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEALEEMLITADVGFNTVMKLTDELRTEAQRRNIQETEDLREVIVEKIVEIYHQEDDHSEAMNIEDGRLNVILMVGVNGVGKTTTIGKLAYRYQQEGKKVMLAAGDTFRAGAIQQLNVWGERVGVEVV-SQNEGSDPAAVVYDAINAAKNKDVDILICDTAGRLQNKSNLMQELDKMKRVINRAIPDAPHEALLCLDATTGQNALSQARSFKEVTNVSGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEKMDDLQPFSPESYVYGLFADMI 386
>gi|71893367|ref|YP_278813.1| cell division protein ftsY [Mycoplasma hyopneumoniae J] >gi|71851494|gb|AAZ44102.1| cell division protein ftsY [Mycoplasma hyopneumoniae J] (333 aa)
Score = 729, Expect = 3.7e-75, Identities = 157/309 (50%), Positives = 212/309 (68%)
  Q:    44 PEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           P    K+  GL KS  +  K I ++ KK  K+DE F+E +EE+LI  D+       I D+++ E+   N+ +PDLI EII+DK++T Y   +  NT L+IK  R N+ LI GVNG GKTTSIAK+A  FI + KKVL++A DTFRA AVEQL IW+ R+   I+ P+   +DP SV+F G+     E  DLV+ DT+GRL N +NLM+EL+KI+ +I +    APHE+LLV+DAT GQ+G+ QA  F +IT ++GIILTKMDGTSKGGI+ SIKD  +I VK +GLGE ++DL  FDL+ F+  ITKE+
  S:    19 PANLDKYVAGLTKSRLSFFKQIVQLQKKHIKIDENFFEELEEILIMSDISPNFVRTIIDSLKAEVRHHNLNNPDLIPEIIMDKMYTIYSNRSVVNTNLNIKDGRINVFLISGVNGSGKTTSIAKVARKFIIEGKKVLIIAADTFRAAAVEQLEIWANRVGALILKPEANEKDPGSVVFRGLDFAIKEKTDLVLIDTAGRLQNNVNLMQELKKINKIISQKVPNAPHESLLVIDATTGQNGVSQAANFAKITPVSGIILTKMDGTSKGGIIFSIKDQLDISVKLVGLGEAMDDLQPFDLDLFIFAITKEV 327
>gi|54019977|ref|YP_115523.1| cell division protein ftsY [Mycoplasma hyopneumoniae 232] >gi|72080350|ref|YP_287408.1| cell division protein ftsY [Mycoplasma hyopneumoniae 7448] >gi|53987150|gb|AAV27351.1| cell division protein [Mycoplasma hyopneumoniae 232] >gi|71913474|gb|AAZ53385.1| cell division protein ftsY [Mycoplasma hyopneumoniae 7448] (333 aa)
Score = 728, Expect = 5.4e-75, Identities = 162/326 (49%), Positives = 219/326 (67%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           KI+EK    + E     P    K+  GL KS  +  K I ++ KK  K+DE F+E +EE+LI  D+       I D+++ E+   N+ +PDLI EII+DK++T Y   +  NT L+IK  R N+ LI GVNG GKTTSIAK+A  FI + KKVL++A DTFRA AVEQL IW+ R+   I+ P+   +DP SV+F G+     E  DLV+ DT+GRL N +NLM+EL+KI+ +I +    APHE+LLV+DAT GQ+G+ QA  F +IT ++GIILTKMDGTSKGGI+ SIKD  +I VK +GLGE ++DL  FDL+ F+  ITKE+
  S:     6 KIKEKIFGTKQE----KPANLDKYVAGLTKSRLSFFKQIVQLQKKHIKIDENFFEELEEILIMSDISPNFVRTIIDSLKAEVRHHNLNNPDLIPEIIMDKMYTIYSNRSVVNTNLNIKDGRINVFLISGVNGSGKTTSIAKVARKFIIEGKKVLIIAADTFRAAAVEQLEIWANRVGALILKPEANEKDPGSVVFRGLDFAIKEKTDLVLIDTAGRLQNNVNLMQELKKINKIISQKVPNAPHESLLVIDATTGQNGVSQAANFAKITPVSGIILTKMDGTSKGGIIFSIKDQLDISVKLVGLGEAMDDLQPFDLDLFIFAITKEV 327
>gi|116492611|ref|YP_804346.1| signal recognition particle-docking protein FtsY [Pediococcus pentosaceus ATCC 25745] >gi|116102761|gb|ABJ67904.1| signal recognition particle-docking protein FtsY [Pediococcus pentosaceus ATCC 25745] (406 aa)
Score = 727, Expect = 6.0e-75, Identities = 150/309 (48%), Positives = 217/309 (70%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD-TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++ +++D GL++S  +  + ++ +   F  VDE+FY+++EE LI  DVG     +I++ +R+EI F++V DPD I ++IV ++   Y ++ +  +  L   K+   + L +GVNGVGKTTSI K+A  F  + +KVLL A DTFRAGA++QL  W +R   D+V   KE  DPASV F  VKK K+ENYDL++ DT+GRL NK+NLM EL+KI  VI +    AP E LLVLD+T GQ+ + QAKAF E TN+TGIILTK+DGT+KGGIVL+I++  ++ VKY+GLGE ++DLS F+ E++V G+ K L+
  S:    96 DEAERYDRGLERSRKSFGQKLSALFTNFSGVDEDFYDDLEETLIEADVGFDTALEISEEVRDEIEFEHVSDPDQISQLIVRRLVALYTRNGSAEDNHLVFSKEGPTVFLFVGVNGVGKTTSIGKMAARFKGRGRKVLLAACDTFRAGAIQQLQEWGKRDGVDVV-AGKEQSDPASVAFEAVKKAKEENYDLLLVDTAGRLQNKVNLMNELDKIKRVISREIPDAPQETLLVLDSTTGQNALTQAKAFLETTNVTGIILTKLDGTAKGGIVLAIRNQLHLAVKYVGLGETVDDLSPFNPEQYVSGLFKGLM 404
>gi|73662843|ref|YP_301624.1| signal recognition particle GTPase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495358|dbj|BAE18679.1| signal recognition particle GTPase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (406 aa)
Score = 727, Expect = 6.2e-75, Identities = 145/305 (47%), Positives = 220/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS       +  ++ +++KVDEEF+E +EE+LI+ DVG     ++ + +REE   +N+ + + ++E+IV+KI   Y QD + +  ++I+ +  N++L++GVNGVGKTT+I K+A+ +  + KKV+L AGDTFRAGA++QL +W +R+  D V+   EG DPA+V++  +   K +  D++ICDT+GRL NK NLM ELEK+  VI +    APHE LL LDAT GQ+ + QAK+FKE+TN+TGI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGEKL+DL  F+ E +V G+  +++
  S:    77 KFRAGLEKSRENFQAQLNNLIARYRKVDEEFFEALEEMLITADVGFNTVMQLVEELREEAQKRNISETEDLREVIVEKIVEIYHQDDEHSEVMNIENEGLNVILMVGVNGVGKTTTIGKLAHRYQAEGKKVMLAAGDTFRAGAIQQLKVWGERVGVD-VMSQNEGSDPAAVMYDAINAAKSKGIDILICDTAGRLQNKSNLMNELEKVKRVISRAVPEAPHEVLLCLDATTGQNALSQAKSFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEKLDDLQPFNPESYVYGLFADMI 380
>gi|15924225|ref|NP_371759.1| signal recognition particle [Staphylococcus aureus subsp. aureus Mu50] >gi|15926818|ref|NP_374351.1| signal recognition particle [Staphylococcus aureus subsp. aureus N315] >gi|148267726|ref|YP_001246669.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus JH9] >gi|150393784|ref|YP_001316459.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus JH1] >gi|156979556|ref|YP_001441815.1| signal recognition particle [Staphylococcus aureus subsp. aureus Mu3] >gi|13701035|dbj|BAB42330.1| signal recognition particle [Staphylococcus aureus subsp. aureus N315] >gi|14247005|dbj|BAB57397.1| signal recognition particle [Staphylococcus aureus subsp. aureus Mu50] >gi|147740795|gb|ABQ49093.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus JH9] >gi|149946236|gb|ABR52172.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus JH1] >gi|156721691|dbj|BAF78108.1| signal recognition particle [Staphylococcus aureus subsp. aureus Mu3] (416 aa)
Score = 724, Expect = 1.4e-74, Identities = 144/305 (47%), Positives = 222/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++KVDE+F+E +EE+LI+ DVG      +T+ +R E   +N++D + ++E+IV+KI   Y Q+ D +  ++I+  R N++L++GVNGVGKTT+I K+A  +  + KKV+L AGDTFRAGA++QL +W +R+  D V+   EG DPA+V++  +   K++  D++ICDT+GRL NK NLM+ELEK+  VI++    APHE LL LDAT GQ+ + QA+ FKE+TN+TGI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGE+L+DL  F+ E +V G+  +++
  S:    87 KFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEALEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMNIEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERVGVD-VISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRAVPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEQLDDLQPFNPESYVYGLFADMI 390
>gi|57651804|ref|YP_186110.1| cell division protein FtsY, putative [Staphylococcus aureus subsp. aureus COL] >gi|87161637|ref|YP_493825.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus USA300] >gi|88194942|ref|YP_499742.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221357|ref|YP_001332179.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509407|ref|YP_001575066.1| type I general secretory pathway protein signal recognition particle protein FtsY [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727452|ref|ZP_02759729.1| Sec family Type I general secretory pathway protein signal recognition particle protein FtsY [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|57285990|gb|AAW38084.1| cell division protein FtsY, putative [Staphylococcus aureus subsp. aureus COL] >gi|87127611|gb|ABD22125.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202500|gb|ABD30310.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374157|dbj|BAF67417.1| signal recognition particle-docking protein FtsY [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368216|gb|ABX29187.1| Sec family Type I general secretory pathway protein signal recognition particle protein FtsY [Staphylococcus aureus subsp. aureus USA300_TCH1516] (416 aa)
Score = 722, Expect = 2.8e-74, Identities = 143/305 (46%), Positives = 222/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++KVDE+F+E +EE+LI+ DVG      +T+ +R E   +N++D + ++E+IV+KI   Y Q+ D +  ++++  R N++L++GVNGVGKTT+I K+A  +  + KKV+L AGDTFRAGA++QL +W +R+  D V+   EG DPA+V++  +   K++  D++ICDT+GRL NK NLM+ELEK+  VI++    APHE LL LDAT GQ+ + QA+ FKE+TN+TGI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGE+L+DL  F+ E +V G+  +++
  S:    87 KFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEALEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMNLEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERVGVD-VISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRAVPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEQLDDLQPFNPESYVYGLFADMI 390
>gi|82750839|ref|YP_416580.1| signal recognition particle protein [Staphylococcus aureus RF122] >gi|82656370|emb|CAI80788.1| signal recognition particle protein [Staphylococcus aureus RF122] (416 aa)
Score = 721, Expect = 3.0e-74, Identities = 143/305 (46%), Positives = 222/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++KVDE+F+E +EE+LI+ DVG      +T+ +R E   +N++D + ++E+IV+KI   Y Q+ D +  ++++  R N++L++GVNGVGKTT+I K+A  +  + KKV+L AGDTFRAGA++QL +W +R+  D V+   EG DPA+V++  +   K++  D++ICDT+GRL NK NLM+ELEK+  VI++    APHE LL LDAT GQ+ + QA+ FKE+TN+TGI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGE+L+DL  F+ E +V G+  +++
  S:    87 KFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEALEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMNLEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERVGVD-VISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRAVPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEQLDDLQPFNPESYVYGLFADMI 390
>gi|49483398|ref|YP_040622.1| putative cell division protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49241527|emb|CAG40213.1| putative cell division protein [Staphylococcus aureus subsp. aureus MRSA252] (416 aa)
Score = 721, Expect = 3.1e-74, Identities = 143/305 (46%), Positives = 222/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++KVDE+F+E +EE+LI+ DVG      +T+ +R E   +N++D + ++E+IV+KI   Y Q+ D +  ++++  R N++L++GVNGVGKTT+I K+A  +  + KKV+L AGDTFRAGA++QL +W +R+  D V+   EG DPA+V++  +   K++  D++ICDT+GRL NK NLM+ELEK+  VI++    APHE LL LDAT GQ+ + QA+ FKE+TN+TGI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGE+L+DL  F+ E +V G+  +++
  S:    87 KFKAGLEKSRQNFQEQLNNLISRYRKVDEDFFEALEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMNLEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERVGVD-VISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRAVPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEQLDDLQPFNPESYVYGLFADMI 390
>gi|21282847|ref|NP_645935.1| signal recognition particle [Staphylococcus aureus subsp. aureus MW2] >gi|49486074|ref|YP_043295.1| putative cell division protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|21204286|dbj|BAB94983.1| signal recognition particle [Staphylococcus aureus subsp. aureus MW2] >gi|49244517|emb|CAG42946.1| putative cell division protein [Staphylococcus aureus subsp. aureus MSSA476] (416 aa)
Score = 721, Expect = 3.4e-74, Identities = 143/305 (46%), Positives = 222/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++KVDE+F+E +EE+LI+ DVG      +T+ +R E   +N++D + ++E+IV+KI   Y Q+ D +  ++++  R N++L++GVNGVGKTT+I K+A  +  + KKV+L AGDTFRAGA++QL +W +R+  D V+   EG DPA+V++  +   K++  D++ICDT+GRL NK NLM+ELEK+  VI++    APHE LL LDAT GQ+ + QA+ FKE+TN+TGI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGE+L+DL  F+ E +V G+  +++
  S:    87 KFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEALEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMNLEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERVGVD-VISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRAVPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEQLDDLQPFNPESYVYGLFADMI 390
>gi|191638591|ref|YP_001987757.1| Signal recognition particle-docking protein FtsY [Lactobacillus casei] >gi|190712893|emb|CAQ66899.1| Signal recognition particle-docking protein FtsY [Lactobacillus casei BL23] (331 aa)
Score = 714, Expect = 2.4e-73, Identities = 148/308 (48%), Positives = 214/308 (69%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYY-IQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++ K+DEGL+KS S+  + +  +   F+ VDE+F++N+EE+LI  DVG     K++D +REE+  +N +DP  +  +IV+K+   Y     D +  L   +   ++ L +GVNG GKTT++ K+A+   ++ K+VLLVA DTFRAGA++QL  W +R+   +V   KEG DPA+V+F GVK+ KDE +D+V+ DT+GRL NK+NLM EL KI  VI +    AP E LLVLDAT GQ+ + QAK F + T ITGI+LTK+DG+ KGGIVL+I++  ++PVK +GLGEK++DL AFD  KFV G+ K L+
  S:    20 EENKYDEGLEKSRSSFGEKLNALFANFRSVDEDFFDNLEEMLIESDVGFETAVKLSDDLREEVKLKNAKDPKAVSHVIVEKLVDMYGDAGKDEDNALHFAESGPSVFLFVGVNGAGKTTTVGKLAHQLKEEGKRVLLVAADTFRAGAIQQLQEWGRRVDVPVV-ATKEGGDPAAVVFDGVKRAKDEQFDVVLVDTAGRLQNKVNLMNELNKIKRVIVRELPDAPQEVLLVLDATTGQNALNQAKEFNQTTKITGIVLTKLDGSGKGGIVLAIRNELHVPVKLVGLGEKMDDLQAFDPTKFVAGLFKGLI 327
>gi|116495087|ref|YP_806821.1| Signal recognition particle GTPase [Lactobacillus casei ATCC 334] >gi|116105237|gb|ABJ70379.1| signal recognition particle-docking protein FtsY [Lactobacillus casei ATCC 334] (331 aa)
Score = 713, Expect = 2.5e-73, Identities = 148/308 (48%), Positives = 214/308 (69%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYY-IQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++ K+DEGL+KS S+  + +  +   F+ VDE+F++N+EE+LI  DVG     K++D +REE+  +N +DP  +  +IV+K+   Y     D +  L   +   ++ L +GVNG GKTT++ K+A+   ++ K+VLLVA DTFRAGA++QL  W +R+   +V   KEG DPA+V+F GVK+ KDE +D+V+ DT+GRL NK+NLM EL KI  VI +    AP E LLVLDAT GQ+ + QAK F + T ITGI+LTK+DG+ KGGIVL+I++  ++PVK +GLGEK++DL AFD  KFV G+ K L+
  S:    20 EENKYDEGLEKSRSSFGEKLNALFANFRSVDEDFFDNLEEMLIESDVGFETAVKLSDDLREEVKLKNAKDPKAVSRVIVEKLVDMYGDAGKDEDNALHFAESGPSVFLFVGVNGAGKTTTVGKLAHQLKEEGKRVLLVAADTFRAGAIQQLQEWGRRVDVPVV-ATKEGGDPAAVVFDGVKRAKDEQFDVVLVDTAGRLQNKVNLMNELNKIKRVIVRELPDAPQEVLLVLDATTGQNALNQAKEFNQTTKITGIVLTKLDGSGKGGIVLAIRNELHVPVKLVGLGEKMDDLQAFDPTKFVAGLFKGLI 327
>gi|70726680|ref|YP_253594.1| hypothetical protein SH1679 [Staphylococcus haemolyticus JCSC1435] >gi|68447404|dbj|BAE04988.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] (407 aa)
Score = 713, Expect = 2.6e-73, Identities = 139/305 (45%), Positives = 222/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF  GL+KS     + +  ++ +++ VDE+F+E +EE+LI+ DVG     ++T+ +R E   +N+++ + ++E+IV+KI   Y Q+ D +  ++++  R N++L++GVNGVGKTT+I K+A+ +  + KKV+L AGDTFRAGA++QL +W  R+  + V+   EG DPA+V++  +   K++  D++ICDT+GRL NK NLM+EL+K+  VI +    APHE LL LDAT GQ+ + QA++FKE+TN++GI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGEKL+DL  F+ E +V G+  +++
  S:    79 KFKAGLEKSRQNFQEQLNNLIARYRTVDEDFFEALEEMLITADVGFNTVMQLTEELRTEAQRRNIQETEDLREVIVEKIVEIYHQEDDQSEAMNLEDGRLNVILMVGVNGVGKTTTIGKLAHRYKMEGKKVMLAAGDTFRAGAIDQLQVWGDRVGVE-VIRQSEGSDPAAVVYDAINSAKNKGVDILICDTAGRLQNKSNLMQELDKMKRVISRAVPDAPHEALLCLDATTGQNALSQARSFKEVTNVSGIVLTKLDGTAKGGIVLAIRNELHIPVKYVGLGEKLDDLQPFNPESYVYGLFADMI 382
>gi|81428324|ref|YP_395324.1| Signal recognition particle-docking protein FtsY [Lactobacillus sakei subsp. sakei 23K] >gi|78609966|emb|CAI55013.1| Signal recognition particle-docking protein FtsY [Lactobacillus sakei subsp. sakei 23K] (487 aa)
Score = 713, Expect = 3.0e-73, Identities = 149/332 (44%), Positives = 219/332 (65%)
  Q:    23 DLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD--TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELVI 354
           D     EE  +    E   V   + +K+D+GL+KS  T  + +  +   F+ VDE F++++EE+LI  DVG     KI D +REE+  +NV+ P+ + + IV+K+   Y Q+   + N      +    + L +GVNG GKTTSI K A+   K  KKVLL AGDTFRAGA+EQL  W +R+   +V  +K G DPA+V F  VK+ K+EN+D+++ DT+GRL N +NLMKELEK+  VI +   +AP E LLVLDAT GQ+ ++QAK FK  T++TGI+LTK+DG++KGGIVL+++   ++PVK +GLGE++ DL  FD  +FV G+ K++++
  S:   138 DEPTATEETTVADDVEAEPVQAAQTEKYDQGLEKSRKTFGQRLNALFANFRSVDESFFDDVEEMLIEADVGYETAMKIADELREEVKLRNVKKPEAVSQAIVEKLVDLYGQEGQQEDNELHFAPEGELTVFLFVGVNGAGKTTSIGKCAHQLEKAGKKVLLAAGDTFRAGAIEQLQEWGRRVSVPVV-ANKAGSDPAAVAFDAVKRAKEENFDVLLVDTAGRLQNNVNLMKELEKVKRVITREISSAPQEVLLVLDATTGQNALVQAKQFKSTTDVTGIVLTKLDGSAKGGIVLAVRTELHLPVKMVGLGEQMNDLQLFDPNRFVYGLFKDIIV 470
>gi|126654293|ref|ZP_01726070.1| recognition particle-docking protein [Bacillus sp. B14905] >gi|126589257|gb|EAZ83418.1| recognition particle-docking protein [Bacillus sp. B14905] (424 aa)
Score = 712, Expect = 3.8e-73, Identities = 148/317 (46%), Positives = 229/317 (72%)
  Q:    36 QAEILEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV-----DGITKEL 352
           + +I+E  P ++KK         F  GL+K+ ++ +  + ++V +++KVDE+F+E +E+LL+  DVG     ++ D +R E+  +N++D + I+ +I +K+   Y Q  D    L+++ D    ++L +GVNGVGKTT+I K+A     + K V+L AGDTFRAGA++QL +W  R+ C+ V+   EG DPA+V++  ++  K+   D++ICDT+GRL NK+NLM ELEK+H VI +   +APHE LL LDAT GQ+ ++QA+ FKE TN+TGI+LTK+DGT+KGGIVL+I++  +IPVK++GLGEK++DL  FD E++V     DG+ KEL
  S:    89 EVQIIEEQPTEEKKPSAWSITQKFKAGLEKTRNSFTSKVNDLVARYRKVDEDFFEELEDLLLQADVGFETVMELMDKLRFEVQRKNIKDTNGIQTLISEKLVEIYEQGEDDLIELNMQPDGELTVILFVGVNGVGKTTTIGKLARRLKSQGKTVVLAAGDTFRAGAIDQLQVWGDRVGCE-VIKQSEGSDPAAVMYDAIRAAKNRKADVLICDTAGRLQNKVNLMNELEKVHRVISREIPSAPHEVLLALDATTGQNALVQAQTFKEATNVTGIVLTKLDGTAKGGIVLAIRNKLHIPVKFVGLGEKMDDLQPFDAERYVYGLFADGLDKEL 419
>gi|110004076|emb|CAK98415.1| cell division protein ftsy [Spiroplasma citri] (328 aa)
Score = 710, Expect = 5.5e-73, Identities = 163/334 (48%), Positives = 229/334 (68%)
  Q:    19 GSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEI-TFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           G  + L AK EEK              KQ K ++ L+K+  T S  I ++  K+KK D+++ E +EE+LI+ D+G+    +IT+ IR+++    ++ED +   + +V+ I   Y         L+IK  R N++L++GVNG GKTT+IAK+A  F+ + K VLLVAGDTFRAGAVEQLN W++RL  +IV P KEGQDPASVI+ G+ +GK E  D++I DT+GRL NK+NLM EL KI+ +I +    APHE LLV+D   GQ+GI QAK F E+T+++GI+LTKMDGT+KGG+VL+IKD  NIPVK IGLGE+  DL  FD+E+++  +TK+L
  S:     2 GFFQKLKAKREEK--------------KQIKLEKALRKTRLTFSNDIKKLAHKYKKYDDQYLEELEEILIASDMGMNMVLQITNQIRKKVRKGWSIEDTN---DYLVEVIMDLYNDPKSKQNKLNIKDQRLNVILMVGVNGAGKTTTIAKLAKQFLDQKKSVLLVAGDTFRAGAVEQLNQWAERLYVNIVKPLKEGQDPASVIYDGLVQGKKEQVDIIIIDTAGRLQNKVNLMNELNKINRIIKREIPDAPHETLLVIDGVTGQNGISQAKNFSEVTDVSGIVLTKMDGTAKGGVVLAIKDQLNIPVKLIGLGEQPVDLQEFDIEQYIYNLTKDL 319
>gi|187605846|ref|ZP_02992031.1| signal recognition particle-docking protein FtsY [Exiguobacterium sp. AT1b] >gi|187482119|gb|EDU20138.1| signal recognition particle-docking protein FtsY [Exiguobacterium sp. AT1b] (341 aa)
Score = 710, Expect = 6.8e-73, Identities = 145/304 (47%), Positives = 221/304 (72%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E  +KF EGL K+    + A+ ++V +F++VDE+F++ +E+LLI  DVGV  T  + + ++EE+  +N++DP  +++ +V+ +    +Q+ +++  L+++ D   ++L +GVNGVGKTT+I K+A+    + + V+L AGDTFRAGA+EQL +W +R+    V+   EG DPA+V+F  V+  K  N D++ICDT+GRL NK+NLMKELEK+  VI +     PHE LL LDAT GQ+ ++QAKAFKE TN++GI+LTK+DGT+KGGIVL+I++  +IPVKY+GLGEK++DL  FD E+FV G+
  S:    17 EVSQKFTEGLTKTRDGFASAVNDLVYRFREVDEDFFDELEDLLIQADVGVTTTMDLVEDLKEEVKRRNLKDPVAVRDALVE-VVANRLQEDESDRELNMQ-DGLTVILFVGVNGVGKTTTIGKLAHQLKSEGRSVMLAAGDTFRAGAIEQLQVWGERVGVP-VIRQTEGSDPAAVVFDAVQAAKSRNMDVLICDTAGRLQNKVNLMKELEKVKRVIEREVPNGPHEVLLALDATTGQNAMVQAKAFKEATNVSGIVLTKLDGTAKGGIVLAIRNELDIPVKYVGLGEKIDDLQEFDPEQFVLGL 317
>gi|28378331|ref|NP_785223.1| signal recognition particle receptor FtsY [Lactobacillus plantarum WCFS1] >gi|28271166|emb|CAD64071.1| signal recognition particle receptor FtsY [Lactobacillus plantarum WCFS1] (515 aa)
Score = 708, Expect = 1.1e-72, Identities = 146/322 (45%), Positives = 214/322 (66%)
  Q:    32 NIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTD-TNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           N    +E  E  P + +++DEGLKKS  T    I   +  F+ VDE F++++E+ LI  DVG     +I+D +R+E+  +N +    I  +IV+K+   Y +  +  +  + + K    ++L +GVNG GKTT+I K+AN + ++ KKVLL A DTFRAGA++QL +W QR   D+V    E  DPA+V F  VKK K E+YD++  DT+GRL NK+NLM ELEKI  VI +    APHE LLVLDAT GQ+ + QAK FK+ T+++GI+LTK+DGT++GGIVL+I++  ++ VKY+GLGEK+ DL  F+   FV G+ K+++
  S:   192 NAAADSESAEPEPTEAERYDEGLKKSRKTFGDRINAFLANFRHVDEAFFDDLEDTLIESDVGYETAMRISDELRDEVKLKNAKSKKEISSVIVEKLVDMYGEAGEGEDNSIHMAKSGPTVILFVGVNGAGKTTTIGKMANMYKQQGKKVLLAACDTFRAGAIQQLQVWGQRDGVDVV-AKAEKSDPAAVCFDAVKKAKAEDYDVLFVDTAGRLQNKVNLMNELEKIKRVITREIPDAPHEVLLVLDATTGQNALNQAKLFKQSTDVSGIVLTKLDGTARGGIVLAIRNELHLAVKYVGLGEKVTDLRPFNANDFVYGLFKDII 513
>gi|169827096|ref|YP_001697254.1| cell division protein ftsY-like protein [Lysinibacillus sphaericus C3-41] >gi|168991584|gb|ACA39124.1| Cell division protein ftsY-like protein [Lysinibacillus sphaericus C3-41] (448 aa)
Score = 705, Expect = 2.5e-72, Identities = 143/305 (46%), Positives = 222/305 (72%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV-----DGITKEL 352
           +KF  GL+K+ ++ +  + ++V +++KVDE+F+E +E+LL+  DVG     ++ D +R E+  +N++D + I+ +I +K+   Y Q  +    L+++ D    ++L +GVNGVGKTT+I K+A+    + K V+L AGDTFRAGA++QL +W  R+ C+ V+   EG DPA+V++  ++  K+   D++ICDT+GRL NK+NLM ELEK+H VI +   +APHE LL LDAT GQ+ ++QA+ FKE TN+TGI+LTK+DGT+KGGIVL+I++  +IPVK++GLGEK++DL  FD E++V     DG+ KEL
  S:   134 QKFKAGLEKTRNSFTSKVNDLVARYRKVDEDFFEELEDLLLQADVGFETVMELMDKLRFEVQRKNIKDTNGIQTLISEKLVEIYEQGEEDLIELNMQPDGELTVILFVGVNGVGKTTTIGKLAHRLKSQGKTVVLAAGDTFRAGAIDQLQVWGDRVGCE-VIKQSEGSDPAAVMYDAIRAAKNRKADVLICDTAGRLQNKVNLMNELEKVHRVISREIPSAPHEVLLALDATTGQNALVQAQTFKEATNVTGIVLTKLDGTAKGGIVLAIRNKLHIPVKFVGLGEKMDDLQPFDAERYVYGLFADGLDKEL 443
>gi|116873238|ref|YP_850019.1| cell division ABC transporter, substrate- binding protein FtsY [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742116|emb|CAK21240.1| ftsY [Listeria welshimeri serovar 6b str. SLCC5334] (328 aa)
Score = 700, Expect = 8.9e-72, Identities = 150/305 (49%), Positives = 221/305 (72%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF +GL K+    S  I E+V +++KVDE+F+E +EE+LI  DVG     ++ DA+R E+  +N+ DP  ++E+IV+K+   Y  D + +  L+I+++   ++L +GVNGVGKTTSI K+A+ F ++ KKV+L AGDTFRAGA++QL +W +R   D V+   EG DPA+V+F  V+  K    D+++CDT+GRL NK+NLM ELEK+  VI +    APHE LLVLDAT GQ+  +QAK FKE T++TGIILTK+DGT+KGGIV++I++  +IPVK++GLGE+++DL AFD  ++V G+  ++V
  S:    21 KFKDGLSKTRGNFSGKINEMVARYRKVDEDFFEELEEILIGADVGFETVMELVDALRREVQLRNISDPKDVQEVIVEKLVDIYQGDENEDETLNIEENGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVD-VIKQAEGSDPAAVMFDAVQAAKARKADILLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMV 324
>gi|116333588|ref|YP_795115.1| Signal recognition particle GTPase [Lactobacillus brevis ATCC 367] >gi|116098935|gb|ABJ64084.1| signal recognition particle-docking protein FtsY [Lactobacillus brevis ATCC 367] (487 aa)
Score = 697, Expect = 2.0e-71, Identities = 140/307 (45%), Positives = 214/307 (69%)
  Q:    47 QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYY-IQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++ +D+GL+K+ +T  + +  ++  F+ VDE F++++EE LI  DVG     K++D +R+E+  QN +    ++ ++V+K+   Y        T +++ +    ++L +GVNGVGKTT+I K+AN + +  KKVLL A DTFRAGA EQL++W++R   DIV   K   DPA+V+F  V+K K ++YD++  DT+GRL NK+NLM ELEK+  +I +   +APHE LLVLDAT GQ+ + QAK FKE T +TGI+LTK+DGT++GGIVL+I++  ++PVK+IGLGE++ DL  FD  +FV G+ K L+
  S:   173 EQLYDKGLEKTRTTFGQRLNALLANFRHVDESFFDDLEETLIGADVGFDMAVKLSDELRDEVKLQNAKKSQDVQNVVVEKLVEIYEAAGNHETTAINMAETGPTVILFVGVNGVGKTTTIGKMANRYHQAGKKVLLAAADTFRAGATEQLDVWAKRADVDIV-TGKPQSDPAAVVFDAVQKAKQDDYDILFVDTAGRLQNKVNLMNELEKMKRIITREIPSAPHEVLLVLDATTGQNALTQAKLFKESTAVTGIVLTKLDGTARGGIVLAIRNELHVPVKFIGLGEQISDLRPFDPNEFVYGLFKGLI 479
>gi|46908034|ref|YP_014423.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes str. 4b F2365] >gi|47093842|ref|ZP_00231586.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes str. 4b H7858] >gi|153167646|ref|ZP_01927750.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes FSL N1-017] >gi|153175036|ref|ZP_01930431.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes FSL N3-165] >gi|153202800|ref|ZP_01944238.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes HPB2262] >gi|168266219|ref|ZP_02688184.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes FSL J2-071] >gi|46881304|gb|AAT04600.1| signal recognition particle-docking protein FtsY [Listeria monocytogenes str. 4b F2365] >gi|47017783|gb|EAL08572.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes str. 4b H7858] >gi|133726745|gb|EBA28443.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes FSL N1-017] >gi|133729489|gb|EBA31187.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes FSL N3-165] >gi|133734870|gb|EBA36568.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes HPB2262] (328 aa)
Score = 695, Expect = 3.0e-71, Identities = 150/305 (49%), Positives = 218/305 (71%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF +GL K+    S  I E+V +++KVDE+F+E +EE+LI  DVG     ++ D +R E+  +N+ DP  ++E+IV+K+   Y  D   +  L I++D   ++L +GVNGVGKTTSI K+A+ F ++ KKV+L AGDTFRAGA++QL +W +R   D V+   EG DPA+V+F  V+  K    D+++CDT+GRL NK+NLM ELEK+  VI +    APHE LLVLDAT GQ+  +QAK FKE T++TGIILTK+DGT+KGGIV++I++  +IPVK++GLGE+++DL AFD  ++V G+  ++V
  S:    21 KFKDGLSKTRGNFSGKINEMVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQGDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVD-VIKQAEGSDPAAVMFDAVQAAKARKADVLLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMV 324
>gi|16803843|ref|NP_465328.1| hypothetical protein lmo1803 [Listeria monocytogenes EGD-e] >gi|47097386|ref|ZP_00234937.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes str. 1/2a F6854] >gi|153179843|ref|ZP_01933016.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes F6900] >gi|153183295|ref|ZP_01934155.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes J0161] >gi|153191312|ref|ZP_01938532.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes J2818] >gi|153196312|ref|ZP_01940682.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes 10403S] >gi|16411257|emb|CAC99881.1| lmo1803 [Listeria monocytogenes] >gi|47014234|gb|EAL05216.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes str. 1/2a F6854] >gi|126943586|gb|EBA21303.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes J0161] >gi|127633773|gb|EBA23165.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes 10403S] >gi|127765091|gb|EBA25441.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes J2818] >gi|133732487|gb|EBA34185.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes F6900] (328 aa)
Score = 695, Expect = 3.0e-71, Identities = 150/305 (49%), Positives = 218/305 (71%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF +GL K+    S  I E+V +++KVDE+F+E +EE+LI  DVG     ++ D +R E+  +N+ DP  ++E+IV+K+   Y  D   +  L I++D   ++L +GVNGVGKTTSI K+A+ F ++ KKV+L AGDTFRAGA++QL +W +R   D V+   EG DPA+V+F  V+  K    D+++CDT+GRL NK+NLM ELEK+  VI +    APHE LLVLDAT GQ+  +QAK FKE T++TGIILTK+DGT+KGGIV++I++  +IPVK++GLGE+++DL AFD  ++V G+  ++V
  S:    21 KFKDGLSKTRGNFSGKINEMVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQGDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVD-VIKQAEGSDPAAVMFDAVQAAKARKADILLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMV 324
>gi|30263850|ref|NP_846227.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. Ames] >gi|47529275|ref|YP_020624.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186697|ref|YP_029949.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. Sterne] >gi|49478413|ref|YP_037908.1| recognition particle-docking protein FtsY [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|65321175|ref|ZP_00394134.1| COG0552: Signal recognition particle GTPase [Bacillus anthracis str. A2012] >gi|165873287|ref|ZP_02217895.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. A0488] >gi|166995405|ref|ZP_02261865.1| recognition particle-docking protein FtsY [Bacillus cereus AH820] >gi|167636667|ref|ZP_02394957.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. A0442] >gi|170689653|ref|ZP_02880834.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. A0465] >gi|190565956|ref|ZP_03018875.1| signal recognition particle-docking protein FtsY [Bacillus anthracis Tsiankovskii-I] >gi|196035825|ref|ZP_03103227.1| signal recognition particle-docking protein FtsY [Bacillus cereus W] >gi|30258494|gb|AAP27713.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. Ames] >gi|47504423|gb|AAT33099.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180624|gb|AAT56000.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. Sterne] >gi|49329969|gb|AAT60615.1| recognition particle-docking protein FtsY [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|164710972|gb|EDR16541.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. A0488] >gi|167527918|gb|EDR90734.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. A0442] >gi|170666398|gb|EDT17180.1| signal recognition particle-docking protein FtsY [Bacillus anthracis str. A0465] >gi|190562875|gb|EDV16841.1| signal recognition particle-docking protein FtsY [Bacillus anthracis Tsiankovskii-I] >gi|195991474|gb|EDX55440.1| signal recognition particle-docking protein FtsY [Bacillus cereus W] (329 aa)
Score = 693, Expect = 5.2e-71, Identities = 151/327 (46%), Positives = 234/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LI  DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D    ++++KD   ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K  N D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVFRYRKVDEDFFEELEEILIGADVGVSTVMELIDQLKEEVQRRNIQDPREVQAVISEKLIEIYKGDSDFTNEVNMQKDGLTVVLFVGVNGVGKTTTIGKMAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARNVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANLV 324
>gi|193216479|ref|YP_001999721.1| cell division protein [Mycoplasma arthritidis 158L3-1] >gi|193001802|gb|ACF07017.1| cell division protein [Mycoplasma arthritidis 158L3-1] (351 aa)
Score = 691, Expect = 9.2e-71, Identities = 162/342 (47%), Positives = 244/342 (71%)
  Q:    11 NKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDE---GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           ++LK K  G+ E+  AK + K  EK+   LE   +K+ K D    GL KS+++ +++I  +  K+ K+++EF+E++EE+LI  D+       I +  ++E+  +N+EDP LI EII DK+FT Y  ++  +T L+I+ +R N++L++GVNG GKTTSI+K+A     + KKVL+ A DTFRA AVEQL IW++R+  DI+ P +   DPA+V++  + K K+E YD+++ DT+GRL NK+NLM+EL KI+ V+    + APHE+LLVLDAT GQ+GI+QAK F + T +TGI+LTKMDGTS+GGI+L+IKD   + VKY+GLGEK++DL  FDL+ ++ G+ + L
  S:     5 SRLKEKIFGTKEERIAKKQAKLEEKEKRKLEKELDKKNKLDNYIAGLSKSNNSFTESIKALQNKYNKINKEFFEDLEEILIMADISARLVTIIVNECKKEVRNENIEDPKLISEIIADKLFTIYASNSVVDTSLNIENNRINVILVVGVNGSGKTTSISKLAKKLSSEGKKVLIAAADTFRAAAVEQLEIWAKRVGVDIIKPTQNETDPAAVVYKAIDKAKEEKYDVLLIDTAGRLQNKVNLMQELAKINKVLESKIEGAPHESLLVLDATTGQNGIVQAKVFTQATPLTGIVLTKMDGTSRGGIILTIKDEIGLNVKYVGLGEKVDDLMEFDLDSYIYGLMRGL 349
>gi|16800983|ref|NP_471251.1| hypothetical protein lin1917 [Listeria innocua Clip11262] >gi|16414418|emb|CAC97147.1| lin1917 [Listeria innocua] (328 aa)
Score = 691, Expect = 1.1e-70, Identities = 149/305 (48%), Positives = 218/305 (71%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF +GL K+    S  I E+V +++KVDE+F+E +EE+LI  DVG     ++ D +R E+  +N+ DP  ++E+IV+K+   Y  D   +  L I+++   ++L +GVNGVGKTTSI K+A+ F ++ KKV+L AGDTFRAGA++QL +W +R   D V+   EG DPA+V+F  V+  K    D+++CDT+GRL NK+NLM ELEK+  VI +    APHE LLVLDAT GQ+  +QAK FKE T++TGIILTK+DGT+KGGIV++I++  +IPVK++GLGE+++DL AFD  ++V G+  ++V
  S:    21 KFKDGLSKTRGNFSGKINEMVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVDIYQGDEKEDETLHIEENGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVD-VIKQAEGSDPAAVMFDAVQAAKARKADILLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMV 324
>gi|30021935|ref|NP_833566.1| cell division protein ftsY [Bacillus cereus ATCC 14579] >gi|29897491|gb|AAP10767.1| Cell division protein ftsY [Bacillus cereus ATCC 14579] (329 aa)
Score = 690, Expect = 1.2e-70, Identities = 149/327 (45%), Positives = 235/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LI  DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D +  +++++D+  ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVYRYRKVDEDFFEELEEILIGADVGVATVMELIDQLKEEVQRRNIQDPKEVQAVISEKLVGIYKGDSDFSNEINMQEDQLTVVLFVGVNGVGKTTTIGKLAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFRETTNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANLV 324
>gi|168136916|ref|ZP_02580145.1| Cell division protein ftsY [Bacillus cereus B4264] (329 aa)
Score = 690, Expect = 1.4e-70, Identities = 149/327 (45%), Positives = 235/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LI  DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D +  +++++D+  ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVYRYRKVDEDFFEELEEILIGADVGVATVMELIDQLKEEVQRRNIQDPKEVQAVISEKLVGIYKGDSDFSNEINMQEDQLTVVLFVGVNGVGKTTTIGKLAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANLV 324
>gi|168139814|ref|ZP_02583043.1| Cell division protein ftsY [Bacillus cereus G9842] (329 aa)
Score = 689, Expect = 1.9e-70, Identities = 149/327 (45%), Positives = 234/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF  GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LI  DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D +  +++++D+  ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKHGLEKTRNSFADKVNDLVYRYRKVDEDFFEELEEILIGADVGVATVMELIDQLKEEVQRRNIQDPKEVQAVISEKLVGIYKGDSDFSNEINMQEDQLTVVLFVGVNGVGKTTTIGKLAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEIDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANLV 324
>gi|47570280|ref|ZP_00240929.1| signal recognition particle-docking protein FtsY [Bacillus cereus G9241] >gi|47553044|gb|EAL11446.1| signal recognition particle-docking protein FtsY [Bacillus cereus G9241] (329 aa)
Score = 687, Expect = 2.6e-70, Identities = 150/327 (45%), Positives = 233/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LI  DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D    ++++KD   ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVFRYRKVDEDFFEELEEILIGADVGVSTVMELIDQLKEEVQRRNIQDPREVQAVISEKLIEIYKGDSDFTNEINMQKDGLTVVLFVGVNGVGKTTTIGKMAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANLV 324
>gi|52141632|ref|YP_085188.1| recognition particle-docking protein [Bacillus cereus E33L] >gi|118479069|ref|YP_896220.1| signal recognition particle-docking protein FtsY [Bacillus thuringiensis str. Al Hakam] >gi|196042326|ref|ZP_03109602.1| signal recognition particle-docking protein FtsY [Bacillus cereus NVH0597-99] >gi|51975101|gb|AAU16651.1| recognition particle-docking protein [Bacillus cereus E33L] >gi|118418294|gb|ABK86713.1| signal recognition particle-docking protein FtsY [Bacillus thuringiensis str. Al Hakam] >gi|196026848|gb|EDX65479.1| signal recognition particle-docking protein FtsY [Bacillus cereus NVH0597-99] (329 aa)
Score = 687, Expect = 3.1e-70, Identities = 150/327 (45%), Positives = 233/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LI  DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D    ++++KD   ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVFRYRKVDEDFFEELEEILIGADVGVSTVMELIDQLKEEVQRRNIQDPREVQAVISEKLIEIYKGDSDFTNEVNMQKDGLTVVLFVGVNGVGKTTTIGKMAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANLV 324
>gi|163790807|ref|ZP_02185232.1| signal recognition particle-docking protein FtsY [Carnobacterium sp. AT7] >gi|159873875|gb|EDP67954.1| signal recognition particle-docking protein FtsY [Carnobacterium sp. AT7] (332 aa)
Score = 687, Expect = 3.3e-70, Identities = 141/320 (44%), Positives = 225/320 (70%)
  Q:    34 EKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E++ E  EV     +K+++GL+K+  T S+ + E+   F+ VDE+F++ +EE+LI  DVG  +T +ITDA+R+E+  +N +  + ++++I++K+   Y +       ++I      ++L++GVNGVGKTT+I K+A+ + ++ KKV+L AGDTFRAGA+EQL++W  R+  ++V   K G DPA+V+F  +K+ K +  D++  DT+GRL NK+NLM ELEK+  +I +     PHE LLVLDAT GQ+ + QAK FK+ T++TGI+LTK+DGT+KGGIVL+I+   +IPVK++GLGE ++DL  FD  +++ G+  EL+
  S:    14 EEKVETTEV----TEKYEKGLEKTRKTFSQRMNELFANFRTVDEDFFDELEEVLIGADVGFESTMEITDALRQEVKLKNAKASNEVQQVIIEKMVEIYEKGNTDKPEININPAGLTVILLVGVNGVGKTTTIGKMAHLYQQEGKKVMLAAGDTFRAGAIEQLHVWGDRVGAEVV-SGKAGGDPAAVVFDAIKEAKQKEADILFVDTAGRLQNKVNLMNELEKMKRIIEREIPGGPHEVLLVLDATTGQNAMNQAKQFKQTTDVTGIVLTKLDGTAKGGIVLAIRKELDIPVKFVGLGESMDDLQVFDPNEYIYGLFSELI 328
>gi|42782939|ref|NP_980186.1| signal recognition particle-docking protein FtsY [Bacillus cereus ATCC 10987] >gi|42738866|gb|AAS42794.1| signal recognition particle-docking protein FtsY [Bacillus cereus ATCC 10987] (329 aa)
Score = 686, Expect = 3.3e-70, Identities = 150/327 (45%), Positives = 233/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LI  DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D    ++++KD   ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVFRYRKVDEDFFEELEEILIGADVGVSTVMELIDQLKEEVQRRNIQDPKEVQAVISEKLIEIYKGDSDFTNEINVQKDGLTVVLFVGVNGVGKTTTIGKMAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANLV 324
>gi|163941585|ref|YP_001646469.1| signal recognition particle-docking protein FtsY [Bacillus weihenstephanensis KBAB4] >gi|163863782|gb|ABY44841.1| signal recognition particle-docking protein FtsY [Bacillus weihenstephanensis KBAB4] (329 aa)
Score = 686, Expect = 4.3e-70, Identities = 148/327 (45%), Positives = 235/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++K+DE+F+E +EE+LIS DVGV    ++ D ++EE+  +N++DP  ++ +I +K+   Y  D+D +  ++I++D+  ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLM ELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  FD E++V G+   +V
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVYRYRKIDEDFFEELEEILISADVGVSTVMELIDQLKEEVQRRNIQDPKEVQAVISEKLVGIYKGDSDFSNEVNIQEDQLTVVLFVGVNGVGKTTTIGKLAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGDRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMNELEKVKRVIEREVPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFDPEQYVYGLFANVV 324
>gi|162447213|ref|YP_001620345.1| signal recognition particle GTPase [Acholeplasma laidlawii PG-8A] >gi|161985320|gb|ABX80969.1| signal recognition particle GTPase [Acholeplasma laidlawii PG-8A] (318 aa)
Score = 683, Expect = 9.1e-70, Identities = 146/305 (47%), Positives = 209/305 (68%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           K  K+  GL KS S+    + +++ +   ++++ ++ IE+LLIS D+GV      T+ +R E+  +  E+P  + E IVDK+F  Y++D   +T L   +   N+ L +GVNGVGKTT+I K+A  +  + KKVL+VAGDTFRAGA+EQL  WS+R K D    D  G DP+SVIF  ++K K E YDLV+ DT+GRL NK+NLM EL K+  VI K   + P E LLV+DAT GQ+G+ QAK F E T++TGI+LTK+DGT+KGGIVL+I+  +N+P+KY+GLGEK++DL  FD+E ++  + K
  S:    13 KNDKYQMGLHKSRSSFDN-LKKLLDESDTINDDLFDAIEDLLISADIGVDTVLHFTNELRNEVINKQFENPSDLSETIVDKLFEIYLKDEFVDTTLSFTEGEVNVFLFVGVNGVGKTTTIGKLAKQYKDQGKKVLMVAGDTFRAGAIEQLYEWSKRAKVDFYQKDA-GSDPSSVIFEALEKAKKETYDLVLVDTAGRLQNKVNLMNELSKMKRVIEKALPSQPAETLLVIDATTGQNGMNQAKVFNEATDLTGIVLTKLDGTAKGGIVLAIRHLYNLPIKYVGLGEKIDDLVPFDIEDYIYNLFK 315
>gi|52785575|ref|YP_091404.1| hypothetical protein BLi01816 [Bacillus licheniformis ATCC 14580] >gi|163119430|ref|YP_078989.2| signal recognition particle (docking protein) [Bacillus licheniformis ATCC 14580] >gi|52348077|gb|AAU40711.1| FtsY [Bacillus licheniformis DSM 13] >gi|145902937|gb|AAU23351.2| signal recognition particle (docking protein) [Bacillus licheniformis ATCC 14580] (328 aa)
Score = 683, Expect = 9.3e-70, Identities = 144/305 (47%), Positives = 216/305 (70%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF EGL K+ +T  + + E+V +++KVDE+F+E +EE+LI  DVGV    ++ D ++ E+  +N++DP  ++ +I +K+   Y       + L ++  R NI+L +GVNGVGKTT+I K+A+ FIK+ K V+L AGDTFRAGA++QL +W +R+   +V    EG DPA+VI+  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLVLDAT GQ+ + QA+ F + T+++GI+LTK+DGT+KGGIVL+I+    IPVK++GLGEK++DL  F+ E +V G+  +L+
  S:    21 KFKEGLAKTRNTFQERVNELVSRYRKVDEDFFEELEEVLIGADVGVATVMELIDELKSEVKRRNIQDPKEVQSVISEKLVEIYEGGEQEASELRVEDGRLNIILFVGVNGVGKTTTIGKLAHQFIKEGKNVVLAAGDTFRAGAIDQLEVWGERVGAHVV-KQAEGSDPAAVIYDAVQAAKARGADVLLCDTAGRLQNKVNLMKELEKVKRVIQREVPDAPHEVLLVLDATTGQNAMTQAREFSKATDVSGIVLTKLDGTAKGGIVLAIRHELQIPVKFVGLGEKMDDLQPFEAESYVYGLFSDLI 324
>gi|171326123|ref|ZP_02914613.1| signal recognition particle-docking protein FtsY [Geobacillus sp. WCH70] >gi|171087867|gb|EDT34228.1| signal recognition particle-docking protein FtsY [Geobacillus sp. WCH70] (329 aa)
Score = 679, Expect = 2.4e-69, Identities = 152/326 (46%), Positives = 232/326 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           K++EK I KQA+ +       +KF +GL K+  + +  + +++ +++KVDEEF+E +EE+LIS DVGV    ++ D ++ E+  +N++DP  +K +I +K+   Y  D D    L+I+++   ++L +GVNGVGKTT+I K+A+    + K V+L AGDTFRAGA+EQL +W +R+  + V+    G DPA+VI+  ++  K  + D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLVLDAT GQ+ + QAK FKE+TN+TGI+LTK+DGT+KGGIVL+I++  +IPVK++GLGEK++DL  FD E++V G+  +L
  S:     6 KLKEK-ITKQADSV------TEKFKQGLSKTRDSFAGRVNDLIARYRKVDEEFFEELEEILISADVGVNTVMELVDELKMEVKRRNIQDPKEMKAVISEKLVEIYRGDDDAKAELNIQENGLTVILFVGVNGVGKTTTIGKLAHKLKSEGKTVMLAAGDTFRAGAIEQLEVWGERVGAE-VIKQSAGSDPAAVIYDAIQAAKARHVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREIPGAPHEVLLVLDATTGQNAMSQAKIFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIPVKFVGLGEKMDDLQPFDPEQYVYGLFADL 323
>gi|56964061|ref|YP_175792.1| signal recognition particle GTPase [Bacillus clausii KSM-K16] >gi|56910304|dbj|BAD64831.1| signal recognition particle GTPase [Bacillus clausii KSM-K16] (327 aa)
Score = 677, Expect = 3.8e-69, Identities = 140/327 (42%), Positives = 230/327 (70%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K+ EK  ++  E+ +       KF  GL+K+ ++ S  I E+V +++K+DE+F+E++EE+LI  DVGV    ++ D ++EE+  +N++D + I+ +I +K+ +   +D D +T L +++   +++L++GVNGVGKTTSI K+A++   + K V+L AGDTFRAGA++QL++W +R+    V+  +EG DPA+V++  +   +    D++ICDT+GRL NK+NLM EL K+  VI +    APHE LLV+DAT GQ+ + QAKAF   T+++G++LTK+DGT+KGGIV++I+   ++PVK+IGLGE+ +DL  FD E+FV G+ ++ +
  S:     6 KLREKMAQQTNEVAD-------KFKHGLEKTRTSFSGKINELVARYRKIDEDFFEDLEEILIGADVGVSTVMELVDELKEEVRLRNLKDTEEIQPVISEKLASLLEKD-DKDTTLQLQEG-LSVILVVGVNGVGKTTSIGKLAHYLKGQGKSVVLAAGDTFRAGAIDQLDVWGERVGVP-VIKQQEGSDPAAVMYDAIAWARSRKADVLICDTAGRLQNKVNLMNELAKVKRVIEREVPGAPHEVLLVVDATTGQNALSQAKAFAASTDVSGLVLTKLDGTAKGGIVIAIRQELDLPVKFIGLGEQKDDLQPFDAEQFVYGLFQDAI 322
>gi|116618657|ref|YP_819028.1| signal recognition particle-docking protein FtsY [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097504|gb|ABJ62655.1| signal recognition particle-docking protein FtsY [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (442 aa)
Score = 676, Expect = 4.7e-69, Identities = 145/307 (47%), Positives = 206/307 (67%)
  Q:    47 QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD--TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           Q+ +D GLKKS +  +      +  F+ VDE F+E++EE L+  DVG     KI+D +REE+  +N +  + ++++I+ K+   Y  D   +  T     K +T ++L +GVNGVGKTT+I K+A+ + K  K VLL A DTFRAGA +QL  W +R    +V   KE  DPASV+F  V+K +DENYD++  DT+GRL N +NLM+ELEK+  +I +    APHE LLVLDAT GQ+ + QAK FK  ++++GI+LTKMDGT+KGGIV +I++  ++PVK+IG GEK  DL  F  E+FV G+ KELV
  S:   133 QQIYDAGLKKSRTGFADRFNRFLANFRSVDENFFEDLEETLVGADVGFDMAIKISDELREEVKLKNAKRKEDVRDVIIKKMVDLYEADGINEDATMNFAPKGQTTVILFVGVNGVGKTTTIGKLASKYQKAGKSVLLAAADTFRAGATKQLQEWGERAHVPVV-AGKEKADPASVVFAAVEKARDENYDVLFVDTAGRLQNNVNLMQELEKMKRIIQREIPEAPHEVLLVLDATTGQNALQQAKLFKNSSDVSGIVLTKMDGTAKGGIVFAIRNEMHLPVKWIGFGEKASDLREFKPEEFVYGLFKELV 440
>gi|89098683|ref|ZP_01171565.1| recognition particle-docking protein FtsY [Bacillus sp. NRRL B-14911] >gi|89086645|gb|EAR65764.1| recognition particle-docking protein FtsY [Bacillus sp. NRRL B-14911] (329 aa)
Score = 676, Expect = 5.0e-69, Identities = 145/306 (47%), Positives = 219/306 (71%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +KF +GL K+    S  + ++V +++KVDE+F+E +EE+LI  DVG     ++ + +R E+  +N++DP  ++ II +K+   Y    + ++ L+I++    ++L +GVNGVGKTTSI K+A+ F  + KKVL+ AGDTFRAGA+EQL +W  R+  + V+   EG DPA+V+F  V+  K  N D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LL LDAT GQ+ ++QAK FKE T+++GI+LTK+DGT+KGGIVL+I+   +IPVK++GLGEK++DL  FD E++V G+  ++V
  S:    20 EKFKDGLTKTRDNFSGKVNDLVARYRKVDEDFFEELEEILIQADVGFDTVMELVEELRMEVKRKNIQDPQGVQSIISEKLVEIYEGSGEASSALNIQEGDLTVILFVGVNGVGKTTSIGKLAHKFKSEGKKVLMAAGDTFRAGAIEQLEVWGDRVGVE-VIKQAEGSDPAAVMFDAVRAAKSRNADILLCDTAGRLQNKVNLMKELEKVKRVIEREIPGAPHEVLLALDATTGQNAMIQAKTFKEATDVSGIVLTKLDGTAKGGIVLAIRKELDIPVKFVGLGEKMDDLQEFDAERYVYGLFADMV 324
>gi|152976213|ref|YP_001375730.1| signal recognition particle-docking protein FtsY [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152024965|gb|ABS22735.1| signal recognition particle-docking protein FtsY [Bacillus cereus subsp. cytotoxis NVH 391-98] (329 aa)
Score = 672, Expect = 1.8e-68, Identities = 146/327 (44%), Positives = 233/327 (71%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK I KQ + +       +KF +GL+K+ ++ +  + ++V +++KVDE+F+E +EE+LIS DVGV    ++ D +++E+  +N++DP  ++ +I +K+   Y  +   +  +++++D+  ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRAGA+EQL +W  R+  + V+    G DPA+V++  V+  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLV+DAT GQ+G+ QAK F+E TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK++GLGE+++DL  F  E++V G+   LV
  S:     6 KLKEK-ISKQTDTV------TEKFKQGLEKTRNSFADKVNDLVYRYRKVDEDFFEELEEILISADVGVTTVMELIDQLKDEVKRRNIQDPKEVQAVISEKLIDIYKGEEGFSNEINMQQDQLTVILFVGVNGVGKTTTIGKMAHKFKSEGKSVLLAAGDTFRAGAIEQLEVWGNRVGVE-VIKQGSGSDPAAVMYDAVQAAKARKVDVLLCDTAGRLQNKVNLMKELEKVKRVIEREIPGAPHEVLLVIDATTGQNGLSQAKTFREATNVTGIVLTKLDGTAKGGIVLAIRNEMDVPVKFVGLGEQMDDLQQFQPEQYVYGLFANLV 324
>gi|148544381|ref|YP_001271751.1| signal recognition particle-docking protein FtsY [Lactobacillus reuteri F275] >gi|184153745|ref|YP_001842086.1| signal recognition particle receptor [Lactobacillus reuteri F275] >gi|148531415|gb|ABQ83414.1| signal recognition particle-docking protein FtsY [Lactobacillus reuteri F275] >gi|183225089|dbj|BAG25606.1| signal recognition particle receptor [Lactobacillus reuteri F275] (508 aa)
Score = 669, Expect = 3.9e-68, Identities = 148/309 (47%), Positives = 215/309 (69%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E  KK+D GL+KS +     + + +  F+ VDE+F++++E++LI  DVG     K++D +REE+  QN +    +  +I++K+   Y +   D N  L + K+   +++ +GVNG GKTT+I K+A  F K+ KKVLL A DTFRAGA EQL++W++R   DIV   + G DPA+V+F  VK+ KDENYD++  DT+GRL NK+NLM EL K+  ++ +    APHE LLVLDAT GQ+ + QAK FKE T++TGI+LTK+DGT++GGIVL+I++  ++PVKY+GLGEK++DL  FD   FV G+ K LV
  S:   197 ETVKKYDRGLEKSRTGFGARLNKFLANFRHVDEDFFDDLEDMLIESDVGYDMAMKLSDELREEVKLQNAKSKQDVSNVIIEKMVELYDEAGQDENPDLTMAKEGPTVIMFVGVNGAGKTTTIGKMAALFKKQGKKVLLAAADTFRAGATEQLDVWAKRDGVDIVTGPENG-DPAAVVFDAVKRAKDENYDILFVDTAGRLQNKVNLMNELAKMKRILTREIPDAPHEVLLVLDATTGQNALNQAKLFKESTDVTGIVLTKLDGTARGGIVLAIRNELHLPVKYVGLGEKVDDLQKFDAGDFVYGLFKGLV 505
>gi|157692275|ref|YP_001486737.1| signal recognition particle-docking protein [Bacillus pumilus SAFR-032] >gi|157681033|gb|ABV62177.1| signal recognition particle-docking protein [Bacillus pumilus SAFR-032] (328 aa)
Score = 668, Expect = 5.1e-68, Identities = 144/306 (47%), Positives = 215/306 (70%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +KF +GL+K+ ++    + E++ +++KVDE+F+E +EE+LI  DVG     ++ D +++E+  +N++DP  ++ +I +K+   Y    +  + L+I+  R NI+L +GVNGVGKTT+I K+AN    + K V+L AGDTFRAGA+EQL +W +R    +V     G DPA+VI+  V+  K +N D++ICDT+GRL NK+NLMKELEK+  VI +    APHE LL LDAT GQ+ + QAK F + TN+TGI LTK+DGT+KGGIVL+I++  NIPVK +GLGEK++DL  FD E +V G+  +++
  S:    20 EKFKDGLEKTRNSFQGRVNELISRYRKVDEDFFEELEEVLIGADVGFTTVMEMIDELKKEVKLRNIQDPSEVQSVISEKLVEIYNSGEEQISALNIEDGRLNIILFVGVNGVGKTTTIGKLANKLKNEGKSVILAAGDTFRAGAIEQLEVWGERSGVPVV-KQTAGSDPAAVIYDAVQSAKAKNADVLICDTAGRLQNKVNLMKELEKVKRVIEREVPDAPHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELNIPVKLVGLGEKVDDLQEFDAESYVYGLFSDVI 324
>gi|167014987|ref|ZP_02277520.1| cell division ABC transporter, substrate-binding protein FtsY [Listeria monocytogenes FSL J1-194] (289 aa)
Score = 667, Expect = 5.5e-68, Identities = 142/286 (49%), Positives = 208/286 (72%)
  Q:    68 IVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +V +++KVDE+F+E +EE+LI  DVG     ++ D +R E+  +N+ DP  ++E+IV+K+   Y  D   +  L I++D   ++L +GVNGVGKTTSI K+A+ F ++ KKV+L AGDTFRAGA++QL +W +R   D V+   EG DPA+V+F  V+  K    D+++CDT+GRL NK+NLM ELEK+  VI +    APHE LLVLDAT GQ+  +QAK FKE T++TGIILTK+DGT+KGGIV++I++  +IPVK++GLGE+++DL AFD  ++V G+  ++V
  S:     1 MVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQGDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVD-VIKQAEGSDPAAVMFDAVQAAKARKADVLLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMV 285
>gi|167212548|ref|ZP_02282855.1| hypothetical protein LmonL_16240 [Listeria monocytogenes LO28] (289 aa)
Score = 667, Expect = 5.7e-68, Identities = 142/286 (49%), Positives = 208/286 (72%)
  Q:    68 IVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +V +++KVDE+F+E +EE+LI  DVG     ++ D +R E+  +N+ DP  ++E+IV+K+   Y  D   +  L I++D   ++L +GVNGVGKTTSI K+A+ F ++ KKV+L AGDTFRAGA++QL +W +R   D V+   EG DPA+V+F  V+  K    D+++CDT+GRL NK+NLM ELEK+  VI +    APHE LLVLDAT GQ+  +QAK FKE T++TGIILTK+DGT+KGGIV++I++  +IPVK++GLGE+++DL AFD  ++V G+  ++V
  S:     1 MVARYRKVDEDFFEELEEILIGADVGFETVMELVDTLRREVQLRNISDPKDVQEVIVEKLVEIYQGDEKEDEALHIEEDGLTVILFVGVNGVGKTTSIGKMAHRFKQEGKKVMLAAGDTFRAGAIDQLEVWGERTGVD-VIKQAEGSDPAAVMFDAVQAAKARKADILLCDTAGRLQNKVNLMNELEKVKRVITREIPNAPHEVLLVLDATTGQNAFVQAKQFKETTDVTGIILTKLDGTAKGGIVIAIRNELDIPVKFVGLGEQMDDLQAFDANEYVYGLFADMV 285
>gi|194014405|ref|ZP_03053022.1| signal recognition particle-docking protein FtsY [Bacillus pumilus ATCC 7061] >gi|194013431|gb|EDW22996.1| signal recognition particle-docking protein FtsY [Bacillus pumilus ATCC 7061] (328 aa)
Score = 667, Expect = 6.6e-68, Identities = 144/306 (47%), Positives = 214/306 (69%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +KF +GL+K+ ++    + E++ +++KVDE+F+E +EE+LI  DVG     ++ D +++E+  +N++DP  ++ +I +K+   Y    +  + L+I+  R NI+L +GVNGVGKTT+I K+AN      K V+L AGDTFRAGA+EQL +W +R    +V     G DPA+VI+  V+  K +N D++ICDT+GRL NK+NLMKELEK+  VI +    APHE LL LDAT GQ+ + QAK F + TN+TGI LTK+DGT+KGGIVL+I++  NIPVK +GLGEK++DL  FD E +V G+  +++
  S:    20 EKFKDGLEKTRNSFQGRVNELISRYRKVDEDFFEELEEVLIGADVGFTTVMELIDELKKEVKLRNIQDPSEVQSVISEKLVEIYNSGEEQISALNIEDGRLNIILFVGVNGVGKTTTIGKLANKLKNDGKSVILAAGDTFRAGAIEQLEVWGERSGVPVV-KQTAGSDPAAVIYDAVQSAKAKNADVLICDTAGRLQNKVNLMKELEKVKRVIEREVPDAPHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELNIPVKLVGLGEKVDDLQEFDAESYVYGLFSDVI 324
>gi|184155712|ref|YP_001844052.1| signal recognition particle receptor [Lactobacillus fermentum IFO 3956] >gi|183227056|dbj|BAG27572.1| signal recognition particle receptor [Lactobacillus fermentum IFO 3956] (509 aa)
Score = 666, Expect = 6.9e-68, Identities = 141/309 (45%), Positives = 210/309 (67%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E +KK+D+GL+KS +     +   +  F+ VDE+F++++E++LI  DVG     K++D++REE+  QN ++   +  +I++K+   Y +      T L +      +++ +GVNG GKTT+I K+A  F  + K+VLL A DTFRAGA EQL +W+QR   DIV    E  DPA+V+F  V K K +NYD++  DT+GRL NK+NLM EL K+  ++ +    APHE LLVLDAT GQ+ + QAK FKE T++TGI+LTK+DGT++GGIVL+I++  ++PVK++GLGEK+ DL  F+ + FV G+ K LV
  S:   198 ETEKKYDQGLEKSRNGFGARLNRFLANFRHVDEDFFDDLEDMLIESDVGYEMAMKLSDSLREEVRLQNAKNKQDVSNVIIEKMVNLYDEAGAGEQTTLTMADQGPTVIMFVGVNGAGKTTTIGKMAARFKGQGKRVLLAAADTFRAGATEQLEVWAQRDGVDIV-TGPENSDPAAVVFDAVTKAKKDNYDVLFVDTAGRLQNKVNLMNELAKMKRILTREIPDAPHEVLLVLDATTGQNALTQAKLFKETTDVTGIVLTKLDGTARGGIVLAIRNELHLPVKFVGLGEKVSDLEEFNAQDFVYGLFKGLV 506
>gi|56419729|ref|YP_147047.1| signal recognition particle GTPase (docking protein) [Geobacillus kaustophilus HTA426] >gi|56379571|dbj|BAD75479.1| signal recognition particle GTPase (docking protein) [Geobacillus kaustophilus HTA426] (328 aa)
Score = 663, Expect = 1.6e-67, Identities = 144/306 (47%), Positives = 218/306 (71%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTF--LDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +KF EGL K+ ++L+  + +++ +++KVDEEF+E +EE+LI+ DVGV    ++ D ++ E+  +N++DP  ++++I +K+   Y    D      L+I++    ++L +GVNGVGKTT+I K+A+    + K VLL AGDTFRAGA+EQL  W +R+  D V+    G DPA+V++  ++  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLVLDAT GQ+ + QAK FKE T++TGI+LTK+DGT+KGGIVL+I++   IPVK +GLGEK++DL  FD E++V G+  +L+
  S:    20 EKFKEGLSKTRNSLAGKVNDLIARYRKVDEEFFEELEEILIAADVGVTTVMELVDELKMEVKRRNIQDPAQMRDVIAEKLVDIYRAGADGKELSALNIQEGGLTVILFVGVNGVGKTTTIGKLAHKLKSEGKSVLLAAGDTFRAGAIEQLEAWGERVGVD-VIKQAAGSDPAAVMYDAIQAAKARGVDVLLCDTAGRLQNKVNLMKELEKVKRVISREIPGAPHEVLLVLDATTGQNAMSQAKLFKEATDVTGIVLTKLDGTAKGGIVLAIRNEMAIPVKLVGLGEKMDDLQVFDPEQYVYGLFADLL 326
>gi|194466491|ref|ZP_03072478.1| signal recognition particle-docking protein FtsY [Lactobacillus reuteri 100-23] >gi|194453527|gb|EDX42424.1| signal recognition particle-docking protein FtsY [Lactobacillus reuteri 100-23] (506 aa)
Score = 663, Expect = 1.9e-67, Identities = 147/309 (47%), Positives = 215/309 (69%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E  KK+D GL+KS +     + + +  F+ VDE+F++++E++LI  DVG     K++D +REE+  QN +    +  +I++K+   Y +   D N  L + K+   +++ +GVNG GKTT+I K+A  F K+ KKVLL A DTFRAGA EQL++W++R   DIV   + G DPA+V+F  VK+ KDE YD++  DT+GRL NK+NLM EL K+  ++++    APHE LLVLDAT GQ+ + QAK FKE T++TGI+LTK+DGT++GGIVL+I++  ++PVKY+GLGEK++DL  FD   FV G+ K LV
  S:   195 ETVKKYDRGLEKSRTGFGARLNKFLANFRHVDEDFFDDLEDMLIESDVGYDMAMKLSDELREEVKLQNAKSKQDVSNVIIEKMVELYDEAGQDENPDLTMAKEGPTVIMFVGVNGAGKTTTIGKMAALFKKQGKKVLLAAADTFRAGATEQLDVWAKRDGVDIVTGPENG-DPAAVVFDAVKRAKDEKYDILFVDTAGRLQNKVNLMNELAKMKRILNREIPDAPHEVLLVLDATTGQNALNQAKLFKESTDVTGIVLTKLDGTARGGIVLAIRNELHLPVKYVGLGEKVDDLQKFDAGDFVYGLFKGLV 503
>gi|167463677|ref|ZP_02328766.1| signal recognition particle-docking protein FtsY [Paenibacillus larvae subsp. larvae BRL-230010] (335 aa)
Score = 662, Expect = 2.0e-67, Identities = 138/300 (46%), Positives = 208/300 (69%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KF EGL K+     + I ++    KKVDE FYE +EE+LIS DVGV    ++ D +R+E+  + +EDP +++ ++ +K+    + +T  +  L++  +  +++L +GVNGVGKTT+I K+A+    + KKV+L AGDTFRAGA+EQL  W +R+  + V+    G DPA+V+F  ++  K    D+++CDT+GRL NK+NLM+EL KI+ VI +    APHE LLVLDAT GQ+ + QAK F + T +TG++LTK+DGT+KGGIV++I+   +IPVK++GLGEK++DL  FD E+FV  +
  S:    21 KFKEGLSKTRDVFVERIEDLFSTRKKVDEGFYEELEEILISADVGVNTVMELIDDLRDEVRKRKIEDPGVLQPVLSEKLIN--LLETGKDAELNLAGEGLSVILFVGVNGVGKTTTIGKMAHMLKSQGKKVMLAAGDTFRAGAIEQLETWGERVGVE-VIKQHSGSDPAAVMFDALQAAKRRGMDVLLCDTAGRLQNKVNLMEELNKIYRVIRREIPEAPHEVLLVLDATTGQNALTQAKLFGDKTGLTGLVLTKLDGTAKGGIVVAIRQELDIPVKFVGLGEKMDDLQKFDSEQFVHAL 317
>gi|138894715|ref|YP_001125168.1| Signal recognition particle-docking protein FtsY [Geobacillus thermodenitrificans NG80-2] >gi|196247666|ref|ZP_03146368.1| signal recognition particle-docking protein FtsY [Geobacillus sp. G11MC16] >gi|134266228|gb|ABO66423.1| Signal recognition particle-docking protein FtsY [Geobacillus thermodenitrificans NG80-2] >gi|196212450|gb|EDY07207.1| signal recognition particle-docking protein FtsY [Geobacillus sp. G11MC16] (329 aa)
Score = 662, Expect = 2.1e-67, Identities = 143/301 (47%), Positives = 216/301 (71%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTF--LDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +KF EGL K+  +L+  + +++ +++KVDEEF+E +EE+LI+ DVGV    ++ D ++ E+  +N++D   ++++I +K+   Y    D +    L+I+ +   ++L +GVNGVGKTT+I K+A+    + K VLL AGDTFRAGA+EQL +W +R+  D V+    G DPA+V++  ++  K    D+++CDT+GRL NK+NLMKELEK+  VI +    APHE LLVLDAT GQ+ + QAK FKE T++TGI+LTK+DGT+KGGIVL+I++   IPVK++GLGEK++DL  FD EK+V G+
  S:    20 EKFREGLSKTRDSLAGKVNDLIARYRKVDEEFFEELEEILIAADVGVTTVMELVDELKMEVKRRNIQDSAQMRDVIAEKLIDIYRAGADDSELSALNIQTNGLTVILFVGVNGVGKTTTIGKLAHKLKSEGKSVLLAAGDTFRAGAIEQLEVWGERVGVD-VIKQTAGSDPAAVMYDAIQAAKARGVDVLLCDTAGRLQNKVNLMKELEKVKRVISREIPGAPHEVLLVLDATTGQNAMSQAKLFKEATDVTGIVLTKLDGTAKGGIVLAIRNELAIPVKFVGLGEKMDDLQPFDAEKYVYGL 321
>gi|154686011|ref|YP_001421172.1| hypothetical protein RBAM_015780 [Bacillus amyloliquefaciens FZB42] >gi|154351862|gb|ABS73941.1| FtsY [Bacillus amyloliquefaciens FZB42] (329 aa)
Score = 661, Expect = 2.7e-67, Identities = 144/306 (47%), Positives = 215/306 (70%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +KF +GL+K+ ++ S  + E+V +++KVDE+F+E +EE+LI  DVG     ++ D +++E+  +N++DP  ++ +I +K+   Y    +  + L+I+ +R N++L++GVNGVGKTT+I K+A+    + K V+L AGDTFRAGA+EQL +W +R     V+    G DPA+VI+  V   K    D++ICDT+GRL NK+NLMKELEK+  VI +    APHE LL LDAT GQ+ + QAK F + TN+TGI LTK+DGT+KGGIVL+I++  +IPVK +GLGEK++DL  FD E +V G+  +LV
  S:    20 EKFKDGLEKTRNSFSNKVNELVSRYRKVDEDFFEELEEVLIGADVGFTTVMELIDELKKEVKLKNIQDPQEVQSVISEKLVDIYNSGDEQISELNIQDERLNVILLVGVNGVGKTTTIGKLAHKLKNEGKSVVLAAGDTFRAGAIEQLEVWGERTGVP-VIKQAAGSDPAAVIYDAVHAAKARGADVLICDTAGRLQNKVNLMKELEKVKRVIEREVPEAPHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELHIPVKLVGLGEKVDDLQRFDAESYVYGLFSDLV 324
>gi|50365053|ref|YP_053478.1| signal recognition particle, cell division protein GTPase [Mesoplasma florum L1] >gi|50363609|gb|AAT75594.1| signal recognition particle, cell division protein GTPase [Mesoplasma florum L1] (367 aa)
Score = 659, Expect = 4.9e-67, Identities = 158/342 (46%), Positives = 247/342 (72%)
  Q:     4 GFFKKIVNKLKGKK-------EGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIW-SQRL--KCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           GF+ K+ +K+ G +       E  ++  +    ++  EK+    +    K++K ++ + KS+   SK I ++ KK+KK+D++F++ +EE+LI  D+G+    KI++ IR ++  +N  + +  +EI+ ++I+  Y   +     L+ +  R N+ +++GVNG GKTTS++KIAN++ +++KKVL+ A DTFRAGA+EQL  W  +RL  K D+V   K+ QDPASV+F  ++K K ENYDL++ DT+GRL NKINLMKELEK++ ++HKFD  APHE LLV+DAT GQ+G+MQA+ F E+ ++TGI+LTKMDGTSKGGI LSIKD  NIPVK +G+GE+++D+  FD++++V
  S:     2 GFWNKLKDKISGNQTEKKVNEEKVIKSETVIENKQPTEKEIAKKQKQKAKKEKAEKAIAKSALDFSKDIKKLSKKYKKMDDDFFDELEEVLIKTDMGMKMVLKISNNIRRKV--KNTSEANEFREILAEEIYDIYTDGSKKVEELNFEDGRLNVFMVIGVNGTGKTTSLSKIANYYAEQNKKVLIAAADTFRAGAIEQLEEWVDKRLDNKVDLVKGKKQNQDPASVVFDALEKAKAENYDLLLIDTAGRLQNKINLMKELEKMYQIVHKFDKKAPHELLLVIDATTGQNGVMQAQEFNEVADVTGIVLTKMDGTSKGGIALSIKDQLNIPVKLVGVGEQVDDIEKFDVDQYV 351
>gi|16078658|ref|NP_389477.1| signal recognition particle (docking protein) [Bacillus subtilis subsp. subtilis str. 168] >gi|33517363|sp|P51835|FTSY_BACSU Cell division protein ftsY homolog >gi|2633967|emb|CAB13468.1| signal recognition particle (docking protein) [Bacillus subtilis subsp. subtilis str. 168] (329 aa)
Score = 658, Expect = 6.2e-67, Identities = 144/306 (47%), Positives = 216/306 (70%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +KF +GL+K+ ++    + ++V +++KVDE+F+E +EE+LIS DVG     ++ D +++E+  +N++DP  ++ +I +K+   Y    +  + L+I+  R N++L++GVNGVGKTT+I K+A+   ++ K V+L AGDTFRAGA+EQL +W +R     V+    G DPA+VI+  V   K  N D++ICDT+GRL NK+NLMKELEK+  VI +    APHE LL LDAT GQ+ + QAK F + TN+TGI LTK+DGT+KGGIVL+I++  +IPVK +GLGEK++DL  FD E +V G+  +LV
  S:    20 EKFKDGLEKTRNSFQNKVNDLVSRYRKVDEDFFEELEEVLISADVGFTTVMELIDELKKEVKRRNIQDPKEVQSVISEKLVEIYNSGDEQISELNIQDGRLNVILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDTFRAGAIEQLEVWGERTGVP-VIKQTAGSDPAAVIYDAVHAAKARNADVLICDTAGRLQNKVNLMKELEKVKRVIEREVPEAPHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELHIPVKLVGLGEKVDDLQEFDPESYVYGLFSDLV 324
>gi|1237016|dbj|BAA10978.1| Srb [Bacillus subtilis] >gi|1237019|dbj|BAA08616.1| Srb [Bacillus subtilis] (329 aa)
Score = 654, Expect = 2.1e-66, Identities = 143/306 (46%), Positives = 215/306 (70%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +KF +GL+K+ ++    + ++V +++KVDE+F+E +EE+LIS DVG     ++ D +++E+  +N++DP  ++ +I +K+   Y    +  + L+I+  R N++L++GVNGVGKTT+I K+A+   ++ K V+L AGDTFRAGA+EQL +W +R     V+    G DPA+VI+  V   K  N D++ICDT+GRL NK+NLMKELEK+  VI +     PHE LL LDAT GQ+ + QAK F + TN+TGI LTK+DGT+KGGIVL+I++  +IPVK +GLGEK++DL  FD E +V G+  +LV
  S:    20 EKFKDGLEKTRNSFQNKVNDLVSRYRKVDEDFFEELEEVLISADVGFTTVMELIDELKKEVKRRNIQDPKEVQSVISEKLVEIYNSGDEQISELNIQDGRLNVILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDTFRAGAIEQLEVWGERTGVP-VIKQTAGSDPAAVIYDAVHAAKARNADVLICDTAGRLQNKVNLMKELEKVKRVIEREVPETPHEVLLALDATTGQNAMAQAKEFSKATNVTGIALTKLDGTAKGGIVLAIRNELHIPVKLVGLGEKVDDLQEFDPESYVYGLFSDLV 324
>gi|15615049|ref|NP_243352.1| signal recognition particle (docking protein) [Bacillus halodurans C-125] >gi|10175106|dbj|BAB06205.1| signal recognition particle (docking protein) [Bacillus halodurans C-125] (330 aa)
Score = 653, Expect = 2.4e-66, Identities = 150/327 (45%), Positives = 227/327 (69%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K++EK   +  E+ E       KF  GL+K+  + +  + ++V K++ VDE+F+E +EE+LI  DVGV     + + +++E+  QN++D   I+ II +K+    ++     T ++++    +++L++GVNGVGKTTSI K+A+ + ++ KKV+L AGDTFRAGA+EQL +W +R   D V+   EG DPA+V+F  ++  K    D++ICDT+GRL NK+NLMKELEK+  VI +    APHE L+ LDAT GQ+ + QAK FKE T++TGIILTK+DGT+KGGIVL+I+   +IPVK++GLGEK++DL  FD E+FV G+ K++V
  S:     6 KLKEKISTQTTEVTE-------KFKAGLEKTRDSFAGKMNDLVYKYRSVDEDFFEELEEILIGADVGVTTVMDLVEELKDEVRRQNIKDSKDIQPIISEKL-AELLEKEGGETEVNLQPAGLSVILVVGVNGVGKTTSIGKLAHMYKQQGKKVILAAGDTFRAGAIEQLEVWGERAGVD-VIKQSEGSDPAAVMFDAIQAAKSREADILICDTAGRLQNKVNLMKELEKVKRVISREIPGAPHEVLIALDATTGQNAMSQAKTFKETTDVTGIILTKLDGTAKGGIVLAIRHELDIPVKFVGLGEKIDDLQPFDSEQFVYGLFKDMV 323
>gi|149183218|ref|ZP_01861664.1| signal recognition particle-docking protein FtsY [Bacillus sp. SG-1] >gi|148849083|gb|EDL63287.1| signal recognition particle-docking protein FtsY [Bacillus sp. SG-1] (332 aa)
Score = 651, Expect = 4.4e-66, Identities = 142/305 (46%), Positives = 214/305 (70%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF +GL K+    S  + ++V +++KVDE+F+E +EE+LI  DVG     ++ D ++ E   +N+++   ++ +I +K+   Y  D   ++ L+I++D   ++L +GVNGVGKTT+I K+A+ F ++ K VLL AGDTFRAGA++QL +W +R     V+   EG DPA+VI+  V+  K +  D++ICDT+GRL NK+NLM EL+K+  VI +    APHE LLVLDAT GQ+ ++QAK FKE T+++GI+LTK+DGT+KGGIV+ I++   IPVK++GLGEK++DL  FD EK+V G+   LV
  S:    21 KFKDGLSKTRDNFSSKVNDLVARYRKVDEDFFEELEEILIGADVGFDTVMELVDQLKFEAKRRNIQETSELQSVISEKLVEIYEGDEGASSELNIQEDTLTVILFVGVNGVGKTTTIGKMAHMFKEQGKNVLLAAGDTFRAGAIDQLEVWGERTGVP-VIKHSEGSDPAAVIYDAVQSAKAKKADILICDTAGRLQNKVNLMNELQKVKRVIEREIPGAPHEVLLVLDATTGQNALLQAKTFKEATDVSGIVLTKLDGTAKGGIVIGIRNELQIPVKFVGLGEKVDDLQPFDAEKYVYGLFSNLV 324
>gi|195978483|ref|YP_002123727.1| signal recognition particle receptor protein FtsY (alpha subunit) [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975188|gb|ACG62714.1| signal recognition particle receptor protein FtsY (alpha subunit) [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (485 aa)
Score = 650, Expect = 5.1e-66, Identities = 140/302 (46%), Positives = 201/302 (66%)
  Q:    47 QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           Q+K+   LKK+ +  S  +      F++VDE+F+E++EELLI  DVGV     +T+ +R E   +N + P+ +K +I++K+   Y  D   N  +  ++D T ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F GV++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGGIVL+I+   +IPVK IG GE ++D+  F  E F+ G+
  S:   181 QEKYKRSLKKTRTGFSARLNSFFANFRRVDEDFFEDLEELLILSDVGVHVATTLTEELRYEAKLENAKKPEALKRLIIEKLVAIYEGDGRYNEAIHYQQDLT-VMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGVERAVAERADILLIDTAGRLQNKDNLMAELEKIGRIIKRVIPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGIVLAIRQELDIPVKLIGFGEAIDDIGEFHSEDFMKGL 480
>gi|23098984|ref|NP_692450.1| signal recognition particle [Oceanobacillus iheyensis HTE831] >gi|22777212|dbj|BAC13485.1| signal recognition particle (docking protein) [Oceanobacillus iheyensis HTE831] (333 aa)
Score = 649, Expect = 6.4e-66, Identities = 149/336 (44%), Positives = 225/336 (66%)
  Q:    19 GSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT-FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELVI 354
           G ++ L  K ++ N  KQ           +K+ EG+KK+ ++ S  + +++ +++KVDE+F+E +EE+LI+ DVGV     + + ++ E+  QN++D + IK++I +K+   Y  D D +   L I  D   ++L++GVNG GKTTSI K+A+   ++ K V+L AGDTFRAGA+EQL +W +R     V+   EG DPA+VI+ GV+  K  N D++ICDT+GRL NK+NLM EL K+  VI +    APHE LLVLDAT GQ+ + QA+ F + T++TGI+LTK+DGT+KGGIVL+I++   +PVK++GLGEK+ DL  FD   FV G+  ++ I
  S:     2 GFMDKLKQKFKQDNETKQV---------TEKYQEGMKKTRNSFSGKLNDLIARYRKVDEDFFEELEEVLITADVGVTTVMDLVEELKMEVKRQNIKDSEQIKDVISEKLVEIYYGDEDESIEKLKIDGDGLKVILVVGVNGAGKTTSIGKLAHQLKQEGKNVVLAAGDTFRAGAIEQLEVWGERADVP-VIKQSEGSDPAAVIYDGVQAAKSRNADVLICDTAGRLQNKVNLMNELSKVKRVIEREIPDAPHEVLLVLDATTGQNALNQARTFSDATDVTGIVLTKLDGTAKGGIVLAIRNELQLPVKFVGLGEKINDLQQFDASAFVYGLFSDIDI 328
>gi|157150948|ref|YP_001450086.1| cell division protein FtsY [Streptococcus gordonii str. Challis substr. CH1] >gi|157075742|gb|ABV10425.1| cell division protein FtsY [Streptococcus gordonii str. Challis substr. CH1] (529 aa)
Score = 640, Expect = 8.3e-65, Identities = 144/336 (42%), Positives = 227/336 (67%)
  Q:    18 EGSLEDLSAKIEEK-NIEKQAEILEVLPEK------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E   +DL  ++E+  +  ++AE+ +   E+      Q+K+D  LKK+ +     +      F+ VDE+F+E++EELLI+ DVGV   + + + +R E   +N + PD ++++I++K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++ + EN D+++ DT+GRL NK NLM ELEKI  +I + +  APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I+   +IPVK IG GEK++D+  F+ E F+ G+ + L+
  S:   189 EEEKQDLPDEVEQGLDTSEEAEVTKSDQEEVHTETVQEKYDRSLKKTRTGFGAKLNAFFANFRTVDEDFFEDLEELLITSDVGVQVASNLAEELRYEARLENAKKPDALRKVIIEKLVDIYEKDGRYNEKINFQ-DGLTVMLFVGVNGVGKTTSIGKLAYKYKQEGKKVMLVAADTFRAGAVAQLAEWGKRVDVPVV-TGPEKCDPASVVFDGMERAQAENVDILMIDTAGRLQNKDNLMAELEKIGRIIKRVNPDAPHETFLALDASTGQNALVQAKEFSKITPVTGIVLTKIDGTARGGVVLAIRQELDIPVKLIGFGEKIDDIGEFNSENFMRGLLEGLL 529
>gi|88191946|pdb|1ZU4|A Chain A, Crystal Structure Of Ftsy From Mycoplasma Mycoides- Space Group P21212 >gi|88191947|pdb|1ZU5|A Chain A, Crystal Structure Of Ftsy From Mycoplasma Mycoides- Space Group H32 >gi|88191948|pdb|1ZU5|B Chain B, Crystal Structure Of Ftsy From Mycoplasma Mycoides- Space Group H32 (320 aa)
Score = 639, Expect = 1.0e-64, Identities = 140/295 (47%), Positives = 218/295 (73%)
  Q:    51 DEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIRE----EITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIW-SQRL--KCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           ++ + KS+   SK I ++ KK+K+ D+EF+E +E++LI  D+G+    K+++ +R+    + +F+N      IK+ +V+ ++  Y  +  TN    +D K++R NI +++GVNG GKTTS+AK+AN++ +   KVL+ A DTFRAGA +QL  W   RL  K D+V  +K   DPASV+F  +KK K++NYDL++ DT+GRL NK NLM ELEK++ +I + + +APHE LLV+DAT GQ+G++QA+ F ++ +++GIILTKMD TSKGGI L+IK+  NIP+K IG+GEK++DL AFD+++++
  S:     8 EKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFEN------IKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYI 305
>gi|172057912|ref|YP_001814372.1| signal recognition particle-docking protein FtsY [Exiguobacterium sibiricum 255-15] >gi|171990433|gb|ACB61355.1| signal recognition particle-docking protein FtsY [Exiguobacterium sibiricum 255-15] (334 aa)
Score = 638, Expect = 1.4e-64, Identities = 143/304 (47%), Positives = 217/304 (71%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E   KF EGL K+   L+ A+ ++V +F++VDE+F+E +EE+LI  DVGV  T  + + ++ E+  +NV+D   +++++V+ +    +++ ++   LD+  +  N++L +GVNGVGKTT+I K+AN    + K V+L AGDTFRAGA++QL +W +R     V+   EG DPA+VI+  V+  K    D++ICDT+GRL NK+NLM ELEK+  VI +    APHE LL LDAT GQ+ ++QAKAFK+ T+++GI+LTK+DGT+KGGIVL+IK+  ++PVK++GLGEK++DL  FD E+FV G+
  S:    17 EVTSKFTEGLTKTRDGLANAVNDLVYRFREVDEDFFEELEEVLIQADVGVTTTMDLVEKLKVEVKRKNVKDTKEVRDVLVEVVANMLVEEEESE--LDLSHE-LNVILFVGVNGVGKTTTIGKLANRLKNEGKTVMLAAGDTFRAGAIDQLQVWGERSGVP-VIRQGEGSDPAAVIYDAVQAAKARRVDVLICDTAGRLQNKVNLMNELEKVKRVIEREIPGAPHEVLLALDATTGQNAMVQAKAFKQATDVSGIVLTKLDGTAKGGIVLAIKNELDLPVKFVGLGEKIDDLQPFDAEQFVYGL 316
>gi|42561024|ref|NP_975475.1| cell division protein FtsY [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|42492521|emb|CAE77117.1| Cell division protein FtsY [Mycoplasma mycoides subsp. mycoides SC str. PG1] (400 aa)
Score = 638, Expect = 1.5e-64, Identities = 140/290 (48%), Positives = 216/290 (74%)
  Q:    56 KSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIRE----EITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIW-SQRL--KCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           KS+   SK I ++ KK+K+ D+EF+E +E++LI  D+G+    K+++ +R+    + +F+N      IK+ +V+ ++  Y  +  TN    +D K++R NI +++GVNG GKTTS+AK+AN++ +   KVL+ A DTFRAGA +QL  W   RL  K D+V  +K   DPASV+F  +KK K++NYDL++ DT+GRL NK+NLM ELEK++ +I + + +APHE LLV+DAT GQ+G++QA+ F ++ +++GIILTKMD TSKGGI L+IK+  NIP+K IG+GEK++DL AFD+++++
  S:    93 KSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFEN------IKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKVNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYI 385
>gi|78222392|ref|YP_384139.1| signal recognition particle-docking protein FtsY [Geobacter metallireducens GS-15] >gi|78193647|gb|ABB31414.1| signal recognition particle-docking protein FtsY [Geobacter metallireducens GS-15] (351 aa)
Score = 638, Expect = 1.5e-64, Identities = 141/345 (40%), Positives = 217/345 (62%)
  Q:     4 GFFKKIVNKL---KGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GF K + NK+   +G +E  + +   ++ E  ++ + E  E  P   ++  +GL K+  +L   I  +V   K++D +  E +EE+LI+ D+GV  T ++   + E ++   + D   +++ + D+I     +D      L +      +++++GVNGVGKTT+I K+A  F ++ KKV+L AGDTFRA A EQL IW +R  CD+V   KEG DP++V+F G+K       D++I DT+GRLH K+NLM+EL+K+  ++ +    APHE LLVLDA  GQ+ + QAK FKE   +TGI LTK+DGT+KGGIV +I + F IPV+YIG+GE ++DL  FD  +FVD +
  S:     7 GFIKGLWNKIAGAEGAEENPIPEQRTEVAEHPVQAE-EPEERKPGLFERLRQGLSKTRDSLVGRIDRLVLGKKEIDADTLEELEEILITADIGVQTTVELIRILEERLSRNELNDGAALRQTLKDEILKRLSRDVRP---LAVDSASPFVIMVIGVNGVGKTTTIGKLAARFSREGKKVVLAAGDTFRAAAAEQLEIWGERTGCDVV-RHKEGADPSAVVFDGIKAAVARKADVLIVDTAGRLHTKVNLMEELKKVRRIMDREIPGAPHETLLVLDAATGQNALSQAKLFKEAAEVTGIALTKLDGTAKGGIVAAICNEFRIPVRYIGVGEGVDDLRDFDPAEFVDAL 349
>gi|29377551|ref|NP_816705.1| signal recognition particle-docking protein FtsY [Enterococcus faecalis V583] >gi|29345018|gb|AAO82775.1| signal recognition particle-docking protein FtsY [Enterococcus faecalis V583] (442 aa)
Score = 633, Expect = 5.5e-64, Identities = 139/307 (45%), Positives = 216/307 (70%)
  Q:    47 QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           Q+K+++GL+K+  T  + + E+   F+ VDE+F+E +EE LI  DVG   + KIT+A+R+E+  +NV+ P  ++  I++K+   Y +   + N  ++++ +   ++L +GVNGVGKTTSI K+A+ +  + KKVL+ A DTFRAGA++QL +W +R   ++V  +  G DPA+V+F  V++ K E  D+++ DT+GRL NK+NLMKELEKI  VI +    APHE LLV+DAT GQ+ + QAK FKE T++TG++LTK+DGT+KGGIV++I++  ++PVK +GLGE + DL  F+   F  G+ K L+
  S:   133 QEKYEKGLEKTRKTFGQRLNELFANFRSVDEDFFEELEETLIGADVGFDTSLKITEALRQEVKLRNVKKPAQVQNTIIEKMVDLYEEAGINENNAINLQPNGLTVILFVGVNGVGKTTSIGKLAHQYKLEGKKVLMAAADTFRAGAIDQLVVWGERAGVEVVRGNA-GGDPAAVVFDAVERAKAEQADVLLVDTAGRLQNKVNLMKELEKIKRVIQREIPDAPHEVLLVVDATTGQNAMTQAKQFKETTDVTGLVLTKLDGTAKGGIVIAIRNELHLPVKLVGLGEGINDLEPFNANDFAMGLFKGLL 439
>gi|69246108|ref|ZP_00603814.1| Cell division transporter substrate-binding protein FtsY [Enterococcus faecium DO] >gi|68195403|gb|EAN09850.1| Cell division transporter substrate-binding protein FtsY [Enterococcus faecium DO] (332 aa)
Score = 628, Expect = 1.8e-63, Identities = 145/320 (45%), Positives = 221/320 (69%)
  Q:    34 EKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYY-IQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E++ E +EV    Q+K+D+GL+K+  T  + + E+   F+ VDE+F+E +EE LI  DVG     +IT+A+R+E+  +N +    ++  I++K+   Y  +  +    L+I++D   ++L +GVNGVGKTTSI K+A+ F  + KKVL+ A DTFRAGA++QL +W +R   ++V  +  G DPA+V+F  +++ K E  D+++ DT+GRL NK+NLM ELEKI  VI +    AP E LLVLDAT GQ+ ++QAK FKE T++TG++LTK+DGT+KGGIVL+I++  ++PVK +GLGE ++DL  FD   FV G+ K L+
  S:    14 EEKTEEVEV----QEKYDKGLEKTRKTFGERMNELFANFRTVDEDFFEELEETLIGADVGFETAIRITEALRQEVKLRNAKKSAEVQNAIIEKLVDLYEAEGINEVNELNIQEDGLTVILFVGVNGVGKTTSIGKLAHQFKNEGKKVLMAAADTFRAGAIDQLVVWGERAGVEVVRGNA-GGDPAAVVFDALERAKTEQADVLLVDTAGRLQNKVNLMNELEKIKRVIQRELPEAPQETLLVLDATTGQNAMVQAKQFKETTDVTGLVLTKLDGTAKGGIVLAIRNELHLPVKLVGLGEGIDDLEPFDPNDFVVGLFKGLL 329
>gi|55821418|ref|YP_139860.1| signal recognition particle receptor (docking protein) [Streptococcus thermophilus LMG 18311] >gi|55823343|ref|YP_141784.1| signal recognition particle receptor (docking protein) [Streptococcus thermophilus CNRZ1066] >gi|55737403|gb|AAV61045.1| signal recognition particle receptor (docking protein) [Streptococcus thermophilus LMG 18311] >gi|55739328|gb|AAV62969.1| signal recognition particle receptor (docking protein) [Streptococcus thermophilus CNRZ1066] (463 aa)
Score = 628, Expect = 2.0e-63, Identities = 141/326 (43%), Positives = 215/326 (65%)
  Q:    28 IEEKNIEKQAEIL--EVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           I+ +N+E+ A  L       +Q+K++  LKK+ +  +  + E    F++VDEEF+E +EE+LI  DVGV    ++T+ +R E   +NV+  + ++ +I++K+   Y +D      ++ + D   ++L +GVNGVGKTTSI K+AN + ++ K V+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G++K   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG++LTK+DG++KGG+VL+I+   +IPVK IG GEK++D+  F  E+F+  +   LV
  S:   138 IQTRNVEETATELPDSKTETEQEKYNRTLKKTRTGFAARLNEFFANFRRVDEEFFEQLEEMLILSDVGVNVATQLTEDLRYEARLENVKKTEDLQRLIIEKLVDIYEKDDVYEEQINFQ-DGLTVILFVGVNGVGKTTSIGKLANKYKQEGKNVMLVAADTFRAGAVAQLVEWGRRVDVPVV-TGAEKADPASVVFDGMEKALAEGVDVLMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETLLALDASTGQNALNQAKEFSKITPLTGLVLTKLDGSAKGGVVLAIRQELDIPVKLIGFGEKIDDIGEFHSEEFMQSLLTGLV 463
>gi|42519391|ref|NP_965321.1| signal recognition particle receptor FtsY [Lactobacillus johnsonii NCC 533] >gi|41583679|gb|AAS09287.1| signal recognition particle receptor FtsY [Lactobacillus johnsonii NCC 533] (443 aa)
Score = 628, Expect = 2.0e-63, Identities = 135/309 (43%), Positives = 209/309 (67%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ--DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++Q+++D+GL+K++ +    +     KF+ VDE F++++E+LLI  DVG     ++TD++R+E   QN +  D +K++IV+K+   Y +  + + +   D    + N+ L +GVNG GKTT+I K+A       K V++VA DTFRAGAVEQL  W +R   + V+   E  DPASV++ GVKK K+   D ++ DT+GRL NK+NLM EL+KI   I K     P+E LLVLD + GQ+ ++QAK F + T +TG++LTK+DG+SKGG+VL+I++  ++PVK +GLGEK++DL+ FD EKF  G+ + L+
  S:   134 DEQERYDKGLEKTNHSFGARLNAFFAKFRTVDENFFDDLEDLLIESDVGFETAEELTDSLRDEAKLQNAKSHDALKQVIVEKLVDIYDKGGEGEDSKLADDPSAKPNVYLFVGVNGAGKTTTIGKLAKRIKDSGKSVMMVAADTFRAGAVEQLVEWGRRDGVE-VITGPEKADPASVVYNGVKKAKERGIDFLLVDTAGRLQNKVNLMSELDKIKRTIKKILPDQPNEVLLVLDGSTGQNALLQAKDFDKTTKLTGLVLTKLDGSSKGGVVLAIRNEMDLPVKLVGLGEKVDDLANFDAEKFAIGLFQGLI 443
>gi|188159320|ref|ZP_02998701.1| signal recognition particle-docking protein FtsY [Mycoplasma mycoides subsp. mycoides LC str. GM12] (409 aa)
Score = 623, Expect = 6.9e-63, Identities = 140/290 (48%), Positives = 215/290 (74%)
  Q:    56 KSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIRE----EITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIW-SQRL--KCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           KS+   SK I ++ KK+K+ D+EF+E +E++LI  D+G+    K+++ +R+    + +F+N      IK+ +V+ ++  Y  +  TN    +D K++R NI +++GVNG GKTTS+AK+AN++ +   KVL+ A DTFRAGA +QL  W   RL  K D+V  +K   DPASV+F  +KK K++NYDL++ DT+GRL NK NLM ELEK++ +I + + +APHE LLV+DAT GQ+G++QA+ F ++ +++GIILTKMD TSKGGI L+IK+  NIP+K IG+GEK++DL AFD+++++
  S:   102 KSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFEN------IKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKTNKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYI 394
>gi|1929401|emb|CAA71224.1| ftsY [Mycoplasma mycoides] (412 aa)
Score = 623, Expect = 8.4e-63, Identities = 139/290 (47%), Positives = 214/290 (73%)
  Q:    56 KSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIRE----EITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIW-SQRL--KCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           KS+   SK I ++ KK+K+ D+EF+E +E++LI  D+G+    K+++ +R+    + +F+N      IK+ +V+ ++  Y  +  TN    +D K++R NI +++GVNG GKTTS+AK+AN++ +   KVL+ A DTF AGA +QL  W   RL  K D+V  +K   DPASV+F  +KK K++NYDL++ DT+GRL NK NLM ELEK++ +I + + +APHE LLV+DAT GQ+G++QA+ F ++ +++GIILTKMD TSKGGI L+IK+  NIP+K IG+GEK++DL AFD+++++
  S:   105 KSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFEN------IKDALVESLYQAYTDNDWTNKKYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFSAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYI 397
>gi|116628140|ref|YP_820759.1| signal recognition particle receptor (docking protein) [Streptococcus thermophilus LMD-9] >gi|116101417|gb|ABJ66563.1| signal recognition particle-docking protein FtsY [Streptococcus thermophilus LMD-9] (463 aa)
Score = 622, Expect = 8.7e-63, Identities = 136/308 (44%), Positives = 206/308 (66%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +Q+K++  LKK+ +  +  + E    F++VDEEF+E +EE+LI  DVGV    ++T+ +R E   +NV+  + ++ +I++K+   Y +D      ++ + D   ++L +GVNGVGKTTSI K+AN + ++ K V+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G++K   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG++LTK+DG++KGG+VL+I+   +IPVK IG GEK++D+  F  E+F+  +   LV
  S:   158 EQEKYNRTLKKTRTGFAARLNEFFANFRRVDEEFFEQLEEILILSDVGVNVATQLTEDLRYEARLENVKKTEDLQRLIIEKLVDIYEKDDVYEEQINFQ-DGLTVILFVGVNGVGKTTSIGKLANKYKQEGKNVMLVAADTFRAGAVAQLVEWGRRVDVPVV-TGAEKADPASVVFDGMEKALAEGVDVLMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETLLALDASTGQNALNQAKEFSKITPLTGLVLTKLDGSAKGGVVLAIRQELDIPVKLIGFGEKIDDIGEFHSEEFMQSLLTGLV 463
>gi|83319748|ref|YP_424455.1| signal recognition particle-docking protein FtsY [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|83283634|gb|ABC01566.1| signal recognition particle-docking protein FtsY [Mycoplasma capricolum subsp. capricolum ATCC 27343] (424 aa)
Score = 622, Expect = 8.8e-63, Identities = 139/290 (47%), Positives = 216/290 (74%)
  Q:    56 KSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIRE----EITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIW-SQRL--KCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           KS+   SK I ++ KK+K+ D+EF+E +E++LI  D+G+    K+++ +R+    + +F+N      IK+ +V+ ++  Y  +  TN    +D K++R N+ +++GVNG GKTTS+AK+AN++ +   KVL+ A DTFRAGA +QL  W   RL  K D+V  +K   DPASV+F  +KK K++NYDL++ DT+GRL NK+NLM ELEK++ +I + + +APHE LLV+DAT GQ+G++QA+ F ++ +++GIILTKMD TSKGGI L+IK+  NIP+K IG+GEK++DL AFD+++++
  S:   117 KSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFEN------IKDALVESLYQAYTDNDWTNKKYRIDFKENRLNVFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKVNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYI 409
>gi|148993853|ref|ZP_01823255.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP9-BS68] >gi|168489071|ref|ZP_02713270.1| cell division protein FtsY [Streptococcus pneumoniae SP195] >gi|147927678|gb|EDK78703.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP9-BS68] >gi|183572532|gb|EDT93060.1| cell division protein FtsY [Streptococcus pneumoniae SP195] (406 aa)
Score = 621, Expect = 1.3e-62, Identities = 145/326 (44%), Positives = 214/326 (65%)
  Q:    28 IEEKNIEK-QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           IEE N E  +AE  +     Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    82 IEENNSEVLEAERPQAEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKRTGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 406
>gi|149924993|ref|ZP_01913317.1| signal recognition particle-docking protein FtsY [Plesiocystis pacifica SIR-1] >gi|149814140|gb|EDM73759.1| signal recognition particle-docking protein FtsY [Plesiocystis pacifica SIR-1] (592 aa)
Score = 621, Expect = 1.3e-62, Identities = 128/313 (40%), Positives = 198/313 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKF-----DDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVD 346
           E++A  L+   ++++++  GL K+       +  + K   KV ++  ++IEE+L + D+G      + +++  E+  + V DPD + E+I  K     I D D             +LL++GVNGVGKTT++ K+A   ++  +K LLVAGDTFRA A EQL +W++R+ CDI L  KE  DP+SV+F G+ +G+DE YD+V+CDT+GRLH +  LM EL K+     K      D+  PH+  LVLDAT+GQ+ + QA+ FKE    +G++LTK+DGT+KGG+VL + D   IP++YIG+GE ++DL  FD E + +
  S:   264 EREAAALDAKKKQRERYRAGLAKTKRGFIAKLARLFKGKPKVSDDLKDDIEEVLFTADIGARTAETLLESVTSELDKKEVADPDAVWEVIRRKALD--ILDIDAPEIDYTPDPGPYVLLMIGVNGVGKTTTLGKLAARHVEAGRKTLLVAGDTFRAAAGEQLEVWARRVGCDIHL-GKENADPSSVLFDGITRGRDEGYDIVLCDTAGRLHTRKELMAELAKMGRAATKALSKGRDEVEPHDIFLVLDATIGQNALAQAQMFKETMAFSGLVLTKLDGTAKGGVVLGVVDELKIPIRYIGVGEAVDDLRRFDPEAYCE 578
>gi|39996234|ref|NP_952185.1| cell division protein FtsY [Geobacter sulfurreducens PCA] >gi|39983114|gb|AAR34508.1| cell division protein FtsY [Geobacter sulfurreducens PCA] (350 aa)
Score = 621, Expect = 1.4e-62, Identities = 136/345 (39%), Positives = 216/345 (62%)
  Q:     4 GFFKKIVNKLKG---KKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFK +  K+ G    +E ++ + ++ + +     + E  +  P   ++  +GL K+  +L   I  +V   K++D +  E +EE+LI+ D+GV  T ++   + + ++   ++D + ++E + + I     +D      LD+      +++++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA A EQL IW +R   D V+  KEG DP++V+F  +K       D++I DT+GRLH K+NLM+EL+K+  ++ +    APHE LLVLDA  GQ+ + QAK FKE   +TGI LTK+DGT+KGGIV++I + F IPV+YIG+GE ++DL  FD  +FV+ +
  S:     7 GFFKGLWGKVTGGDRDQEEAVNETTSAVADVAAPPEQE--DRRPGLFERLKQGLSKTRDSLVGRIDRLVLGKKEIDADTLEELEEILITADLGVQTTVELIRGLEQRLSRNELKDGEALREALKEDIHGRLARDAHQ---LDVTGASPFVIMVIGVNGVGKTTTIGKLAARFTAQGKKVILAAGDTFRAAAAEQLQIWGERTGVD-VIRHKEGADPSAVVFDSIKAAVARGADILIVDTAGRLHTKVNLMEELKKVRRIMSREIPGAPHETLLVLDAATGQNALSQAKLFKEAAQVTGIALTKLDGTAKGGIVVAICNEFRIPVRYIGVGEGIDDLRDFDPSQFVEAL 348
>gi|169833825|ref|YP_001694674.1| cell division protein FtsY [Streptococcus pneumoniae Hungary19A-6] >gi|168996327|gb|ACA36939.1| cell division protein FtsY [Streptococcus pneumoniae Hungary19A-6] (425 aa)
Score = 619, Expect = 1.9e-62, Identities = 150/347 (43%), Positives = 224/347 (64%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIEK-QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +K V +    +EG+ E L   +EE N E  +AE  +     Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    81 QKEVKEFPHSEEGNTEFLET-VEENNSEVLEAERPQTEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKRAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 425
>gi|149019235|ref|ZP_01834597.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP23-BS72] >gi|147931105|gb|EDK82084.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP23-BS72] (425 aa)
Score = 619, Expect = 2.3e-62, Identities = 150/347 (43%), Positives = 224/347 (64%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIE-KQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +K V +    +EG+ E L   +EE N E  +AE  +     Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    81 QKEVKEFPHSEEGNTEFLET-VEENNSEILEAERPQTEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKRAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 425
>gi|15903166|ref|NP_358716.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae R6] >gi|116516398|ref|YP_816572.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae D39] >gi|149002612|ref|ZP_01827544.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP14-BS69] >gi|194398069|ref|YP_002037844.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae G54] >gi|15458750|gb|AAK99926.1| Cell division protein FtsY [Streptococcus pneumoniae R6] >gi|116076974|gb|ABJ54694.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae D39] >gi|147759223|gb|EDK66216.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP14-BS69] >gi|194357736|gb|ACF56184.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae G54] (425 aa)
Score = 618, Expect = 2.5e-62, Identities = 153/347 (44%), Positives = 227/347 (65%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEK-------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +K V +    +EG+ E L   IEE N    +E+LE  PE+       Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    81 QKEVEEFPHSEEGNTEFLET-IEENN----SEVLE--PERPQAEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKQAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 425
>gi|149007093|ref|ZP_01830762.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP18-BS74] >gi|147761397|gb|EDK68363.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP18-BS74] (429 aa)
Score = 618, Expect = 2.9e-62, Identities = 144/347 (41%), Positives = 224/347 (64%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +++  + K + EG++E+ + ++ E    +  E +      Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    91 QEVTEEEKLEHEGTVEENNFEVLEPEAPQTEETV------QEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKRAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 429
>gi|167037691|ref|YP_001665269.1| signal recognition particle-docking protein FtsY [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856525|gb|ABY94933.1| signal recognition particle-docking protein FtsY [Thermoanaerobacter pseudethanolicus ATCC 33223] (319 aa)
Score = 618, Expect = 3.1e-62, Identities = 147/315 (46%), Positives = 211/315 (66%)
  Q:    34 EKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K++E  E      +K  EGL K+   L+  I  IV   +K+DEE  E +EE+LI  D+G+  T+KI + IR++   + + D   IKE++ ++++    +D +  T          ++L +GVNGVGKTT+I K+A  + K+ KKV+L AGDTFRA A++QL IW++R+ C I+   +EG DPASVIF G++  K    D++ICDT+GRLHNK NLM+EL KI  VI +    A  E  LVLDAT GQ+ + QAK FKE+++ITGI+LTK+DGT+KGGIV++IK   N+P++YIG+GE +EDL AFD + FV  I
  S:     9 KKESETAEEKKGFFQKIKEGLLKTRENLTSKIDSIVTIGRKIDEELLEELEEILILADIGISTTSKIIEGIRQKAKERKIYDASQIKELLAEEVYEILQKDVEPFTLTS-----PMVILNVGVNGVGKTTTIGKLAYLYKKEGKKVMLAAGDTFRAAAIDQLEIWAERVNCPII-KHQEGSDPASVIFDGIQASKARGIDILICDTAGRLHNKKNLMEELRKIRRVIDREYPEARVETFLVLDATTGQNALQQAKIFKEVSDITGIVLTKLDGTAKGGIVVAIKSELNVPIRYIGIGEGIEDLQAFDAKSFVSAI 317
>gi|121533798|ref|ZP_01665625.1| signal recognition particle-docking protein FtsY [Thermosinus carboxydivorans Nor1] >gi|121307789|gb|EAX48704.1| signal recognition particle-docking protein FtsY [Thermosinus carboxydivorans Nor1] (307 aa)
Score = 618, Expect = 3.2e-62, Identities = 126/296 (42%), Positives = 195/296 (65%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           K   GL+K+    ++ I +++  + K+D+EF + +E +L+S DVG+  T  +   IR+ I  + +E P+ +K ++ +++       ++  T + +  +   ++L++GVNGVGKTT+I K+ N++ +   KVLL AGDTFRA A++QL IW QR+  + V+   EG DPA+V F  V+  K    ++VI DT+GRLH K NLM+EL+KI  VI +    APHE LLVLDAT GQ+ I QAK F E T +TG++LTK+DGT+KGG+V++IK    +PVK++G+GE + DL  F+ + F
  S:     8 KLKAGLEKTRKNFTEKIEQLITGYTKIDDEFLDELEAVLLSADVGIKTTATLMKDIRQAIKNREIETPEQLKPVLQERLCAVL---SEGWTGMRLAPEPPTVILVVGVNGVGKTTTIGKLGNYYRQLGLKVLLAAGDTFRAAAIDQLEIWGQRIGAE-VIKHSEGSDPAAVAFDAVQAAKARKAEIVIIDTAGRLHTKSNLMEELKKIRRVIAREIPDAPHETLLVLDATTGQNAISQAKLFSEATGVTGVVLTKLDGTAKGGVVVAIKTELGLPVKWVGVGEGVNDLRPFNAQDF 299
>gi|148998676|ref|ZP_01826115.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP11-BS70] >gi|147755513|gb|EDK62561.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP11-BS70] (425 aa)
Score = 617, Expect = 3.3e-62, Identities = 153/347 (44%), Positives = 227/347 (65%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEK-------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +K V +    +EG+ E L   IEE N    +E+LE  PE+       Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    81 QKEVEEFPHSEEGNTEFLET-IEENN----SEVLE--PERPQAEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHCYKQAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 425
>gi|148989266|ref|ZP_01820646.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP6-BS73] >gi|147925244|gb|EDK76323.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP6-BS73] (425 aa)
Score = 617, Expect = 3.4e-62, Identities = 153/347 (44%), Positives = 227/347 (65%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEK-------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +K V +    +EG+ E L   IEE N    +E+LE  PE+       Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    81 QKEVEEFPHSEEGNTEFLET-IEENN----SEVLE--PERPQAEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKQAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 425
>gi|170017641|ref|YP_001728560.1| Signal recognition particle-docking protein FtsY [Leuconostoc citreum KM20] >gi|169804498|gb|ACA83116.1| Signal recognition particle-docking protein FtsY [Leuconostoc citreum KM20] (400 aa)
Score = 617, Expect = 3.6e-62, Identities = 136/311 (43%), Positives = 208/311 (66%)
  Q:    43 LPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD-TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +  +Q+ +++GL+K+ +  +    + +  F+ VDE+F+E +EE L+  DVG     KI+D +REE+  +N +  + ++++I+ K+   Y  D  D +  +    + T ++L +GVNGVGKTT+I K+A  + ++ K VLL A DTFRAGA +QL  W +R    +V   KE  DPASV+F  V K +DE+YD++  DT+GRL N +NLM+ELEK+  +I +    APHE LLVLDAT GQ+ + QAK FK+ +++TGI+LTKMDGT+KGGIV +I+   ++PVK+IG GEK  DL  F  E+F+  + K+L+
  S:    89 IESEQQVYNKGLEKTRTGFAARFNKFLANFRSVDEDFFEELEETLVGADVGFDMAIKISDELREEVKLENAKRKEDVRDVIIKKMVDLYEADGVDEDATMHFNANGTTVILFVGVNGVGKTTTIGKLATKYRQQGKSVLLAAADTFRAGATKQLQEWGERAGVPVV-AGKEKADPASVVFEAVAKARDEHYDILFVDTAGRLQNNVNLMQELEKMKRIIQREIPDAPHEVLLVLDATTGQNALQQAKLFKDSSDVTGIVLTKMDGTAKGGIVFAIRSEMHLPVKWIGFGEKASDLRVFKPEEFIYSLFKDLI 399
>gi|168575699|ref|ZP_02721614.1| cell division protein FtsY [Streptococcus pneumoniae MLV-016] >gi|183578203|gb|EDT98731.1| cell division protein FtsY [Streptococcus pneumoniae MLV-016] (425 aa)
Score = 617, Expect = 3.9e-62, Identities = 153/347 (44%), Positives = 227/347 (65%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEK-------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +K V +    +EG+ E L   IEE N    +E+LE  PE+       Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    81 QKEVEEFPHSEEGNTEFLET-IEENN----SEVLE--PERPQAEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHCYKQAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 425
>gi|167040352|ref|YP_001663337.1| signal recognition particle-docking protein FtsY [Thermoanaerobacter sp. X514] >gi|166854592|gb|ABY93001.1| signal recognition particle-docking protein FtsY [Thermoanaerobacter sp. X514] (319 aa)
Score = 616, Expect = 4.4e-62, Identities = 147/315 (46%), Positives = 211/315 (66%)
  Q:    34 EKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K++E  E      +K  EGL K+   L+  I  IV   +K+DEE  E +EE+LI  D+G+  T+KI + IR++   + + D   IKE++ ++++    +D +  T          ++L +GVNGVGKTT+I K+A  + K+ KKV+L AGDTFRA A++QL IW++R+ C I+   +EG DPASVIF G++  K    D++ICDT+GRLHNK NLM+EL KI  VI +    A  E  LVLDAT GQ+ + QAK FKE+++ITGI+LTK+DGT+KGGIV++IK   N+P++YIG+GE +EDL AFD + FV  I
  S:     9 KKESETAEEKKGFFQKIKEGLLKTRENLTSKIDSIVTIGRKIDEELLEELEEILILADIGISTTSKIIEGIRQKAKERKIYDASQIKELLAEEVYEILQKDVEPFTLTS-----PMVILNVGVNGVGKTTTIGKLAYLYKKEGKKVMLAAGDTFRAAAIDQLEIWAERVNCPII-KHQEGSDPASVIFDGIQASKARGIDILICDTAGRLHNKKNLMEELRKIRKVIDREYPEARVETFLVLDATTGQNALQQAKIFKEVSDITGIVLTKLDGTAKGGIVVAIKSELNVPIRYIGIGEGIEDLQAFDAKSFVSAI 317
>gi|168493165|ref|ZP_02717308.1| cell division protein FtsY [Streptococcus pneumoniae CDC3059-06] >gi|183576736|gb|EDT97264.1| cell division protein FtsY [Streptococcus pneumoniae CDC3059-06] (429 aa)
Score = 616, Expect = 5.1e-62, Identities = 144/320 (45%), Positives = 214/320 (66%)
  Q:    34 EKQAEILEVLPEK-------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E  +E+LE  PE+       Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:   107 ENNSEVLE--PERPQTEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKRTGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 429
>gi|148985139|ref|ZP_01818378.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP3-BS71] >gi|147922584|gb|EDK73702.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP3-BS71] (429 aa)
Score = 616, Expect = 5.2e-62, Identities = 144/320 (45%), Positives = 214/320 (66%)
  Q:    34 EKQAEILEVLPEK-------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E  +E+LE  PE+       Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:   107 ENNSEVLE--PERPQTEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKRTGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 429
>gi|163762490|ref|ZP_02169555.1| ribosomal protein L28 [Bacillus selenitireducens MLS10] >gi|160357229|gb|EDP83877.1| ribosomal protein L28 [Bacillus selenitireducens MLS10] (336 aa)
Score = 616, Expect = 5.4e-62, Identities = 134/305 (43%), Positives = 219/305 (71%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           KF +GL K+  +   A+ ++VK F+++DE+F+E +EE+LI  DVGV    ++ + +++E   +N++  + I+ +I +K+    +Q ++  + L+++ +    ++L +GVNGVGKTTSI K+A+ F +  KKV++ AGDTFRAGA+EQL +W +R   D V+  + G DPA+V++  ++  K +  D+++CDT+GRL NK+NLM ELEK+  V+ +   +APHE LLVLDAT GQ+ + QAKAF + T+++GI+LTK+DGT+KGGIVL+I++  +IPVK +GLGEK++DL  F  E++V G+  +++
  S:    21 KFRDGLSKTRDSFVGAMNDLVKDFREIDEDFFEELEEILIGADVGVHTVMELVEELKDEARTRNIKHAEDIRPVISEKL-AEMLQKSENESKLNMQPEGELTVILFVGVNGVGKTTSIGKLAHQFKEDGKKVVMAAGDTFRAGAIEQLEVWGERSGVD-VIKQQAGSDPAAVMYDAIQSAKSKKADVLLCDTAGRLQNKVNLMNELEKVKRVLAREIPSAPHEVLLVLDATTGQNAMSQAKAFGQATDVSGIVLTKLDGTAKGGIVLAIRNELDIPVKLVGLGEKIDDLHEFRAEQYVHGLFADVL 324
>gi|148263169|ref|YP_001229875.1| signal recognition particle-docking protein FtsY [Geobacter uraniireducens Rf4] >gi|146396669|gb|ABQ25302.1| signal recognition particle-docking protein FtsY [Geobacter uraniireducens Rf4] (340 aa)
Score = 615, Expect = 7.0e-62, Identities = 137/345 (39%), Positives = 215/345 (62%)
  Q:     4 GFFKKIVNKLKGKK-EGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFK +++K+ G   + + E ++A+  E+            P   ++   GL K+  ++   I  ++   K++D +  E +EE+LI+ D+GV  T ++   + + +    ++D + +K+ + D+I     Q T   T LD+      ++L++GVNGVGKTT+I K+A  F  + KKVLL AGDTFRA A EQL +W  R+  D+V   KEG DP++V+F   K     N D+++ DT+GRLH K+NLM+E++KI  V+ +    APHE +L+LDA  GQ+ I QAK FKE   ++G++LTK+DGT+KGGIV+++   F IPV+YIG+GE ++DL  FD  +FV+ I
  S:     7 GFFKGLLDKIAGADVQTADETVAARGGEQ---------APTPGFFERLKRGLSKTHESIVGRIDTLLLGKKQIDADTLEELEEILITADMGVKTTVELIRTLEQRLKRNELQDGEALKKALKDEITARLSQHT---TALDVNAASPYVILVIGVNGVGKTTTIGKLAAKFRSEGKKVLLAAGDTFRAAAAEQLEVWGNRVGADVV-RHKEGSDPSAVVFDACKAALARNSDILLIDTAGRLHTKVNLMEEMKKIRRVLEREIPGAPHETMLILDAATGQNAISQAKLFKEAAQVSGVVLTKLDGTAKGGIVVAVSHEFAIPVRYIGVGEGVDDLREFDPLQFVEAI 339
>gi|81096642|ref|ZP_00874979.1| Cell division transporter substrate-binding protein FtsY [Streptococcus suis 89/1591] >gi|80977321|gb|EAP40867.1| Cell division transporter substrate-binding protein FtsY [Streptococcus suis 89/1591] (424 aa)
Score = 613, Expect = 9.6e-62, Identities = 146/340 (42%), Positives = 221/340 (65%)
  Q:    14 KGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           + +++G    +  K++E+ +E+ A + +    +Q K+   LKK+ +     + E    F+ VDEEF+E +EE+LI  DVGV   + +T+ +R E   QN +  D ++ +I++K+   Y +D   +  ++ + D T ++L +GVNGVGKTTSI K+A  + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F GVK+   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG++LTK+DGT+KGG+VL+I+   +IPVK IG GEK++D+  F  E+F+ G+ + LV
  S:    89 EAQEQGFDPAIQTKVKEEPVEEVAPVGQ--ESEQDKYQRTLKKTRTGFGARLNEFFANFRSVDEEFFEELEEMLILSDVGVQVASTLTEELRYEAKLQNAKKTDELRRVIIEKLVDIYEKDGQFSERINFQDDLT-VMLFVGVNGVGKTTSIGKLAYKYKQAGKKVMLVAADTFRAGAVAQLVEWGRRVDVPVV-TGPEKSDPASVVFDGVKRAVAEGVDILMIDTAGRLQNKENLMAELEKIGRIIKRTLPDAPHETLLALDASTGQNALSQAKEFAKITPLTGLVLTKLDGTAKGGVVLAIRQELDIPVKLIGFGEKIDDIGEFKSEEFMRGLLEGLV 424
>gi|90961604|ref|YP_535520.1| cell division protein [Lactobacillus salivarius UCC118] >gi|90820798|gb|ABD99437.1| Cell division protein [Lactobacillus salivarius UCC118] (423 aa)
Score = 613, Expect = 1.0e-61, Identities = 145/313 (46%), Positives = 216/313 (69%)
  Q:    41 EVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD-TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +V  ++++++D+GL+KS       I  ++  F+ VDE+F+E +EE LI  DVG     KI+D +R+E+  +N +  + I + I++K+   Y  +  + +  L    +   + L +GVNGVGKTT+I K+A+ +  + KKV+L A DTFRAGA+EQL  W +R+   +V    E  DPA+V+F  VKK K+E+YD+++ DT+GRL NK+NLMKELEKI  VI +    APHE LL LDAT GQ+ + QAK FK++TN+TGI+LTK+DGT+KGGIVL+I++  ++PVK +GLGEK++DL  F  E++V G+ K LV
  S:   107 KVSSDEEERYDKGLEKSRKGFGAMINSLLANFRHVDEDFFEELEETLIEADVGFETAMKISDELRQEVKLRNAKKKNEISDAIIEKLVEIYENEGKEEDNNLHFSSEGPTVFLFVGVNGVGKTTTIGKLAHRYKMEGKKVMLAAADTFRAGAIEQLAEWGRRVGVTVV-KKVEKSDPAAVVFDAVKKAKEEDYDILLVDTAGRLQNKVNLMKELEKIARVITREIPDAPHEVLLALDATTGQNALTQAKQFKDVTNVTGIVLTKLDGTAKGGIVLAIRNELHLPVKLVGLGEKMDDLRDFSPEEYVVGLFKGLV 419
>gi|168486564|ref|ZP_02711072.1| cell division protein FtsY [Streptococcus pneumoniae CDC1087-00] >gi|183570449|gb|EDT90977.1| cell division protein FtsY [Streptococcus pneumoniae CDC1087-00] (429 aa)
Score = 613, Expect = 1.1e-61, Identities = 144/326 (44%), Positives = 214/326 (65%)
  Q:    28 IEEKNIE-KQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +EE N E  +AE  +     Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:   105 VEENNSEILEAERPQTEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKQAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 429
>gi|15901105|ref|NP_345709.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae TIGR4] >gi|111658433|ref|ZP_01409112.1| hypothetical protein SpneT_02000404 [Streptococcus pneumoniae TIGR4] >gi|149012294|ref|ZP_01833363.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP19-BS75] >gi|182684029|ref|YP_001835776.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae CGSP14] >gi|14972726|gb|AAK75349.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae TIGR4] >gi|147763620|gb|EDK70555.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae SP19-BS75] >gi|182629363|gb|ACB90311.1| signal recognition particle-docking protein FtsY [Streptococcus pneumoniae CGSP14] (429 aa)
Score = 613, Expect = 1.1e-61, Identities = 143/326 (43%), Positives = 214/326 (65%)
  Q:    28 IEEKNIEK-QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +EE N E  + E  +     Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD+++ +I++K+   Y +D   +  +  + D   ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:   105 VEENNSEVLEPEAPQTEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDVLRRVIIEKLVELYEKDGSYDESIHFQ-DNLTVMLFVGVNGVGKTTSIGKLAHRYKQAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVTEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 429
>gi|153003590|ref|YP_001377915.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter sp. Fw109-5] >gi|152027163|gb|ABS24931.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter sp. Fw109-5] (465 aa)
Score = 613, Expect = 1.2e-61, Identities = 127/301 (42%), Positives = 190/301 (63%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTF--LDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K    GL+K+       +  +    K VD+    ++EE+L + D+GV    ++ ++ RE +  + + DP+ +K+ + ++I      D        L++   R  +++++GVNG GKTT+I K+A+    + K+VLL AGDTFRA A EQL IW++R+   IV   KEG DPASV F  V++G  +  D+V+CDT+GRLH K  LM+EL+K+  VI K  D APHE LLVLD+T GQ+ I QA+ F E   +TGI+LTK+DGT+KGG+++ I D   IPV+Y+G+GE + DL AF   +FV  +
  S:   162 KTLAAGLEKTRGGFMARLNALFSGGKLVDDAVLADLEEVLFTADIGVRTATRLLESARERVRRKELSDPERLKDALREEIARILALDGQPAAARPLELGPARPWVVMVVGVNGSGKTTTIGKLASKLQAEGKRVLLGAGDTFRAAAGEQLEIWAERVGAPIV-RGKEGADPASVCFEAVQRGAQDGADVVLCDTAGRLHTKAPLMEELKKVKRVIGKAVDGAPHEVLLVLDSTNGQNAIAQARQFHEALGVTGIVLTKIDGTAKGGVIIGICDELGIPVRYVGVGESVADLKAFVPAEFVRAL 463
>gi|116490533|ref|YP_810077.1| signal recognition particle-docking protein FtsY [Oenococcus oeni PSU-1] >gi|116091258|gb|ABJ56412.1| signal recognition particle-docking protein FtsY [Oenococcus oeni PSU-1] (382 aa)
Score = 613, Expect = 1.2e-61, Identities = 144/320 (45%), Positives = 219/320 (68%)
  Q:    34 EKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ--DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E+Q +  E L  +   ++EGL K+ S+ S+    ++  F+ VDE+F+E +EE LI+ DVG     KI++ +++E+  +N      ++  I++K+   Y Q  + + N  L  +  + ++ L +GVNGVGKTT+I K+A+ + K+ KKVLL A DTFRAGA EQL  W+ R + D+V   KE  DPASV+F GVKK  D +YD++  DT+GRL N  NLM+ELEK+  +I +    AP E LLVLDAT GQ+ + QA+ FK+ T++TG++LTK+DGT+KGGIVL+I+   ++PVK++GLGEK++DL  F+ ++FV G+ K+L+
  S:    64 EEQVQYKEDL--EANSYEEGLTKTRSSFSEKFKMLMANFRAVDEDFFEELEETLIAADVGFEMALKISNELQDEVRLKNASSKKDVQNTIIEKLVNVYDQAGNGENNEMLFAEAGQPSVFLFVGVNGVGKTTTIGKMASFYKKQGKKVLLAAADTFRAGATEQLVEWAHRDQVDVV-TGKEKSDPASVVFDGVKKSIDGHYDILFVDTAGRLQNNDNLMRELEKMKKIITRQLPNAPQEVLLVLDATTGQNALQQARLFKDSTDVTGLVLTKLDGTAKGGIVLAIRQELHLPVKWVGLGEKVDDLEPFNADEFVYGLFKDLI 382
>gi|168491164|ref|ZP_02715307.1| cell division protein FtsY [Streptococcus pneumoniae CDC0288-04] >gi|183574535|gb|EDT95063.1| cell division protein FtsY [Streptococcus pneumoniae CDC0288-04] (425 aa)
Score = 612, Expect = 1.3e-61, Identities = 152/347 (43%), Positives = 227/347 (65%)
  Q:     7 KKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEK-------QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +K V +    +EG+ E L   IEE N    +E+LE  PE+       Q+K+D  LKK+ +     +      F+ VDEEF+E +EELLI  DVGV   + +T+ +R E   +N + PD ++ +I++K+   Y +  + +  +  +   T ++L +GVNGVGKTTSI K+A+ + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I++  NIPVK IG GEK++D+  F+ E F+ G+ + L+
  S:    81 QKEVEEFPHSEEGNTEFLET-IEENN----SEVLE--PERPQAEETVQEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEELEELLIMSDVGVQVASNLTEELRYEAKLENAKKPDALRRVIIEKLVELYEKGGNYDERIHFQAGLT-VMLFVGVNGVGKTTSIGKLAHRYKQAGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAEGIDILMIDTAGRLQNKDNLMAELEKIGRIIKRVVPEAPHETFLALDASTGQNALVQAKEFSKITPLTGIVLTKIDGTARGGVVLAIREELNIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLI 425
>gi|192812216|ref|ZP_03040884.1| signal recognition particle-docking protein FtsY [Geobacillus sp. Y412MC10] >gi|192798623|gb|EDV75135.1| signal recognition particle-docking protein FtsY [Geobacillus sp. Y412MC10] (333 aa)
Score = 612, Expect = 1.3e-61, Identities = 138/306 (45%), Positives = 210/306 (68%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           K+F +GL+K+     + ++++V + KK+DEEFYE +EE+LI  DVGV     + D +R E+  + +ED   ++ ++ +K+    ++D  +N   +   D   ++L +GVNGVGKTT+I K+A+ + ++ KKVLL AGDTFRAGA+EQL +W +R+  + V+  + G DPA+V+F  V+  K    D+++CDT+GRL NK NLM+EL KI  VI +   +APHE L+VLDAT GQ+ + QAK F E + +TG++LTK+DGT+KGGIV++I+   N+PVK +GLGEK+ DL  FD E+FV  +   L+
  S:    20 KQFRDGLEKTRKGFIEKVSDLVIRRKKIDEEFYEELEEILIGADVGVNTVMDLMDDLRAEVKKRRIEDAADLQPVLSEKLMGL-LRDDSSNELRE-NPDGITVILFVGVNGVGKTTTIGKLAHRYKQEGKKVLLAAGDTFRAGAIEQLEVWGERVGVE-VIKQQPGSDPAAVMFDAVQAAKQRQADVLLCDTAGRLQNKTNLMEELNKIFRVIQREIPSAPHEVLMVLDATTGQNALSQAKLFGEKSGVTGLVLTKLDGTAKGGIVIAIRQELNLPVKLVGLGEKMGDLQTFDSEQFVHALFAGLI 322
>gi|146318841|ref|YP_001198553.1| Signal recognition particle GTPase [Streptococcus suis 05ZYH33] >gi|146321051|ref|YP_001200762.1| Signal recognition particle GTPase [Streptococcus suis 98HAH33] >gi|145689647|gb|ABP90153.1| Signal recognition particle GTPase [Streptococcus suis 05ZYH33] >gi|145691857|gb|ABP92362.1| Signal recognition particle GTPase [Streptococcus suis 98HAH33] (428 aa)
Score = 612, Expect = 1.5e-61, Identities = 146/340 (42%), Positives = 221/340 (65%)
  Q:    14 KGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           + +++G    +  K++E+ +E+ A + +    +Q K+   LKK+ +     + E    F+ VDEEF+E +EE+LI  DVGV   + +T+ +R E   QN +  D ++ +I++K+   Y +D   +  ++ + D T ++L +GVNGVGKTTSI K+A  + +  KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F GVK+   E  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG++LTK+DGT+KGG+VL+I+   +IPVK IG GEK++D+  F  E+F+ G+ + LV
  S:    93 EAQEQGFDPAIQTKVKEEPVEEVAPVGQ--ESEQDKYQRTLKKTRTGFGARLNEFFANFRSVDEEFFEELEEMLILSDVGVQVASTLTEELRYEAKLQNAKKIDELRRVIIEKLVDIYEKDGQFSEQINFQDDLT-VMLFVGVNGVGKTTSIGKLAYKYKQAGKKVMLVAADTFRAGAVAQLVEWGRRVDVPVV-TGPEKSDPASVVFDGVKRAVAEGVDILMIDTAGRLQNKENLMAELEKIGRIIKRTLPDAPHETLLALDASTGQNALSQAKEFAKITPLTGLVLTKLDGTAKGGVVLAIRQELDIPVKLIGFGEKIDDIGEFKSEEFMRGLLEGLV 428
>gi|83592517|ref|YP_426269.1| signal recognition particle-docking protein FtsY [Rhodospirillum rubrum ATCC 11170] >gi|83575431|gb|ABC21982.1| signal recognition particle-docking protein FtsY [Rhodospirillum rubrum ATCC 11170] (506 aa)
Score = 611, Expect = 1.9e-61, Identities = 129/308 (41%), Positives = 200/308 (64%)
  Q:    41 EVLPEKQK---------KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           EVLPE            +   GL ++S  L   I  +V + +K+D++  E++E+LLI+ D+GV    K+T ++ +E   +NV   + I+    D+I T           L+I    + +++L++GVNG GKTT+I KIAN  + ++K+VLL AGDTFRA AVEQL IW  R  C+++  D  G D A + F  ++K + E YD+++ DT+GRLHNK  LM+EL+K+  V+ K D   PH  L VLDAT+GQ+   Q K F+E+T+++G+++TK+DGT+KGG+V+++ D F +PV Y+G+GE ++DL  F    F  G+
  S:   191 EVLPEPVAEPVKVSFFARLRGGLSRTSGKLVGGIMGLVSE-RKLDDQALEDLEDLLITADIGVETAGKLTRSLAKERFGKNVTGEE-IRGHFADEIATIL---GPVARPLEIDGSLKPHVVLVVGVNGSGKTTTIGKIANQLVHENKRVLLAAGDTFRAAAVEQLRIWGDRTGCEVIARDT-GADSAGLAFDALQKARAEGYDVLLIDTAGRLHNKTELMEELKKVVRVLRKIDPAVPHTCLQVLDATVGQNAHQQVKVFQEMTDVSGLVMTKLDGTAKGGVVVALADKFGLPVHYVGIGEGIDDLRPFSARDFARGL 502
>gi|158521729|ref|YP_001529599.1| signal recognition particle-docking protein FtsY [Desulfococcus oleovorans Hxd3] >gi|158510555|gb|ABW67522.1| signal recognition particle-docking protein FtsY [Desulfococcus oleovorans Hxd3] (381 aa)
Score = 610, Expect = 2.5e-61, Identities = 130/300 (43%), Positives = 196/300 (65%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL+K+   L+  + ++    KK+D++  E++EELLI+ D+GV AT ++   + ++     + DPD +KE I + I  Y   D  T+          ++++++GVNGVGKTT+I K+A       KKV+LVA DTFRA A+EQL+IW+ R   DI L  +E  DPA+V + GV+  +    D+VI DT+GRLH K+NLM+EL+KI   + K    APHE LLVLDAT GQ+ I Q + F +  ++TGI+LTK+DGT+KGGI ++++ +F IP++YIG+GE++EDL  FD   F+D +
  S:    85 RLRRGLEKTRRFLTTDVDKLFVPGKKLDDQTLEDLEELLITADIGVKATTELIAGLSKQAA--GITDPDHLKEAIKEMILPYLEDDRPTDEATR-PLATPHVIMVIGVNGVGKTTTIGKLAARHRANGKKVMLVAADTFRAAAIEQLSIWADRTGADI-LKHRENSDPAAVAYDGVEAARARGVDVVIVDTAGRLHTKVNLMEELKKIKRSMSKTMPDAPHEVLLVLDATTGQNAISQTELFTKAADVTGIVLTKLDGTAKGGIAINLRHSFGIPIQYIGVGEQVEDLQPFDPRAFLDAM 380
>gi|120556651|ref|YP_961002.1| signal recognition particle-docking protein FtsY [Marinobacter aquaeolei VT8] >gi|120326500|gb|ABM20815.1| signal recognition particle-docking protein FtsY [Marinobacter aquaeolei VT8] (405 aa)
Score = 610, Expect = 2.5e-61, Identities = 126/304 (41%), Positives = 198/304 (65%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           ++  +GL K+ ++L+  + ++    KK+DE+  E IE  L+  DVGV AT++I DA+ E++    ++D + +++ + D++    +++      +D  K +  ++L++GVNGVGKTT+I K+   F  + K V+L AGDTFRA AVEQL +W +R    +V     G D ASVIF  ++  +    D+VI DT+GRL NK NLM EL K+  V+ K D++APHE +LVLDA  GQ+ + QA+ F++   ++GI LTK+DGT+KGGIV +I     +P++YIG+GE+ EDL +FD E FVD + ++
  S:   105 ERIKQGLGKTRASLTGGLADLFSVGKKIDEDLLEEIETTLLMADVGVTATSEIIDALTEKLERNQLKDGEALRKALRDELHGL-LKEVARPLEIDAGK-QPYVILMVGVNGVGKTTTIGKLTKKFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVV-AQHTGADSASVIFDAIQSAQSRGVDVVIADTAGRLQNKDNLMNELSKVVRVMKKLDESAPHEVMLVLDAGTGQNALSQAQVFQQAVGVSGITLTKLDGTAKGGIVFAIARQLQLPIRYIGVGEQAEDLRSFDAETFVDALFED 405
>gi|104774251|ref|YP_619231.1| Signal recognition particle-docking protein FtsY [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514341|ref|YP_813247.1| Signal recognition particle GTPase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|103423332|emb|CAI98179.1| Signal recognition particle-docking protein FtsY [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093656|gb|ABJ58809.1| signal recognition particle-docking protein FtsY [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (442 aa)
Score = 609, Expect = 3.1e-61, Identities = 136/304 (44%), Positives = 201/304 (66%)
  Q:    50 FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDT-NTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVL-PDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +++GL+KS+      +   + KF+ VDE+F++++EELLI  DVG   + ++TD +REE   Q  +  D +K +IV K+   Y ++ ++ N  L    + + N+ L +GVNG GKTT++ K+A  F  + KKVLLVA DTFRAGAVEQL  W +R    +V  PDK   DPA+V++ G+++   E  D ++ DT+GRL NK+NLM ELEKI   I K     P E LLVLD + GQ+ ++QAK F + T ++G++LTK+DG+SKGG+VLSI+    +PVK +GLGEK EDL+ FD   +  G+  +L+
  S:   138 YEKGLEKSNKGFGARLNAFLAKFRTVDEDFFDDLEELLIESDVGYETSEELTDQLREEAKLQKAKSRDDLKRVIVQKLVEVYDENANSENEKLAYDPNAKPNVYLFVGVNGAGKTTTVGKLAKRFHDQGKKVLLVAADTFRAGAVEQLVEWGKRTGVPVVTGPDK--ADPAAVVYDGLERAIAEEADYLLVDTAGRLQNKVNLMNELEKIQRTIKKRLPDQPAETLLVLDGSTGQNALLQAKDFDKTTKLSGLVLTKLDGSSKGGVVLSIRHEMKLPVKLVGLGEKAEDLADFDAANYAVGLFHDLL 442
>gi|19745687|ref|NP_606823.1| putative signal recognition particle (docking protein) [Streptococcus pyogenes MGAS8232] >gi|19747821|gb|AAL97322.1| putative signal recognition particle (docking protein) [Streptococcus pyogenes MGAS8232] (516 aa)
Score = 608, Expect = 4.3e-61, Identities = 141/308 (45%), Positives = 206/308 (66%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E +EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEELEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVGIYEKDGRYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|24379207|ref|NP_721162.1| putative cell division protein FtsY; signal recognition particle (docking protein) [Streptococcus mutans UA159] >gi|24377118|gb|AAN58468.1|AE014916_9 putative cell division protein FtsY; signal recognition particle (docking protein) [Streptococcus mutans UA159] (498 aa)
Score = 607, Expect = 5.8e-61, Identities = 138/332 (41%), Positives = 217/332 (65%)
  Q:    22 EDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++    + +   E  ++I E +  +++K++  LKK+ +     +   +  F+ VDEEF+E++EE+LI  DVGV   + +T+ +R E   +  + P+ ++ +I++K+   Y +D   N  ++ + D T ++L +GVNGVGKTTSI K+A  +  + KKV+LVA DTFRAGAV QL  W +R+   +V   K   DPASV++ GV++    + D+++ DT+GRL NK NLM ELEKI  V+ +    APHE LL LDA+ GQ+ ++QAK F +IT +TG+ILTK+DGT+KGG+VL+I+    IPVK+IG GEK++D+  F  E F+ G+ + L+
  S:   169 KETETAVNQSEEEASSQIAESVESEEEKYNRSLKKTRTGFGARLNAFLANFRNVDEEFFEDLEEMLILSDVGVQVASTLTEDLRYEAKLEKAKKPEALRRVIIEKLVDIYDKDGQFNEKINFQNDLT-VMLFVGVNGVGKTTSIGKLAYKYKHQGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVVTGPKNA-DPASVVYDGVERAVAADVDILMIDTAGRLQNKDNLMAELEKIGRVVKRVIPDAPHETLLTLDASTGQNALVQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELAIPVKFIGFGEKIDDIGEFHSEDFMRGLLEGLL 498
>gi|15672795|ref|NP_266969.1| hypothetical protein L0206 [Lactococcus lactis subsp. lactis Il1403] >gi|12723735|gb|AAK04911.1|AE006314_9 cell division protein FtsY [Lactococcus lactis subsp. lactis Il1403] (459 aa)
Score = 606, Expect = 8.0e-61, Identities = 152/309 (49%), Positives = 203/309 (65%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E +KK+++ L  +  T S    E+   F+ VDEEF+E +EE LI  DVGV    ++T+ +R+E    N +  D ++++I++KI   +       T LDI+ D  ++ L +GVNGVGKTT+I K+A  +  + KKVLL A DTFRAGA++QL  W  R   ++V     G DPA+V+F  + K K ENYD+++ DT+GRL NK NLMKELEKI  VI +    APHE +L LDAT GQ+ I QAK F  +T ITGI LTK+DG++KGGIVLSI  +  IPVK IGLGEKL DL  FD E FV G+ KEL+
  S:   153 ETEKKYEQSLTLTRKTFSDGFNELFANFRTVDEEFFEELEETLIMSDVGVDLAMEVTEELRKEAKLVNAKSTDDLRQLIIEKIVDKF-DGEKLPTKLDIQSDGLSVFLFVGVNGVGKTTTIGKLAARYKNEGKKVLLAAADTFRAGAIDQLVEWGNRSGVEVV-TKPAGSDPAAVVFDALAKAKAENYDILLVDTAGRLQNKDNLMKELEKIGKVIKREIPDAPHETILALDATTGQNAIQQAKEFSAVTPITGIALTKLDGSAKGGIVLSIVQSLKIPVKLIGLGEKLNDLQDFDEEFFVRGLFKELL 459
>gi|110601184|ref|ZP_01389382.1| signal recognition particle-docking protein FtsY [Geobacter sp. FRC-32] >gi|110548125|gb|EAT61353.1| signal recognition particle-docking protein FtsY [Geobacter sp. FRC-32] (342 aa)
Score = 605, Expect = 1.0e-60, Identities = 143/345 (41%), Positives = 214/345 (62%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFD---EGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFFK +++K       +      + EEK +   AEI E   EK   FD   +GL K+  ++   I  ++   K++D +  E +EE+LI+ D+GV  T ++   + + +    ++D + +K  +  +I    +Q     + LDI   +  ++L++GVNGVGKTT+I K+A  +    KKVLL AGDTFRA A EQL IW +R+  ++V   KEG DP++V F   K       D+++ DT+GRLH K+NLM+E++KI  VI +    APHE LLVLDA  GQ+ I QA  FKE   +TG+ILTK+DGT+KGGIV+++   F++PV+YIG+GE +EDL  F+ ++FVD I
  S:     7 GFFKGLLDKFTADTSAT------EAEEKAV--NAEIAEP-KEKTGFFDRLKQGLTKTHESIVGRIDSLLLGQKQIDADVLEELEEILITADIGVKTTVELIRTLEQRLKRNELKDGNALKAALKQEITNRLVQ---VESGLDIIAAKPFVILVIGVNGVGKTTTIGKLAAQYRLAGKKVLLAAGDTFRAAAAEQLEIWGERVGAEVV-RHKEGADPSAVAFDACKAALARGCDVLLIDTAGRLHTKVNLMEEMKKIRRVIEREIPGAPHETLLVLDAATGQNAISQASLFKEAAQVTGLILTKLDGTAKGGIVVAVSHEFSLPVRYIGVGEGVEDLREFEPQEFVDAI 341
>gi|169191328|ref|ZP_02851188.1| signal recognition particle-docking protein FtsY [Paenibacillus sp. JDR-2] >gi|169002039|gb|EDS48942.1| signal recognition particle-docking protein FtsY [Paenibacillus sp. JDR-2] (332 aa)
Score = 605, Expect = 1.0e-60, Identities = 140/304 (46%), Positives = 201/304 (66%)
  Q:    50 FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           F EGL K+   L + + E++ + KK+DEEFYE +EE+LI  DVGV     + D +R E+  + +E    ++ I+ +K+    +   + N  L + K    ++L +GVNGVGKTT+I K+A+ F  + K VLL AGDTFRA A+EQL +W QR+  D V+  + G DPA+V+F  V+  K    D+++CDT+GRL NK NLM+EL KI  VI +    APHE LLVLDAT GQ+ + QAK F E + +TG++LTK+DGT+KGGIV++I++  N+PVK +GLGEK+ DL  FD  +FV  +   L+
  S:    22 FKEGLTKTRVALVEKVEELITRRKKIDEEFYEELEEILIGADVGVNTVMTLIDELRAEVKKRKIEQAAELQPILSEKLIG--LLKGEQNPGLQMAKSGITVILFVGVNGVGKTTTIGKLAHKFKSEGKSVLLAAGDTFRAAAIEQLEVWGQRVGVD-VIKQQSGSDPAAVMFDAVQAAKQRGVDVLLCDTAGRLQNKSNLMEELNKIFRVIQREIPDAPHEVLLVLDATTGQNALSQAKLFGEKSGVTGLVLTKLDGTAKGGIVIAIRNELNLPVKLVGLGEKMTDLQEFDSVQFVHALFAGLI 322
>gi|125624534|ref|YP_001033017.1| signal recognition particle-docking protein [Lactococcus lactis subsp. cremoris MG1363] >gi|124493342|emb|CAL98316.1| signal recognition particle-docking protein [Lactococcus lactis subsp. cremoris MG1363] (459 aa)
Score = 605, Expect = 1.0e-60, Identities = 152/309 (49%), Positives = 203/309 (65%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           E +KK+++ L  +  T S    E+   F+ VDEEF+E +EE LI  DVGV    ++T+ +R+E    N +  D ++++I++KI   +       T LDI+ D  ++ L +GVNGVGKTT+I K+A  +  + KKVLL A DTFRAGA++QL  W  R   ++V     G DPA+V+F  + K K ENYD+++ DT+GRL NK NLMKELEKI  VI +    APHE +L LDAT GQ+ I QAK F  +T ITGI LTK+DG++KGGIVLSI  +  IPVK IGLGEKL DL  FD E FV G+ KEL+
  S:   153 ETEKKYEQSLTLTRKTFSDGFNELFANFRTVDEEFFEELEETLIMSDVGVDLAMEVTEELRKEAKLVNAKSTDDLRQLIIEKIVDKF-DGEKLPTKLDIQSDGLSVFLFVGVNGVGKTTTIGKLAARYKNEGKKVLLAAADTFRAGAIDQLVEWGNRSGVEVV-TKPAGSDPAAVVFDALAKAKAENYDILLVDTAGRLQNKDNLMKELEKIGKVIKREIPDAPHETILALDATTGQNAIQQAKEFSAVTPITGIALTKLDGSAKGGIVLSIVQSLKIPVKLIGLGEKLNDLQDFDEEFFVRGLFKELL 459
>gi|21909937|ref|NP_664205.1| putative signal recognition particle-docking protein FtsY [Streptococcus pyogenes MGAS315] >gi|21904125|gb|AAM79008.1| putative signal recognition particle-docking protein FtsY [Streptococcus pyogenes MGAS315] (516 aa)
Score = 604, Expect = 1.3e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVDIYEKDGHYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|28896366|ref|NP_802716.1| putative signal recognition particle (docking protein) [Streptococcus pyogenes SSI-1] >gi|28811617|dbj|BAC64549.1| putative signal recognition particle (docking protein) [Streptococcus pyogenes SSI-1] (516 aa)
Score = 604, Expect = 1.3e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVDIYEKDGHYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|94993890|ref|YP_601988.1| Cell division protein ftsY [Streptococcus pyogenes MGAS10750] >gi|94547398|gb|ABF37444.1| Cell division protein ftsY [Streptococcus pyogenes MGAS10750] (516 aa)
Score = 603, Expect = 1.5e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVDIYEKDGRYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|71903119|ref|YP_279922.1| cell division protein [Streptococcus pyogenes MGAS6180] >gi|71802214|gb|AAX71567.1| cell division protein [Streptococcus pyogenes MGAS6180] (516 aa)
Score = 603, Expect = 1.5e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVDIYEKDGRYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|15674659|ref|NP_268833.1| putative signal recognition particle (docking protein) [Streptococcus pyogenes M1 GAS] >gi|50913842|ref|YP_059814.1| cell division protein ftsY [Streptococcus pyogenes MGAS10394] >gi|71910285|ref|YP_281835.1| cell division protein [Streptococcus pyogenes MGAS5005] >gi|13621775|gb|AAK33554.1| putative signal recognition particle (docking protein) [Streptococcus pyogenes M1 GAS] >gi|50902916|gb|AAT86631.1| Cell division protein ftsY [Streptococcus pyogenes MGAS10394] >gi|71853067|gb|AAZ51090.1| cell division protein [Streptococcus pyogenes MGAS5005] (516 aa)
Score = 603, Expect = 1.6e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVDIYEKDGRYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|94989975|ref|YP_598075.1| cell division protein ftsY [Streptococcus pyogenes MGAS10270] >gi|94543483|gb|ABF33531.1| Cell division protein ftsY [Streptococcus pyogenes MGAS10270] (516 aa)
Score = 602, Expect = 1.8e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVDIYEKDGHYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKMAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|125718364|ref|YP_001035497.1| SRPR, signal recognition particle-docking protein, putative [Streptococcus sanguinis SK36] >gi|125498281|gb|ABN44947.1| SRPR, signal recognition particle-docking protein, putative [Streptococcus sanguinis SK36] (512 aa)
Score = 602, Expect = 2.1e-60, Identities = 138/307 (44%), Positives = 209/307 (68%)
  Q:    47 QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           Q+K+D  LKK+ +     +      F+ VDEEF+E++EELLI+ DVGV   + +T+ +R E   +N + P  ++++I++K+   Y +D   N  ++ +   T ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV++ G+++ + E  D+++ DT+GRL NK NLM ELEKI  +I + D  APHE  L LDA+ GQ+ ++QAK F +IT +TGI+LTK+DGT++GG+VL+I+   +IPVK IG GEK++D+  F+ E F+ G+ + LV
  S:   208 QEKYDRSLKKTRTGFGARLNAFFANFRSVDEEFFEDLEELLITSDVGVQVASSLTEELRYEARLENAKKPAALRQLIIEKLVDIYEKDGRFNEKINFQNGLT-VMLFVGVNGVGKTTSIGKLAYKYKQQGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKSDPASVVYDGMERAQAEQVDVLMIDTAGRLQNKDNLMAELEKIGRIIKRVDPEAPHETFLALDASTGQNALVQAKEFSKITPVTGIVLTKIDGTARGGVVLAIRQELDIPVKLIGFGEKIDDIGEFNSENFMKGLLEGLV 512
>gi|139474212|ref|YP_001128928.1| putative cell division protein FtsY [Streptococcus pyogenes str. Manfredo] >gi|134272459|emb|CAM30716.1| putative cell division protein FtsY [Streptococcus pyogenes str. Manfredo] (516 aa)
Score = 602, Expect = 2.2e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVGIYEKDGRYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKGVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|94988095|ref|YP_596196.1| cell division protein [Streptococcus pyogenes MGAS9429] >gi|94991982|ref|YP_600081.1| cell division protein ftsY [Streptococcus pyogenes MGAS2096] >gi|94541603|gb|ABF31652.1| cell division protein [Streptococcus pyogenes MGAS9429] >gi|94545490|gb|ABF35537.1| Cell division protein ftsY [Streptococcus pyogenes MGAS2096] (516 aa)
Score = 601, Expect = 3.1e-60, Identities = 141/308 (45%), Positives = 207/308 (67%)
  Q:    41 EVLPEK-QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +PE  Q+K+   LKK+ +  S  +      F++VDEEF+E++EE+LI  DVGV     +T+ +R E   +N + PD +K +IV+K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  + ++ KKV+LVA DTFRAGAV QL  W +R+    V+   E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEK+  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F  E F+ G+
  S:   205 DTIPETDQEKYKRSLKKTRTGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKPDALKRVIVEKLVDIYEKDGRYNEAINYQ-DGLTVMLFVGVNGVGKTTSIGKLAYRYKQEGKKVMLVAADTFRAGAVAQLVEWGRRVDVP-VITGPEKADPASVVFDGMEKAVAKEVDILLIDTAGRLQNKENLMAELEKMGRIIKRVLPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKVDDIGEFHSEDFMKGL 511
>gi|125555838|gb|EAZ01444.1| hypothetical protein OsI_022676 [Oryza sativa (indica cultivar-group)] (1326 aa)
Score = 600, Expect = 3.6e-60, Identities = 118/276 (42%), Positives = 180/276 (65%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D++ ++ +EE L+  DVGV  T KI  ++ +  + + ++D + +   + +++     +    +  LD+  +   ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R +  +V     G D ASVIF  V+  K    D++I DT+GRL NK +LM+EL+KI  V+ K DD APHE +L LDA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F  + F++ +
  S:  1050 KKIDDDLFDELEEQLLIADVGVDTTRKIITSLTQHASRKQLKDAEALYGKLKEEMSEILAK---VDQPLDVSGNTPYVILMVGVNGVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNRIPVV-AQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDDQAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDFIEAL 1321
>gi|126664539|ref|ZP_01735523.1| signal recognition particle-docking protein FtsY [Marinobacter sp. ELB17] >gi|126630865|gb|EBA01479.1| signal recognition particle-docking protein FtsY [Marinobacter sp. ELB17] (406 aa)
Score = 600, Expect = 3.9e-60, Identities = 126/307 (41%), Positives = 194/307 (63%)
  Q:    42 VLPEKQ----KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           V PE Q    ++   GL K+ ++ +  + ++    KK+D +  E IE  L+  DVGV AT +I +++ E++    ++D + +++ + D++    ++D      +D  + +  ++L++GVNGVGKTT+I K+   F  +   VLL AGDTFRA A+EQL +W  R K   V+    G D ASVIF  ++  K    D+VI DT+GRL NK NLM ELEK+  V+ K D  APHE +LVLDA  GQ+ + QA+ F++   ++GI LTK+DGT+KGGIV +I     +P+++IG+GE++EDL +FD   FVD +
  S:    97 VEPEPQISVLERIRRGLGKTRASFTGGLADMFSAGKKIDADLLEEIETTLLMADVGVTATTEIIESLTEKLKRDQLKDGEALRQALRDQLHGL-LKDVSKPLVID-AQTKPYVILMVGVNGVGKTTTIGKLTKKFQDEGMSVLLAAGDTFRAAAMEQLQVWGDRNKVP-VIAQHTGADSASVIFDAIQSAKSRGIDVVIADTAGRLQNKDNLMSELEKVVRVMKKLDTAAPHEVMLVLDAGTGQNALNQAQVFQQAVGVSGITLTKLDGTAKGGIVFAIARQLQLPIRFIGIGEQVEDLRSFDARAFVDAL 404
>gi|149378431|ref|ZP_01896125.1| signal recognition particle-docking protein FtsY [Marinobacter algicola DG893] >gi|149357281|gb|EDM45809.1| signal recognition particle-docking protein FtsY [Marinobacter algicola DG893] (400 aa)
Score = 599, Expect = 4.6e-60, Identities = 126/304 (41%), Positives = 195/304 (64%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           ++  +GL K+ + L+    ++    KKVDE+  E IE  L+  DVGV AT++I +++ +++    ++D + +++ + D++    + D      +D  K +  ++L++GVNGVGKTT+I K+   F +  K V+L AGDTFRA AVEQL +W +R    +V     G D ASVIF  V+  +    D+VI DT+GRL NK NLM ELEK+  V+ K D++APHE +LVLDA  GQ+ + QA+ F++   ++GI LTK+DGT+KGGIV +I     +P++YIG+GE+++DL +FD   FVD +  E
  S:    96 ERIRKGLGKTRANLTGGFADLFSIGKKVDEDLLEEIETTLLMADVGVTATSEIIESLTDKLERNQLKDGEALRKALRDELHGL-LADVTKPLEIDASK-KPYVILMVGVNGVGKTTTIGKLTKLFQRDGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVV-AQHTGADSASVIFDAVQSAQSRGVDVVIADTAGRLQNKDNLMSELEKVVRVMKKLDESAPHEVMLVLDAGTGQNALSQAQVFQQAVGVSGITLTKLDGTAKGGIVFAIARQLQLPIRYIGVGEQVDDLRSFDARTFVDALFDE 396
>gi|70733142|ref|YP_262915.1| signal recognition particle-docking protein FtsY [Pseudomonas fluorescens Pf-5] >gi|68347441|gb|AAY95047.1| signal recognition particle-docking protein FtsY [Pseudomonas fluorescens Pf-5] (497 aa)
Score = 598, Expect = 5.4e-60, Identities = 121/303 (39%), Positives = 192/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D+E  E++E  L++ DVGV AT+ I   + +++  + + D D +   +  ++ T  ++  +    + + +++  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R K   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   ++G+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ E FV  +  E
  S:   194 RLKQGLSKTSASIGEGMASLFLGKKAIDDELLEDLETRLLTADVGVEATSVIIQNLTQKVARKQLTDSDALYASLQAEL-TSMLKPVEQPLQI-VAQNKPFVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNKIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQAKQFNQTVQLSGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAE 493
>gi|77409117|ref|ZP_00785832.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae COH1] >gi|16588994|gb|AAL26980.1|AF380672_4 putative signal recognition particle [Streptococcus agalactiae] >gi|33439457|gb|AAO49795.1| putative signal particle [Streptococcus agalactiae serogroup III] >gi|77172295|gb|EAO75449.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae COH1] (536 aa)
Score = 598, Expect = 5.9e-60, Identities = 143/326 (43%), Positives = 218/326 (66%)
  Q:    23 DLSAKIEEKNIEKQAEILEVLPEKQK-KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           D S   E + +  Q++   +  E Q+ K++  LKK+ +  S  +   +  F++VDEEF+E +EE+LI  DVGV    ++T+ +R E   +N +  + +K +IV+K+   Y +D   N  ++ ++  T ++L +GVNGVGKTTSI K+A+ +  + KKV+LVA DTFRAGAV QL  W +R+   +V  +K+  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F+ E F+ G+
  S:   207 DESELSEAQEVLSQSQADTIKAESQEEKYNRSLKKTRTGFSARLNAFLSNFRRVDEEFFEELEEMLILSDVGVNVATQLTEDLRYEAKLENAKKSEDLKRVIVEKLVEIYEKDGIYNEAINFQEGLT-VMLFVGVNGVGKTTSIGKLAHQYKSQGKKVMLVAADTFRAGAVAQLVEWGRRVDVPVVTGEKKA-DPASVVFDGMEKAVAQGVDVLLIDTAGRLQNKENLMAELEKIGRIIKRVVPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKIDDIGEFNSEDFMRGL 531
>gi|167561478|ref|ZP_02354394.1| signal recognition particle-docking protein FtsY [Burkholderia oklahomensis EO147] (434 aa)
Score = 598, Expect = 6.5e-60, Identities = 127/300 (42%), Positives = 184/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKE----IIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+DE  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+    ++VD +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+G+ Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   143 RLKSGLAKTSSSITNVFVN-----TKIDEALYEELETALLMSDAGIDATEHLLDALREKVRTGRLTDPQQVKDALRGLLVDLL-------KPLEKSLMLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNGLAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFADAL 432
>gi|171780112|ref|ZP_02921016.1| hypothetical protein STRINF_01900 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281460|gb|EDT46895.1| hypothetical protein STRINF_01900 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (430 aa)
Score = 597, Expect = 8.3e-60, Identities = 148/348 (42%), Positives = 229/348 (65%)
  Q:     6 FKKIVNKLKGKKEGSLE--DLSAKIEEKNIE-KQAEILE-----VLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           F  ++     KKE + E  D    +E + +E KQ ++ E      +  +++K++  LKK+ +  S  +   +  F++VDE+F+E +EE+LI  DVGV    ++T+ +R E   +N +  D ++ +I++K+   Y +D   N  ++ + D   ++L +GVNGVGKTTSI K+A  +  + KKV+LVA DTFRAGAV QL  W +R+   +V    E  DPASV+F G+++   EN D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  FD E F+ G+ + ++
  S:    77 FSGVMADYYAKKEAAKEALDRGETVEFEAVETKQEDVKEESVNAPVETEEEKYNRSLKKTRTGFSARLNAFLANFRRVDEDFFEELEEMLILSDVGVNVATQLTEDLRYEAKLENAKKADDLRRVIIEKLVEIYEKDGVFNEQINFQ-DGLTVMLFVGVNGVGKTTSIGKLAYKYKNEGKKVMLVAADTFRAGAVAQLAEWGRRVDVPVV-TGPEKADPASVVFDGMERAVAENVDVLLIDTAGRLQNKDNLMAELEKIGRIIKRVVPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKIDDIGEFDSEDFIRGLLEGII 430
>gi|26991787|ref|NP_747212.1| signal recognition particle-docking protein FtsY [Pseudomonas putida KT2440] >gi|24986898|gb|AAN70676.1|AE016711_4 signal recognition particle receptor FtsY [Pseudomonas putida KT2440] (494 aa)
Score = 597, Expect = 8.7e-60, Identities = 121/303 (39%), Positives = 192/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK-KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  + IE  L++ DVGV AT+ I   + +++  + + D D + + + +++             L+++ +++  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   FNIP+++IG+GE ++DL  F+ E FV  +  E
  S:   193 RLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSAIVQNLTQKVARKQLADADALYKSLQEELAALL---RPVEQPLNVQAQNKPYVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIP-VIAQHTGADSASVIFDAVQAAKARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDVEAPHEVLLVLDAGTGQNAISQAKYFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPFVKALFAE 492
>gi|148550186|ref|YP_001270288.1| signal recognition particle-docking protein FtsY [Pseudomonas putida F1] >gi|148514244|gb|ABQ81104.1| signal recognition particle-docking protein FtsY [Pseudomonas putida F1] (497 aa)
Score = 596, Expect = 9.7e-60, Identities = 121/303 (39%), Positives = 191/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK-KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  + IE  L++ DVGV AT+ I   + +++  + + D D + + + +++             L ++ +++  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   FNIP+++IG+GE ++DL  F+ E FV  +  E
  S:   196 RLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSAIVQNLTQKVARKQLADADALYKSLQEELAALL---RPVEQPLKVQAQNKPYVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIP-VIAQHTGADSASVIFDAVQAAKARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDVEAPHEVLLVLDAGTGQNAISQAKYFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPFVKALFAE 495
>gi|167036150|ref|YP_001671381.1| signal recognition particle-docking protein FtsY [Pseudomonas putida GB-1] >gi|166862638|gb|ABZ01046.1| signal recognition particle-docking protein FtsY [Pseudomonas putida GB-1] (510 aa)
Score = 596, Expect = 1.0e-59, Identities = 121/303 (39%), Positives = 190/303 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK-KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  + IE  L++ DVGV AT+ I   + +++  + + D D + + + +++             L ++ +++  ++L++GVNG GKTT+I K+A       KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   FNIP+++IG+GE ++DL  F+ E FV  +  E
  S:   209 RLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSAIVQNLTQKVARKQLADADALYKSLQEELAALL---RPVEQPLKVQAQNKPYVILVVGVNGAGKTTTIGKLAKKLQLDGKKVMLAAGDTFRAAAVEQLQVWGERNQIP-VIAQHTGADSASVIFDAVQAAKARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAKYFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPFVKALFAE 508
>gi|114566315|ref|YP_753469.1| Signal recognition particle GTPase-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114337250|gb|ABI68098.1| signal recognition particle-docking protein FtsY [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (305 aa)
Score = 596, Expect = 1.0e-59, Identities = 136/300 (45%), Positives = 197/300 (65%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVD---KIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +GL K+       I  +VK  KK+D++F+E +EE+LI  DVGV  T ++ D I++    Q + D   + E+I D   K+  Y       N  L+I +    ++L++GVNG GKTTSIAK+A  F ++ KKVLL A DTFRA A++QLNIW+ R+  +++   +EG DP +V+F  +   K  + D++I DT+GRL NK NLMKE+ KI ++I +    APHE LLVLDAT GQ+ I QAK F+E T +TG+IL+K+DGT+KGGI+L+++    IPVK +G+GE LEDL  F  + F + +
  S:     3 KLKKGLSKTRENTIGKIEALVKSSKKLDDDFWEELEEILIQADVGVNTTIELVDNIKQAAKKQKMHDSSEVLELIKDEVRKLLEY------NNVPLNIPERELAVILVVGVNGAGKTTSIAKLAYRFHEEGKKVLLGAADTFRAAAIDQLNIWADRVGVELI-KHQEGSDPGAVVFDAIHAAKARHADILIIDTAGRLQNKANLMKEISKIKNIIQREIPEAPHEVLLVLDATTGQNAISQAKIFEEATGVTGLILSKLDGTAKGGIILAVEKELKIPVKLVGIGEGLEDLRDFSPQIFTEAL 298
>gi|77413067|ref|ZP_00789268.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae 515] >gi|77160860|gb|EAO71970.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae 515] (536 aa)
Score = 595, Expect = 1.2e-59, Identities = 143/326 (43%), Positives = 217/326 (66%)
  Q:    23 DLSAKIEEKNIEKQAEILEVLPEKQK-KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           D S   E + +  Q++   +  E Q+ K++  LKK+ +  S  +   +  F++VDEEF+E +EE+LI  DVGV    ++T+ +R E   +N +  + +K +IV+K+   Y +D   N  ++ ++  T ++L +GVNGVGKTTSI K+A+ +  + KKV+LVA DTFRAGAV QL  W +R+   +V   +E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F+ E F+ G+
  S:   207 DESKLSEAQEVLSQSQADTIKAESQEEKYNRSLKKTRTGFSARLNAFLSNFRRVDEEFFEELEEMLILSDVGVNVATQLTEDLRYEAKLENAKKSEDLKRVIVEKLVEIYEKDGIYNEAINFQEGLT-VMLFVGVNGVGKTTSIGKLAHQYKSQGKKVMLVAADTFRAGAVAQLVEWGRRVDVPVV-TGEEKADPASVVFDGMEKAIAQGVDVLLIDTAGRLQNKENLMAELEKIGRIIKRVVPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKIDDIGEFNSEDFMRGL 531
>gi|104779581|ref|YP_606079.1| cell division protein FtsY [Pseudomonas entomophila L48] >gi|95108568|emb|CAK13262.1| cell division protein FtsY [Pseudomonas entomophila L48] (524 aa)
Score = 595, Expect = 1.3e-59, Identities = 120/303 (39%), Positives = 193/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  + IE  L++ DVGV AT+ I   + +++  + + D D + + + +++    ++  +    ++  +++  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   FNIP+++IG+GE ++DL  F+ E FV  +  E
  S:   221 RLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSTIVQNLTQKVARKQLADADALYKSLQEEL-AALLRPVEQPLKIE-AQNKPYVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIP-VIAQHTGADSASVIFDAVQAAKARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAKYFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPFVKALFAE 520
>gi|167568708|ref|ZP_02361582.1| signal recognition particle-docking protein FtsY [Burkholderia oklahomensis C6786] (366 aa)
Score = 595, Expect = 1.3e-59, Identities = 128/300 (42%), Positives = 184/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKE----IIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+DE  YE +E  L+  D GV AT  + DA+RE++    + DP  +K+    ++VD +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+G+ Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    75 RLKSGLAKTSSSITNVFVN-----TKIDEALYEELETALLMSDAGVDATEHLLDALREKVRTGRLTDPQQVKDALRGLLVDLL-------KPLEKSLMLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNGLAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFADAL 364
>gi|22536891|ref|NP_687742.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae 2603V/R] >gi|25010804|ref|NP_735199.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae NEM316] >gi|76798202|ref|ZP_00780453.1| cell division protein FtsY [Streptococcus agalactiae 18RS21] >gi|77406417|ref|ZP_00783476.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae H36B] >gi|77410752|ref|ZP_00787110.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae CJB111] >gi|22533741|gb|AAM99614.1|AE014224_17 signal recognition particle-docking protein FtsY [Streptococcus agalactiae 2603V/R] >gi|23095158|emb|CAD46393.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586465|gb|EAO62972.1| cell division protein FtsY [Streptococcus agalactiae 18RS21] >gi|77163131|gb|EAO74084.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae CJB111] >gi|77174981|gb|EAO77791.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae H36B] (536 aa)
Score = 594, Expect = 1.5e-59, Identities = 143/326 (43%), Positives = 217/326 (66%)
  Q:    23 DLSAKIEEKNIEKQAEILEVLPEKQK-KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           D S   E + +  Q++   +  E Q+ K++  LKK+ +  S  +   +  F++VDEEF+E +EE+LI  DVGV    ++T+ +R E   +N +  + +K +IV+K+   Y +D   N  ++ ++  T ++L +GVNGVGKTTSI K+A+ +  + KKV+LVA DTFRAGAV QL  W +R+   +V   +E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+VL+I+   +IPVK+IG GEK++D+  F+ E F+ G+
  S:   207 DESEFSEAQEVLSQSQADTIKAESQEEKYNRSLKKTRTGFSARLNAFLSNFRRVDEEFFEELEEMLILSDVGVNVATQLTEDLRYEAKLENAKKSEDLKRVIVEKLVEIYEKDGIYNEAINFQEGLT-VMLFVGVNGVGKTTSIGKLAHQYKSQGKKVMLVAADTFRAGAVAQLVEWGRRVDVPVV-TGEEKADPASVVFDGMEKAVAQGVDVLLIDTAGRLQNKENLMAELEKIGRIIKRVVPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKIDDIGEFNSEDFMRGL 531
>gi|20807911|ref|NP_623082.1| Signal recognition particle GTPase [Thermoanaerobacter tengcongensis MB4] >gi|20516478|gb|AAM24686.1| Signal recognition particle GTPase [Thermoanaerobacter tengcongensis MB4] (295 aa)
Score = 594, Expect = 1.6e-59, Identities = 140/295 (47%), Positives = 201/295 (68%)
  Q:    54 LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           L+K    L+  + E++   KKVDEE +E +EE LI  DVGV  T KI  +++++   + + +   ++E++  +I  Y I   D   F+        ++LI+GVNGVGKTT+I K+A+ + K+ K V++VA DTFRA A++QL +W++R+ C I+   +EG DPASV+F G++  K    D+VICDT+GRLHNK NLM+EL KI  VI +    A  E  LVLDAT GQ+ + QAK FKE+ +ITGIILTK+DGT+KGGIV++IK+  N+P++YIG+GE +EDL AFD + FV  I
  S:     5 LQKFKENLTAKLNEVLSFGKKVDEELFEELEEALILADVGVDTTYKIIQSLKQKTKEEKIFEASKVRELLAQEI--YEILQKDVEPFV---LTSPMVILIVGVNGVGKTTTIGKLAHLYKKQGKSVMMVAADTFRAAAIDQLEVWAKRVNCPII-KHQEGSDPASVVFDGLQSAKARGIDVVICDTAGRLHNKKNLMEELRKIRKVIDREYSEARVETFLVLDATTGQNALQQAKIFKEVADITGIILTKLDGTAKGGIVIAIKEELNLPIRYIGIGEGMEDLQAFDAKSFVSAI 293
>gi|163755934|ref|ZP_02163051.1| amidase [Kordia algicida OT-1] >gi|161324105|gb|EDP95437.1| amidase [Kordia algicida OT-1] (318 aa)
Score = 594, Expect = 1.7e-59, Identities = 139/307 (45%), Positives = 200/307 (65%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL+KS S+    +T+ V    KVD+E  +N+EE+L+S DVGV  T KI D I E +        D + +I+ ++I     + ++  +T   I  D+   +L+++GVNGVGKTT+I K+A+ F KK  KV+L A DTFRA A++QL +W+ R+   IV     G DPASV F  ++ G  ++ D++I DT+GRLHNK+NLMKEL K+  V+ K    APH+ LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL  F+  +FVD   K+
  S:    11 EKKETLDKGLEKSKSSFFSKLTKAVAGKSKVDDEVLDNLEEVLVSSDVGVDTTLKIIDRIEERVAKDKYLGTDELNKILREEIAALLSETNSGEDTEYTIPADKKPYVLMVVGVNGVGKTTTIGKLAHQFNKKGLKVVLGAADTFRAAAIDQLQVWADRVGVPIV-KQSMGSDPASVAFDALQSGVAQDADVIIIDTAGRLHNKVNLMKELTKVKKVMQKVIGDAPHDVLLVLDGSTGQNAFEQAKQFTAATEVTTLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIEDLQVFNKYEFVDSFFKK 318
>gi|149174765|ref|ZP_01853390.1| cell division protein FtsY [Planctomyces maris DSM 8797] >gi|148846459|gb|EDL60797.1| cell division protein FtsY [Planctomyces maris DSM 8797] (315 aa)
Score = 593, Expect = 2.2e-59, Identities = 135/300 (45%), Positives = 199/300 (66%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTN-------TFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVL-PDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL+K+   L   + ++ K  + +D++  E  E  LI  D+GV+A++ I + IR++   + V   D I+E + +KI T    + DT        + L+   D   ++L+ GVNGVGKTTSIAK+AN  +K++K VLL AGDTFRA AVEQL +W+ RL C+IV  PD  G DPASV ++G ++  +   D +I DT+GRL    NLM+ELEKI  V+ K    APHE+LLVLDAT GQ+GI QA+ F +    +G+IL K+DGT++GG+ ++I+    IPVKY+G+GE+++DL  F+ + FVD +
  S:     6 RLKRGLEKTKEVLRTDVRDLFKAGEILDDQKIEQFEARLIKTDMGVVASSAICEEIRKKHGGRTV-ILDEIEETVKEKIRTLLEGEGDTKWDISAPLSPLNKNPDGVTVILVAGVNGVGKTTSIAKLANLILKQNKTVLLAAGDTFRAAAVEQLTMWADRLGCEIVTRPD--GTDPASVAYSGCERALETGVDYLIIDTAGRLQTHTNLMEELEKIKRVVSKKIPNAPHESLLVLDATTGQNGISQAEHFSKSIECSGLILAKLDGTARGGVTVAIRQKMGIPVKYVGVGEQIDDLELFNSQGFVDAL 310
>gi|182677358|ref|YP_001831504.1| signal recognition particle-docking protein FtsY [Beijerinckia indica subsp. indica ATCC 9039] >gi|182633241|gb|ACB94015.1| signal recognition particle-docking protein FtsY [Beijerinckia indica subsp. indica ATCC 9039] (408 aa)
Score = 593, Expect = 2.3e-59, Identities = 121/296 (40%), Positives = 192/296 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           +  +GL +SSS++   + +I  K +K+DE   E++E++LI  D+G     +IT+A+ +     +V DP  +K I+   V+++ T Y +    +T       +  ++L++GVNG GKTT+I K+A  F ++  KV+L AGDTFRA A+EQL IW QRL C  V+   +G D + + F  +K  + E  DL++ DT+GRL N+  LM ELEKI  V+ K D+ APH  LLVLDAT+GQ+ + Q + F  +  +TG+++TK+DGT++GGI+++I + F +P+ +IG+GEK++DL  F    F
  S:   104 RLRDGLSRSSSSIGTGLVDIFTK-RKLDEAMLEDLEDILIRADLGTAVAQRITEAVGKGRYNWDV-DPREVKTILASEVEQVLTPYAKPLVIDT-----TKKPFVILVVGVNGSGKTTTIGKLAAQFSREGHKVMLAAGDTFRAAAIEQLQIWGQRLGC-TVIARPQGSDASGLAFDAIKTARSEGADLLLMDTAGRLQNRAELMDELEKIIRVMRKQDEEAPHAVLLVLDATVGQNALNQVEIFGRVAGVTGLVMTKLDGTARGGILVAITEKFKLPIHFIGVGEKVDDLEPFAASDF 394
>gi|126451651|ref|YP_001064860.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1106a] >gi|126225293|gb|ABN88833.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1106a] (476 aa)
Score = 593, Expect = 2.3e-59, Identities = 123/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   185 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 474
>gi|76808739|ref|YP_332160.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1710b] >gi|76578192|gb|ABA47667.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1710b] (476 aa)
Score = 593, Expect = 2.3e-59, Identities = 123/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   185 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 474
>gi|160915312|ref|ZP_02077525.1| hypothetical protein EUBDOL_01321 [Eubacterium dolichum DSM 3991] >gi|158433111|gb|EDP11400.1| hypothetical protein EUBDOL_01321 [Eubacterium dolichum DSM 3991] (323 aa)
Score = 592, Expect = 2.9e-59, Identities = 133/305 (43%), Positives = 192/305 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           ++  GL KS  + S+ I  +   F+ +DEEF E +   L+  D+G+    K+ D +      + +   D I E +V+ +   Y+   D    + I +    ++ ++GVNG GKTT+ AK+   F+ + KKV+L A DTFRAGAV+QL  W+ RL  D +   +E  DP++VI    +  K+ + D +ICDT+GRL NK NLM EL K+  V+ +  + APHE  LVLDAT GQ+GI QAK F E TN+TGIILTK+DGT+KGGIV++I+D   +PVKYIGLGE LEDL  FD++ ++ G+ + LV
  S:    19 RYLSGLDKSKRSFSERIRRLSLGFRGIDEEFLEELMVALLEADLGIKTAQKVVDEVENRALDRKLSSFDEISECLVEVLRDMYVSYEDEA--MHINEQGVTVIYMVGVNGSGKTTTTAKLTKSFLDEGKKVVLAAADTFRAGAVDQLATWADRLGVDCI-KGRENGDPSAVIVDAARFAKEHHADYLICDTAGRLQNKTNLMNELSKMRRVVEREIEGAPHEVWLVLDATTGQNGISQAKIFTETTNVTGIILTKLDGTAKGGIVIAIRDLLGLPVKYIGLGETLEDLRPFDIDSYLYGLCEGLV 320
>gi|116629439|ref|YP_814611.1| Signal recognition particle GTPase [Lactobacillus gasseri ATCC 33323] >gi|116095021|gb|ABJ60173.1| signal recognition particle-docking protein FtsY [Lactobacillus gasseri ATCC 33323] (449 aa)
Score = 592, Expect = 3.1e-59, Identities = 144/331 (43%), Positives = 222/331 (67%)
  Q:    23 DLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ--DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +L+A  EE++ EK AE      ++Q+++D+GL+K++ +    +     KF+ VDE+F++++E+LLI  DVG     ++TD++R+E   QN +  D +K++IV+K+   Y +  + + +   D    + N+ L +GVNG GKTT+I K+A       K V++VA DTFRAGAVEQL  W +R   ++V    E  DPASV++ GVKK KD   D ++ DT+GRL NK+NLM EL+KI   I K     P+E LLVLD + GQ+ ++QAK F + T +TG++LTK+DG+SKGG+VL+I++  ++PVK +GLGEK++DL+ FD EKF  G+ + L+
  S:   122 ELAANTEEESDEKVAE----KEDEQERYDKGLEKTNHSFGARLNAFFAKFRTVDEDFFDDLEDLLIESDVGFETAEELTDSLRDEAKLQNAKSHDDLKQVIVEKLVDIYDKGGEGEDSKLADDPDAKPNVYLFVGVNGAGKTTTIGKLAKRIKDSGKSVMMVAADTFRAGAVEQLVEWGRRDGVEVV-TGPEKADPASVVYDGVKKAKDRGIDFLLVDTAGRLQNKVNLMSELDKIKRTIKKILPDQPNEVLLVLDGSTGQNALLQAKDFDKTTKLTGLVLTKLDGSSKGGVVLAIRNEMDLPVKLVGLGEKVDDLANFDAEKFAIGLFQGLI 449
>gi|167579753|ref|ZP_02372627.1| signal recognition particle-docking protein FtsY [Burkholderia thailandensis TXDOH] (425 aa)
Score = 592, Expect = 3.2e-59, Identities = 124/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D GV AT  +  A+RE++    + DP  +K+ +   +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   134 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGVDATEHLLGALREKVRTGRLTDPQQVKDALRGLLVELL---TPLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFADAL 423
>gi|83718719|ref|YP_441024.1| signal recognition particle-docking protein FtsY [Burkholderia thailandensis E264] >gi|83652544|gb|ABC36607.1| signal recognition particle-docking protein FtsY [Burkholderia thailandensis E264] (433 aa)
Score = 591, Expect = 3.7e-59, Identities = 124/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D GV AT  +  A+RE++    + DP  +K+ +   +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   142 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGVDATEHLLGALREKVRTGRLTDPQQVKDALRGLLVELL---TPLEQSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFADAL 431
>gi|87308020|ref|ZP_01090162.1| cell division protein FtsY [Blastopirellula marina DSM 3645] >gi|87289102|gb|EAQ80994.1| cell division protein FtsY [Blastopirellula marina DSM 3645] (328 aa)
Score = 591, Expect = 3.7e-59, Identities = 133/300 (44%), Positives = 190/300 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKK-VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  +GL K+S  L+  I ++ K+  + VD+EF   +  +L+  D+GV    KI D ++ +   + V   +++  +  +      +Q  +T   +   +    +++++GVNG GKTTSIAK+A++   + K V+L AGDTFRA AVEQL+IW+ RL  DIV  + +G DPASV F  V      N D+VI DT+GRL  + NLM EL+KI  V  K  + APHE LLVLDAT GQ+GI QAK F E    TGIILTK+DGT+KGG+V+ I+  FN+PVKYIG+GE  ED + F+ E+F D +
  S:    28 RLKQGLVKTSRVLNTDIRDLFKQEGRLVDDEFLTELYAILVRTDMGVGPAGKIRDQVKTDFRGRVVHLSEVLTTVKTE--LVALMQQPETP--IQFAESGPTVVMVVGVNGSGKTTSIAKLASYLKSQGKSVVLGAGDTFRAAAVEQLSIWADRLGVDIVKAE-QGSDPASVAFKAVDFALQNNKDVVILDTAGRLQTQTNLMNELDKIRRVAGKKIEAAPHEVLLVLDATAGQNGISQAKGFSEAAQCTGIILTKLDGTAKGGVVVPIRQTFNLPVKYIGVGETPEDFALFNAEQFGDAL 323
>gi|76788040|ref|YP_329475.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae A909] >gi|76563097|gb|ABA45681.1| signal recognition particle-docking protein FtsY [Streptococcus agalactiae A909] (536 aa)
Score = 591, Expect = 4.0e-59, Identities = 142/326 (43%), Positives = 216/326 (66%)
  Q:    23 DLSAKIEEKNIEKQAEILEVLPEKQK-KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           D S   E + +  Q++   +  E Q+ K++  LKK+ +  S  +   +  F++VDEEF+E +EE+LI  DVGV    ++T+ +R E   +N +  + +K +IV+K+   Y +D   N  ++ ++  T ++L +GVNGVGKTTSI K+A+ +  + KKV+LVA DTFRAGAV QL  W +R+   +V   +E  DPASV+F G++K   +  D+++ DT+GRL NK NLM ELEKI  +I +    APHE LL LDA+ GQ+ + QAK F +IT +TG+ILTK+DGT+KGG+ L+I+   +IPVK+IG GEK++D+  F+ E F+ G+
  S:   207 DESEFSEAQEVLSQSQADTIKAESQEEKYNRSLKKTRTGFSARLNAFLSNFRRVDEEFFEELEEMLILSDVGVNVATQLTEDLRYEAKLENAKKSEDLKRVIVEKLVEIYEKDGIYNEAINFQEGLT-VMLFVGVNGVGKTTSIGKLAHQYKSQGKKVMLVAADTFRAGAVAQLVEWGRRVDVPVV-TGEEKADPASVVFDGMEKAVAQGVDVLLIDTAGRLQNKENLMAELEKIGRIIKRVVPDAPHETLLALDASTGQNALSQAKEFSKITPLTGLILTKIDGTAKGGVALAIRQELDIPVKFIGFGEKIDDIGEFNSEDFMRGL 531
>gi|118728305|ref|ZP_01576864.1| signal recognition particle-docking protein FtsY [Clostridium cellulolyticum H10] >gi|118662310|gb|EAV69012.1| signal recognition particle-docking protein FtsY [Clostridium cellulolyticum H10] (302 aa)
Score = 591, Expect = 4.1e-59, Identities = 141/300 (47%), Positives = 212/300 (70%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  EGL+K+  ++++ I +++  F KVDEE +E +EE+LI+ D+G+  T ++ + ++E++  + + DP  +K ++ + +    ++   +   +  K    ++++++GVNGVGKTTSI KIAN +  + KKVLL AGDTFRA A++QL +W+QR+  DI++  KEG DPA+VIF  V+  K  N DL+ICDT+GRLH K NLM+EL+KI  V+ +    A  E LLVLDAT GQ+ I QAK F E ++ITGI+LTK+DGT+KGGIV++IK   +IPVK IG+GE+L+DL  FD E+FV+ +
  S:     6 KLKEGLQKTRKSITEKIDQVLVSFGKVDEELFEELEEILITSDIGIDTTMRVIEDLKEKVKERKIIDPKDVKGLLKESL-KEILEKGGSEMKIGTKP---SVIIVIGVNGVGKTTSIGKIANLYKNQGKKVLLAAGDTFRAAAIDQLEVWAQRVGTDIIM-HKEGSDPAAVIFDAVQAAKSRNADLLICDTAGRLHTKKNLMEELKKISRVLDRELPGADRETLLVLDATTGQNAISQAKTFSETSDITGIVLTKLDGTAKGGIVIAIKSELDIPVKLIGVGEQLDDLQKFDAEEFVEAL 300
>gi|116749888|ref|YP_846575.1| signal recognition particle-docking protein FtsY [Syntrophobacter fumaroxidans MPOB] >gi|116698952|gb|ABK18140.1| signal recognition particle-docking protein FtsY [Syntrophobacter fumaroxidans MPOB] (326 aa)
Score = 590, Expect = 5.5e-59, Identities = 122/296 (41%), Positives = 197/296 (66%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           +  + L K+       +  +V   KK+D +  + +EE+LI+ D+GV  T  + + + ++I  Q ++DP  +++ + ++I    I   +++ + D +  R  +++I+GVNGVGKTT+I K+A+ F  +  KV+LVA DTFRA AVEQL++W +R+   +V   K G DP++V F  +        D+V+ DT+GR+H K+NLM+EL+K+  V+++ D +APHE LLVLDA+ GQ+ + QA+ FKE   +TG+ILTK+DGT+KGGI+++I D   +PV+YIG+GE L+DL  FD E+F
  S:    30 RLRDRLHKTREQFINRMDRLVLGRKKIDMDLLDELEEVLITSDLGVRTTQLLLEKVADKIKRQELKDPQKLRDQLREEITR--ILSVESSAW-DPRSARPFVIMIIGVNGVGKTTTIGKLAHQFKSEGLKVMLVAADTFRAAAVEQLSLWGERVNVPVV-KQKSGSDPSAVAFDAMDAAVSRGMDIVLLDTAGRMHTKVNLMEELKKVQRVVNRKDPSAPHEILLVLDASTGQNALSQARLFKEEIGVTGLILTKLDGTAKGGIIVAISDELQLPVRYIGIGESLDDLRPFDPEEF 321
>gi|120601367|ref|YP_965767.1| signal recognition particle-docking protein FtsY [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120561596|gb|ABM27340.1| signal recognition particle-docking protein FtsY [Desulfovibrio vulgaris subsp. vulgaris DP4] (483 aa)
Score = 589, Expect = 7.0e-59, Identities = 117/296 (39%), Positives = 179/296 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           K  EGL ++   + + I  ++    ++DE F+E +EE+LI  DVG   T ++   +RE       +DP   +E++ +++   +              +   ++L++GVNGVGKTT+IAK+A     + +KVL+ AGDTFRA A+EQL IW++R+          G DPA+V +  + K   E YDL++ DT+GRLH K NLM+EL KI  V+ +    APH ++LV+DAT GQ+ + Q K F E   +  I+LTK+DGT+KGGIV+++   F IP+ Y+GLGEK+ED+  F+   F
  S:   181 KLTEGLARTREQIGRRIDGLLASHGRIDEGFWEELEEILIMADVGFEPTTQLIGRLRERARKAGTDDPARFRELLREELEVIFRAPRRIAAV-----NPPEVVLLIGVNGVGKTTTIAKLAYRAQLQGRKVLIAAGDTFRAAAIEQLEIWAKRVGAGF-YAKTAGADPAAVAYEAMDKAVSEGYDLLLVDTAGRLHTKANLMEELHKIRKVLGRKHPGAPHRSILVIDATTGQNALSQTKLFNEACGVDEIVLTKLDGTAKGGIVVAVAMQFGIPITYVGLGEKMEDMRPFNGSDF 470
>gi|196170973|gb|ACG71946.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter sp. K] (469 aa)
Score = 588, Expect = 8.8e-59, Identities = 124/301 (41%), Positives = 188/301 (62%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT----DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K    GL+K+       +  +    K VD+    ++EE+L + D+GV    ++ ++ RE++  + + DP+ +K  + ++I    I D          L + + R  +++++GVNG GKTT++ K+A        KVLL AGDTFRA A EQL +W++R+   +V   KEG DPA+V F  V++G  E  D+V+CDT+GRLH K+ LM+EL+K+  VI K    APHE LLVLDAT GQ+ I QA+ F E   +TGI LTK+DGT+KGG+++ I D   IPV+Y+G+GE++ DL  F   +FV+ +
  S:   166 KTLAAGLEKTRGGFMARLNALFAGGKVVDDAVLADLEEVLFTADIGVKTATRLLESAREKVRRKELSDPERLKAALREEIAR--ILDLAGTGGAAAPLAVGEARPWVVMVVGVNGSGKTTTVGKLAAKLQGAGHKVLLGAGDTFRAAAGEQLEVWAERVSAPVV-RGKEGADPAAVCFEAVQRGAQEGVDVVLCDTAGRLHTKMPLMEELKKVQRVIGKAAAGAPHEVLLVLDATNGQNAIAQARQFHEALGVTGIALTKLDGTAKGGVIIGICDELRIPVRYVGVGERVADLKPFSPREFVEAL 467
>gi|154492268|ref|ZP_02031894.1| hypothetical protein PARMER_01902 [Parabacteroides merdae ATCC 43184] >gi|154087493|gb|EDN86538.1| hypothetical protein PARMER_01902 [Parabacteroides merdae ATCC 43184] (317 aa)
Score = 588, Expect = 9.7e-59, Identities = 138/307 (44%), Positives = 191/307 (62%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD--TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL K+   +   IT  +    KVD+E  +N+EE+LI+ DVGV  T KI   I + +          +  I+ ++I +   ++   D  +F   +  +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL IWS+R+   IV   K G DPASV F  +   K    D+VI DT+GRLHNKINLM EL KI +V+ K    APHE LLVLD + GQ+   QAK F   T +  + +TK+DGT+KGG+V+ I D+F IPVKYIGLGE +EDL  F+ ++FV+ +  E
  S:    10 EKKETLDKGLSKTKENVFSKITRAIAGKSKVDDEVLDNLEEVLITSDVGVDTTLKIISRIEDRVARDKYVTTSELTAILREEIASLLTENHTEDLESFTVPEDKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKNVYLGAADTFRAAAVEQLVIWSERVGVPIV-KQKMGSDPASVAFDTLSSAKANGADVVIIDTAGRLHNKINLMNELTKIKNVMKKVVPDAPHEVLLVLDGSTGQNAFEQAKQFTAATEVNALAVTKLDGTAKGGVVIGISDHFRIPVKYIGLGEGMEDLQVFNRKEFVNSLFGE 317
>gi|86157101|ref|YP_463886.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter dehalogenans 2CP-C] >gi|85773612|gb|ABC80449.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter dehalogenans 2CP-C] (444 aa)
Score = 587, Expect = 1.1e-58, Identities = 125/301 (41%), Positives = 187/301 (62%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTN----TFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K    GL+K+       +  +    K VD+    ++EE+L + D+GV    ++ ++ RE++  + + DP+ +K  + ++I    I D          L + + R  +++++GVNG GKTT++ K+A        KVLL AGDTFRA A EQL +W++R+   IV   KEG DPA+V F  V++G  E  D+V+CDT+GRLH K  LM+EL+K+  VI K    APHE LLVLDAT GQ+ I QA+ F E   +TGI LTK+DGT+KGG+++ I D   IPV+Y+G+GE++ DL  F   +FV+ +
  S:   141 KTLAAGLEKTRGGFMARLNALFAGGKVVDDSVLADLEEVLFTADIGVKTATRLLESAREKVRRKELSDPERLKAALREEIAR--ILDLAATGGAAAPLAVGEARPWVVMVVGVNGSGKTTTVGKLAAKLQGGGHKVLLGAGDTFRAAAGEQLEVWAERVSAPIV-RGKEGADPAAVCFEAVQRGAQEGVDVVLCDTAGRLHTKTPLMEELKKVQRVIGKAAAGAPHEVLLVLDATNGQNAIAQARQFHEALGVTGIALTKLDGTAKGGVIIGICDELRIPVRYVGVGERVADLKPFSPREFVEAL 442
>gi|46581462|ref|YP_012270.1| signal recognition particle-docking protein FtsY [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|46450884|gb|AAS97530.1| signal recognition particle-docking protein FtsY [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (488 aa)
Score = 587, Expect = 1.2e-58, Identities = 117/296 (39%), Positives = 179/296 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           K  EGL ++   + + I  ++    ++DE F+E +EE+LI  DVG   T ++   +RE       +DP   +E++ +++   +              +   ++L++GVNGVGKTT+IAK+A     + +KVL+ AGDTFRA A+EQL IW++R+          G DPA+V +  + K   E YDL++ DT+GRLH K NLM+EL KI  V+ +    APH ++LV+DAT GQ+ + Q K F E   +  I+LTK+DGT+KGGIV+++   F IP+ Y+GLGEK+ED+  F+   F
  S:   186 KLTEGLARTREQIGRRIDGLLASHGRIDEGFWEELEEILIMADVGFEPTTQLIGRLRERARKAGTDDPARFRELLREELEVIFRAPRRIAAV-----NPPEVVLLIGVNGVGKTTTIAKLAYRAQLQGRKVLIAAGDTFRAAAIEQLEIWAKRVGAGF-YAKTAGADPAAVAYEAMDKAVSEGYDLLLVDTAGRLHTKANLMEELHKIRKVLGRKHPGAPHRSILVIDATTGQNALSQTKLFNEACGVDEIVLTKLDGTAKGGIVVAVAMQFGIPITYVGLGEKMEDMRPFNGSDF 475
>gi|167455702|ref|ZP_02321923.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417796|gb|EDR84497.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter dehalogenans 2CP-1] (290 aa)
Score = 586, Expect = 1.6e-58, Identities = 120/276 (43%), Positives = 180/276 (65%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT----DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K VD+    ++EE+L + D+GV    ++ ++ RE++  + + DP+ +K  + ++I    I D          L + + R  +++++GVNG GKTT++ K+A        KVLL AGDTFRA A EQL +W++R+   +V   KEG DPA+V F  V++G  E  D+V+CDT+GRLH K+ LM+EL+K+  VI K    APHE LLVLDAT GQ+ I QA+ F E   +TGI LTK+DGT+KGG+++ I D   IPV+Y+G+GE++ DL  F   +FV+ +
  S:    12 KVVDDSVLADLEEVLFTADIGVKTATRLLESAREKVRRKELSDPERLKAALREEIAR--ILDLAGTGGAAAPLAVGEARPWVVMVVGVNGSGKTTTVGKLAAKLQGAGHKVLLGAGDTFRAAAGEQLEVWAERVSAPVV-RGKEGADPAAVCFEAVQRGAQEGVDVVLCDTAGRLHTKMPLMEELKKVQRVIGKAAAGAPHEVLLVLDATNGQNAIAQARQFHEALGVTGIALTKLDGTAKGGVIIGICDELRIPVRYVGVGERVADLKPFSPREFVEAL 288
>gi|134279674|ref|ZP_01766386.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 305] >gi|134248874|gb|EBA48956.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 305] (476 aa)
Score = 586, Expect = 1.6e-58, Identities = 122/300 (40%), Positives = 179/300 (59%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   185 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 474
>gi|161369920|ref|ZP_02109488.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1710a] >gi|167917481|ref|ZP_02504572.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei BCC215] >gi|194511201|ref|YP_002023730.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei Pasteur 52237] >gi|194516541|ref|YP_002051807.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei S13] >gi|157935486|gb|EDO91156.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei Pasteur 52237] >gi|169653774|gb|EDS86467.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei S13] (439 aa)
Score = 585, Expect = 2.0e-58, Identities = 123/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   148 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 437
>gi|167745645|ref|ZP_02417772.1| hypothetical protein ANACAC_00337 [Anaerostipes caccae DSM 14662] >gi|167654957|gb|EDR99086.1| hypothetical protein ANACAC_00337 [Anaerostipes caccae DSM 14662] (316 aa)
Score = 585, Expect = 2.0e-58, Identities = 126/296 (42%), Positives = 198/296 (66%)
  Q:    53 GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GL K+   ++     I K F  +D++FYE +EE++I  D+G+  T  I + +++++  + +++P+  +++++D I        +   F    KD+ +++L++GVNGVGKTTS+ K+A+    + KKV++ A DTFRAGA+EQL  W+ R   DI+    EG DPA+V++  V   K  N D+++CDT+GRLHNK NLM EL+KI+ ++ +    A  E L+VLD T GQ+ + QAK FKE T+I+GIILTK+DGT+KGGI ++I+    IPVKYIG+GE+++DL  FD + FV+ +
  S:    20 GLTKTRDNIASGFDSIFKGFSSIDDDFYEELEEIMIMSDMGIDTTMSIIENLKKKVKEEKIKEPEECRQVLIDSIKEQMKLGEEAYDF----KDKKSVVLVIGVNGVGKTTSVGKMASLLKGEGKKVMMAAADTFRAGAIEQLKEWAGRAGVDII-SQAEGADPAAVVYDAVSAAKARNVDVLLCDTAGRLHNKKNLMDELKKINRIVEREYPEAYKETLIVLDGTTGQNALAQAKQFKEATDISGIILTKLDGTAKGGIAIAIQAELGIPVKYIGIGEQVDDLQPFDPDMFVNAL 310
>gi|168030830|ref|XP_001767925.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162680767|gb|EDQ67200.1| predicted protein [Physcomitrella patens subsp. patens] (383 aa)
Score = 585, Expect = 2.1e-58, Identities = 117/272 (43%), Positives = 173/272 (63%)
  Q:    77 EEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E   + +EE+L+  D G     KI D IR++I    ++    IKE +   IF    +   T T L +   R  +L+I+GVNG GKTT++ K+AN F K+  KVL+ AGDTFRA A EQL +W+QR   +IV+ +     PA+V+   V++  +E++D+V+CDTSGRLH   NLM+EL      + K   +AP+E LLVLD T G + + QA+ F ++  +TG ILTK+DGT++GG V+S+ D  +IPVK++G+GE ++DL  FD + FVD +
  S:   111 ESILDELEEVLLVSDFGPKTALKIVDTIRKDILAGRLKSGPQIKEALKKNIFKLLTERV-TTTELQLGNSRPAVLMIVGVNGGGKTTTLGKLANRFKKEGVKVLMAAGDTFRAAAGEQLEVWAQRTGSEIVMAEGPKPRPAAVLSQAVRRAVEEDFDVVLCDTSGRLHTNYNLMEELRGCKRAVSKALSSAPNEVLLVLDGTTGLNMLAQAREFNQVIGVTGFILTKLDGTARGGCVVSVVDELSIPVKFVGVGEGIDDLQPFDAQSFVDAL 381
>gi|146302707|ref|YP_001197298.1| signal recognition particle-docking protein FtsY [Flavobacterium johnsoniae UW101] >gi|146157125|gb|ABQ07979.1| signal recognition particle-docking protein FtsY [Flavobacterium johnsoniae UW101] (317 aa)
Score = 584, Expect = 2.2e-58, Identities = 136/306 (44%), Positives = 196/306 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+K+ +T    +++ V    KVD++  +N+EE+L+  DVGV  T KI + I + +        D + +I+ D+I     + +T   T  +I KD+   +L+++GVNGVGKTT+I K+A  F K   KV+L A DTFRA A++QL +W+ R+   IV  +  G DPASV F  ++    +N D+VI DT+GRLHNKINLM EL K+  V+ K    APH+ LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL  F+  +FVD   K
  S:    11 EKKETLDKGLEKTKTTFFSKLSKAVAGKSKVDDDVLDNLEEVLVGSDVGVNTTLKIIERIEKRVAEDKYLGTDELNQILRDEIGGLLSETNTGEATEFEIPKDKKPYVLMVVGVNGVGKTTTIGKLAYQFKKAGYKVVLGAADTFRAAAIDQLQVWADRVNVPIVRQNM-GSDPASVAFDTLQSAVAQNADVVIIDTAGRLHNKINLMNELSKVKRVMQKVVADAPHDVLLVLDGSTGQNAFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIEDLQVFNKYEFVDSFFK 317
>gi|168700596|ref|ZP_02732873.1| cell division protein FtsY [Gemmata obscuriglobus UQM 2246] (304 aa)
Score = 584, Expect = 2.5e-58, Identities = 134/301 (44%), Positives = 189/301 (62%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD--TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQ--DPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K    GL K+ S     + ++++   +VDE F E +E+ L   DVG  AT  I D +R     Q   D ++  EI  +      +++  TD +  L+ +     +++I GVNG GKTTSIAK+AN      KKVLL A DTFRA AVEQL +W+ RL CDIV   K+GQ  DP++V     +K K   +D++I DT+GRLH + +LMKELEKIH ++ +    APHE L+VLDAT GQ+ ++QA+ F +    TGIIL+K+DGT+KGG V +IK    +PVK++GLGEK+ED+  FD + FV  +
  S:     7 KGIKAGLTKTKSVFG-GVFDLLRGKGRVDEAFLEELEKRLYLADVGTQATLLIVDRVR-----QGFRDKEITGEI--ETFVKAQLRELLTDPSPGLNYQASGPTVVMIAGVNGSGKTTSIAKLANRLQADGKKVLLAACDTFRAAAVEQLTVWAGRLGCDIV---KQGQNADPSAVAHDACEKAKARGFDVLIVDTAGRLHTQTHLMKELEKIHRIVTRQIPGAPHEVLMVLDATTGQNALVQAEQFSKSVKCTGIILSKLDGTAKGGAVFAIKQKLGLPVKFVGLGEKIEDMEPFDPDAFVTAL 300
>gi|71736424|ref|YP_276881.1| signal recognition particle-docking protein FtsY [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556977|gb|AAZ36188.1| signal recognition particle-docking protein FtsY [Pseudomonas syringae pv. phaseolicola 1448A] (500 aa)
Score = 584, Expect = 2.5e-58, Identities = 119/303 (39%), Positives = 189/303 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  E IE  L++ DVGV AT+ I +++ +++  + + D   +   +  ++    ++  +    + ++  +  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ E FV  +  E
  S:   197 RLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIINSLTQKVARKQLTDAQALYTSLQGEL-AAMLKPVEQPLVIKVEH-KPFVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAE 496
>gi|67643445|ref|ZP_00442191.1| COG0552: Signal recognition particle GTPase [Burkholderia mallei GB8 horse 4] >gi|121600561|ref|YP_991446.1| signal recognition particle-docking protein FtsY [Burkholderia mallei SAVP1] >gi|124383927|ref|YP_001027477.1| signal recognition particle-docking protein FtsY [Burkholderia mallei NCTC 10229] >gi|126448883|ref|YP_001082444.1| signal recognition particle-docking protein FtsY [Burkholderia mallei NCTC 10247] >gi|167001053|ref|ZP_02266854.1| signal recognition particle-docking protein FtsY [Burkholderia mallei PRL-20] >gi|194317106|ref|YP_002012912.1| signal recognition particle-docking protein FtsY [Burkholderia mallei ATCC 10399] >gi|194523582|ref|YP_002059114.1| signal recognition particle-docking protein FtsY [Burkholderia mallei FMH] >gi|194528564|ref|YP_002064086.1| signal recognition particle-docking protein FtsY [Burkholderia mallei JHU] >gi|194576254|ref|YP_002111137.1| signal recognition particle-docking protein FtsY [Burkholderia mallei 2002721280] >gi|121229371|gb|ABM51889.1| signal recognition particle-docking protein FtsY [Burkholderia mallei SAVP1] >gi|124291947|gb|ABN01216.1| signal recognition particle-docking protein FtsY [Burkholderia mallei NCTC 10229] >gi|126241753|gb|ABO04846.1| signal recognition particle-docking protein FtsY [Burkholderia mallei NCTC 10247] >gi|147747592|gb|EDK54668.1| signal recognition particle-docking protein FtsY [Burkholderia mallei FMH] >gi|147752574|gb|EDK59640.1| signal recognition particle-docking protein FtsY [Burkholderia mallei JHU] >gi|148026575|gb|EDK84660.1| signal recognition particle-docking protein FtsY [Burkholderia mallei 2002721280] >gi|160696261|gb|EDP86231.1| signal recognition particle-docking protein FtsY [Burkholderia mallei ATCC 10399] (439 aa)
Score = 584, Expect = 2.7e-58, Identities = 123/300 (41%), Positives = 182/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +    +   + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   148 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDAL-RGLLVELLAPLEKSFVLG--RAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 437
>gi|150007588|ref|YP_001302331.1| recognition particle-docking protein FtsY [Parabacteroides distasonis ATCC 8503] >gi|149936012|gb|ABR42709.1| recognition particle-docking protein FtsY [Parabacteroides distasonis ATCC 8503] (317 aa)
Score = 583, Expect = 3.5e-58, Identities = 137/307 (44%), Positives = 192/307 (62%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +K++  D+GL K+  ++   IT+ +    KVD++  +N+EE+LI+ DVGV  T KI D I + +          +  ++ D+I +   ++   D   F   +  +  +++++GVNGVGKTT+I K+A  F K  KKV L A DTFRA AVEQL IWS+R+   IV     G DPASV F  +   K  + D+VI DT+GRLHNKINLM EL KI +V+ K    APHE LLVLD + GQ+   QAK F   T +  + +TK+DGT+KGG+V+ I D+F IPVKYIGLGE +EDL  F   +FV+ +  E
  S:    10 DKKETLDKGLSKTKESVFSKITKAIAGKSKVDDDVLDNLEEVLITSDVGVDTTLKIIDRIEKRVARDKYVTTQELTTLLRDEIASLLTENNTEDAEGFALPEGKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKKVYLGAADTFRAAAVEQLVIWSERVGVPIV-KQNMGSDPASVAFDTLSSAKANDADVVIIDTAGRLHNKINLMNELTKIKNVMKKVIPDAPHEILLVLDGSTGQNAFEQAKQFTAATEVNALAVTKLDGTAKGGVVIGISDHFRIPVKYIGLGEGMEDLQVFRKREFVNSLFGE 317
>gi|37527951|ref|NP_931296.1| cell division protein [Photorhabdus luminescens subsp. laumondii TTO1] >gi|36787387|emb|CAE16476.1| cell division protein [Photorhabdus luminescens subsp. laumondii TTO1] (424 aa)
Score = 582, Expect = 4.2e-58, Identities = 122/276 (44%), Positives = 183/276 (66%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D++ ++ +EE L+  DVGV  T KI  ++ E  + + ++D + +   + +++       T  N  LDI+     ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R    +V     G DPASVIF  ++  K ++ D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L+LDA+ GQ+ I QAK F E   +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F  + F++ +
  S:   148 KKIDDDLFDELEEQLLIADVGVDTTRKIISSLTEHASRKELKDAEALYAKLKEEMSGIL---TKVNKPLDIEGKTPYVILMVGVNGVGKTTTIGKLARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVV-AQHTGADPASVIFDAIQSAKAKSVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDENAPHEIMLILDASTGQNAISQAKLFHEAVGLTGISLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFKADDFIEAL 419
>gi|66047975|ref|YP_237816.1| cell division transporter substrate-binding protein FtsY [Pseudomonas syringae pv. syringae B728a] >gi|63258682|gb|AAY39778.1| Cell division transporter substrate-binding protein FtsY [Pseudomonas syringae pv. syringae B728a] (505 aa)
Score = 582, Expect = 4.3e-58, Identities = 122/303 (40%), Positives = 186/303 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  E IE  L++ DVGV AT+ I  ++ +++  + + D   +   +  ++             L IK + +  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ E FV  +  E
  S:   202 RLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKSLTQKVARKQLTDAQALYTSLQGELAAML---KPVEQPLVIKAEHKPFVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAE 501
>gi|78355607|ref|YP_387056.1| signal recognition particle-docking protein FtsY [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|78218012|gb|ABB37361.1| signal recognition particle-docking protein FtsY [Desulfovibrio desulfuricans G20] (506 aa)
Score = 582, Expect = 4.3e-58, Identities = 118/300 (39%), Positives = 182/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  EGL ++   +++ I  ++   K++DE F+E +EE+LI  DVG     ++   +R  +     +DP L KE++ +++     +D           +   ++L++GVNGVGKTT+IAK+A     + KKVL+ AGDTFRA A+EQL +W+ R+            DPA+V +  + K   E YD++  DT+GR+H K+NLM+EL+KI  V+ K    APH ++LV+DAT GQ+ + Q + F E   +  I+LTK+DGT+KGGIV+++   F IP+ Y+GLGEK+EDL  FD   F   +
  S:   209 KLSEGLTRTKEQITRRIDGLLSAHKQIDEAFWEELEEILIMADVGYEPAMELVGRLRARVRASGSDDPALFKELMREEL-----EDIFRTPRRIAAINPPEVVLMVGVNGVGKTTTIAKLAYRARLQGKKVLIAAGDTFRAAAIEQLKVWADRVGAGF-HSKGANADPAAVAYEAMDKAVKEGYDILFVDTAGRIHTKVNLMEELQKIRGVLGKKHPGAPHRSILVIDATTGQNALSQTRLFDESCKLDEIVLTKLDGTAKGGIVVAVAMQFGIPITYVGLGEKMEDLRPFDGRDFAQAL 502
>gi|170719541|ref|YP_001747229.1| signal recognition particle-docking protein FtsY [Pseudomonas putida W619] >gi|169757544|gb|ACA70860.1| signal recognition particle-docking protein FtsY [Pseudomonas putida W619] (514 aa)
Score = 582, Expect = 4.6e-58, Identities = 122/303 (40%), Positives = 191/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK-KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  + IE  L++ DVGV AT+ I   + +++  + + D D + + + +++             L I+ +++  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   FNIP+++IG+GE ++DL  F+ E FV  +  E
  S:   211 RLKQGLSKTSASIGEGMASLFLGKKVIDDDLLDEIETRLLTADVGVEATSTIVQNLTQKVARKQLADADALYKSLQEELAALL---RPVEQPLKIQAQNKPYVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNQIP-VIAQHTGADSASVIFDAVQAAKARGVDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDAEAPHEVLLVLDAGTGQNAISQAKYFNQSVELTGLALTKLDGTAKGGVIFALAKQFNIPIRFIGVGEGIDDLRTFEAEPFVKALFAE 510
>gi|160947508|ref|ZP_02094675.1| hypothetical protein PEPMIC_01442 [Peptostreptococcus micros ATCC 33270] >gi|158446642|gb|EDP23637.1| hypothetical protein PEPMIC_01442 [Peptostreptococcus micros ATCC 33270] (326 aa)
Score = 582, Expect = 4.8e-58, Identities = 132/301 (43%), Positives = 196/301 (65%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++  +GL  + + LS  I  ++    K+DEE +E +E +L+S D+G   T ++ D ++E +  + + +P LIK+ +++ +    +   + N   +I      I+L++GVNGVGKTTSI K+AN F  K K V+LVA DTFRA A EQL  W+ R    I+  ++EG DPASV++ G++  K +N D++ICDT+GRLHNK NLM EL KI  VI +    A  E  LVLDAT GQ+ I+QAK F++  NI  +ILTK+DGT+KGG+V +I+    IPVK IG+GE+++DL  ++ E FV+ I
  S:    26 ERLKKGLVNTRNNLSSKIDNLLSMSTKIDEELFEELEYILVSADIGANVTMELIDDLKEIVKKEKITEPSLIKDKLIE-LMNSKLASKELNHDFNIIDGIPTIILVVGVNGVGKTTSIGKLANKFKSKGKNVMLVAADTFRAAATEQLTEWANRSGVPII-SNEEGADPASVVYDGIQSAKSKNIDVLICDTAGRLHNKKNLMNELNKIARVIDREYPEANKEVTLVLDATTGQNAIVQAKEFRDTANIDSVILTKLDGTAKGGVVFTIQLEMEIPVKQIGIGEQIDDLQDYNDEDFVNAI 324
>gi|110637071|ref|YP_677278.1| signal recognition particle-docking protein FtsY [Cytophaga hutchinsonii ATCC 33406] >gi|110279752|gb|ABG57938.1| signal recognition particle-docking protein FtsY [Cytophaga hutchinsonii ATCC 33406] (320 aa)
Score = 581, Expect = 5.3e-58, Identities = 129/304 (42%), Positives = 198/304 (65%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTF-LDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           EK++  ++GL+K+ ++    +++ V    +VD+E  +N+EE+L++ DVG+  T KI   I++  +         +  I+ ++I    + DT  D+  F +        +++++GVNGVGKTT+I K+A+H+ K  KKV+L A DTFRA AVEQL +W +R+    V+      DPA+V F  VK+  D   D+VI DT+GRLH K+NLM EL KI  VI KF   APH+ +LVLD + GQ+ ++QA+ F + T +T + +TK+DGT+KGG+V+ I D F IPV+YIG+GEK+EDL  F+  +FVD +
  S:    10 EKKETLNKGLEKTKTSFFSKLSKAVLGKTQVDDEVLDNLEEVLVTSDVGIETTLKIIGRIQDRASKDKYVSTSELNTILKEEIAALLVGDTVPDSKEFEIPETGGLPYVIMVVGVNGVGKTTTIGKLASHYHKNGKKVVLGAADTFRAAAVEQLELWGKRVGVP-VISHGMNTDPAAVAFDAVKQAVDMKADVVIIDTAGRLHTKVNLMNELSKIKRVIQKFIPEAPHDVMLVLDGSTGQNAVIQAREFTKATEVTSLAITKLDGTAKGGVVIGISDQFQIPVRYIGVGEKMEDLQVFNKHEFVDSL 315
>gi|163766537|ref|ZP_02173561.1| signal recognition particle-docking protein FtsY [Anaeromyxobacter sp. K] (469 aa)
Score = 580, Expect = 6.6e-58, Identities = 121/301 (40%), Positives = 185/301 (61%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKI--FTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K    GL+K+       +  +    K VD+    ++EE+L + D+GV    ++ ++ RE++  + + DP+ +K  + + +               L + + R  +++++GVNG GKTT++ K+A        KVLL AGDTFRA A EQL +W++R+   +V   KEG DPA+V F  V++G  E  D+V+CDT+GRLH K+ LM+EL+K+  VI K    APHE LLVLDAT GQ+ I QA+ F E   +TGI LTK+DGT+KGG+++ I D   IPV+Y+G+GE++ DL  F   +FV+ +
  S:   166 KTLAAGLEKTRGGFMARLNALFAGGKVVDDAVLADLEEVLFTADIGVKTATRLLESAREKVRRKELSDPERLKASLREGMARILGLAGTGGAAAPLAVGEARPWVVMVVGVNGSGKTTTVGKLAAKLQGAGHKVLLGAGDTFRAAAGEQLEVWAERVSAPVV-RGKEGADPAAVCFEAVQRGAQEGVDVVLCDTAGRLHTKMPLMEELKKVQRVIGKAAAGAPHEVLLVLDATNGQNAIAQARQFHEALGVTGIALTKLDGTAKGGVIIGICDELRIPVRYVGVGERVADLKPFSPREFVEAL 467
>gi|150390510|ref|YP_001320559.1| signal recognition particle-docking protein FtsY [Alkaliphilus metalliredigens QYMF] >gi|149950372|gb|ABR48900.1| signal recognition particle-docking protein FtsY [Alkaliphilus metalliredigens QYMF] (423 aa)
Score = 580, Expect = 6.6e-58, Identities = 143/304 (47%), Positives = 203/304 (66%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           K+  EGL K+   ++  + E++K +KK+DE  +E +EE+LI+ D+GV  T +I D +R++I  + V +P+ +KE++ + +     +  D    ++       I+L++GVNGVGKTTSI K+A+ F +  KKVLL AGDTFRA A EQL IW+QR+  ++V   +EG DPA+VIF  ++  K    D++ICDT+GRLHNK NLM EL K+  V+ +    A  E LLVLDAT GQ+ I QAK FKE+ NITG+ILTK+DGT+KGG+V+ I     IPVK IG+GEK+EDL  F+   FV  +  E
  S:   122 KRLKEGLSKTKQGITGKVDELLKSYKKIDEALFEELEEILITSDIGVKTTMEIIDGLRDKIKEKKVSEPEQVKELLKEALIEILQRLPDAQVNIE---PGPAIVLVVGVNGVGKTTSIGKMAHRFKQDGKKVLLAAGDTFRAAASEQLEIWAQRVGVEVV-KHQEGSDPAAVIFDAIQAAKARKVDVLICDTAGRLHNKKNLMNELGKVFKVVDREYGEATKEVLLVLDATTGQNAIQQAKTFKEVANITGLILTKLDGTAKGGVVIGISQELTIPVKLIGVGEKMEDLQQFNATDFVKALFGE 421
>gi|108760294|ref|YP_633872.1| signal recognition particle-docking protein FtsY [Myxococcus xanthus DK 1622] >gi|108464174|gb|ABF89359.1| signal recognition particle-docking protein FtsY [Myxococcus xanthus DK 1622] (463 aa)
Score = 580, Expect = 8.0e-58, Identities = 120/276 (43%), Positives = 180/276 (65%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++VDE     +EE+L + D+GV   N + +  RE++    ++DP+ IK +I D++    I D      L+      ++++++GVNG GKTT+I K+A+    + KKV+L AGDTFRA A EQL++W++R +  +V    EG DP++VIF  VKK K+E  D++I DT+GRLH K  LM+EL+K+  V+ K    APHE LLVLD+T GQ+ I QAK F E   ++ I LTK+DGT+KGG+V+ I D   +PV ++G+GEK+ DL  F+  +FV  +
  S:   190 RQVDESVLAELEEILFTADIGVRTANHLVEVAREKLKRNELKDPERIKGLIRDEVAR--ICDLPVPRSLE-GGGPPHVIMVVGVNGAGKTTTIGKLASKLTSEGKKVVLAAGDTFRAAATEQLDVWAERAQAQLV-KGAEGGDPSAVIFEAVKKAKEEGADVIIADTAGRLHTKAPLMEELKKVKRVMDKALPGAPHEVLLVLDSTNGQNAIQQAKQFHEAVGVSAIALTKLDGTAKGGVVIGICDELKLPVVWVGVGEKVADLRRFEPREFVRAL 461
>gi|169824542|ref|YP_001692153.1| signal recognition particle protein [Finegoldia magna ATCC 29328] >gi|167831347|dbj|BAG08263.1| signal recognition particle protein [Finegoldia magna ATCC 29328] (378 aa)
Score = 580, Expect = 8.0e-58, Identities = 142/301 (47%), Positives = 198/301 (65%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K    L K+   +S  I +++  ++ VDEE +E IEE LIS D+GV  T KI   +R+++  +N++DP  IK ++ D +    I +   N   ++  D   I+L++GVNGVGKTT+I K+A  + K  KKVL+VA DTFRA A+EQL  WS R K DI+   KEG DPASV+F GV   K  N D++ICDT+GRLHNK NLM EL KI  VI K    A  E LL++D T GQ+ I+QAK F   T++TG I+TK+DGT+KGG++  ++    IPVK+IG+GE++ DL  F+ EKF++ I
  S:    80 EKLKNSLLKTRDNISNKIDQVLANYRTVDEELFEEIEETLISADIGVDTTLKIVGQLRDQVKLRNIQDPSKIKSVLADILKENIINEKIDN---NLNVDEKTIILVVGVNGVGKTTTIGKLAMKYKKDGKKVLMVAADTFRAAAIEQLTEWSNRAKVDII-SHKEGADPASVVFDGVNAMKSRNTDILICDTAGRLHNKKNLMNELNKIKRVIEKEYPEAKKEILLIVDGTTGQNAIIQAKEFMNATDLTGAIITKLDGTAKGGMIFPLEMELGIPVKFIGIGEQVNDLVKFEPEKFIEAI 376
>gi|53718154|ref|YP_107140.1| putative cell division protein [Burkholderia pseudomallei K96243] >gi|126441269|ref|YP_001057615.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 668] >gi|194504573|ref|YP_002034145.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1655] >gi|52208568|emb|CAH34504.1| putative cell division protein [Burkholderia pseudomallei K96243] >gi|126220762|gb|ABN84268.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 668] >gi|184212410|gb|EDU09453.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1655] (439 aa)
Score = 579, Expect = 9.2e-58, Identities = 122/300 (40%), Positives = 179/300 (59%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:   148 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 437
>gi|167771629|ref|ZP_02443682.1| hypothetical protein ANACOL_03001 [Anaerotruncus colihominis DSM 17241] >gi|167666269|gb|EDS10399.1| hypothetical protein ANACOL_03001 [Anaerotruncus colihominis DSM 17241] (309 aa)
Score = 579, Expect = 1.0e-57, Identities = 134/300 (44%), Positives = 191/300 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDP----DLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  EGLKK+  ++++ +  IV  F K+DEE +E +EE LI  DVGV  + +I   +R  +  + V D     +LIKEII D +         T         + +I+L++GVNGVGKTT+I K+A     + K+VLL A DTFRA A++QL +W+ R   ++V    EG DPA+V+F  +  G+    D++ICDT+GRLHNK NLM EL KI  VI +       E LLVLDAT GQ+ + QA+ FKE   ITGIILTK+DGT++GG+V+ I+    +P+KYIG+GE+++DL  F+   FVD +
  S:     6 RLAEGLKKTRESMARKVDAIVNSFTKIDEELFEELEETLIMSDVGVATSAEICRRLRAAVKQRGVTDAAEVRELIKEIIADMLAGGEALSIST---------KPSIVLVIGVNGVGKTTTIGKLAASLKAQGKQVLLGAADTFRAAAIDQLQVWADRAGVEMV-RQSEGADPAAVVFDAITAGRARGVDVIICDTAGRLHNKKNLMDELSKISRVIQREAPGCDVEVLLVLDATTGQNALNQARQFKEAAGITGIILTKLDGTARGGVVIGIRQELEVPIKYIGVGEQVDDLRPFNAADFVDAL 299
>gi|28867657|ref|NP_790276.1| signal recognition particle-docking protein FtsY [Pseudomonas syringae pv. tomato str. DC3000] >gi|28850892|gb|AAO53971.1| signal recognition particle-docking protein FtsY [Pseudomonas syringae pv. tomato str. DC3000] (513 aa)
Score = 578, Expect = 1.2e-57, Identities = 122/303 (40%), Positives = 186/303 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  E IE  L++ DVGV AT+ I  ++ +++  + + D   +   +  ++             L IK + +  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ E FV  +  E
  S:   210 RLKQGLSKTSASIGEGMASLFLGKKAIDDDLLEEIETRLLTADVGVEATSVIIKSLTQKVARKQLTDAQALYTSLQGELAAML---KPVEQPLVIKAEHKPFVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNHIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQAKQFNQTVTLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAE 509
>gi|150025489|ref|YP_001296315.1| cell division protein FtsY [Flavobacterium psychrophilum JIP02/86] >gi|149772030|emb|CAL43506.1| Cell division protein FtsY [Flavobacterium psychrophilum JIP02/86] (317 aa)
Score = 578, Expect = 1.2e-57, Identities = 134/306 (43%), Positives = 194/306 (63%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDT---NTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+KSS++    +T+ +    KVD++  +N+EE+L+S DVGV  T KI   I   ++       D + +I+ ++I    + +T+T     F      +  +++++GVNGVGKTT+I K+AN F K    V+L AGDTFRA A++QL IW+ R+   IV   + G DPASV F  ++    +N D+VI DT+GRLHNKI LM EL KI  V+ K    APH+ +LVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE + DL  F+  +FVD   K
  S:    11 EKKENLDKGLEKSSNSFLSKLTKAIAGKSKVDDDVLDNLEEILVSSDVGVNTTLKIIQRIEARVSNNKYLGTDELNKILREEI-AGLLSETNTGEATKFEIPAHKKPYVIMVVGVNGVGKTTTIGKLANQFKKSGYSVVLGAGDTFRAAAIDQLQIWADRVGVPIV-RQQMGSDPASVAFDTLQSAVAQNADVVIIDTAGRLHNKIGLMNELTKIKRVMEKVIPEAPHDVMLVLDGSTGQNAFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGINDLQVFNKYEFVDSFFK 317
>gi|158320494|ref|YP_001513001.1| signal recognition particle-docking protein FtsY [Alkaliphilus oremlandii OhILAs] >gi|158140693|gb|ABW19005.1| signal recognition particle-docking protein FtsY [Alkaliphilus oremlandii OhILAs] (431 aa)
Score = 578, Expect = 1.4e-57, Identities = 138/303 (45%), Positives = 205/303 (67%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  EGL K+ S ++  +  ++K +KK+DE+ +E +EE+LI+ D+GV  T +I + ++E +  + + DP  +K++++DKI     +  D+   ++       I+L++GVNGVGKTTSI K+A  F  + KKVLL AGDTFRA A++QL IW  R+  D++   +E  DPA+VI+  ++  K  N D++ICDT+GRLHNK NLM EL KI  V+ +  + A  E LLVLDAT GQ+ + QAK FKE+ NI+G+ILTK+DGT+KGG+++ I    N+PVK IG+GEK+EDL  F+ + FV  I  E
  S:   132 RLKEGLLKTKSGITDRVDHLLKSYKKIDEDLFEELEEILITSDMGVQTTMEIVEDLKERVRKEKISDPLEVKQLLMDKITEILEELPDSKINIE---PSPAIILVVGVNGVGKTTSIGKMAYRFKSEGKKVLLAAGDTFRAAAIDQLKIWGDRVGVDVIRHQEE-SDPAAVIYDAIQAAKARNTDVLICDTAGRLHNKKNLMNELGKIFKVVDREYENASKEVLLVLDATTGQNAVQQAKTFKEVANISGLILTKLDGTAKGGVIVGISRELNVPVKLIGVGEKMEDLQEFNPQSFVKAIFGE 430
>gi|85710834|ref|ZP_01041895.1| Signal recognition particle GTPase [Idiomarina baltica OS145] >gi|85695238|gb|EAQ33175.1| Signal recognition particle GTPase [Idiomarina baltica OS145] (426 aa)
Score = 578, Expect = 1.4e-57, Identities = 127/308 (41%), Positives = 198/308 (64%)
  Q:    41 EVLPEKQK----KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E  P K+K    +  EGLK++S ++   +  + K  KK+D++ +E +E  L+  D+GV  T KI D + ++   + ++D + + E++ +++    ++  D    +D  K    ++L+ GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL IW +R +   V+  + G D ASV+F  ++  K    D++I DT+GRL NK NLM+EL+KI  V+ K D  APHE +L LDA  GQ+ I QAK F E   ++GI++TK+DGT+KGG++ ++ D F IP++YIG+GE+L+DL  F    F+  +
  S:   111 EAAPAKKKGLWARLTEGLKRTSGSIGSGLFGVFKG-KKIDDDLFEELETQLLMADLGVKTTTKIIDNLTQQADRKQLKDAEALYELLQEQM-EALLEPVDKPLAIDTSKT-PYVILVTGVNGVGKTTTIGKLAKQFKREGKSVMLAAGDTFRAAAVEQLQIWGERNEIP-VIAQQTGSDSASVLFDAMQAAKARGIDVLIADTAGRLQNKSNLMEELKKIVRVMKKQDPEAPHEVMLTLDAGTGQNAISQAKLFTEAVGVSGIVMTKLDGTAKGGVIFAVADEFKIPIRYIGVGEQLDDLRPFVARDFIQAL 418
>gi|85859850|ref|YP_462052.1| cell division protein ftsY [Syntrophus aciditrophicus SB] >gi|85722941|gb|ABC77884.1| cell division protein ftsY [Syntrophus aciditrophicus SB] (330 aa)
Score = 577, Expect = 1.7e-57, Identities = 122/312 (39%), Positives = 206/312 (66%)
  Q:    40 LEVLPEKQKKFDE---GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           + +  +KQ  FD+   GL K+   L   + +I+   K++D+E ++ +EE LI+ DVG   T+++ + + + +  + ++ P+ +KE++   + T   ++      L I + +   +L++GVNG GKTT+I K+AN F ++ + V +VA DTFRA A+EQL IWSQR+   ++   K+  DP++V+F  +   K    +++I DT+GRLH ++NLM+E++K+  ++ +    APHE LLVLDAT GQ+ + QAK F +   +TGI+LTK+DGTSKGG++L I   +NIP++YIG+GE L+DL  F+ E+FV+ + ++
  S:    17 MSIFQKKQGFFDKLKRGLAKTRDLLLTDVDDIILGKKEIDQELFDELEEALIAADVGPAFTSELIEKMTDSVKRKELDSPERLKEVLRSTMKTLLKKNEAP---LVIPEKQIFTILVVGVNGTGKTTTIGKLANQFKEEGRTVAMVAADTFRAAAIEQLEIWSQRVGVPLI-KQKQDSDPSAVVFDAITAAKSGKAEVLIIDTAGRLHTQVNLMEEMKKMKRIMGRELPGAPHEVLLVLDATTGQNAVNQAKMFTDAVGVTGIVLTKLDGTSKGGVILRIAQEYNIPIRYIGIGEGLDDLREFNSEEFVEALFEQ 327
>gi|189426542|ref|YP_001953719.1| signal recognition particle-docking protein FtsY [Geobacter lovleyi SZ] >gi|189422801|gb|ACD97199.1| signal recognition particle-docking protein FtsY [Geobacter lovleyi SZ] (342 aa)
Score = 577, Expect = 1.8e-57, Identities = 121/301 (40%), Positives = 190/301 (63%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++   GLKK++  L   I  +V   K++D +  E +EE+LI+ D+GV  T ++  ++ + ++   ++D   ++  + D++    +     +T L ++      +L++GVNGVGKTT+I K+A  +  + +KVLL AGDTFRA A EQL IW  R     V+  +EG DP++V F   K       +++I DT+GRLH K+NLM+E++KIH VI +    APHE LLVLD   GQ+ + QA+ FKE   +TGI LTK+DGT+KGGIV+++   F +PV++IG+GE ++DL  F+  +FVD +
  S:    42 ERLKAGLKKTTDGLVGRIDALVLGKKEIDADTLEELEEILITSDIGVKTTVELIRSLEQRLSRNELKDGAALRGALKDELLARLLAH---HTPLRLEGTAPFTILVVGVNGVGKTTTIGKLAAKYAAEGRKVLLAAGDTFRAAAAEQLEIWGDRAGVS-VIRHQEGADPSAVAFDACKAAVSRGTEILIIDTAGRLHTKVNLMEEMKKIHRVIGREIPGAPHETLLVLDGATGQNALSQARLFKESAGVTGIALTKLDGTAKGGIVVAVSHEFGLPVRFIGVGEGIDDLREFEPNEFVDAL 338
>gi|109645696|ref|ZP_01369616.1| signal recognition particle-docking protein FtsY [Desulfitobacterium hafniense DCB-2] >gi|109643645|gb|EAT53198.1| signal recognition particle-docking protein FtsY [Desulfitobacterium hafniense DCB-2] (320 aa)
Score = 577, Expect = 1.8e-57, Identities = 132/300 (44%), Positives = 201/300 (67%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K   GL K+       + EI+   +K+DEE YE +EE+LI  DVGV  + ++ + +R+E+  + +++ + +K +++ ++    + + ++  F    +   +I L++GVNGVGKTT+I K+A++F ++ KKV+L AGDTFRA A++QL +W QR   + V+  KEG DPA+V +  ++  K    DLVI DT+GRLHNK+NLM+EL K+  VI +    APHE LLVLDAT GQ+ + QAK F+E+  +TGI+LTK+DGT+KGG+VL I+   NIPVK+IG+GE +EDL  F  + F   +
  S:    14 KLKAGLTKTRDQFVTKVEEILTGRRKIDEELYEELEEVLIRSDVGVNTSFELVEGLRKEVKKRKLQEAEELK-VVLQELIAELLGEEESMNF---AEHGPSIFLVVGVNGVGKTTTIGKLAHYFQEEGKKVILAAGDTFRAAAIDQLEVWGQRAGVE-VIKQKEGADPAAVAYDALQAAKSRGADLVIMDTAGRLHNKVNLMEELRKVKRVIEREIPGAPHEVLLVLDATTGQNALQQAKLFQEVAGVTGIVLTKLDGTAKGGVVLGIQGEINIPVKWIGVGEGMEDLRPFIPQDFASAL 308
>gi|167765551|ref|ZP_02437615.1| hypothetical protein CLOSS21_00045 [Clostridium sp. SS2/1] >gi|167712736|gb|EDS23315.1| hypothetical protein CLOSS21_00045 [Clostridium sp. SS2/1] (318 aa)
Score = 577, Expect = 1.9e-57, Identities = 132/301 (43%), Positives = 198/301 (65%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K+  +GL K+   ++ +   I   F  +DE+FYE +EE+LI  D+G+  T  I + +++++    +++P+  +++++D I      +     F+D K    +++L++GVNGVGKTTS+ K+A     + KKVLL A DTFRAGA+EQL  WS R   DI+    EG DPA+V++  V   K  + D+++CDT+GRLHNK NLM EL KI+ +I K    A  E L+VLD T GQ+ + QAK FKE T+I+GIILTK+DGT+KGGI ++I+    IPVKYIG+GE+++DL  FD + FV+ +
  S:    16 KRLAQGLSKTRDNIASSFDSIFSGFSGIDEDFYEELEEILIMSDMGIDTTMNIIEDLKKKVKENKIKEPEECRQLLIDSIKDQMRLEDSAYDFIDKK----SVVLVIGVNGVGKTTSVGKLAASLKGQGKKVLLAAADTFRAGAIEQLKEWSNRAGVDII-SQAEGADPAAVVYDAVAAAKARDVDVLLCDTAGRLHNKKNLMNELSKINRIIQKEYSEAYLETLIVLDGTTGQNAMAQAKQFKEATDISGIILTKLDGTAKGGIAIAIQSELGIPVKYIGIGEQVDDLQRFDPDMFVNAL 311
>gi|83643465|ref|YP_431900.1| signal recognition particle-docking protein FtsY [Hahella chejuensis KCTC 2396] >gi|83631508|gb|ABC27475.1| signal recognition particle-docking protein FtsY [Hahella chejuensis KCTC 2396] (376 aa)
Score = 577, Expect = 1.9e-57, Identities = 134/312 (42%), Positives = 194/312 (62%)
  Q:    37 AEILEVLPEKQ-----KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           A + EV P++       +   GL K+    S+ +  +    K +DEE  E IE LL+S DVG+ AT +IT AI E++    ++D   + + + +++           + L I+     ++L++GVNGVGKTT+I K+AN F ++ + V+L AGDTFRA AVEQL +W +R     V+    G D ASVIF  V+  K    D+VI DT+GRL NK NLM ELEK+  VI K D  APHE LLVLDA  GQ+ + QA+ F++   +TGI +TK+DGT+KGGI+ +I     +P++YIG+GE ++DL  FD  +FVD +
  S:    61 APVKEVAPQEPVGGWLTRVRSGLSKTRGQFSQNLMALFAGSKAIDEELLEEIETLLLSADVGIEATTQITQAITEKLDRNQLKDSSALYDALKEELRGLL---EPCCSPLQIENKTPYVILVVGVNGVGKTTTIGKLANKFQQEGRSVVLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIFDAVQAAKSRGVDVVIADTAGRLQNKENLMAELEKVVRVIKKHDPDAPHEVLLVLDAGTGQNALSQAQLFRQAVGVTGIAITKLDGTAKGGILFAIAKQHGLPIRYIGVGEGIDDLRPFDASEFVDAL 373
>gi|188585992|ref|YP_001917537.1| signal recognition particle-docking protein FtsY [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350679|gb|ACB84949.1| signal recognition particle-docking protein FtsY [Natranaerobius thermophilus JW/NM-WN-LF] (310 aa)
Score = 576, Expect = 2.0e-57, Identities = 134/300 (44%), Positives = 205/300 (68%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +GL K+       I +++   KK+DEEF+E +E++LIS DVGV  T KI + +R+ I  + ++D + + +++ D++    +Q   +   L  ++    + L++GVNGVGKTTSI K+A    ++ KKV+L AGDTFRA A++QL IW  R+  D V+  +EG DPA+V++  ++ G+  N D +ICDT+GRLHNK NLM+EL+K+  +I +   T PH+  +VLDAT GQ+ + QAK F E+T ++GIILTK+DGT+KGGIVL++ +   IP+KYIG+GE +EDL  FD ++F+D +
  S:     6 KIKDGLTKTRRGFVSQIEKLLTG-KKIDEEFFEELEDILISADVGVDTTLKIVENLRQRIKEEKIKDSETVNQVLKDEMKDMLMQKDKS---LTPQEGTPKVSLVVGVNGVGKTTSIGKLAYKHKQEGKKVVLAAGDTFRAAAIDQLQIWGDRVGVD-VIKHQEGADPAAVVYDAIQAGRARNADHLICDTAGRLHNKKNLMEELKKVSRIIEREIGTPPHDVYMVLDATTGQNALSQAKLFSEVTPVSGIILTKLDGTAKGGIVLALANEMEIPIKYIGVGEGMEDLQDFDPDQFIDAL 300
>gi|167630242|ref|YP_001680741.1| signal recognition particle-docking protein ftsy [Heliobacterium modesticaldum Ice1] >gi|167592982|gb|ABZ84730.1| signal recognition particle-docking protein ftsy [Heliobacterium modesticaldum Ice1] (304 aa)
Score = 576, Expect = 2.2e-57, Identities = 126/296 (42%), Positives = 192/296 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           +  EGL ++   L + +  +V    K+DEE +E +EE LIS DVG   +  + + +R+ +  Q + DP  IK+++ +++     +      F      +  ++LI+GVNGVGKTT+IAK+A+ + ++ +KVLL AGDTFRA A++QL IW QR+  + V+  +EG DP++V F  V+       D++I DT+GRLHNK +LM EL KI+ V+ +    APHE LLVLDAT GQ+ + QA+ F E   +TG++LTK+DGT+KGG++L+I      PVK+IG+GEK++DL  FD  +F
  S:     8 RLKEGLTRTRQNLVEKVEALVTGRPKIDEELFEELEEALISADVGADTSLDLVERLRQTVKAQKIGDPARIKDLLQEEVARILGEQAQPVAF----DHQPTVVLIVGVNGVGKTTTIAKLAHRWKQEGRKVLLAAGDTFRAAAIDQLEIWGQRVGVE-VIRHQEGSDPSAVAFDAVQAAVSRGVDVLIIDTAGRLHNKSHLMNELSKINRVLDRALPGAPHETLLVLDATTGQNAVSQARLFSEAVGLTGLVLTKLDGTAKGGVILAIAAEMQAPVKFIGIGEKMDDLRDFDPPEF 298
>gi|167892738|ref|ZP_02480140.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 7894] (354 aa)
Score = 576, Expect = 2.3e-57, Identities = 123/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    63 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 352
>gi|161360842|ref|ZP_02106702.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 1106b] (384 aa)
Score = 576, Expect = 2.3e-57, Identities = 123/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    93 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 382
>gi|116623313|ref|YP_825469.1| signal recognition particle-docking protein FtsY [Solibacter usitatus Ellin6076] >gi|116226475|gb|ABJ85184.1| signal recognition particle-docking protein FtsY [Solibacter usitatus Ellin6076] (316 aa)
Score = 576, Expect = 2.4e-57, Identities = 125/309 (40%), Positives = 192/309 (62%)
  Q:    40 LEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +E  P   +K   G++K+ + L  A+ + ++  K++D +  + +E  LIS D+GV  T++I ++IR+ +    + D   +K +I +++             +    +   ++L++GVNG GKTT+I K+A+ F  + + VLL A DTFRA A+EQL IW +R     V+  K G DP++V+F  V   K    D VI DT+GRL  K +LM ELEK++    K    APHE LLVLDAT GQ+G+ QA+ F   + +TGI+LTK+DGT+KGGIV++I    N+P++YIG+GEK+EDL  FD EKF++ +
  S:     9 VEQEPSLLEKLKSGVQKTRAGLVTALEDALQGKKEIDADLLDELEFTLISADIGVATTSEILESIRQRVERHQLADAGELKGLIRERLLEILQASERAPARV---AEPPAVVLVVGVNGAGKTTTIGKLAHRFKNEQRSVLLCAADTFRAAAIEQLEIWGERTGTQ-VIRQKPGSDPSAVLFDAVTAAKSRKVDYVIVDTAGRLQTKEHLMLELEKMNRTARKVIPDAPHEVLLVLDATTGQNGLEQARKFTGSSGVTGIVLTKLDGTAKGGIVVAIARELNLPIRYIGVGEKIEDLLPFDGEKFIESL 313
>gi|89895351|ref|YP_518838.1| hypothetical protein DSY2605 [Desulfitobacterium hafniense Y51] >gi|89334799|dbj|BAE84394.1| hypothetical protein [Desulfitobacterium hafniense Y51] (322 aa)
Score = 575, Expect = 2.4e-57, Identities = 133/300 (44%), Positives = 199/300 (66%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K   GL K+       + EI+   +K+DEE YE +EE+LI  DVGV  +  + + +R+E+  + +++ + +K I++ ++    + + ++  F +      +I L++GVNGVGKTT+I K+A++F  + KKV+L AGDTFRA A++QL +W QR   + V+  KEG DPA+V +  ++  K    DLVI DT+GRLHNK+NLM+EL K+  VI +    APHE LLVLDAT GQ+ + QAK F+E+  +TGI+LTK+DGT+KGG+VL I+   NIPVK+IG+GE +EDL  F  + F   +
  S:    16 KLKNGLTKTRDQFVTKVEEILTGRRKIDEELYEELEEVLIRSDVGVNTSFGLVEGLRKEVKKRKLQEAEELK-IVLQELIAELLGEEESMNFAE---HGPSIFLVVGVNGVGKTTTIGKLAHYFQGEGKKVILAAGDTFRAAAIDQLEVWGQRAGVE-VIKQKEGADPAAVAYDALQAAKSRGADLVIMDTAGRLHNKVNLMEELRKVKRVIEREIPGAPHEVLLVLDATTGQNALQQAKLFQEVAGVTGIVLTKLDGTAKGGVVLGIQGEINIPVKWIGVGEGMEDLRPFIPQDFASAL 310
>gi|83857832|ref|ZP_00951360.1| recognition particle-docking protein FtsY [Croceibacter atlanticus HTCC2559] >gi|83849199|gb|EAP87068.1| recognition particle-docking protein FtsY [Croceibacter atlanticus HTCC2559] (317 aa)
Score = 575, Expect = 2.4e-57, Identities = 133/306 (43%), Positives = 196/306 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDI---KKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+KS S+    +++ V    KVD++  + +EE+L++ DVGV  T KI   I E +        D +  I+ ++I    + +T+T++ L     +  +  +++++GVNGVGKTT+I K+A+ F  + K V+L A DTFRA A++QL +W+ R    IV   + G DPASV F  V++   +N D+V+ DT+GRLHNK+NLM EL K+  V+ K  D  P E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL AFD  +FVD   K
  S:    11 EKKETLDKGLEKSKSSFFGKLSKAVAGKSKVDDDVLDELEEILVASDVGVTTTIKIIKRIEERVAKDKYLGTDELNLILREEI-AGLLSETETDSKLGFHIPEGKKPYVIMVVGVNGVGKTTTIGKLAHQFKSQGKNVVLGAADTFRAAAIDQLQVWADRTGVPIV-KQQMGSDPASVAFETVQEAVKQNADVVLVDTAGRLHNKVNLMNELSKVKRVMQKVADNVPDEVLLVLDGSTGQNAFEQAKQFTAATEVTSLAITKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIEDLQAFDKFEFVDSFFK 317
>gi|146284304|ref|YP_001174457.1| signal recognition particle receptor FtsY [Pseudomonas stutzeri A1501] >gi|145572509|gb|ABP81615.1| signal recognition particle receptor FtsY [Pseudomonas stutzeri A1501] (477 aa)
Score = 575, Expect = 2.5e-57, Identities = 120/312 (38%), Positives = 190/312 (60%)
  Q:    37 AEILEVLPEKQKKFD------EGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           A ++   PE   K        +GL K+S+++ + +  +    K +D++  + +E  L++ DVGV AT  I   +   ++ + + D   +   + +++    ++  +    +D  K R  ++L++GVNGVGKTT+I K+A       KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  V+ K D++APHE LLVLDA  GQ+ I Q + F +   +TG+ LTK+DGT+KGG++ ++   F  P++YIG+GE ++DL  F+ + FV  +
  S:   156 APVVAATPEAPAKLGFFARLRQGLSKTSASIGEGMASLFLGKKAIDDDLLDELETRLLTADVGVEATTAIMQNLTRRVSRKELADSGALYTALQEELVGL-LKPVEQPLAIDASK-RPYVILVVGVNGVGKTTTIGKLAKKLQLDGKKVMLAAGDTFRAAAVEQLQVWGERNGIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVMGKLDESAPHEVLLVLDAGTGQNAINQTRQFNQAVELTGLALTKLDGTAKGGVIFALAKQFGTPIRYIGVGEGIDDLRTFEADAFVKAL 470
>gi|194558155|ref|YP_002093181.1| Signal recognition particle GTPase [Burkholderia cenocepacia PC184] >gi|124871946|gb|EAY63662.1| Signal recognition particle GTPase [Burkholderia cenocepacia PC184] (413 aa)
Score = 575, Expect = 2.6e-57, Identities = 129/311 (41%), Positives = 190/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  + DA+RE++    + DP  +K+ + D +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:   101 ETVEIVPPPLQ--DASAKKSWLARLKTGLAKTGSSITGVFVNTKIDEDLYEELETALLMSDAGVDATEYLLDALREKVRAGRLTDPQQVKDALHDLLVELL---TPLEKSLMLGRAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVIAKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 411
>gi|77919948|ref|YP_357763.1| cell division membrane protein [Pelobacter carbinolicus DSM 2380] >gi|77546031|gb|ABA89593.1| signal recognition particle-docking protein FtsY [Pelobacter carbinolicus DSM 2380] (472 aa)
Score = 575, Expect = 3.0e-57, Identities = 117/304 (38%), Positives = 202/304 (66%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           ++   GL K+ ++L   I  +++  + VDEE  E +EE+LI+ D+G+  T ++  ++   +    + DPD+++E +  +I    +Q++     LD ++    +++++GVNGVGKTT+I K+A+ ++++ KKVL+ AGDTFRA A EQL +W QR   + V+    G DPA+V F  +K  +    D+++ DT+GRLH K+NLM+EL+KI  V+ +    APHE LLV+DAT GQ+ ++QA+ F+E  +++G+ LTK+DGT++GG++++I     +P+ Y+G+GE +EDL  FD + FV+ + ++
  S:   171 QRMRTGLAKTQASLVGRIDALLRGCQGVDEELLEELEEILITADLGMKTTQQLIQSLEMRLDKGQLNDPDVLREALKGEIRDRLMQESAP---LDPQRATPFVIMVVGVNGVGKTTTIGKLAHQYVQQGKKVLVGAGDTFRAAAAEQLEVWGQRAGVE-VIRQAAGSDPAAVAFDAIKAAQARKADVLLLDTAGRLHTKVNLMEELKKIRRVLDREMPGAPHETLLVVDATTGQNALVQARLFQEAVSVSGLALTKLDGTARGGMLVAIGGELGLPIHYVGIGEGIEDLRPFDPDLFVEALFRQ 470
>gi|86132661|ref|ZP_01051254.1| putative recognition particle-docking protein [Cellulophaga sp. MED134] >gi|85816903|gb|EAQ38088.1| putative recognition particle-docking protein [Dokdonia donghaensis MED134] (317 aa)
Score = 574, Expect = 3.2e-57, Identities = 129/306 (42%), Positives = 200/306 (65%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK---KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+K+ ++    +++ V    KVD++  +N+EE+L++ DVGV  T K+   I E +        D +  I+ ++I    + +T+T    + +   +++ ++++++GVNGVGKTT+I K+A  F K+ KKV+L A DTFRA A++QL +W+ R+   IV   + G DPASV F  ++ G  ++ D++I DT+GRLHNK+NLM EL K+  V+ K    APH+ LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL  F+  +FVD   K
  S:    11 EKKETLDKGLEKTKTSFFDKMSKAVAGKSKVDDDVLDNLEEVLVTSDVGVKTTLKVITRIEERVAKDKYVGTDELNRILREEI-AGLLSETNTGNATEFEIPSQNKPHVIMVVGVNGVGKTTTIGKLAYQFKKQGKKVVLGAADTFRAAAIDQLQVWADRVDVPIV-KQQMGSDPASVAFDALESGVKQDADVIIIDTAGRLHNKVNLMNELTKVKRVMQKVVGDAPHDVLLVLDGSTGQNAFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIEDLQVFNKVEFVDSFFK 317
>gi|67155482|ref|ZP_00417110.1| Cell division transporter substrate-binding protein FtsY [Azotobacter vinelandii AvOP] >gi|67087283|gb|EAM06750.1| Cell division transporter substrate-binding protein FtsY [Azotobacter vinelandii AvOP] (451 aa)
Score = 574, Expect = 3.5e-57, Identities = 122/303 (40%), Positives = 189/303 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+ STL + +  +    K +D+E  E +E  L+  DVGV AT  I  ++ + +  + + D + +   + +++    ++  +    L+  + R  ++L++GVNGVGKTT+I K+A    ++ +KV+L AGDTFRA AVEQL IW +R +   V+    G D ASVIF  ++  K    D++I DT+GRLH K NLM+EL+K+  V+ K D+ APHE LLVLDA  GQ+ I Q K F +   ITG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F  E+FV  +  E
  S:   148 RLRQGLAKTGSTLGEGMASLFLGEKAIDDELLEELETRLLLADVGVEATTAIIQSLTQRVARKELADSEALYRALQEEL-AALLRPVEQPLVLE-SEQRPYVILVVGVNGVGKTTTIGKLAARLQQEGRKVMLAAGDTFRAAAVEQLQIWGERNRIP-VIAQHTGADSASVIFDALQAAKARGMDVLIADTAGRLHTKDNLMEELKKVRRVLGKLDEAAPHEVLLVLDAGTGQNAINQTKQFNQAVEITGLALTKLDGTAKGGVIFALARQFGLPIRYIGVGEGVDDLRDFAAEEFVRALFAE 447
>gi|167901234|ref|ZP_02488439.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei NCTC 13177] (339 aa)
Score = 574, Expect = 3.7e-57, Identities = 123/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    48 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 337
>gi|91215248|ref|ZP_01252220.1| signal recognition particle-docking protein FtsY [Psychroflexus torquis ATCC 700755] >gi|91186853|gb|EAS73224.1| signal recognition particle-docking protein FtsY [Psychroflexus torquis ATCC 700755] (319 aa)
Score = 574, Expect = 4.1e-57, Identities = 137/302 (45%), Positives = 190/302 (62%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKI--FTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVD 346
           EK+ K DEGLKKS S     +++ V    KVDE   +++EE+L+S DVG+  T KI + I   +        D +  I+ ++I       ++ +  +    +  +  +++++GVNGVGKTT+I K+A H+  K KKV+L AGDTFRA AVEQL IW+ R+   IV   K G DPASV F  V+    +N D+VI DT+GRLHNK+NLM EL KI  V+ K     P E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE ++DL  F+  +FVD
  S:    11 EKKDKLDEGLKKSKSDFFGKLSKAVAGKSKVDESVLDDLEEILVSSDVGITTTIKIINRIEARVAKNKYLGTDELNLILREEIAGLLSESENGELESLELPESKKPYVIMVVGVNGVGKTTTIGKLAKHYKLKGKKVVLGAGDTFRAAAVEQLQIWADRVGVPIV-KQKMGSDPASVAFDTVQSAIKQNADIVILDTAGRLHNKVNLMNELIKIKRVMQKVIPNIPDEVLLVLDGSTGQNAFEQAKQFTAATQVTALAITKLDGTAKGGVVIGISDQFKIPVKYIGVGEGIDDLQIFNKYEFVD 313
>gi|167844229|ref|ZP_02469737.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei B7210] (345 aa)
Score = 573, Expect = 4.2e-57, Identities = 123/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    54 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 343
>gi|192360531|ref|YP_001983953.1| signal recognition particle receptor FtsY [Cellvibrio japonicus Ueda107] >gi|190686696|gb|ACE84374.1| signal recognition particle receptor FtsY [Cellvibrio japonicus Ueda107] (374 aa)
Score = 573, Expect = 4.5e-57, Identities = 117/300 (39%), Positives = 186/300 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL ++SS  ++ + ++    K +DEE +E +E  L+  DVG+ AT++I D +   +  + + D D +   + +++    ++  +    +    ++  ++L++GVNGVGKTT+I K+A       +KV+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  +   +    D+VI DT+GRLHNK +LM EL K+  V+ K D +APHE LLVLDA  GQ+ + QA+ F++   +TGI LTK+DGT+KGG++ ++   F +PV++IG+GE ++DL  F  E F++ +
  S:    72 RIKRGLSRTSSHFAEGLGKLFLGRKTIDEELFEELETQLLIADVGMEATSEIIDNLTSRVARKQLADSDALFAALREQL-AELLRPVEQPLVIP-AANKPYVILVVGVNGVGKTTTIGKLAKRLQNDGRKVMLAAGDTFRAAAVEQLQVWGQRNNVP-VIAQHSGADSASVIFDALSAAQSRGIDVVIADTAGRLHNKNHLMDELAKVKRVMAKLDVSAPHEVLLVLDAGTGQNALNQAEQFRDAAGVTGIALTKLDGTAKGGVIFALSKKFGLPVRFIGVGEGIDDLQPFAAEPFINAL 368
>gi|149925749|ref|ZP_01914013.1| signal recognition particle-docking protein FtsY(cell division protein) [Limnobacter sp. MED105] >gi|149825866|gb|EDM85074.1| signal recognition particle-docking protein FtsY(cell division protein) [Limnobacter sp. MED105] (313 aa)
Score = 573, Expect = 4.6e-57, Identities = 119/300 (39%), Positives = 186/300 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+ S L+   T      +KVDE F+E +EE L+  D G+ AT  +   +R+ +  + +  P+ ++ ++ D +F          T + + + R  I++++GVNG GKTTSI K+ANH+ +    VLL AGDTFRA A EQL++W+QR   D++    EG DP +V F  V+ G   N  +VICDT+GRL  +++LM+EL+KI  V+ K    APHE +LV+DAT GQ+ + Q KAF +   +T +++TK+DGT+KGGI+ ++  +  +PV +IG+GEK+ DL  F   +F + +
  S:    13 RLKSGLTKTRSGLTSMFTG-----EKVDEAFFEEMEERLLLADCGLPATELLMQKVRDTVYQKGLTRPEDVRLVLRDAVFDLL---RPLETSMGVDRARPLIMMVVGVNGAGKTTSIGKLANHYAEIGYSVLLAAGDTFRAAAREQLDVWAQRSNVDVI--SAEGSDPGAVAFDSVQAGISRNKHIVICDTAGRLPTQLHLMEELKKIKKVLGKAKMDAPHEIVLVVDATNGQNALQQIKAFNDALTLTALVVTKLDGTAKGGILAAMSMSTRVPVAFIGVGEKMGDLRPFSPREFANAL 302
>gi|154483579|ref|ZP_02026027.1| hypothetical protein EUBVEN_01283 [Eubacterium ventriosum ATCC 27560] >gi|149735489|gb|EDM51375.1| hypothetical protein EUBVEN_01283 [Eubacterium ventriosum ATCC 27560] (317 aa)
Score = 573, Expect = 5.0e-57, Identities = 136/304 (44%), Positives = 202/304 (66%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           KK   GL K+ + +   +  I   F  +D++FYE +EE+LI  D+GV  T +I D ++E++    +++P   KE+++  I      D   N + D + +++ IL+I GVNGVGKTTSI K+A+ F    KKV+L A DTFRA A +QL  W+ R   DIV+   EG DP SV++  +   K++N D+++CDT+GRLHNK NLM+EL+K+  +I K  +    EN +VLDAT GQ+ + QA+ FKE T+ITG+ILTKMDG++KGGI ++I+    IPVKYIG+GE+++DL  FD  +FV+ + +E
  S:     6 KKLVSGLTKTRNNIVSNLNSIFNGFSSIDDDFYEELEEILIMSDIGVNTTEEILDNLKEQVKENKIKEPIECKELLIKNIEEQ--MDLGENAY-DFENEKSVILMI-GVNGVGKTTSIGKLASQFKNNGKKVVLAAADTFRAAATDQLKEWANRANVDIVM-GAEGSDPGSVLYDAISSAKNKNADILLCDTAGRLHNKKNLMEELKKLDRIIEKEYNGCRRENFIVLDATTGQNALAQARQFKECTDITGVILTKMDGSAKGGIAIAIQSELGIPVKYIGVGEQIDDLQKFDSHQFVEALFEE 304
>gi|94263346|ref|ZP_01287161.1| Cell division transporter substrate-binding protein FtsY [delta proteobacterium MLMS-1] >gi|93456301|gb|EAT06431.1| Cell division transporter substrate-binding protein FtsY [delta proteobacterium MLMS-1] (373 aa)
Score = 572, Expect = 5.8e-57, Identities = 122/300 (40%), Positives = 194/300 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  E L ++       + E+    K +D+E +E +EELLI+ D+G     ++ D  R  I   ++ +P  ++EI+   +  Y ++  +    L + +    +++++GVNGVGKTT+I K+A  F    ++VLLVA DTFRA A+EQL  W++R+  ++V   ++G DP+SVI+      +  ++D++I DT+GRLH K+NLM+EL K+  V+ K    APHE +LV+DAT GQ+GI QAK F +  +++GI LTK+DGT++GGIV++I   FNIP+++IG+GEK+EDL  FD  +FV  I
  S:    70 RLKEQLGRTREGFIHRLDELFLGRKDIDDELFEELEELLITSDLGAATAMELLDRARARIKRDDLSEPAALREILQQLLLEYLVK-AERPAELVMPESGPFVIMVLGVNGVGKTTTIGKLAWKFKNAGQRVLLVAADTFRAAAIEQLQAWAERVGVEVV-AQQQGADPSSVIYDAFDYARPRDFDVIIVDTAGRLHTKVNLMEELRKVKRVMSKKIPGAPHEVMLVIDATTGQNGISQAKLFHQAVDVSGIALTKLDGTARGGIVVNISREFNIPIRFIGIGEKMEDLRDFDPREFVSAI 367
>gi|144898020|emb|CAM74884.1| Signal recognition particle GTPase [Magnetospirillum gryphiswaldense MSR-1] (357 aa)
Score = 572, Expect = 5.9e-57, Identities = 129/323 (39%), Positives = 205/323 (63%)
  Q:    22 EDLSAKIEEKNIEKQAEILEVLPEKQ-KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           ED +A +++ +    AEIL   P+    +   GL KSSS L++ + ++  K +K+D+E  E++E+LLI+ D+GV    ++T  + +    Q+V   + IK+++ +++    I              R +++L++GVNG GKTT+I K+A HF  + K+V L AGDTFRA AVEQL +W +R +C  V   + G D A ++F  + +      DL+  DT+GRL NK +LM+EL K+  VI K D+TAPH+ LLVLDAT+GQ+   Q + FK++ ++TG++LTK+DGT++GG+++++ + F +PV  IG+GEK EDL  FD   F
  S:    34 EDEAAIVDDPH---PAEILAEAPQSWLSRLKSGLTKSSSKLTQGLGDLFTK-RKLDDEALEDLEDLLITTDLGVGTAARVTKRLAKTRFGQDVGAEE-IKQVLAEEVAQ--ILAPVAKPLQPACVARPHVVLVVGVNGSGKTTTIGKMAKHFKDQGKQVALAAGDTFRAAAVEQLKVWGERTQCP-VFSRETGADAAGLVFDAMAESAKRGDDLLFVDTAGRLQNKADLMEELRKVVRVIKKQDETAPHDVLLVLDATVGQNAHSQVEVFKDMVDVTGLVLTKLDGTARGGVLVALAEKFALPVHAIGVGEKAEDLRPFDANAF 349
>gi|161508236|ref|YP_001577669.1| cell division protein [Lactobacillus helveticus DPC 4571] >gi|160349225|gb|ABX27899.1| Cell division protein [Lactobacillus helveticus DPC 4571] (430 aa)
Score = 572, Expect = 5.9e-57, Identities = 134/308 (43%), Positives = 203/308 (65%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD--TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +++ +++GL+K++      +     KF+ VDE+F++++E+LLI  DVG     ++TD +REE   QN +  D +K++IV+K+   Y +D  ++    +   +D+ N+ L +GVNG GKTT+I K+A  F  + K V++ A DTFRAGAVEQL  W +R+   +V   KE  DPASV++   ++   EN D ++ DT+GRL NK NLM ELEKI  +I K     P E LLVLD + GQ+ ++QAK F + T +TG++LTK+DG+SKGG+VL+I++  N+PVK +GLGEK EDL+ FD   +  G+   LV
  S:   122 QEELYEKGLEKTNKGFGARLNAFFAKFRTVDEDFFDDLEDLLIESDVGYETAEQLTDELREEAKLQNAKSRDDLKKVIVEKLVDLYDKDGNSEDEKLIYHPEDKPNVYLFVGVNGAGKTTTIGKLAKRFKDEGKSVIMAAADTFRAGAVEQLVEWGKRVDVPVV-TGKEKADPASVVYDATERAIKENADYLLVDTAGRLQNKKNLMAELEKIQRIIKKLLPDQPTETLLVLDGSTGQNALLQAKDFDKTTKLTGLVLTKLDGSSKGGVVLAIRNEMNLPVKLVGLGEKAEDLADFDAANYAIGLFHGLV 430
>gi|78043121|ref|YP_360274.1| signal recognition particle-docking protein FtsY [Carboxydothermus hydrogenoformans Z-2901] >gi|77995236|gb|ABB14135.1| signal recognition particle-docking protein FtsY [Carboxydothermus hydrogenoformans Z-2901] (303 aa)
Score = 572, Expect = 7.0e-57, Identities = 126/300 (42%), Positives = 198/300 (66%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  E L K+   +   I ++ KK   VDEE +E +EE+LI  DVGV  + ++ + +R+    + + D + +K+++ ++I    I +   N   ++ +    ++L++GVNGVGKTT+I K+A +F ++ K+VLL AGDTFRA A+EQL IW  ++ C  V+  KEG DPA+V F  VK       D++I DT+GRLH K NLM+EL K+  VI +    AP E LLVLDAT GQ+ + Q + F +  ++TG++LTK+DGT+KGG+++ IK ++ IP+K+IG+GEK++DL  FD ++FV+ +
  S:     6 RLKESLIKTKQNIVAKIEDVFKK-STVDEELFEKLEEILIEGDVGVKPSLELVEKLRKTARERRITDSEQLKQVLKEEILK--ILEAGDNKLKNVPRTPL-VILVVGVNGVGKTTTIGKLAYYFKQQGKQVLLAAGDTFRAAAIEQLEIWGNKVGCP-VIKQKEGSDPAAVAFDAVKAAIARKIDVLIIDTAGRLHTKTNLMEELRKVKRVIERELPGAPDEVLLVLDATTGQNALSQVEYFNKALDLTGLVLTKLDGTAKGGVIIGIKSSYQIPIKFIGVGEKMDDLRPFDPQEFVEAL 300
>gi|94499827|ref|ZP_01306363.1| signal recognition particle-docking protein FtsY [Oceanobacter sp. RED65] >gi|94428028|gb|EAT13002.1| signal recognition particle-docking protein FtsY [Oceanobacter sp. RED65] (359 aa)
Score = 572, Expect = 7.0e-57, Identities = 123/300 (41%), Positives = 197/300 (65%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDI-KKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL ++ S LS+ + +++   K++DE+  E+IE  L+  D+G+ AT  I D + E  + + ++D + + E +       +++D     +  L+I + D+  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL  W +R K  +V     G D ASVI+  V+  + +  D+VI DT+GRL NK NLM+ELEK+  V+ K DDTAPHE +LVLDA  GQ+ + QAK F+E   ++ + L+K+DGT+KGG++ +I     +PV++IG+GE+++DL  F+ E+F++ +
  S:    58 RIKAGLSRTRSGLSEGLGDLLLGKKEIDEDLLEDIETQLLMADIGINATQAIIDDLTERSSRKELKDSEALLEAL-----KQHLKDILEPCHAPLEIPQSDKPFVILMVGVNGVGKTTTIGKMAKRFQSQGKSVMLAAGDTFRAAAVEQLQTWGERNKVPVV-AQHTGADSASVIYDAVQSAQSKGVDVVIADTAGRLQNKANLMQELEKVVRVMRKLDDTAPHEVMLVLDAGTGQNALSQAKIFQEAVGVSSLTLSKLDGTAKGGVIFAIAKELQLPVRFIGVGEQIDDLRPFNHEEFIEAL 354
>gi|167585413|ref|ZP_02377801.1| Cell division transporter substrate-binding protein FtsY [Burkholderia ubonensis Bu] (345 aa)
Score = 571, Expect = 7.5e-57, Identities = 123/300 (41%), Positives = 183/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+DE+ YE +E  L+  D GV AT  + DA+RE++    + DP  +K  + D +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    54 RLKSGLAKTSSSITGVFVS-----TKIDEDLYEELETALLMSDAGVDATEYLLDALREKVRTGRLTDPQQVKAALHD-LLVDLLKPLEKSLMLG--RAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLTIWGERNNVTVV--QQESGDPAAVIFDAVSAARARGIDVMMADTAGRLPTQLHLMEELKKVKRVISKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 343
>gi|167822657|ref|ZP_02454128.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 9] (347 aa)
Score = 571, Expect = 7.6e-57, Identities = 124/300 (41%), Positives = 183/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDP----DLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP    D ++E++V+ +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    56 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRELLVELL-------APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 345
>gi|94265751|ref|ZP_01289487.1| Cell division transporter substrate-binding protein FtsY [delta proteobacterium MLMS-1] >gi|93453726|gb|EAT04104.1| Cell division transporter substrate-binding protein FtsY [delta proteobacterium MLMS-1] (367 aa)
Score = 571, Expect = 8.5e-57, Identities = 122/300 (40%), Positives = 194/300 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  E L ++       + E+    K +D+E +E +EELLI+ D+G     ++ D  R  I   ++ +P  ++EI+   +  Y ++  +    L + +    +++++GVNGVGKTT+I K+A  F    ++VLLVA DTFRA A+EQL  W++R+  ++V   ++G DP+SVI+      +  ++D++I DT+GRLH K+NLM+EL K+  V+ K    APHE +LV+DAT GQ+GI QAK F +  +++GI LTK+DGT++GGIV++I   FNIP+++IG+GEK+EDL  FD  +FV  I
  S:    64 RLKEQLGRTREGFIHRLDELFLGRKDIDDELFEELEELLITSDLGAATAMELLDRARARIKRDDLSEPAALREILQQLLLEYLVK-AERPAELVMPESGPFVIMVLGVNGVGKTTTIGKLAWKFKNAGQRVLLVAADTFRAAAIEQLQAWAERVGVEVV-AQQQGADPSSVIYDAFDYARPRDFDVIIVDTAGRLHTKVNLMEELRKVKRVMSKKIPGAPHEVMLVIDATTGQNGISQAKLFHQAVDVSGIALTKLDGTARGGIVVNISREFNIPIRFIGIGEKMEDLRDFDPREFVSAI 361
>gi|160889556|ref|ZP_02070559.1| hypothetical protein BACUNI_01980 [Bacteroides uniformis ATCC 8492] >gi|156861073|gb|EDO54504.1| hypothetical protein BACUNI_01980 [Bacteroides uniformis ATCC 8492] (319 aa)
Score = 571, Expect = 9.2e-57, Identities = 136/307 (44%), Positives = 187/307 (60%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL K+  ++   I   V    KVD+E  +N+EE+LI+ DVGV  T KI + I +        +   +  I+ D+I     ++   D + F      +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL IW +R+   +V   K G DPASV F  +      N D+VI DT+GRLHNK+ LM EL KI +V+ K    AP+E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIGLGE +EDL  F  ++FVD +  E
  S:    10 EKKETLDKGLSKTKESVFGKIARAVAGKSKVDDEVLDNLEEVLITSDVGVETTLKIIERIEKRAAADKYMNATELNHILRDEIAALLTENNSEDVDDFEAPIAKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKSVYLGAADTFRAAAVEQLVIWGERVGVPVV-KQKMGADPASVAFDTLSSATANNADVVIIDTAGRLHNKVGLMNELTKIKNVMKKVVPDAPNEVLLVLDGSTGQNAFEQAKQFTLATEVTAMAVTKLDGTAKGGVVIGISDQFKIPVKYIGLGEGMEDLQVFRKKEFVDSLFGE 317
>gi|120436587|ref|YP_862273.1| cell division protein FtsY [Gramella forsetii KT0803] >gi|117578737|emb|CAL67206.1| cell division protein FtsY [Gramella forsetii KT0803] (317 aa)
Score = 571, Expect = 9.2e-57, Identities = 134/306 (43%), Positives = 195/306 (63%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK---KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+KS ++    +++ V    KVDEE  +++E +L+S DVGV  T KI + I E +        D + +I+ ++I    + +T+T    +I+     +  +++++GVNGVGKTT+I K+A+ F    +KV+L A DTFRA A++QL IW+ R    I+   K G DPASV F  V+     N D+V+ DT+GRLHNK+NLM EL K+  V+ K    APHE LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL  F+  +FVD   K
  S:    11 EKKENLDKGLEKSKTSFFDKMSKAVAGKDKVDEEVLDDLENVLVSSDVGVTTTIKIINRIEERVARDKYLGTDELNKILREEI-AALLSETNTGEGSEIQIPSDKKPYVIMVVGVNGVGKTTTIGKLAHQFKSNGQKVVLGAADTFRAAAIDQLQIWADRTGVPII-KQKMGSDPASVAFDTVQSAVKMNADVVLIDTAGRLHNKVNLMNELTKVKRVMQKTIADAPHEVLLVLDGSTGQNAFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFKIPVKYIGVGEGIEDLQVFNKYEFVDSFFK 317
>gi|196193681|gb|EDX88640.1| signal recognition particle-docking protein FtsY, putative [Alcanivorax sp. DG881] (394 aa)
Score = 570, Expect = 1.0e-56, Identities = 121/304 (39%), Positives = 193/304 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           +  +G+ K+   L K + +++   K++D+E +E IE  L+  DVGV AT+ I  A+ +++T + + D D + E + +++    +   D    +D  K +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R    +V     G D ASV++  V+  +    D++I DT+GRLH + NLM+EL K+  V+ K    APHE LLVLDA  GQ+ I QA+ F++   +TG+ LTK+DGT+KGGI+ ++     +P+++IG+GE+LEDL  F  E+FV  + +++
  S:    92 RMKQGMSKTRKGLGKGLADLLVGAKEIDDEIFEEIETQLLVADVGVEATDVIVQALTDQVTREELVDADALYESLQNELRKLLVP-VDQPMQIDGSK-KPYVILMVGVNGVGKTTTIGKLACRFKAEGKSVMLAAGDTFRAAAVEQLQVWGERNDIPVV-AQHTGADSASVVYDAVQAAQSRGADILIADTAGRLHTRGNLMEELTKVTRVMKKLIPDAPHEVLLVLDAGTGQNAINQAEQFRDAAGVTGLALTKLDGTAKGGILFALAKRTGLPIRFIGVGERLEDLRPFHAEEFVQALFEDV 392
>gi|167627247|ref|YP_001677747.1| signal recognition particle-docking protein FtsY [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167597248|gb|ABZ87246.1| signal recognition particle-docking protein FtsY [Francisella philomiragia subsp. philomiragia ATCC 25017] (333 aa)
Score = 570, Expect = 1.0e-56, Identities = 140/320 (43%), Positives = 201/320 (62%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++K  +  +EI  V  +  KK        GL K++S     ++ I+   K VD+E  E+IE  L++ DVGV AT++I + +R ++    ++  D + EII DK+    +        L I  + T  ++LI+GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V   KEG D ASVI+  +   K    D+VI DT+GRLHNK NLM+EL+K+  VI K DD+APHE +LV+DAT G + + QA+AF EI N+TGI +TK+DGT+KGGIV SI     +P+++IG+GEK++DL  F+ + F   +
  S:     5 KKKETQSSSEIERVQEQDNKKGLFSRLQSGLSKTASKFGSGLSTILMGQKVVDDELLEDIEMQLLTSDVGVEATDEIVEYLRGKVARNELQTVDKLNEIIQDKLTEIILP---CQKPLQINHENTPYVILIVGVNGVGKTTTIGKLTKKLQSEGKSVILAAGDTFRAAAVEQLREWGDRNNTQVVY-QKEGADSASVIYDAISSAKSRGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKVDDSAPHETMLVVDATTGGNALSQAEAFNEIVNLTGITITKLDGTAKGGIVFSIAKKMGLPLRFIGVGEKIDDLQVFNAKNFTKAL 326
>gi|56696224|ref|YP_166581.1| signal recognition particle-docking protein FtsY [Silicibacter pomeroyi DSS-3] >gi|56677961|gb|AAV94627.1| signal recognition particle-docking protein FtsY [Silicibacter pomeroyi DSS-3] (390 aa)
Score = 570, Expect = 1.2e-56, Identities = 116/277 (41%), Positives = 182/277 (65%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           + +D++  E +EELLI+ D+GV    ++T  + E    + +   + IK ++  +I T  ++       + +   R  ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + + +++  DL++ DT+GRL N+ +LM+EL KI  VI K DDTAPH  LLVLDAT GQ+ I Q + F+++ +++G+++TK+DGT+KGGI++S+ D F +P+  IG+GE+++DL+ FD E F   +T
  S:   114 RTLDDDMLEQLEELLIAADMGVDTALRVTANMAEGRIGRKLSTQE-IKALLAQEI-TRIMEPVARP--MPLYPKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMTRAQEDGADLLLIDTAGRLQNRADLMEELAKIVRVIRKKDDTAPHNTLLVLDATTGQNAISQVETFQKLADVSGLVMTKLDGTAKGGILVSLADRFGLPIHAIGVGEQIDDLAPFDPEDFAAALT 385
>gi|17545105|ref|NP_518507.1| putative cell division protein [Ralstonia solanacearum GMI1000] >gi|17427396|emb|CAD13914.1| putative cell division protein [Ralstonia solanacearum] (328 aa)
Score = 570, Expect = 1.2e-56, Identities = 128/316 (40%), Positives = 190/316 (60%)
  Q:    33 IEKQAEILEVLP-----EKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++ QA+ +E +P     E+ +K        GL K+S +L+     +     KVDE  +E +E  L+  D GV AT  + D +R  +  Q +E  + +K  + D +         T   + + +D+  +++I GVNG GKTTSI K+  HF    + VLL AGDTFRA A EQL IW QR    +V   +E  DPA+VIF  V   +    D+V+ DT+GRL  +++LM+EL+K+  VI K   TAPHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GE++EDL  F   +F D +
  S:    11 LDMQADDIETVPTPPVVEQARKGWMSRLRSGLSKTSKSLTTLFVGV-----KVDEALFEELETALLMADAGVDATEYLLDELRRRVKAQRIETAEGVKTALRDLLIELLHPLEKT---MVLGRDQPTVIMIAGVNGAGKTTSIGKLCKHFQTYGQSVLLAAGDTFRAAAREQLVIWGQRNNVTVVA--QESGDPAAVIFDAVNAARARGIDIVMADTAGRLPTQLHLMEELKKVRRVIGKAMATAPHETLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEQVEDLQPFSAREFADAL 326
>gi|189461330|ref|ZP_03010115.1| hypothetical protein BACCOP_01980 [Bacteroides coprocola DSM 17136] >gi|189431859|gb|EDV00844.1| hypothetical protein BACCOP_01980 [Bacteroides coprocola DSM 17136] (320 aa)
Score = 569, Expect = 1.2e-56, Identities = 135/304 (44%), Positives = 185/304 (60%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           EK++  D+GL K+  ++   I   V    KVD+E  +N+EE+LI+ DVGV  T KI   I + +      +   +  I+ ++I     ++   D+  F   +  +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL IW +R+    V+  K G DPASV F  +      N D+VI DT+GRLHNKI LM EL KI +V+ K    APHE LLVLD + GQ+   QAK F   T +  + +TK+DGT+KGG+V+ I D F IPVKYIGLGE +EDL  F   +FVD +
  S:    10 EKKETLDKGLSKTKESVFGKIARAVAGKSKVDDEVLDNLEEVLITSDVGVETTLKIIKRIEKRVAQDKYVNTQELNNILREEIAALLTENNTVDSEEFTVPEGKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKSVYLGAADTFRAAAVEQLVIWGERVGVP-VIKQKMGSDPASVAFDTLSSAVANNADVVIIDTAGRLHNKIGLMNELTKIKNVMQKVVPDAPHEILLVLDGSTGQNAFEQAKQFTLATEVNAMAITKLDGTAKGGVVIGISDQFKIPVKYIGLGEGIEDLQIFRRREFVDSL 314
>gi|170734154|ref|YP_001766101.1| signal recognition particle-docking protein FtsY [Burkholderia cenocepacia MC0-3] >gi|169817396|gb|ACA91979.1| signal recognition particle-docking protein FtsY [Burkholderia cenocepacia MC0-3] (388 aa)
Score = 569, Expect = 1.3e-56, Identities = 129/311 (41%), Positives = 190/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  + DA+RE++    + DP  +K+ + D +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    76 ETVEIVPPPLQ--DASAKKSWLARLKTGLAKTGSSITGVFVNTKIDEDLYEELETALLMSDAGVDATEYLLDALREKVRAGRLTDPQQVKDALHDLLVELL---TPLEKSLMLGRAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVIAKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 386
>gi|167617829|ref|ZP_02386460.1| signal recognition particle-docking protein FtsY [Burkholderia thailandensis Bt4] (328 aa)
Score = 568, Expect = 1.7e-56, Identities = 124/300 (41%), Positives = 180/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D GV AT  +  A+RE++    + DP  +K+ +   +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    37 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGVDATEHLLGALREKVRTGRLTDPQQVKDALRGLLVELL---TPLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFADAL 326
>gi|187922585|ref|YP_001894227.1| signal recognition particle-docking protein FtsY [Burkholderia phytofirmans PsJN] >gi|187713779|gb|ACD15003.1| signal recognition particle-docking protein FtsY [Burkholderia phytofirmans PsJN] (386 aa)
Score = 568, Expect = 1.7e-56, Identities = 131/311 (42%), Positives = 191/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +EV+P      D G K+S      + LSK  + +   F   K+DE+ YE +E  L+  D GV AT  + +A+RE++  + + DP  +K  +   +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW QR    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    73 ETVEVVPPPLP--DAGAKRSWLTRLKTGLSKTSSNLTGIFVGTKIDEDLYEELETALLMSDAGVDATEFLLEALREKVRAERLVDPQQVKTAL-RTLLVDLLKPLEKSLMLG--RAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGQRNNVTVV--SQESGDPAAVIFDAVGAARARKIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAQDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFSDAL 383
>gi|189345804|ref|YP_001942333.1| signal recognition particle-docking protein FtsY [Chlorobium limicola DSM 245] >gi|189339951|gb|ACD89354.1| signal recognition particle-docking protein FtsY [Chlorobium limicola DSM 245] (317 aa)
Score = 568, Expect = 1.7e-56, Identities = 136/303 (44%), Positives = 194/303 (64%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKK---DRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +  EGL K+  T  + ++ I +   ++DEEF E +E +L++ DVGV  T  I +AI E    +     + +  +++++I    + DTDT   LD      +   ++L++GVNG GKTTS+AK+A+++ K  KKV++ A DTFRA A EQL IW+ R    ++    +G DPASV++  V      N D+V+ DT+GRLHNK +LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F    N+TG++LTK+DGTSKGGIVLSI     +PVKYIG+GEK++DL  FD EKFV+ +
  S:     8 KISRLKEGLSKTRDTFREKLSVITQGKTEIDEEFLEELETILVAADVGVETTLAIVEAITERAKKETYRSGEELNRMLMEEI-QQLLLDTDTAHPLDFDAPLPETPYVILVVGVNGAGKTTSVAKLAHNYDKAGKKVIIAAADTFRAAAYEQLKIWADRAGVPLI-GQGQGADPASVVYDAVSSAVSRNVDVVLVDTAGRLHNKAHLMEELAKIMRVAKKKVPAAPHEVLLVLDGTTGQNAVQQAREFTRFVNVTGLVLTKLDGTSKGGIVLSISRELKLPVKYIGVGEKIDDLQLFDREKFVEAL 311
>gi|188589484|ref|YP_001920588.1| signal recognition particle-docking protein FtsY [Clostridium botulinum E3 str. Alaska E43] >gi|188499765|gb|ACD52901.1| signal recognition particle-docking protein FtsY [Clostridium botulinum E3 str. Alaska E43] (302 aa)
Score = 568, Expect = 1.7e-56, Identities = 141/300 (47%), Positives = 201/300 (67%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD----LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +GL K+   L+  I E +K    +DE+ YE +EE+LI+ D+G+  T  I + +R++I  + + DP      +KE+I + +     +D D         D   ++L++GVNGVGKTTSI K+A    +  KKVLL+A DTFRA A++QL +WS+R + D++   +EG DPA+V+F  ++  K  N DL+ICDT+GRLHNK NLM ELEKI+ +I +  D    E LLVLDAT GQ+ ++QAK F E+  I GIILTK+DGT+KGG+V+SIK + NIPV+YIG+GE ++DL  FD E F + I
  S:     8 KLKDGLTKTRDGLTDKINEALKIAITIDEDLYEELEEILITSDIGMDTTMDIIERLRKKIRKEKINDPQDVKPALKEVIKEILLEGNYEDND---------DEKKVMLVIGVNGVGKTTSIGKLAAKNKRAGKKVLLIAADTFRAAAIDQLEVWSRRAEVDLI-KHQEGSDPAAVVFDAIEASKARNTDLLICDTAGRLHNKKNLMNELEKINRIIDRELDGVKKETLLVLDATTGQNAVIQAKQFMEVCPIDGIILTKLDGTAKGGVVISIKQSLNIPVRYIGVGECIDDLQEFDAESFAEAI 301
>gi|92115105|ref|YP_575033.1| signal recognition particle-docking protein FtsY [Chromohalobacter salexigens DSM 3043] >gi|91798195|gb|ABE60334.1| signal recognition particle-docking protein FtsY [Chromohalobacter salexigens DSM 3043] (501 aa)
Score = 568, Expect = 1.8e-56, Identities = 115/300 (38%), Positives = 182/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+ +  ++ +  +    K++D++  E++E  L+  DVG+ AT +I D + E ++ + ++DP  +   + +++    +        L  K     ++L++GVNGVGKTT+I K+   F ++ + V+L AGDTFRA AVEQL +W +R    +V     G D ASVI+  +   K    D++I DT+GRLHNK +LM+EL+K+  V+ K D+ APHE +LVLDA  GQ+ + QA  F E   +TGI LTK+DGT+KGGI+ ++      P+++IG+GE L+DL  F  E FV  +
  S:   195 RIKAGLGKTRANFTEGLAGLFLGKKQIDDDLMEDLETQLLMADVGIEATTEIIDRLTERVSRKELKDPQALYSALQEEL-QDLLDPVAQPLALPPKGQGPFVILMVGVNGVGKTTTIGKLTQRFQREGRSVMLAAGDTFRAAAVEQLKVWGERNHVPVV-AQHTGADSASVIYDALSAAKARGVDVLIADTAGRLHNKSHLMEELKKVRRVMAKLDEQAPHEVMLVLDAGTGQNALSQASTFNEAVPVTGITLTKLDGTAKGGIIFALAKQLGTPIRFIGVGETLDDLRPFAAEDFVSAL 492
>gi|160938004|ref|ZP_02085361.1| hypothetical protein CLOBOL_02897 [Clostridium bolteae ATCC BAA-613] >gi|158438998|gb|EDP16753.1| hypothetical protein CLOBOL_02897 [Clostridium bolteae ATCC BAA-613] (317 aa)
Score = 568, Expect = 1.8e-56, Identities = 129/297 (43%), Positives = 194/297 (65%)
  Q:    52 EGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           EGL K+ S +   I  I   F  +D++FYE IEE LI  D+G+  T  I + +R+++  Q++ +P+  KE++++ I        +   F    + R +++L++GVNGVGKTTS+ K+A       ++V+L A DTFRA A+EQL  W+ R   +++   +EG DPA+VI+  V   K    D++ICDT+GRLHNK NLM+EL+KI+ +I K    A  E L+VLD T GQ+ + QA+ F E+ +ITGIILTK+DGT+KGGI ++I+    IPVKYIG+GEK++DL  F+ + FV+ +
  S:    14 EGLAKTRSNIVSGIDSIFSGFSAIDDDFYEEIEETLIMGDLGIQTTMSIVEDLRKKVKEQHIREPEECKELLINSIKEQMDLGENAYEF----EHRKSVVLVIGVNGVGKTTSVGKLAGQLKDDGRRVILAAADTFRAAAIEQLTEWASRAGVELI-AQQEGSDPAAVIYDAVAAAKSRKADVLICDTAGRLHNKKNLMEELKKINRIIDKEYPDAYRETLVVLDGTTGQNALAQARQFMEVADITGIILTKLDGTAKGGIAVAIQSELGIPVKYIGIGEKIDDLQKFNADDFVNAL 305
>gi|53724091|ref|YP_104611.1| signal recognition particle-docking protein FtsY [Burkholderia mallei ATCC 23344] >gi|52427514|gb|AAU48107.1| signal recognition particle-docking protein FtsY [Burkholderia mallei ATCC 23344] (327 aa)
Score = 568, Expect = 2.0e-56, Identities = 123/300 (41%), Positives = 182/300 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  + DA+RE++    + DP  +K+ +   +    +   + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    36 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLDALREKVRAGRLTDPQQVKDAL-RGLLVELLAPLEKSFVLG--RAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 325
>gi|150005788|ref|YP_001300532.1| recognition particle-docking protein FtsY [Bacteroides vulgatus ATCC 8482] >gi|149934212|gb|ABR40910.1| recognition particle-docking protein FtsY [Bacteroides vulgatus ATCC 8482] (319 aa)
Score = 567, Expect = 2.1e-56, Identities = 134/307 (43%), Positives = 190/307 (61%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL K+  ++   I   V    KVD+E  +N+EE+LI+ DVGV  T  I   I E +      +   + +I+ ++I     ++   D++ F   +  +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL+IW +R+    V+  K G DPASV F  +      N D+VI DT+GRLHNK+ LM EL KI +V+ K    APHE LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I + F IPVKYIGLGE +ED+  F  ++FVD +  E
  S:    10 EKKETLDKGLSKTKESVFSKIARAVAGKSKVDDEVLDNLEEVLITSDVGVETTLNIIKRIEERVAKDKYVNTQELNKILREEIAALLTENNTVDSDDFTVPEGKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKTVYLGAADTFRAAAVEQLDIWGERVGVP-VIKQKMGSDPASVAFDTLSSAVANNADVVIIDTAGRLHNKVGLMNELTKIKNVMKKVVADAPHEVLLVLDGSTGQNAFEQAKQFTLATEVTAMAITKLDGTAKGGVVIGISEQFKIPVKYIGLGEGIEDMQVFRKKEFVDSLFGE 317
>gi|149371256|ref|ZP_01890742.1| signal recognition particle-docking protein FtsY [unidentified eubacterium SCB49] >gi|149355394|gb|EDM43953.1| signal recognition particle-docking protein FtsY [unidentified eubacterium SCB49] (318 aa)
Score = 567, Expect = 2.4e-56, Identities = 131/306 (42%), Positives = 189/306 (61%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRT--NILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+KS S+    + + V    KVD    +++EE+L+S DVGV  T K+ D I   +          +  I+ ++I     + D+   +   I K  T  ++++++GVNG GKTT+I K+A+ F K   KV+L A DTFRA A++QL +W+ R    IV     G DPASV F  ++ G  +N D++I DT+GRLHNKINLM EL K+  V+ K    APH+ LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE ++DL  F+  +FVD   K
  S:    11 EKKETLDKGLEKSKSSFFSKLNKAVAGKSKVDASVLDDLEEVLVSSDVGVTTTLKVIDRIEARVAKDKYVGTSELNAILREEIAGLLSEIDSGNESQFTIPKHETGPHVIMVVGVNGAGKTTTIGKLAHQFSKAGHKVVLGAADTFRAAAIDQLQVWADRTNVPIV-KQAMGSDPASVAFDTLESGVKQNADVIIIDTAGRLHNKINLMNELTKVKRVMQKVIPDAPHDVLLVLDGSTGQNAFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIDDLQVFNKFEFVDSFFK 318
>gi|91781706|ref|YP_556912.1| signal recognition particle-docking protein FtsY [Burkholderia xenovorans LB400] >gi|91685660|gb|ABE28860.1| signal recognition particle-docking protein FtsY [Burkholderia xenovorans LB400] (385 aa)
Score = 567, Expect = 2.4e-56, Identities = 124/300 (41%), Positives = 183/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+L+           K+DE+ YE +E  L+  D GV AT  + +A+RE++  + + DP  +K  +   +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW QR    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL K+  VI K  + APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    93 RLKTGLSKTSSSLTGIFVG-----TKIDEDLYEELETALLMSDAGVDATEYLLEALREKVRTERLTDPQQVKAAL-RTLLVDLLKPLEKSLMLG--RAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGQRNNVTVV--SQESGDPAAVIFDAVGAARARKIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAQEGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFSDAL 382
>gi|167737024|ref|ZP_02409798.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 14] (337 aa)
Score = 567, Expect = 2.6e-56, Identities = 122/300 (40%), Positives = 179/300 (59%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    46 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 335
>gi|167718007|ref|ZP_02401243.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei DM98] (337 aa)
Score = 567, Expect = 2.6e-56, Identities = 122/300 (40%), Positives = 179/300 (59%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    46 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 335
>gi|167909452|ref|ZP_02496543.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 112] (345 aa)
Score = 566, Expect = 2.7e-56, Identities = 122/300 (40%), Positives = 179/300 (59%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    54 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 343
>gi|91974997|ref|YP_567656.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris BisB5] >gi|91681453|gb|ABE37755.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris BisB5] (315 aa)
Score = 566, Expect = 2.7e-56, Identities = 122/305 (40%), Positives = 192/305 (62%)
  Q:    44 PEKQK-----KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           PE QK     +   GLK++SS++  A++E + K +K+D    + IE++L+  D+G    ++I+DA+ E    + +   D +KEI+  ++              D KK    ++L++GVNG GKTT+I K++  F  + +KV++ AGDTFRA A+EQL +W +R     V+   +G D AS+ F  +   K++  D+++ DT+GRL N+  LM ELEK+  VI K DDTAPH  LLVLDAT+GQ+ + Q +AF     +TG+++TK+DGT++GGI+++I +   +PV +IG+GE +EDLS F    F   I
  S:     5 PETQKPSWWRRLSSGLKRTSSSIGTALSEFISK-RKLDRAMLDEIEDVLLRADLGTEVASRISDAVGEGRYDKMISASD-VKEIVASEVEKVLAPVAKPLVIDDAKK--PFVVLVVGVNGSGKTTTIGKLSARFAAEGRKVMMAAGDTFRAAAIEQLKVWGERTGTP-VIAGAQGSDSASLAFNALTAAKEQGRDVLLIDTAGRLQNRKELMSELEKVVRVIKKVDDTAPHAVLLVLDATVGQNALSQVEAFTRTAGVTGLVMTKLDGTARGGILVAIAEKHKLPVHFIGVGEGVEDLSPFTARDFAQAI 309
>gi|110835427|ref|YP_694286.1| cell division protein FtsY [Alcanivorax borkumensis SK2] >gi|110648538|emb|CAL18014.1| Cell division protein FtsY [Alcanivorax borkumensis SK2] (397 aa)
Score = 566, Expect = 2.7e-56, Identities = 120/304 (39%), Positives = 192/304 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           +  +G+ K+   L K + +++   K++D+E +E IE  L+  DVGV AT+ I  A+ ++++ + + D D + E + +++    +   D    +D  K +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R    +V     G D ASV++  V+  +    D++I DT+GRLH + NLM EL K+  V+ K    APHE LLVLDA  GQ+ I QA+ F++   +TG+ LTK+DGT+KGGI+ ++     +P+++IG+GE+LEDL  F  E+FV  + +++
  S:    95 RMKQGMSKTRKGLGKGLADLLVGAKEIDDEIFEEIETQLLVADVGVEATDVIVQALTDQVSREELVDADALYESLQNELRKLLVP-VDQPMQIDSSK-KPYVILMVGVNGVGKTTTIGKLACRFKAEGKSVMLAAGDTFRAAAVEQLQVWGERNDIPVV-AQHTGADSASVVYDAVQAAQSRGADILIADTAGRLHTRGNLMDELTKVTRVMKKLIPDAPHEVLLVLDAGTGQNAINQAEQFRDAAGVTGLALTKLDGTAKGGILFALAKRTGLPIRFIGVGEQLEDLRPFHAEEFVQALFEDV 395
>gi|167814132|ref|ZP_02445812.1| signal recognition particle-docking protein FtsY [Burkholderia pseudomallei 91] (342 aa)
Score = 566, Expect = 3.0e-56, Identities = 122/300 (40%), Positives = 179/300 (59%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP  +K+ +   +             L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    51 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRAGRLTDPQQVKDALRGLLVELL---APLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGIGEKVEDLQPFSAEEFADAL 340
>gi|83746837|ref|ZP_00943884.1| FtsY [Ralstonia solanacearum UW551] >gi|83726422|gb|EAP73553.1| FtsY [Ralstonia solanacearum UW551] (328 aa)
Score = 566, Expect = 3.0e-56, Identities = 127/316 (40%), Positives = 190/316 (60%)
  Q:    33 IEKQAEILEVLP------EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++ QA+ +E +P      + +K +   L+   S  SK++T +    K VDE  +E +E  L+  D GV AT  + D +R  +  Q +E  + +K  + D +    +   +    L   +D+  +++I GVNG GKTTSI K+  HF    + VLL AGDTFRA A EQL IW QR    +V   +E  DPA+VIF  V   +    D+V+ DT+GRL  +++LM+EL+K+  VI K   TAPHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GE++EDL  F   +F D +
  S:    11 LDMQADDIETVPTPPVMEQARKGWMSRLRSGLSKTSKSLTTLFVGVK-VDETLFEELETALLMADAGVDATEYLLDELRRRVKTQRIETAESVKTALRD-LLVELLHPLEKTMVLG--RDQPMVIMIAGVNGAGKTTSIGKLCKHFQTYGQSVLLAAGDTFRAAAREQLVIWGQRNNVTVVA--QESGDPAAVIFDAVNAARARGIDIVMADTAGRLPTQMHLMEELKKVRRVIGKAMVTAPHETLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEQVEDLQPFSAREFADAL 326
>gi|170691511|ref|ZP_02882676.1| signal recognition particle-docking protein FtsY [Burkholderia graminis C4D1M] >gi|170143716|gb|EDT11879.1| signal recognition particle-docking protein FtsY [Burkholderia graminis C4D1M] (395 aa)
Score = 566, Expect = 3.3e-56, Identities = 132/319 (41%), Positives = 197/319 (61%)
  Q:    30 EKNIEKQA-EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E ++E+ + E +E++P      DE  K+S      + LSK  + I   F   K+DE+ YE +E  L+  D GV AT  + +A+RE++  + + +P  +K  +   +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL IW QR    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    73 ETDVEEASLETVEIVPPPVP--DESAKRSWLTRLKTGLSKTSSSITGIFVGAKIDEDLYEELETALLMSDAGVDATEFLLEALREKVRAERLTEPQQVKAAL-RTLLVDLLKPLEKSLMLG--RAKPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAIWGQRNNVTVVA--QESGDPAAVIFDAVGAARARKIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAQDGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFSDAL 392
>gi|37678296|ref|NP_932905.1| signal recognition particle GTPase [Vibrio vulnificus YJ016] >gi|37197035|dbj|BAC92876.1| signal recognition particle GTPase [Vibrio vulnificus YJ016] (437 aa)
Score = 566, Expect = 3.3e-56, Identities = 135/332 (40%), Positives = 211/332 (63%)
  Q:    17 KEGSLEDLSAKIEEKNIEKQAEILEV--LPEKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +E + E +S    E+ +E    ++E   + E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T KI + + E+ + ++++D + +  ++ +++       +     L +   +T  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D FNIP++YIG+GE +EDL  F+ ++F+D +
  S:    96 EEAAAEPISEPAAEEPVEATPVVVEAPRVQEQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTTLKIIENLTEKASRRDLKDGEALYGLLKEEMAEIL---SKVEQPLQVDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFNIPIRYIGVGEGIEDLRPFETQEFIDAL 432
>gi|34540014|ref|NP_904493.1| signal recognition particle-docking protein FtsY [Porphyromonas gingivalis W83] >gi|188994128|ref|YP_001928380.1| signal recognition particle-docking protein [Porphyromonas gingivalis ATCC 33277] >gi|34396325|gb|AAQ65392.1| signal recognition particle-docking protein FtsY [Porphyromonas gingivalis W83] >gi|188593808|dbj|BAG32783.1| signal recognition particle-docking protein [Porphyromonas gingivalis ATCC 33277] (317 aa)
Score = 566, Expect = 3.4e-56, Identities = 131/307 (42%), Positives = 186/307 (60%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD--TDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +K++  DEGL K+   +   IT  V    KVD+E  + +E +L++ DVGV  T KI   I E +          +  I+  +I +   ++   D ++F      +  +++++GVNGVGKTT+I K+A+ F +  K V+L A DTFRA AVEQL IWS+R+   I+   + G DPASV +  V        D+VI DT+GRLHNK+NLM EL KI  V+ K    APHE LLVLD + GQ+   QA+ F   T +  + +TK+DGT+KGG+V+ I D F IPVKYIGLGE ++DL  F  ++FVD +  E
  S:    10 KKKETLDEGLSKTKENVFAKITRAVAGKSKVDDEVLDELENVLVTSDVGVDTTLKIIKRIEERVARDKYVSTSELTTILRQEIASLLTENGSADGDSFDLPSGTKPYVIMVVGVNGVGKTTTIGKLAHRFRQAGKSVVLGAADTFRAAAVEQLEIWSERVGVPII-KQQMGSDPASVAYDTVSSAVANGVDVVIIDTAGRLHNKVNLMNELTKIKRVMQKVVPDAPHEILLVLDGSTGQNAFEQARQFTAATEVNALAVTKLDGTAKGGVVIGISDQFKIPVKYIGLGEGIDDLQIFRKKEFVDSLFGE 317
>gi|194562358|ref|YP_002097381.1| Signal recognition particle GTPase [Burkholderia dolosa AUO158] >gi|124893982|gb|EAY67862.1| Signal recognition particle GTPase [Burkholderia dolosa AUO158] (386 aa)
Score = 565, Expect = 3.6e-56, Identities = 129/311 (41%), Positives = 189/311 (60%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F  E+F D +
  S:    74 ETVEIVPPPMQ--DASAKKSWLARLKTGLAKTGSSITGVFVNTKIDEDLYEELETALLMSDAGVDATEYLLGALREKVRVGRLTDPQQVKSALRDLLVELL---TPLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVISKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAEEFADAL 384
>gi|69934576|ref|ZP_00629654.1| Cell division transporter substrate-binding protein FtsY [Paracoccus denitrificans PD1222] >gi|119384655|ref|YP_915711.1| signal recognition particle-docking protein FtsY [Paracoccus denitrificans PD1222] >gi|119374422|gb|ABL70015.1| signal recognition particle-docking protein FtsY [Paracoccus denitrificans PD1222] (346 aa)
Score = 565, Expect = 3.6e-56, Identities = 115/272 (42%), Positives = 177/272 (65%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           +++D+   E +EE+LI  D+GV    ++T  I E    + V   +L KE++ D+I       T     L +   R  ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W QR     V+   EG DPAS+ F  + K + E  DL++ DT+GRL N+ +LM+EL KI  VI K D +APH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT++GG+++++ D F +P+  IG+GE+++DL AFD   F
  S:    71 RELDDAMLEELEEMLIQADMGVETALRVTANIAEGRMGRRVSATEL-KELLADEIARIM---TPVAKPLPLYPKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQLQVWGQRAGVP-VMTAPEGSDPASLAFDAMTKAEAEGADLLMIDTAGRLQNRQDLMEELAKIVRVIRKKDPSAPHNTLLVLDATTGQNALSQVEIFRKLADVSGLVMTKLDGTARGGVLVALADRFGLPIHAIGVGEQIDDLDAFDARDF 337
>gi|91775086|ref|YP_544842.1| signal recognition particle-docking protein FtsY [Methylobacillus flagellatus KT] >gi|91709073|gb|ABE49001.1| signal recognition particle-docking protein FtsY [Methylobacillus flagellatus KT] (335 aa)
Score = 565, Expect = 3.6e-56, Identities = 120/297 (40%), Positives = 183/297 (61%)
  Q:    52 EGLKKS-SSTLSKAITEIVKKFK--KVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E LK+S + T S+   ++ + F   K+DE  YE +E +L++ DVG+ AT  + + IR  +  QN+ D   +KE +   +       T     LD    +  ++++ GVNG GKTT+I K+AN F  + K VL+ AGDTFRA A EQL  W +R    +V   +E  DPA+VIF  V   K    D+V+ DT+GRL  ++NLM+E+ K+  VI K    APHE LLVLD+  GQ+ + Q KAF +   +TG++L+K+DGT+KGG++ +I  +  +P++YIG+GE ++DL  F   +F+D +
  S:    39 ERLKRSLAKTRSQWGQQLARLFGGGKIDENVYEELETILLTSDVGIAATQALLEQIRTRVKRQNLSDTTQLKEALKQSLLELL---TPLEKPLDTTTAQPFVIMLAGVNGAGKTTTIGKLANLFQAQGKSVLIAAGDTFRAAAREQLQAWGERNNVHVVA--QESGDPAAVIFDAVNSAKARGIDIVLADTAGRLPTQLNLMEEIRKVQRVIDKALPGAPHEVLLVLDSNTGQNAVTQVKAFDDALGVTGLVLSKLDGTAKGGVIAAIAQSRPVPIRYIGIGESIDDLRPFKASEFIDAL 333
>gi|146296632|ref|YP_001180403.1| signal recognition particle-docking protein FtsY [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145410208|gb|ABP67212.1| signal recognition particle-docking protein FtsY [Caldicellulosiruptor saccharolyticus DSM 8903] (300 aa)
Score = 565, Expect = 3.7e-56, Identities = 133/300 (44%), Positives = 204/300 (68%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  EGL K+    ++ +  ++K FK+VD+E ++ +EE+L+  DVGV  + KI + ++E++    + D   +KE++ +++F         N    +++    I+L++GVNGVGKTTSI KIAN      KKV++ A DTFRA A++QL IW++R+ CDI+    EG DPA+V+F G++  +    D++I DT+GRLH K NL++EL KI  VI++    A  E LLV+DAT GQ+G++QAK F +  NI+GI+LTK+DGT+KGGIV+SI D   IPVK+IG+GEK++DL  FD ++F+D +
  S:     6 RLKEGLSKTKKNFTERVENLLKAFKQVDDELFDELEEVLVLSDVGVKTSQKIIENLKEKVKMNKISDSQAVKELLKEEMFNI------INLPNKLRERYPLIILMVGVNGVGKTTSIGKIANLLKSNGKKVIIAAADTFRAAAIDQLEIWAKRVGCDII-KHVEGADPAAVVFDGIQAMRARKADVLIVDTAGRLHTKKNLIEELRKIDRVINQQIPEAEKETLLVIDATTGQNGLIQAKEFNQAVNISGIVLTKLDGTAKGGIVVSICDELKIPVKFIGVGEKIDDLQEFDPKEFIDAL 298
>gi|167729769|emb|CAO80681.1| Cell division protein FtsY [Candidatus Cloacamonas acidaminovorans] (324 aa)
Score = 564, Expect = 4.7e-56, Identities = 132/304 (43%), Positives = 185/304 (60%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYI-QDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           K   E L K++S     ITE VKK K VDEE    IEE+L+S D G+  T+ I    +E++    V DP++ +  + D +    + ++ +T  F    + +  +++ +GVNG GKTT+I K+A  F +  KKVL+VAGDTFRA A+EQ+ IW++R    IV    +  DPA++I+ GV       YD+V+ DT+GR H K NLMKEL KI   I K    APHE +LV+DAT GQ+ + QA  F +   +TGI LTK DGTSKGGI+ ++K N  +PVK +G+GE +EDL  F    FV    +E
  S:    21 KNLKEKLAKTNSNFMGKITETVKKRKVVDEEMLAEIEEILLSCDTGIEMTDIILTRFKEQLKKDKVTDPEIAQIYLTDVMRDILLAENEETPDFFAEPQAKPYVVVFVGVNGTGKTTTIGKVAYKFNQMGKKVLIVAGDTFRAAAIEQIAIWAERAGVPIVRSQPD-SDPAAIIYDGVHSALARGYDVVLIDTAGRQHTKDNLMKELTKIERTIQKLIPDAPHEVILVVDATTGQNAVSQAHNFDKAMKLTGIALTKYDGTSKGGIIFNLKYNLQLPVKLLGVGEGIEDLLPFKAVPFVKAFFEE 324
>gi|159045265|ref|YP_001534059.1| signal recognition particle-docking protein FtsY [Dinoroseobacter shibae DFL 12] >gi|157913025|gb|ABV94458.1| signal recognition particle-docking protein FtsY [Dinoroseobacter shibae DFL 12] (499 aa)
Score = 564, Expect = 4.9e-56, Identities = 116/275 (42%), Positives = 179/275 (65%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           +D+   E++EE+LI+ D+GV    +++  I E    + V   + IK I+ D+I             L I   R  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  +K+ +    DL++ DT+GRL N+ +LM+EL KI  VI K D+TAPH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F D +T
  S:   226 MDDAMLESLEEVLIAADMGVDTALRVSANIAEGRMGRKVSTNE-IKRILADEIARIM---EPVAKPLPIYPKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKSVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAIKQAQASGADLLMIDTAGRLQNRADLMEELAKIVRVIRKVDETAPHNTLLVLDATTGQNALSQVETFRKLADVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEEFADALT 495
>gi|78067608|ref|YP_370377.1| signal recognition particle-docking protein FtsY [Burkholderia sp. 383] >gi|77968353|gb|ABB09733.1| signal recognition particle-docking protein FtsY [Burkholderia sp. 383] (388 aa)
Score = 564, Expect = 5.0e-56, Identities = 128/311 (41%), Positives = 188/311 (60%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    76 ETVEIVPPPLQ--DASAKKSWLARLKTGLAKTGSSITGVFVNTKIDEDLYEELETALLMSDAGVDATEYLLGALREKVRTGRLTDPQQVKSALHDLLVELL---TPLEKSLMLGRAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVISKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 386
>gi|196158334|ref|YP_002127823.1| signal recognition particle GTPase [Alteromonas macleodii 'Deep ecotype'] >gi|88774077|gb|EAR05335.1| signal recognition particle GTPase [Alteromonas macleodii 'Deep ecotype'] >gi|196114113|gb|ACG67829.1| signal recognition particle GTPase [Alteromonas macleodii 'Deep ecotype'] (541 aa)
Score = 564, Expect = 5.0e-56, Identities = 129/319 (40%), Positives = 201/319 (63%)
  Q:    34 EKQAEILEVLPEKQKKF---DEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           + Q ++ +   EK+  F    E L ++   L   I  + K  K +D+E YE++E  L+  DVG+  T KI   + +  + ++++D + + EI+  ++     +     + +    D +    ++L++GVNGVGKTT+I K+A  F ++ KKV+L AGDTFRA AVEQL +W +R   DI V+    G D ASV++  ++  K    D++I DT+GRL NK NLM+EL+K+  V+ K +  APHE +L LDA  GQ+ + QAK F E   +TGI LTK+DGT+KGG++ SI D F IP++YIG+GE ++DL  FD ++F+D +  E+
  S:   214 DAQTQVQDKPKEKKSLFARLRESLSRTKENLGSGIVSLFKG-KAIDDELYEDLETQLLVADVGMDTTQKIITHLTDSASRKDLKDAEALLEILKQRMSGMLSEVNQPLSDVMQAHDASEGPFVILMVGVNGVGKTTTIGKLAKQFQQQGKKVMLAAGDTFRAAAVEQLQVWGER--NDIPVIAQHTGADSASVLYDALEAAKSRGTDILIADTAGRLQNKNNLMEELKKVVRVMKKINPNAPHEVMLTLDAGTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFSIADKFKIPIRYIGVGESIDDLRQFDGQEFIDALFSEM 536
>gi|189465616|ref|ZP_03014401.1| hypothetical protein BACINT_01974 [Bacteroides intestinalis DSM 17393] >gi|189437890|gb|EDV06875.1| hypothetical protein BACINT_01974 [Bacteroides intestinalis DSM 17393] (319 aa)
Score = 564, Expect = 5.7e-56, Identities = 134/307 (43%), Positives = 186/307 (60%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL K+  ++   I   V    KVD+E  +N+EE+LI+ DVGV  T  I   I +    +   +   +  I+ D+I     ++   D + F      +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL+IW  R+   +V   K G DPASV +  +      N D+VI DT+GRLHNK+ LM EL KI +V+ K    AP+E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIGLGE +EDL  F  ++FVD +  E
  S:    10 EKKETLDKGLSKTKESVFGKIARAVAGKSKVDDEVLDNLEEVLITSDVGVETTLNIIQRIEKRAASEKYMNAQELNTILRDEIAALLTENNSDDVDDFEAPIAKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKSVYLGAADTFRAAAVEQLDIWGGRVGVPVV-KQKMGADPASVAYDTLSSAVANNADVVIIDTAGRLHNKVGLMNELTKIKNVMKKVVPDAPNEVLLVLDGSTGQNAFEQAKQFTLATEVTAMAITKLDGTAKGGVVIGISDQFKIPVKYIGLGEGMEDLQVFRKKEFVDSLFGE 317
>gi|187934978|ref|YP_001885441.1| signal recognition particle-docking protein FtsY [Clostridium botulinum B str. Eklund 17B] >gi|187723131|gb|ACD24352.1| signal recognition particle-docking protein FtsY [Clostridium botulinum B str. Eklund 17B] (302 aa)
Score = 563, Expect = 6.1e-56, Identities = 140/300 (46%), Positives = 201/300 (67%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD----LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +GL K+   L+  I E +K    +DE+ YE +EE+LI+ D+G+  T  I + +R++I  + + DP      +KE+I + +     ++ D         D   ++L++GVNGVGKTTSI K+A    +  KKVLL+A DTFRA A++QL +WS+R + D++   +EG DPA+V+F  ++  K  N DL+ICDT+GRLHNK NLM ELEKI+ +I +  D    E LLVLDAT GQ+ ++QAK F E+  I GIILTK+DGT+KGG+V+SIK + NIPV+YIG+GE ++DL  FD E F + I
  S:     8 KLKDGLTKTRDGLTDKINEALKIAITIDEDLYEELEEILITSDIGMDTTMDIIERLRKKIRKEKINDPQDVKPALKEVIKEILLEGNYEEVD---------DEKKVMLVIGVNGVGKTTSIGKLAAKNKRAGKKVLLIAADTFRAAAIDQLEVWSRRAEVDLI-KHQEGSDPAAVVFDAIEASKARNTDLLICDTAGRLHNKKNLMNELEKINRIIDRELDGVKKETLLVLDATTGQNAVIQAKQFMEVCPIDGIILTKLDGTAKGGVVISIKQSLNIPVRYIGVGEGIDDLQEFDAEGFAEAI 301
>gi|163787980|ref|ZP_02182426.1| putative recognition particle-docking protein [Flavobacteriales bacterium ALC-1] >gi|159876300|gb|EDP70358.1| putative recognition particle-docking protein [Flavobacteriales bacterium ALC-1] (324 aa)
Score = 563, Expect = 6.2e-56, Identities = 132/306 (43%), Positives = 200/306 (65%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIF-----TYYIQDTD-TNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+KS S+    + + V    KVD++  +N+EE+L++ DVGV  T K+ + I E +          + +I+ ++I      T   ++TD T   L  ++D +    +L+++GVNGVGKTT+I K+A  F K+  KV+L A DTFRA A++QL +W+ R+   ++  +  G DPASV F  ++ G +++ D++I DT+GRLHNK+NLM EL K+  V+ K    APH+ LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL  F+  +FVD   K
  S:    11 EKKETLDKGLEKSKSSFFNKLNKAVAGKSKVDDDVLDNLEEILVTSDVGVNTTLKVIERIEERVAKDKYLGTSELNKILREEIAGLLSETNSGEETDYTIPELPTQEDGSKTPYVLMVVGVNGVGKTTTIGKLAYQFKKQGLKVVLGAADTFRAAAIDQLQVWADRVDVPMIRQEM-GSDPASVAFDALQSGVNQDADVIIIDTAGRLHNKVNLMNELTKVKRVMQKVVGDAPHDVLLVLDGSTGQNAFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIEDLQVFNKYEFVDSFFK 324
>gi|126728988|ref|ZP_01744803.1| Signal recognition particle-docking protein FtsY [Sagittula stellata E-37] >gi|126710918|gb|EBA09969.1| Signal recognition particle-docking protein FtsY [Sagittula stellata E-37] (357 aa)
Score = 563, Expect = 6.4e-56, Identities = 134/345 (38%), Positives = 213/345 (61%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEV------------LPEKQKKFDEGLKKSSSTLSKAI--TEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           FF K+ N+L        E L A +EE + E  A+                LPE+ +   +G ++    L + I   +  +  + +D++  E++EELLI+ D+GV    ++T  I E    + V   + IKE++ ++I             L I   +  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W +R     VL   EG DPAS+ F  + K + E  DL++ DT+GRL N+ +LM+EL KI  VI K D  APH  LLVLDAT GQ+ ++Q +AF+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F   +T
  S:     3 FFGKLKNRLFKTSSKLDEGLDAIVEEGSDETPADDTPAPEAPIAAMQPMALPEETEP--QGTQRPG-LLGRLIGQPDSAEPRRVLDDDMLESLEELLIASDMGVDTALRVTSNIAEGRMGRRVSARE-IKELLAEEIARVM---ESVARPLPIYPKKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQLQVWGERAGVP-VLTAPEGSDPASLAFDAMGKAQAEGADLLMIDTAGRLQNRADLMEELAKIVRVIRKKDPDAPHNTLLVLDATTGQNALIQVEAFRQLADVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALT 353
>gi|167835367|ref|ZP_02462250.1| signal recognition particle-docking protein FtsY [Burkholderia thailandensis MSMB43] (327 aa)
Score = 563, Expect = 6.4e-56, Identities = 124/300 (41%), Positives = 183/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKE----IIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+SS+++           K+D+  YE +E  L+  D G+ AT  +  A+RE++    + DP  +K+    ++VD +       T     L + + +  +++I GVNG GKTTSI K+A H    ++ VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +  N D+++ DT+GRL  +++LM+EL K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     IPV +IG+GEK+EDL  F  E+F D +
  S:    36 RLKSGLAKTSSSITNVFVN-----TKIDDALYEELETALLMSDAGIDATEHLLGALREKVRTGRLTDPQQVKDALRGLLVDLL-------TPLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFNQSVLLAAGDTFRAAAREQLAIWGERNNVTVV--QQESGDPAAVIFDAVSAARARNIDVMMADTAGRLPTQLHLMEELRKVKRVIGKAHDGAPHEVLLVIDANTGQNALAQVKAFDDTLGLTGLIVTKLDGTAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFADAL 325
>gi|149278721|ref|ZP_01884857.1| signal recognition particle-docking protein FtsY [Pedobacter sp. BAL39] >gi|149230716|gb|EDM36099.1| signal recognition particle-docking protein FtsY [Pedobacter sp. BAL39] (320 aa)
Score = 563, Expect = 6.7e-56, Identities = 128/310 (41%), Positives = 191/310 (61%)
  Q:    41 EVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTF--LDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           E  PE Q+  D+GL+K+       IT+ V     VD++  +N+EE+L++ DVGV  T KI + I++ +          +  ++ D+I    + + ++N F   +  + +  +++++GVNGVGKTT+I K+++    +  KV+L A DTFRA AVEQ+ +W +R+   +V     G DPASV F  ++       D+VI DT+GRLHNKI LM EL KI  V+ K   +APHE LLVLD + GQ+   Q K F E T++  + +TK+DGT+KGG+V+ I D F IPVKYIG+GE + DL  FD + FVD + K
  S:    11 ETAPEAQEALDKGLEKTKEGFLSKITKAVAGKSTVDDDVLDNLEEVLVTSDVGVTTTLKIIERIQDRVAKDKYLSTTELNHLLRDEI-QLLLSENNSNDFRKFEYGQHKPYVIMVVGVNGVGKTTTIGKLSHKLKAEGLKVVLGAADTFRAAAVEQIKLWGERVGVRVV-AQAMGSDPASVAFDTLQSAVANGEDVVIIDTAGRLHNKIGLMNELGKIKHVMEKVIPSAPHEILLVLDGSTGQNAFEQCKQFTEATDVNALAITKLDGTAKGGVVIGISDQFKIPVKYIGVGEGMNDLQLFDKKAFVDSLFK 320
>gi|152998323|ref|YP_001343158.1| signal recognition particle-docking protein FtsY [Marinomonas sp. MWYL1] >gi|150839247|gb|ABR73223.1| signal recognition particle-docking protein FtsY [Marinomonas sp. MWYL1] (413 aa)
Score = 563, Expect = 7.0e-56, Identities = 129/321 (40%), Positives = 194/321 (60%)
  Q:    28 IEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDP-DLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +EE   E ++E ++      ++F  GL ++ S L   ++ ++   KKVD+   E +E  L+  DVG+ AT  +  A+ +++  + ++D   L+  +  D      I          + KD   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W +R    +V     G D ASVI+  ++  K +  D+VI DT+GRL NK NLM EL K+  V+ K D+ APHE +LVLDA  GQ+ I QAK F E   ++GI LTK+DGT+KGGI+ +I   F IP++YIG+GE+ +DL  F  ++FVD +
  S:    92 VEEIPRESESEPVQPALSWSQRFKLGLSRTRSGLGNGLSSVIGGHKKVDDNLLEELETQLLMADVGIDATQTLISALTDKLNRKELKDSATLLSHLKAD---MNGILSQSQQMLEPVSKDGPFVILMVGVNGVGKTTTIGKLAKKYQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNVPVV-AQHTGADSASVIYDAIESAKAKGVDIVIADTAGRLQNKANLMNELSKVVRVMKKLDENAPHEVMLVLDAGTGQNAISQAKLFSEAVGVSGITLTKLDGTAKGGIIFAIAKQFGIPIRYIGVGEQADDLRPFVAQEFVDAL 409
>gi|193214940|ref|YP_001996139.1| signal recognition particle-docking protein FtsY [Chloroherpeton thalassium ATCC 35110] >gi|193088417|gb|ACF13692.1| signal recognition particle-docking protein FtsY [Chloroherpeton thalassium ATCC 35110] (313 aa)
Score = 562, Expect = 8.0e-56, Identities = 141/305 (46%), Positives = 193/305 (63%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           K  +  EGL K+   +   IT++VK   ++D+EF E +E++LIS DVGV  T  I D I E    +     + +  +++D+I        D +   F         ++LI+GVNGVGKTTSI K+A ++    KKVL+ A DTFRA A EQL IW++R    IV   ++G DPASV+F  V      + D+V+ DT+GRLHNKI+LM+EL KI  V  K    APHE LLVLDA+ GQ+ I QAK F +   +TG+ILTK+DGT+KGG+V+ I    NIPVKYIG+GEK+EDL  FD +KF++ + K
  S:     8 KISRLKEGLAKTRENIKTKITKLVKGRTEIDDEFLEELEQILISADVGVQTTLDIVDKITERAKNERYASEEDLNNMLIDEIQKMLSDARDAHVVDFDAPLPSTPYVILIVGVNGVGKTTSIGKMAYNYKTAGKKVLIAAADTFRAAATEQLEIWAERAGVPIV-GQRQGADPASVVFDSVSSAVSRDMDVVLVDTAGRLHNKIHLMEELSKIMRVAQKKVPDAPHEVLLVLDASTGQNAINQAKEFMKSVKVTGLILTKLDGTAKGGVVIGISRELNIPVKYIGVGEKIEDLQIFDRQKFIEALLK 313
>gi|107023742|ref|YP_622069.1| signal recognition particle-docking protein FtsY [Burkholderia cenocepacia AU 1054] >gi|105893931|gb|ABF77096.1| signal recognition particle-docking protein FtsY [Burkholderia cenocepacia AU 1054] (327 aa)
Score = 562, Expect = 8.0e-56, Identities = 129/311 (41%), Positives = 190/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  + DA+RE++    + DP  +K+ + D +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    15 ETVEIVPPPLQ--DASAKKSWLARLKTGLAKTGSSITGVFVNTKIDEDLYEELETALLMSDAGVDATEYLLDALREKVRAGRLTDPQQVKDALHDLLVELL---TPLEKSLMLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVIAKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 325
>gi|116690829|ref|YP_836452.1| signal recognition particle-docking protein FtsY [Burkholderia cenocepacia HI2424] >gi|116648918|gb|ABK09559.1| signal recognition particle-docking protein FtsY [Burkholderia cenocepacia HI2424] (388 aa)
Score = 562, Expect = 8.1e-56, Identities = 129/311 (41%), Positives = 190/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  + DA+RE++    + DP  +K+ + D +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    76 ETVEIVPPPLQ--DASAKKSWLARLKTGLAKTGSSITGVFVNTKIDEDLYEELETALLMSDAGVDATEYLLDALREKVRAGRLTDPQQVKDALHDLLVELL---TPLEKSLMLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVIAKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 386
>gi|134297005|ref|YP_001120740.1| signal recognition particle-docking protein FtsY [Burkholderia vietnamiensis G4] >gi|134140162|gb|ABO55905.1| signal recognition particle-docking protein FtsY [Burkholderia vietnamiensis G4] (377 aa)
Score = 562, Expect = 8.3e-56, Identities = 129/311 (41%), Positives = 191/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      S L+K  + I   F   K+DE+ YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +    +Q  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F+  +F D +
  S:    65 EAVEIVPPPTQ--DASAKKSWLSRLKSGLAKTGSSITSVFVNTKIDEDLYEELETALLMSDAGVDATEYLLGALREKVRVGRLTDPQQVKAALHD-LLVELLQPLEKSLMLG--RAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVIAKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFNAVEFADAL 375
>gi|119356176|ref|YP_910820.1| signal recognition particle-docking protein FtsY [Chlorobium phaeobacteroides DSM 266] >gi|119353525|gb|ABL64396.1| signal recognition particle-docking protein FtsY [Chlorobium phaeobacteroides DSM 266] (316 aa)
Score = 562, Expect = 8.4e-56, Identities = 133/303 (43%), Positives = 193/303 (63%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK---KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +  EGL K+S T  + ++ I +   ++DEEF E +E +L+  DVGV  T  I DAI E    ++    + +  +++++I    + D+  +  +D       +  ++L++GVNG GKTTS+AK+A ++ K  KKV++ A DTFRA A EQL IW+ R    ++    +G DPASV++  V      N D+V+ DT+GRLHNK +LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F    N+TG++LTK+DGTSKGGIVLSI    N+PVKYIG+GEK++DL  FD  +FV+ +
  S:     8 KLSRLKEGLSKTSETFREKLSLITQGKTEIDEEFLEELEHILVGADVGVETTLSIVDAITERAKRESYRSAEELNRMLMEEI-QQMLLDSGEHYPIDFDAPLSAKPYVILVVGVNGAGKTTSVAKLAYNYEKAGKKVIIAAADTFRAAAYEQLKIWADRAGVPLI-GQGQGADPASVVYDAVSSAVSRNSDVVLVDTAGRLHNKSHLMEELAKIMRVAKKKIPEAPHEVLLVLDGTTGQNAVSQAREFTRFVNVTGLVLTKLDGTSKGGIVLSISRELNLPVKYIGVGEKIDDLQLFDRARFVEAL 311
>gi|56459337|ref|YP_154618.1| Signal recognition particle GTPase [Idiomarina loihiensis L2TR] >gi|56178347|gb|AAV81069.1| Signal recognition particle GTPase [Idiomarina loihiensis L2TR] (449 aa)
Score = 562, Expect = 8.4e-56, Identities = 127/316 (40%), Positives = 204/316 (64%)
  Q:    30 EKNIEKQAEILEVLPEKQ-------KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDI-KKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           E   E + E  EV P+++        +  +GL+++S ++   +  + +  KK+D++ +E +E  L+  D+GV  T KI D + ++   + ++D + + E++ +++    ++  D    L+I + D   ++L+ GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R   DI V+    G D ASV++  ++  K  + D++I DT+GRL NK NLM+EL+K+  V+ K D  APHE +L LDA  GQ+ I QAK F E   ++GI++TK+DGT+KGG++ ++ D F IP++YIG+GE LEDL  F  + F+
  S:   114 EHKPEHKPEPTEVAPKEKGEKKGFWARLTQGLRRTSGSIGSGLIGVFRG-KKIDDDLFEELETQLLMADLGVATTTKIIDNLTKQADRKQLKDAEALYELLQEQL-AEILKPVDKR--LEIPESDSPYVILMTGVNGVGKTTTIGKLAKQFKAEGKSVMLAAGDTFRAAAVEQLQVWGER--NDIPVIAQHTGADSASVLYDALQAAKARDVDVLIADTAGRLQNKANLMEELKKLVRVMKKLDPEAPHEVMLTLDAGTGQNAISQAKLFTEAVGVSGIVMTKLDGTAKGGVIFAVADQFAIPIRYIGVGESLEDLRPFVAKDFI 432
>gi|161523672|ref|YP_001578684.1| signal recognition particle-docking protein FtsY [Burkholderia multivorans ATCC 17616] >gi|189351559|ref|YP_001947187.1| signal recognition particle receptor [Burkholderia multivorans ATCC 17616] >gi|160341101|gb|ABX14187.1| signal recognition particle-docking protein FtsY [Burkholderia multivorans ATCC 17616] >gi|189335581|dbj|BAG44651.1| signal recognition particle receptor [Burkholderia multivorans ATCC 17616] (380 aa)
Score = 562, Expect = 9.2e-56, Identities = 128/311 (41%), Positives = 188/311 (60%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+D+  YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +       T     L + + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F  E+F D +
  S:    68 ETVEIVPPPVQ--DASAKKSWLARLKTGLAKTGSSITGVFVNTKIDDALYEELETALLMSDAGVDATEYLLGALREKVRVGRLTDPQQVKSALRDLLVELL---TPLEKSLVLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLTVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVIAKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAEEFADAL 378
>gi|167763124|ref|ZP_02435251.1| hypothetical protein BACSTE_01493 [Bacteroides stercoris ATCC 43183] >gi|167699464|gb|EDS16043.1| hypothetical protein BACSTE_01493 [Bacteroides stercoris ATCC 43183] (319 aa)
Score = 562, Expect = 9.5e-56, Identities = 134/304 (44%), Positives = 187/304 (61%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           EK++  D+GL K+  ++   I   +    KVD+E  +N+EE+LI+ DVGV  T KI + I +    +   +   +  I+ D+I     ++   D + F      +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL IW +R+    V+  K G DPASV F  +      N D+VI DT+GRLHNK+ LM EL KI +V+ K    AP+E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIGLGE +EDL  F  ++FVD +
  S:    10 EKKETLDKGLSKTKESVFGKIARAIAGKSKVDDEVLDNLEEVLITSDVGVETTLKIIERIEKRAADEKYMNAKELNVILRDEIAALLTENNSDDVDDFETPVTKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKSVYLGAADTFRAAAVEQLVIWGERVGVP-VIKQKMGADPASVAFDTLSSAVANNADVVIIDTAGRLHNKVGLMNELTKIKNVMKKVVPDAPNEVLLVLDGSTGQNAFEQAKQFTLATEVTAMAVTKLDGTAKGGVVIGISDQFKIPVKYIGLGEGIEDLQVFRKKEFVDSL 314
>gi|146309189|ref|YP_001189654.1| signal recognition particle-docking protein FtsY [Pseudomonas mendocina ymp] >gi|145577390|gb|ABP86922.1| signal recognition particle-docking protein FtsY [Pseudomonas mendocina ymp] (475 aa)
Score = 562, Expect = 9.5e-56, Identities = 124/308 (40%), Positives = 194/308 (62%)
  Q:    44 PEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           P    +  +GL K+S++L + +  +    K +D++  +++E  L++ DVGV AT  I   + + +  + + D   + + + +++ T  ++  +    +D  K +  ++L++GVNGVGKTT+I K+A       KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D+TAPHE LLVLDA  GQ+ I QAK F +  N+TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ + FV  + +E
  S:   167 PSFFARLKQGLSKTSASLGEGMASLFLGKKAIDDDLLDDLETRLLTADVGVEATTTIIGNLTKRVARKELADSGALYKALQEELVTL-LKPVEQPLVIDSAK-QPYVILVVGVNGVGKTTTIGKLAKKLQLDGKKVMLAAGDTFRAAAVEQLQVWGERNNI-AVIAQHTGADSASVIFDAVQAAKSRGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAISQAKQFDQTVNLTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRPFEAQAFVQALFEE 471
>gi|86142309|ref|ZP_01060819.1| signal recognition particle-docking protein FtsY [Flavobacterium sp. MED217] >gi|85831061|gb|EAQ49518.1| signal recognition particle-docking protein FtsY [Leeuwenhoekiella blandensis MED217] (317 aa)
Score = 562, Expect = 9.9e-56, Identities = 131/307 (42%), Positives = 192/307 (62%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL+KS++     + + V    KVD+E  +++EE+L+S DVGV  T KI + I   +        D +  I+ D+I     + ++   T   I   +  +++++GVNGVGKTT+I K+A+ F  K  KV+L A DTFRA A++QL IW+ R+   I+   + G DPASV F  V+     + D+VI DT+GRLHNK+NLMKEL K+  V+ K    AP E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE ++DL  F+  +FVD   ++
  S:    11 EKKETLDKGLEKSNTNFLNKLGKAVAGKSKVDDEVLDDLEEVLVSSDVGVATTIKIIERIEARVARDKYLGTDELNAILRDEIAGLMSETNSGEATDFSIPSKKPYVIMVVGVNGVGKTTTIGKLAHQFKSKGLKVVLGAADTFRAAAIDQLQIWADRVDVPII-KQQMGSDPASVAFDTVQSAVKLDADVVIIDTAGRLHNKVNLMKELTKVKRVMQKVVPDAPDEVLLVLDGSTGQNAFEQAKQFTAATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIDDLQVFNKIEFVDSFFRK 317
>gi|50123266|ref|YP_052433.1| cell division protein FtsY [Pectobacterium atrosepticum SCRI1043] >gi|49613792|emb|CAG77243.1| cell division protein [Erwinia carotovora subsp. atroseptica SCRI1043] (469 aa)
Score = 561, Expect = 1.2e-55, Identities = 120/276 (43%), Positives = 179/276 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D++ ++ +EE L+  DVGV  T KI D++ E  + + ++D D +   + +++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K    D++I DT+GRL NK  LM+EL+KI  V+ K D+ APHE +L LDA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F  + F++ +
  S:   193 KKIDDDLFDELEEQLLIADVGVETTRKIIDSLTEHASRRQLKDADTLFVKLKEEMAEILAK---VDVPLNIEGKTPYVILMVGVNGVGKTTTIGKMARQFQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNNVP-VIAQHTGADSASVIFDAIQAAKARGVDVLIADTAGRLQNKAYLMEELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDFIEAL 464
>gi|134299913|ref|YP_001113409.1| signal recognition particle-docking protein FtsY [Desulfotomaculum reducens MI-1] >gi|134052613|gb|ABO50584.1| signal recognition particle-docking protein FtsY [Desulfotomaculum reducens MI-1] (309 aa)
Score = 560, Expect = 1.4e-55, Identities = 126/300 (42%), Positives = 196/300 (65%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  E L K+  +  + I ++V     +DE+ YE +EE+LI  DVGV    K+ + +R+ +  +NV++   +KEI  +++  Y + +  T   + +  +   +++++GVNGVGKTT+I K+A++F ++ KKVLL AGDTFRA A++QL IW+ R+  DI+   +EG DP +V +  V   +    D+++ DT+GRLHNK NLM EL K+H ++ +    APHE LLVLDAT GQ+ + Q K F E  N+TGI LTK+DGT+KGG+V SI     IPVK IG+GE+++DL  F+ + F++ +
  S:     6 RLKESLTKTRQSFIEKIDQVVTGRTGIDEDLYEELEEVLIQADVGVSTAMKLVERVRKGVKARNVQEASRLKEIFQEEL-EYLMGEKITP--IQLNPEGPTVIMVVGVNGVGKTTTIGKMAHNFKEQGKKVLLAAGDTFRAAAIDQLEIWADRVGVDII-KHQEGSDPGAVAYDAVHAARSRKADILLVDTAGRLHNKSNLMDELRKVHKIVAREMPGAPHEVLLVLDATTGQNALNQVKIFSEAVNVTGIALTKLDGTAKGGVVTSIVTEMAIPVKLIGIGERMDDLRPFNPKDFINAL 301
>gi|27375584|ref|NP_767113.1| cell division protein [Bradyrhizobium japonicum USDA 110] >gi|27348721|dbj|BAC45738.1| bll0473 [Bradyrhizobium japonicum USDA 110] (315 aa)
Score = 560, Expect = 1.5e-55, Identities = 116/301 (38%), Positives = 191/301 (63%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++   GLK++SS+L  A+ ++V K +K+D    ++IE++L+  D+G     +I DA+     +      D +K+++   V+K+     +  + +        +  ++L++GVNG GKTT+I K++  F  + +KV+L AGDTFRA A+EQL +W +R K   V+   +G D AS+ F  +   K++  D+++ DT+GRL NK  LM ELEK+  VI K DDTAPH  LLVLDAT+GQ+ + Q +AF     +TG+++TK+DGT++GGI++++ + F +PV +IG+GE ++DL+ F    F   I
  S:    15 RRLSNGLKRTSSSLGTAVADLVTK-RKLDRAMLDDIEDVLLRADLGTSVAVRIADAVGTG-RYDKAISADEVKDVVATEVEKVLAPVAKPLEIDA-----ARKPFVILVVGVNGSGKTTTIGKLSQKFASEGRKVMLAAGDTFRAAAIEQLKVWGERTKTP-VIAGTQGSDSASLAFNALTAAKEQKTDVLLIDTAGRLQNKAELMNELEKVVRVIRKVDDTAPHAVLLVLDATVGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALAEKFKLPVHFIGVGEGVDDLAPFTARDFARAI 310
>gi|107099358|ref|ZP_01363276.1| hypothetical protein PaerPA_01000370 [Pseudomonas aeruginosa PACS2] (454 aa)
Score = 560, Expect = 1.5e-55, Identities = 120/303 (39%), Positives = 194/303 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K++D++  ++IE  L++ DVGV AT  I   + + +  + + D   + + + +++ +  ++  +    +D+ ++   ++L++GVNGVGKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D+TAPHE LLVLDA  GQ+ I QAK F     +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ + FV  +  E
  S:   151 RLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEELASL-LRPVEQPLQVDVARE-PYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAE 450
>gi|194548376|ref|YP_002083404.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa C3719] >gi|126169322|gb|EAZ54833.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa C3719] (456 aa)
Score = 560, Expect = 1.5e-55, Identities = 120/303 (39%), Positives = 194/303 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K++D++  ++IE  L++ DVGV AT  I   + + +  + + D   + + + +++ +  ++  +    +D+ ++   ++L++GVNGVGKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D+TAPHE LLVLDA  GQ+ I QAK F     +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ + FV  +  E
  S:   153 RLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEELASL-LRPVEQPLQVDVARE-PYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAE 452
>gi|51892595|ref|YP_075286.1| signal recognition particle [Symbiobacterium thermophilum IAM 14863] >gi|51856284|dbj|BAD40442.1| signal recognition particle [Symbiobacterium thermophilum IAM 14863] (320 aa)
Score = 560, Expect = 1.6e-55, Identities = 128/304 (42%), Positives = 200/304 (65%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD----LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDK--KVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           ++   GL+K+   L   +  ++  F+K+D++ ++ +EE LI  DVGV  + K+ + +R E   + +++ D    L+KE++ +++ +           L + +    ++L++GVNGVGKTT+I K+A H +++D+  KV+L A DTFRA A++QL +W +R   ++V    EG DPA+V F GVK  +    D++I DT+GRLHNK +LM EL KI  V+ +    APHE LLVLDAT GQ+ I Q + FKE   +TGI LTK+DGT+KGG+V++I D   +PVK+IG+GE+L+DL  FD  +FV+ +  E
  S:    20 ERLKAGLQKTKEALIGQVNTVMSVFRKIDDDLFDELEEALIRGDVGVATSAKLVEELRREARQKGLKNGDELLPLLKELVAERLGS-------GAAPLRLNEGGLTVILVVGVNGVGKTTTIGKLARH-LREDRGLKVVLAAADTFRAAAMDQLKVWGERAGAEVV-AGPEGADPAAVAFDGVKAARASGADVLIVDTAGRLHNKAHLMAELGKIARVLGREVPGAPHETLLVLDATTGQNAIQQTRLFKETVPVTGIALTKLDGTAKGGVVVAIADTEQVPVKFIGVGERLDDLQPFDPRQFVEALFSE 320
>gi|153806284|ref|ZP_01958952.1| hypothetical protein BACCAC_00540 [Bacteroides caccae ATCC 43185] >gi|149130961|gb|EDM22167.1| hypothetical protein BACCAC_00540 [Bacteroides caccae ATCC 43185] (319 aa)
Score = 559, Expect = 1.8e-55, Identities = 135/307 (43%), Positives = 185/307 (60%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQD-TDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL K+  ++   I   V    KVD+E  +N+EE+LI+ DVGV  T  I   I +        +   +  I+ D+I     ++ +D     D+  +R   +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL IW +R+   +V   K G DPASV +  +      N D+VI DT+GRLHNK+ LM EL KI +V+ K    AP E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIGLGE +EDL  F   +FVD +  E
  S:    10 EKKETLDKGLSKTKESVFSKIARAVAGKSKVDDEVLDNLEEVLITSDVGVETTLNIIKRIEKRAAADKYVNTQELNHILRDEIAALLTENNSDDVADFDVPIERKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKSVYLGAADTFRAAAVEQLMIWGERVGVPVV-KQKMGADPASVAYDTLSSAVANNADIVIIDTAGRLHNKVGLMNELTKIKNVMKKVVPDAPDEVLLVLDGSTGQNAFEQAKQFTLATEVTAMAITKLDGTAKGGVVIGISDQFKIPVKYIGLGEGMEDLQVFRKNEFVDSLFGE 317
>gi|126740023|ref|ZP_01755713.1| signal recognition particle-docking protein FtsY [Roseobacter sp. SK209-2-6] >gi|126718842|gb|EBA15554.1| signal recognition particle-docking protein FtsY [Roseobacter sp. SK209-2-6] (378 aa)
Score = 559, Expect = 1.9e-55, Identities = 127/321 (39%), Positives = 203/321 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAI--TEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           EEK  E+ ++  E  P       E   KS   L + I  +   +  + +D++  E +EELLI+ D+GV    ++T  + E    + +   + IKE++  ++    + +T     + I   R  ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W +R     VL   EG DPAS+ F  + K ++E  DL++ DT+GRL N+ +LM+EL KI  VI K D+TAPH  LLVLDAT GQ+ + Q + F++I++++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F   +T
  S:    56 EEKTTERDSQAAEPSPAPAASAPESKAKSPGLLGRLIGRSSASEPRRVLDDDMLEQLEELLIAADMGVDTALRVTSNMAEGRLGKKLSARE-IKELLAAEVAR--VMETVAKP-MPIYAHRPQVVLVVGVNGSGKTTTIGKLASQFKGAGKKVVIAAGDTFRAAAVEQLQVWGERAGVP-VLTAPEGSDPASLAFDAMTKAQEEGADLLMIDTAGRLQNRADLMEELAKIVRVIRKKDETAPHNTLLVLDATTGQNALSQVETFRKISDVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALT 373
>gi|145220378|ref|YP_001131087.1| signal recognition particle-docking protein FtsY [Prosthecochloris vibrioformis DSM 265] >gi|145206542|gb|ABP37585.1| signal recognition particle-docking protein FtsY [Prosthecochloris vibrioformis DSM 265] (317 aa)
Score = 559, Expect = 2.0e-55, Identities = 132/303 (43%), Positives = 193/303 (63%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTN--TFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +  EGL K+  TL + +  + K   ++D+EF E +E +L+S DVGV  T  I DAI E    ++    D +  +++D+I    ++  + +   F      +  ++LI+GVNG GKTTS+AK+A+++ K  KKV++ A DTFRA A EQL +W++R    ++    +G DPASV+F  V      N D+V+ DT+GRLHNK +LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F +  ++TGI++TK+DGT+KGGIVLSI     +PVKYIG+GEK++DL  FD  +FV  +
  S:     8 KLSRLTEGLGKTRETLREKLAVVTKGRTEIDDEFLEELENILVSADVGVETTLAIVDAITERAGTESYRSEDELNGMLMDEIGKMLMESGEEHPVEFDAPLPAKPYVILIVGVNGAGKTTSVAKLASNYEKAGKKVMIAAADTFRAAAYEQLQVWAERAGVPLI-GQGQGADPASVVFDAVSAAVARNADVVLVDTAGRLHNKSHLMEELAKIMRVAKKKIPEAPHEVLLVLDGTTGQNAVQQAREFMKFVHVTGIVVTKLDGTAKGGIVLSISRELKLPVKYIGVGEKIDDLQLFDRSRFVGAL 311
>gi|148261479|ref|YP_001235606.1| signal recognition particle-docking protein FtsY [Acidiphilium cryptum JF-5] >gi|146403160|gb|ABQ31687.1| signal recognition particle-docking protein FtsY [Acidiphilium cryptum JF-5] (312 aa)
Score = 559, Expect = 2.1e-55, Identities = 119/301 (39%), Positives = 182/301 (60%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII--VDKIFTYYIQ----DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           +   GL +S+  L+  IT+   K +K+D+   E +E+LLI+ D+G  A  ++  A R     Q+V  P++   +   V KI     Q    D   N F         ++L++GVNG GKTT+I K+A  + +   + LLVAGDTFRA AVEQL +W +R     V+      DPA + F  + + + + +D+V+ DT+GRLHNK  LM+EL KI  VI K D+TAPH  LL LDAT GQ+ I Q   FKE+ ++TG+I+TK+DG+++ G+V+++ +   +P+  +G+GE+  DL  FD  +F   +T
  S:     9 RLKSGLTRSTQKLAAGITDTFTK-RKLDDAALEELEDLLITADLGPAAAARVIRAFRRTRFGQDVSAPEIRASLAEEVAKILAPVAQPLAIDRSKNPF---------VILMVGVNGTGKTTTIGKLAQSYAEAGARPLLVAGDTFRAAAVEQLQVWGERTGAP-VMTGPANADPAGLAFDAIARARRDGHDIVLIDTAGRLHNKAALMEELRKIIRVIRKQDETAPHAVLLTLDATTGQNAIAQVATFKEMVDLTGLIVTKLDGSARAGVVVALAETAALPIHAVGVGEQAADLRPFDATEFARALT 304
>gi|118498159|ref|YP_899209.1| cell division protein, signal recognition particle GTPase [Francisella tularensis subsp. novicida U112] >gi|118424065|gb|ABK90455.1| cell division protein, signal recognition particle GTPase [Francisella tularensis subsp. novicida U112] (331 aa)
Score = 558, Expect = 2.3e-55, Identities = 137/320 (42%), Positives = 203/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I  V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   +R+++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI    ++P+++IG+GEK++DL  F+   F   +
  S:     5 KKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVAYLRDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGNRNNTHVVY-QHEGADSASVIYDAISSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALSQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLSLPLRFIGVGEKIDDLQVFNARDFTTAL 326
>gi|188591100|ref|YP_001795700.1| Signal recognition particle GTPase [Cupriavidus taiwanensis] >gi|170937994|emb|CAP62978.1| Signal recognition particle GTPase [Cupriavidus taiwanensis] (385 aa)
Score = 558, Expect = 2.3e-55, Identities = 120/301 (39%), Positives = 183/301 (60%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++   GL K+S  L      +     KVDE+ +E +E  L+  D GV AT  +   +R+ +  + +E  + +K  + + +         T   +++ +++  +++I GVNG GKTTSI K+  HF + D+KVLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   K    D+V+ DT+GRL  +++LM+EL+K+  VI K   +APHE LLV+DA  GQ+ + Q +AF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F  E+F D +
  S:    93 QRLRTGLSKTSRNLGTLFVGV-----KVDEDLFEELETALLMADAGVEATEYLLGELRKRVKAERIETAEGVKTALRELLTRLLRPLEKT---MELGREQPLVMMIAGVNGAGKTTSIGKLCKHFQRYDQKVLLAAGDTFRAAAREQLAIWGERNNVTVVA--QESGDPAAVIFDAVNAAKARGIDIVMADTAGRLPTQLHLMEELKKVKRVISKAMPSAPHEVLLVIDANTGQNALQQTRAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKAEEFADAL 383
>gi|115373711|ref|ZP_01461005.1| cell division protein FtsY [Stigmatella aurantiaca DW4/3-1] >gi|115369258|gb|EAU68199.1| cell division protein FtsY [Stigmatella aurantiaca DW4/3-1] (527 aa)
Score = 558, Expect = 2.3e-55, Identities = 117/308 (37%), Positives = 190/308 (61%)
  Q:    41 EVLPEKQKKFDEGLKKSSST-LSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRT-------NILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++  E  +   +GL K+ S      +  +  + ++VDE     +EE+L + D+GV   + + D  RE++    + +P+ IK +I +++             +D+   R+       ++++++GVNG GKTT+I K+A     + KKV+L AGDTFRA A EQL++W++R + ++V  ++ G DP +V+F  VK+ ++    +VI DT+GRLH K  LM+EL+K+  V+ K  + APHE LLVLD+T GQ+ I QAK F E   I  I LTK+DGT+KGG+++ I D   +PV ++G+GEK+ DL  F+   FV  +
  S:   221 KIQAEAGRTLAQGLDKTKSQGFMARLNGLFGQNRQVDESVLAELEEILFTADIGVRTASNLVDLAREKLKRNELSNPERIKALIREEV----------ARIVDLPVPRSLEGGGPPHVVMVVGVNGAGKTTTIGKLAAQLTGQGKKVVLAAGDTFRAAATEQLDVWAERAQAELVKGEENG-DPGAVVFNAVKRAQEIGAHVVIADTAGRLHTKAPLMEELKKVKRVLGKALEGAPHEVLLVLDSTNGQNAIQQAKQFHEAVGINAIALTKLDGTAKGGVIIGICDELKLPVVWVGVGEKISDLRRFEPRDFVKAL 525
>gi|169830830|ref|YP_001716812.1| signal recognition particle-docking protein FtsY [Candidatus Desulforudis audaxviator MP104C] >gi|169637674|gb|ACA59180.1| signal recognition particle-docking protein FtsY [Candidatus Desulforudis audaxviator MP104C] (304 aa)
Score = 558, Expect = 2.5e-55, Identities = 130/300 (43%), Positives = 197/300 (65%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKD-KKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  + L K+   L+  +  +V     VDE  YE +EE+LI  DVGV  + ++   +RE +  Q ++DP  +K I+ D++   +    +T   L +  D T ++L++GVNG GKTTSI K+A H +++D KKVLL A DTFRA A++QL IW+ R   +++    EG DPA+V++  ++  +   YD++I DT+GRLH ++NLM+EL+K+  V+ +    AP E LLVLDAT G + + QAK F E   +TGI+LTK+DGT+KGGIV +I+++  IPVK +G GE++EDLS F   +FVDG+
  S:     6 RLKQSLTKTREVLAGKVEGLVYGRTTVDESLYEELEEILIQADVGVETSLELVARVRERMKAQKLDDPTKLKPILKDELRRIFAGGDETAN-LRLDGDPT-VILVVGVNGTGKTTSIGKLA-HLLRRDGKKVLLAAADTFRAAAIDQLEIWAHRAGVELI-RHGEGADPAAVVYDAIQAARAREYDVLIIDTAGRLHTRVNLMEELKKVFRVVSRELPGAPQEVLLVLDATTGHNAVNQAKIFGEAVGVTGIVLTKLDGTAKGGIVAAIRNSQKIPVKLVGTGERIEDLSYFHAGEFVDGL 302
>gi|194324332|ref|ZP_03058105.1| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. novicida FTE] >gi|194321397|gb|EDX18882.1| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. novicida FTE] (343 aa)
Score = 558, Expect = 2.8e-55, Identities = 137/320 (42%), Positives = 203/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I  V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   +R+++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI    ++P+++IG+GEK++DL  F+   F   +
  S:    17 KKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVAYLRDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGNRNNTHVVY-QHEGADSASVIYDAISSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALSQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLSLPLRFIGVGEKIDDLQVFNARDFTTAL 338
>gi|182704869|ref|ZP_02957268.1| signal recognition particle-docking protein FtsY [Methylocella silvestris BL2] >gi|172066082|gb|EDT52217.1| signal recognition particle-docking protein FtsY [Methylocella silvestris BL2] (374 aa)
Score = 558, Expect = 2.8e-55, Identities = 110/300 (36%), Positives = 186/300 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  +GL +SS ++   +  I  K +K+D    + +EE+LI  D+GV     I   + +    +++E  D +K I+   V+++   Y +  + +  +     +  ++L++GVNG GKTT+I K+A  F ++ +KVLL AGDTFRA A+EQL +W  RL C  V+   +G D +++ F  ++  ++   D++I DT+GRL N+  LM ELEKI  V+ K +  APH  LLVLDAT+GQ+ + Q + F ++  +TG+++TK+DGT++GGI++++ + F +P+ Y+G+GE   DL+ F    F   I
  S:    69 RLRQGLARSSDSIGSGLKAIFTK-RKLDAAMLDELEEVLIRADLGVATATHIAGLVGKGRYDKSIE-VDEVKTILAEEVERVLAPYARPLEIDPAI-----KPFVILVVGVNGSGKTTTIGKLAAQFSQEGRKVLLAAGDTFRAAAIEQLRLWGDRLNC-AVIAGNQGSDASALAFDAIRAARESGADILIMDTAGRLQNRAELMAELEKIVRVMKKVEPAAPHAVLLVLDATVGQNAVSQTEIFSKVAGVTGLVMTKLDGTARGGILVALAEKFQLPIHYVGVGETAADLAPFAARDFARAI 363
>gi|28198783|ref|NP_779097.1| cell division protein [Xylella fastidiosa Temecula1] >gi|182681482|ref|YP_001829642.1| signal recognition particle-docking protein FtsY [Xylella fastidiosa M23] >gi|28056874|gb|AAO28746.1| cell division protein [Xylella fastidiosa Temecula1] >gi|182631592|gb|ACB92368.1| signal recognition particle-docking protein FtsY [Xylella fastidiosa M23] (397 aa)
Score = 558, Expect = 2.8e-55, Identities = 113/290 (38%), Positives = 173/290 (59%)
  Q:    59 STLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           S  ++ I  +     ++DE   + IE  LI+ DVGV  TN I D +R+ +  +   D   +   + +++ T        +  L +K+D    + L++GVNGVGKTT+I K+A  F +    ++L AGDTFRA AV QL  W +R    ++       D ASV++  ++  K  + +++I DT+GRLH +I LM EL KI  V+ K D TAPHE L+V+D T GQ+ + Q + F    N+TGI++TK+DGT+KGG+V ++   F IP+ +I +GE+LED+  FD E FVD +
  S:   102 SLFARNINALFSNNPRLDENLLDEIETALITADVGVSTTNAIVDGLRKRMKAREFADIQTLLAALRNELITIL---RPVSKPLIVKRDALPFVFLVVGVNGVGKTTTIGKLAKWFKRDGYSLMLAAGDTFRAAAVAQLQAWGERNSITVIAQKGPNADAASVVYDALQAAKARSIEVLIADTAGRLHTQIGLMNELSKIRRVLGKLDSTAPHEVLMVIDGTTGQNALSQLRQFHAAVNVTGIVVTKLDGTAKGGVVFTLAREFGIPIHFISIGEQLEDMHFFDPEAFVDAL 389
>gi|90023237|ref|YP_529064.1| signal recognition particle-docking protein FtsY [Saccharophagus degradans 2-40] >gi|89952837|gb|ABD82852.1| signal recognition particle-docking protein FtsY [Saccharophagus degradans 2-40] (375 aa)
Score = 558, Expect = 2.9e-55, Identities = 128/315 (40%), Positives = 197/315 (62%)
  Q:    34 EKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-----ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E Q+E L V      +   GL ++S+  +  ++ ++   K +D+E  E IE LL+  DVG+ AT  I + + + +  + + D + + + + + +     Q        D+++         ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W +R K   V+    G D ASVIF  V+  +    D++I DT+GRLHNK NLM+EL K+  V+ K D+TAPHE LLVLDA  GQ+ + QA  FK+  ++TG++LTK+DGT+KGGI+ ++    NIPV+YIG+GE ++DL  FD +KF + +
  S:    59 EPQSEKLGVF----ARIKRGLSRTSNQFANGLSNLLLGKKAIDDELLEEIETLLLMADVGMDATTDIIEDLTDRVARKQLNDSEALYDALRESLAKLLQQ---VEVPFDLEQSHAPLPSPYVILVVGVNGVGKTTTIGKLAKRYQNQGKSVILAAGDTFRAAAVEQLQVWGERNKVP-VIAQHSGADSASVIFDAVQSAQARGIDVLIADTAGRLHNKSNLMEELAKVKRVMGKLDNTAPHEVLLVLDAGTGQNAVSQADHFKKAADVTGLVLTKLDGTAKGGIIFALSKKHNIPVRYIGVGESVDDLQPFDAKKFTEAL 370
>gi|88714068|ref|ZP_01108146.1| putative recognition particle-docking protein [Flavobacteriales bacterium HTCC2170] >gi|88707583|gb|EAQ99825.1| putative recognition particle-docking protein [Flavobacteriales bacterium HTCC2170] (318 aa)
Score = 558, Expect = 3.0e-55, Identities = 129/302 (42%), Positives = 194/302 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVD 346
           +K++  D+GL+KS ++    +++ V    KVD++  +N+EE+L++ DVGV  T KI + I   ++       D + +I+ ++I     + +    T   I  D+   +++++GVNGVGKTT+I K+A  F K+  KV+L A DTFRA A++QL +W+ R+   IV   K G DPASV F  +     ++ D+VI DT+GRLHNK+NLM EL K+  V+ K  D  PH+ LLVLD + GQ+   QAK F + T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL  F+  +FVD
  S:    11 QKKESLDKGLEKSKTSFFSKLSKAVAGKSKVDDDVLDNLEEVLVTSDVGVDTTLKIIERIEARVSEDKYMGTDELNKILREEIAGLLSETNIGEETEYSIPADKKPYVIMVVGVNGVGKTTTIGKLAYQFKKQGLKVVLGAADTFRAAAIDQLQVWADRVDVPIV-KQKMGSDPASVAFDTLSSAVTQDADVVIIDTAGRLHNKVNLMNELTKVKRVMQKVVDDTPHDVLLVLDGSTGQNAFEQAKQFTKATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIEDLQVFNKYEFVD 313
>gi|125973443|ref|YP_001037353.1| signal recognition particle-docking protein FtsY [Clostridium thermocellum ATCC 27405] >gi|196253276|ref|ZP_03151910.1| signal recognition particle-docking protein FtsY [Clostridium thermocellum DSM 4150] >gi|125713668|gb|ABN52160.1| signal recognition particle-docking protein FtsY [Clostridium thermocellum ATCC 27405] >gi|196197291|gb|EDX92154.1| signal recognition particle-docking protein FtsY [Clostridium thermocellum DSM 4150] (302 aa)
Score = 557, Expect = 3.4e-55, Identities = 134/300 (44%), Positives = 205/300 (68%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRT-NILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  EGLKK+ +T+++ I +++  F K+DEE +E +EE+LI+ DVG+  + KI + ++  +      DP  +KE++ +++     Q        D+K D T +++L++GVNGVGKTTSI KIAN    + KKV+L AGDTFRA A++QL IW+ R+  +I+    EG DPA+VI+  ++  K    D++ICDT+GRLH K NLM+EL+K+  ++ +       E LLVLDAT GQ+ I QAK F E+T++TGI+LTK+DGT+KGGI++++    NIPVK IG+GE+++DL  F+  +FV+ +
  S:     6 KLKEGLKKTKNTITERIDKVLVSFGKIDEELFEELEEILITSDVGIDTSMKIIENLKNRVKETKTTDPAKVKELLKEELAQILSQGES-----DLKLDTTPSVILVVGVNGVGKTTSIGKIANLLKSQGKKVILAAGDTFRAAAIDQLEIWANRVGVEII-KQAEGSDPAAVIYDAIQAVKARKADVLICDTAGRLHTKKNLMEELKKVFRIVDRELPGVSREVLLVLDATTGQNAISQAKTFSEVTDVTGIVLTKLDGTAKGGIIIAVASELNIPVKLIGVGEQMDDLQRFNAREFVEAL 300
>gi|151571230|gb|EDN36884.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. novicida GA99-3549] (343 aa)
Score = 557, Expect = 3.5e-55, Identities = 137/320 (42%), Positives = 203/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I  V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   +R+++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI    ++P+++IG+GEK++DL  F+   F   +
  S:    17 KKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVAYLRDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGDRNNTQVVY-QHEGADSASVIYDAISSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALSQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLSLPLRFIGVGEKIDDLQVFNARDFTTAL 338
>gi|51246788|ref|YP_066672.1| cell division protein FtsY [Desulfotalea psychrophila LSv54] >gi|50877825|emb|CAG37665.1| probable cell division protein FtsY [Desulfotalea psychrophila LSv54] (470 aa)
Score = 557, Expect = 3.8e-55, Identities = 129/301 (42%), Positives = 190/301 (63%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK    L KS    +  +  +    K++D    +++EELLI  D+GV  T++I +  R +   + + DP  +KE I  KI ++ I++   +  L + +    I++++GVNGVGKTT+I KIA  F+     V+LVA DTFRA AV QL IW +R +   V   +EG DP+SV +  + K   E YD+V+ DT+GRLH + NLM+EL+KI  VI K    APHE +LV+DAT GQ+GI QAK F +   ITGI LTK+DGT+KGGIV +I    + P+++IG+GE+++DL  FD  +F++ +
  S:   166 KKLSARLAKSREAFTYQLDSLFLGKKEIDTNLLDDLEELLIMADLGVSTTDEILEFARRKAKRKELSDPAALKEAIKTKIASF-IEEAQEDAELVMPESGPFIIMVIGVNGVGKTTTIGKIAKKFVNSGNSVMLVAADTFRAAAVSQLKIWGERNEVP-VFSRQEGADPSSVAYDAIAKAVAEEYDVVLIDTAGRLHTQTNLMEELKKIKRVIGKNCAGAPHEIMLVIDATTGQNGISQAKLFNDAVGITGITLTKLDGTAKGGIVANISRELDTPIRFIGIGEQIDDLRDFDHNEFIEAL 464
>gi|160946003|ref|ZP_02093229.1| hypothetical protein FAEPRAM212_03536 [Faecalibacterium prausnitzii M21/2] >gi|158443734|gb|EDP20739.1| hypothetical protein FAEPRAM212_03536 [Faecalibacterium prausnitzii M21/2] (312 aa)
Score = 556, Expect = 4.1e-55, Identities = 131/302 (43%), Positives = 189/302 (62%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVG----VLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVD 346
           +++ K   GL+K+ +    +I   +     +D+E Y+++EE LI  DVG    V   +K+ D +R++      +  D +++II +++        +    LD K     ++L++GVNGVGKTTSIAK+A+++ ++ K+V+L AGDTFRA A EQL IW+ R    IV    EG DPA+VIF  VK      YD+VI DT+GRLHNK NLM EL KI   + K    A  E LLVLDA  GQ+ I QAK F +  + TGIILTK+DGT+KGG V+++K    +PV++IG+GE ++DL  F  E FV+
  S:     9 KEKDKMKTGLEKTRTGFWGSIMNTLTG-SVIDDEMYDDLEEQLILADVGGEVAVHLVDKLRDRVRDKGLKTGEQAADALRDIIAEEM------TPEAEMALDGKP---AVILVIGVNGVGKTTSIAKLADYYTRQGKRVMLAAGDTFRAAASEQLEIWASRAGVPIV-SAGEGADPAAVIFDTVKSATARGYDMVIADTAGRLHNKSNLMAELSKISRSVKKASPEASLETLLVLDAITGQNAISQAKEFCKAADATGIILTKLDGTAKGGCVVAVKQRLGLPVRFIGVGEGIDDLLPFTPEGFVE 303
>gi|73540040|ref|YP_294560.1| signal recognition particle-docking protein FtsY [Ralstonia eutropha JMP134] >gi|72117453|gb|AAZ59716.1| signal recognition particle-docking protein FtsY [Ralstonia eutropha JMP134] (382 aa)
Score = 556, Expect = 4.5e-55, Identities = 119/301 (39%), Positives = 179/301 (59%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++   GL K+S  +S     +     KVDE  +E +E  L+  D GV AT  +   +R+ +    +E  + +K  + D +         T   +++ +++  +++I GVNG GKTTSI K+  HF    + VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +    D+V+ DT+GRL  +++LM+EL+K+  VI K   TAPHE LLV+DA  GQ+ + Q +AF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F  E+F D +
  S:    90 QRLRTGLSKTSRNISTLFVGM-----KVDEALFEELETALLMADAGVEATEYLLGELRKRVRSDRIESAEGVKAALRDLLIQLLRPLEKT---MELGREQPLVMMIAGVNGAGKTTSIGKLCKHFQHYGQSVLLAAGDTFRAAAREQLTIWGERNNVTVVA--QESGDPAAVIFDAVNAARARGIDIVMADTAGRLPTQLHLMEELKKVKRVISKAMPTAPHEVLLVIDANTGQNALAQTRAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKAEEFADAL 380
>gi|84683623|ref|ZP_01011526.1| signal recognition particle-docking protein FtsY [Rhodobacterales bacterium HTCC2654] >gi|84668366|gb|EAQ14833.1| signal recognition particle-docking protein FtsY [Rhodobacterales bacterium HTCC2654] (453 aa)
Score = 556, Expect = 4.5e-55, Identities = 116/286 (40%), Positives = 185/286 (64%)
  Q:    64 AITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           A T +V++   +D++  E++EEL+I+ D+GV    +++  I E    + V   + IKEI+  +I             L +  +R  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W +R     VL   EG DPAS+ F  + K + +  DL++ DT+GRL N+ +LM EL KI  VI K DD+APH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD + F   +T
  S:   173 AKTTVVRRV--LDDDMLESLEELMIASDMGVDTALRVSANIAEGRLGRKVSVEE-IKEILAKEIARVM---EPVAKPLPLYPNRPQVVLVVGVNGAGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQLQVWGERAGVP-VLTAPEGSDPASLAFDALTKARADGADLLMIDTAGRLQNREDLMAELAKIVRVIKKIDDSAPHNTLLVLDATTGQNALSQVQTFQKLADVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPDDFAKALT 451
>gi|110679220|ref|YP_682227.1| signal recognition particle-docking protein FtsY [Roseobacter denitrificans OCh 114] >gi|109455336|gb|ABG31541.1| signal recognition particle-docking protein FtsY [Roseobacter denitrificans OCh 114] (512 aa)
Score = 556, Expect = 4.8e-55, Identities = 116/276 (42%), Positives = 177/276 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +D++  E +EELLIS D+GV    ++   + E    + +   + IKE++  +I             L +      ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + K + +  DL++ DT+GRL N+ +LM+EL KI  VI K D+TAPH  LLVLDAT GQ+ + Q K F +I++++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL AFD E F D +
  S:   236 RTLDDDMLEQLEELLISADMGVDTALRVVANMAEGRVGKKLSVQE-IKELLASEIAQIM---EPVAKPLPLYPRTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKKVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMLKAQRDGADLLLIDTAGRLQNRTDLMEELAKIVRVIRKNDETAPHNTLLVLDATTGQNALNQVKVFSDISDVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLDAFDPEDFADAL 506
>gi|54295510|ref|YP_127925.1| hypothetical protein lpl2597 [Legionella pneumophila str. Lens] >gi|53755342|emb|CAH16838.1| hypothetical protein [Legionella pneumophila str. Lens] (355 aa)
Score = 556, Expect = 5.0e-55, Identities = 130/344 (37%), Positives = 207/344 (60%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQK----KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +FK+  N          +D +    E  +E+  E+    P  ++    +F +GL K+   L + I+ ++   K++ +E  E +E LLIS D+G+  T  +   + E +  + + + D + + +   + T   Q+    + ++ +     ++L++GVNG GKTT+I K+A  F K+ KKV+L AGDTFRA AVEQL++W +R     V+    G D ASVIF  ++  K    D++I DT+GRLH + NLM+EL+K+  V+ K D  APHE +LVLDA++GQ+ + QAK F E   +TGI +TK+DGT+KGGI+ +I ++  IP +Y+G+GE +EDL  FD  +FV  I
  S:     4 WFKRNQNSEPNLDTEEQQDHAESSRESRLEEPRELTAKEPSPKESIFARFRKGLSKTRHQLGEGISRLLLGKKEISQELLEELETLLISADLGLDTTQDVLKQLNEGLARKQLSNGDAVYQTLKTNLQTILSQEEKPLS-IETEDGSPFVILMVGVNGAGKTTTIGKLAKQFQKQGKKVMLAAGDTFRAAAVEQLHVWGERNGIP-VIAQHTGADSASVIFDALQAAKARKIDVLIADTAGRLHTQSNLMEELKKVKRVMQKLDPKAPHETMLVLDASIGQNALAQAKQFHEAVQLTGITMTKLDGTAKGGILFAIANDLGIPFRYLGVGEGIEDLRPFDAAQFVSAI 349
>gi|162148087|ref|YP_001602548.1| cell division protein ftsY [Gluconacetobacter diazotrophicus PAl 5] >gi|187598016|ref|ZP_02984272.1| signal recognition particle-docking protein FtsY [Gluconacetobacter diazotrophicus PAl 5] >gi|161786664|emb|CAP56247.1| Cell division protein ftsY [Gluconacetobacter diazotrophicus PAl 5] >gi|187490118|gb|EDU28063.1| signal recognition particle-docking protein FtsY [Gluconacetobacter diazotrophicus PAl 5] (326 aa)
Score = 555, Expect = 5.1e-55, Identities = 126/305 (41%), Positives = 196/305 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIRE-----EITFQNVEDPDLIKEI--IVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +   GL +S+  L   I  +  + +K+D+E  E +E+LLIS D+G     +I ++ R      E+T   V D  L  EI  +++ +   ++ D          + + +++L++GVNG GKTT+I K+A ++ ++  KV++VAGDTFRA AVEQL +W QR+    V+      D A + F  +K+G+ E  DL++ DT+GRLHNK  LM+EL KI  V+ KFD++APH  LLVLDAT GQ+ I Q + FKE+ N+TG+++TK+DG+++GGIV+++ D F +PV  +G+GE+ EDL  F  E F  G+  + V
  S:     8 RLKAGLSRSTQKLGGGIAAVFTR-RKLDDEALEELEDLLISADLGPAVAARIIESFRHSRFGAEVTDDEVRDA-LSAEIAQVLEPVAVPFVPD---------PQRKPHVVLVVGVNGTGKTTTIGKMARYYGEQGLKVMMVAGDTFRAAAVEQLQVWGQRVGAP-VIAGPPNADAAGLAFEALKRGQAEGCDLLLIDTAGRLHNKGALMEELAKIIRVMRKFDESAPHSVLLVLDATTGQNAIEQVRVFKELVNVTGLVVTKLDGSARGGIVVALADTFGLPVHAVGVGEQAEDLRPFSAEAFARGLVGDSV 307
>gi|15595570|ref|NP_249064.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa PAO1] >gi|9946225|gb|AAG03762.1|AE004475_4 signal recognition particle receptor FtsY [Pseudomonas aeruginosa PAO1] (455 aa)
Score = 555, Expect = 5.2e-55, Identities = 120/303 (39%), Positives = 194/303 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K++D++  ++IE  L++ DVGV AT  I   + + +  + + D   + + + +++ +  ++  +    +D+ ++   ++L++GVNGVGKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D+TAPHE LLVLDA  GQ+ I QAK F     +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ + FV  +  E
  S:   152 RLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEELASL-LRPVEQPLQVDVARE-PYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAE 451
>gi|116054103|ref|YP_788546.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa UCBPP-PA14] >gi|115589324|gb|ABJ15339.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa UCBPP-PA14] (451 aa)
Score = 555, Expect = 5.2e-55, Identities = 120/303 (39%), Positives = 194/303 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K++D++  ++IE  L++ DVGV AT  I   + + +  + + D   + + + +++ +  ++  +    +D+ ++   ++L++GVNGVGKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D+TAPHE LLVLDA  GQ+ I QAK F     +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ + FV  +  E
  S:   148 RLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEELASL-LRPVEQPLQVDVARE-PYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAE 447
>gi|163746083|ref|ZP_02153442.1| signal recognition particle-docking protein FtsY [Oceanibulbus indolifex HEL-45] >gi|161380828|gb|EDQ05238.1| signal recognition particle-docking protein FtsY [Oceanibulbus indolifex HEL-45] (461 aa)
Score = 555, Expect = 5.5e-55, Identities = 116/272 (42%), Positives = 179/272 (65%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           + +D++  E +EELLIS D+GV    ++T A   E  F        IK+++  ++    I +      L I      ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W +R     VL    G DPAS+ F  + + ++E  DL++ DT+GRL N+ +LM+EL KI  VI K D+TAPH  LLVLDAT GQ+ + Q K F+EI++++G+++TK+DGT+KGG+++++ D F +P+  +G+GE+++DLS FD ++F
  S:   186 RTLDDDMLEQLEELLISADMGVDTALRVT-ANMAEGRFGKKLSVGEIKQLLATEV--SRIMEPVARP-LPIYSKTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKKVVIAAGDTFRAAAVEQLQVWGERAGVP-VLTAAHGSDPASLAFDAMGRAQEEGADLLLIDTAGRLQNRGDLMEELAKIVRVIRKKDETAPHNTLLVLDATTGQNALNQVKVFQEISDVSGLVMTKLDGTAKGGVLVALADRFGLPIHAVGVGEQIDDLSPFDPDEF 452
>gi|71901777|ref|ZP_00683846.1| Cell division transporter substrate-binding protein FtsY [Xylella fastidiosa Ann-1] >gi|71728460|gb|EAO30622.1| Cell division transporter substrate-binding protein FtsY [Xylella fastidiosa Ann-1] (397 aa)
Score = 555, Expect = 5.5e-55, Identities = 113/290 (38%), Positives = 173/290 (59%)
  Q:    59 STLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           S  ++ I  +     ++DE   + IE  LI+ DVGV  TN I D +R+ +  +   D   +   + +++ T        +  L +K+D    + L++GVNGVGKTT+I K+A  F +    ++L AGDTFRA AV QL  W +R    ++       D ASV++  ++  K  + +++I DT+GRLH +I LM EL KI  V+ K D TAPHE L+V+D T GQ+ + Q + F    N+TGI++TK+DGT+KGG+V ++   F IP+ +I +GE+LED+  FD E FVD +
  S:   102 SLFARNINALFSNNPRLDENLLDEIETALITADVGVSTTNAIVDGLRKRMKAREFADIQTLLAALRNELITIL---RPVSKPLIVKRDALPFVFLVVGVNGVGKTTTIGKLAKWFKRDGYSLMLAAGDTFRAAAVAQLQAWGERNSITVIAQKGPNADAASVVYDALQAAKARSIEVLIADTAGRLHTQIGLMNELSKIRRVLGKLDSTAPHEVLMVIDGTTGQNALSQLRQFHVAVNVTGIVVTKLDGTAKGGVVFTLAREFGIPIHFISIGEQLEDMHFFDPEAFVDAL 389
>gi|134301331|ref|YP_001121299.1| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. tularensis WY96-3418] >gi|187931064|ref|YP_001891048.1| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. mediasiatica FSC147] >gi|134049108|gb|ABO46179.1| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. tularensis WY96-3418] >gi|187711973|gb|ACD30270.1| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. mediasiatica FSC147] (331 aa)
Score = 555, Expect = 5.9e-55, Identities = 137/320 (42%), Positives = 202/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I  V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   +R+++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI     +P+++IG+GEK++DL  F+   F   +
  S:     5 KKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVTYLRDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGDRNNTHVVY-QHEGADSASVIYDAIGSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTAL 326
>gi|56707294|ref|YP_169190.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669764|ref|YP_666321.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. tularensis FSC198] >gi|56603786|emb|CAG44753.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320097|emb|CAL08136.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. tularensis FSC 198] >gi|151568222|gb|EDN33876.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. tularensis FSC033] (343 aa)
Score = 555, Expect = 5.9e-55, Identities = 137/320 (42%), Positives = 202/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I  V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   +R+++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI     +P+++IG+GEK++DL  F+   F   +
  S:    17 KKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVTYLRDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGDRNNTHVVY-QHEGADSASVIYDAIGSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTAL 338
>gi|119503518|ref|ZP_01625601.1| signal recognition particle-docking protein FtsY [marine gamma proteobacterium HTCC2080] >gi|119460580|gb|EAW41672.1| signal recognition particle-docking protein FtsY [marine gamma proteobacterium HTCC2080] (339 aa)
Score = 554, Expect = 6.6e-55, Identities = 125/337 (37%), Positives = 189/337 (56%)
  Q:    12 KLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQ-KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  G+KE   +   ++  +      AE+L V  +    +F  GL ++    S  I  +    K +DE   E +E+ L++ DVG+ AT +I   I E I+ + + D   + E     +       T     L    ++  ++L++GVNG GKTT+I K+A+ F  + K+V+L AGDTFRA AVEQL  W +R +   V+    G D ASV+F  V+  K    D++I DT+GRL NK +LM ELEK+  V+ K D  APHE LLVLDA  GQ+ + QA+ F     +TGI L+K+DGT++GG++ +I      P++++G+GE + DL  FD   FV  +
  S:     2 KFFGRKEKPEKTAQSQPADTLSTAPAELLSVDEQGMFSRFRRGLSRTGGQFSNGIGALFLGRKVIDENVLEALEDQLLTADVGIEATQRIVSDITERISRKELSDGAAVMEATKSALLDIL---TPCEQPLAPDDNKPFVILVVGVNGAGKTTTIGKLAHRFKAEGKQVMLAAGDTFRAAAVEQLQAWGERNEVP-VIAQHTGADSASVLFDAVQAAKARGVDILIADTAGRLQNKSHLMDELEKVVRVMRKVDPQAPHETLLVLDAGTGQNAVSQAEEFDRTVGVTGIALSKLDGTARGGVIFAIAQRLARPIRFVGIGEAVTDLQPFDANAFVSAL 335
>gi|167758290|ref|ZP_02430417.1| hypothetical protein CLOSCI_00628 [Clostridium scindens ATCC 35704] >gi|167664187|gb|EDS08317.1| hypothetical protein CLOSCI_00628 [Clostridium scindens ATCC 35704] (314 aa)
Score = 554, Expect = 7.0e-55, Identities = 130/301 (43%), Positives = 200/301 (66%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K+   GL K+   +   I  I   F  +D++FYE +EE+LI  D+GV AT  I + ++ ++  Q++++P   +++++D I     +  D        +D+T++++++GVNGVGKTT+I K+A     ++KKV+L A DTFRA A EQL  W+ R + D++   +EG DPASV++  V   K  + D+++CDT+GRLHNK NLM+EL+K++ +I +    A  E L+VLDAT GQ+ + QA+ F E+ +ITGIILTKMDGT+KGGI ++I+    IPVKYIG+GE +EDL  FD + FV+ +
  S:    13 KRLVSGLGKTRDNIVSGIDSIFSGFSHIDDDFYEELEEVLIMGDLGVTATYDILEDLKAKVKEQHIKEPSQCRQLLIDSI----KEQMDVGETAYEFEDQTSVVMVIGVNGVGKTTTIGKLAGKLRAQNKKVVLAAADTFRAAAGEQLKEWANRAQADLI-GGQEGSDPASVVYDAVAAAKARHADVLLCDTAGRLHNKKNLMEELKKMNRIIDREYPEAFRETLVVLDATTGQNALQQAREFNEVADITGIILTKMDGTAKGGIAVAIQAELGIPVKYIGVGETIEDLQKFDADTFVNAL 308
>gi|160882777|ref|ZP_02063780.1| hypothetical protein BACOVA_00738 [Bacteroides ovatus ATCC 8483] >gi|156111801|gb|EDO13546.1| hypothetical protein BACOVA_00738 [Bacteroides ovatus ATCC 8483] (319 aa)
Score = 554, Expect = 7.7e-55, Identities = 134/307 (43%), Positives = 182/307 (59%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL K+  ++   I   V    KVD+E  +N+EE+LI+ DVGV  T  I   I +        +   +  I+ D+I     ++   D   F      +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL IW +R+   +V   K G DPASV +  +      N D+VI DT+GRLHNK+ LM EL KI +V+ K    AP E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIGLGE +EDL  F   +FVD +  E
  S:    10 EKKETLDKGLSKTKESVFSKIARAVAGKSKVDDEVLDNLEEVLITSDVGVETTLNIIKRIEKRAAADKYVNTQELNLILRDEIAALLTENNSGDVADFDVPIARKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKSVYLGAADTFRAAAVEQLMIWGERVGVPVV-KQKMGADPASVAYDTLSSAVANNADVVIIDTAGRLHNKVGLMNELTKIKNVMKKVVPDAPDEVLLVLDGSTGQNAFEQAKQFTLATEVTAMAITKLDGTAKGGVVIGISDQFKIPVKYIGLGEGMEDLQVFRKNEFVDSLFGE 317
>gi|194333177|ref|YP_002015037.1| signal recognition particle-docking protein FtsY [Prosthecochloris aestuarii DSM 271] >gi|194310995|gb|ACF45390.1| signal recognition particle-docking protein FtsY [Prosthecochloris aestuarii DSM 271] (315 aa)
Score = 554, Expect = 7.8e-55, Identities = 135/303 (44%), Positives = 191/303 (63%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD---RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +  +GL K+  T+   I+ + +   ++DEEF E +E +LI+ DVGV  T  I D I E    +     D +  +++ ++    + D   +  +D       +  ++LI+GVNGVGKTTSIAK+A+++ K  KKV++ A DTFRA AVEQL IW+ R    +V    +G DPASV+F  V        D+V+ DT+GRLHNK  LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F +  N+TG+I+TK+DGT+KGGIVLSI  + ++PVKYIG+GEK++DL  FD  KFV  +
  S:     8 KLSRLKDGLTKTRETIRDNISRLTQGRTEIDEEFLEELENILIAADVGVETTLSIVDRITERAKEETYRSEDELNNMLL-QVMQEMLLDASEDHPVDFDASLPAKPYVILIVGVNGVGKTTSIAKLAHNYHKSGKKVMIAAADTFRAAAVEQLQIWADRAGVPMV-SQGQGADPASVVFDAVSSAVAREADVVLVDTAGRLHNKAYLMEELAKIMRVAKKKVPEAPHEVLLVLDGTTGQNAVSQAREFTKCVNVTGLIITKLDGTAKGGIVLSISRDLHLPVKYIGVGEKIDDLQIFDRSKFVGAL 311
>gi|27262314|gb|AAN87438.1| signal recognition particle receptor FtsY [Heliobacillus mobilis] (364 aa)
Score = 554, Expect = 8.0e-55, Identities = 110/266 (41%), Positives = 173/266 (65%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVL 314
           +  EGL ++   L   +  +V    K+D++ Y+ +EE LIS DVG   + ++ + +R ++  Q + DP L++ ++ ++I      +           ++  ++LI+GVNGVGKTT+IAK+A+ + ++ +KVLL AGDTFRA A++QL IW QR+  + V+  +EG DP++V F  V+  K    D++I DT+GRLHNK +LM EL KI+ V+ +    APHE LLVLDAT GQ+ + QA+ F E   +TG++LTK+DGT+KGG++L
  S:     7 RLKEGLTRTRQNLVDKVEALVTGRTKIDDDLYDELEEALISADVGAETSIELVERLRRKVKEQKISDPSLLQGLLQEEIAAILGGEAIPVNL----GNQPTVILIVGVNGVGKTTTIAKLAHRWKQEGRKVLLAAGDTFRAAAIDQLEIWGQRVGVE-VIRHQEGADPSAVAFDAVQAAKSRESDVLIIDTAGRLHNKSHLMNELSKINRVLGRAMPGAPHETLLVLDATTGQNALSQARIFGEAVGLTGLVLTKLDGTAKGGVIL 267
>gi|53802591|ref|YP_112672.1| cytochrome oxidase assembly family protein/cell division protein FtsY [Methylococcus capsulatus str. Bath] >gi|53756352|gb|AAU90643.1| cytochrome oxidase assembly family protein/cell division protein FtsY [Methylococcus capsulatus str. Bath] (671 aa)
Score = 554, Expect = 8.2e-55, Identities = 118/298 (39%), Positives = 178/298 (59%)
  Q:    54 LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           L K+ S+L+  ++ + +   ++D    + IEE L+  DVGV  T +I   +  ++  Q  E  D        +     I    +   +   + R  ++L++GVNGVGKTT+I K+A     +   V+L AGDTFRA AVEQL  W +R K   V+    G D ASVI+  V+  +    D++I DT+GRLH K NLM+EL KI  +I + D+TAPHE LLVLDA  GQ+ + QA+ F E   +TG++LTK+DGT+KGG++ ++   F IP+++IG+GE ++DL  FD  +F+D +  E
  S:   369 LGKTRSSLTGLLSALGRG--RIDRALLDEIEEQLLMADVGVPVTREIIADLGSDLDRQ--EPADGRALRDRLRGRLLDIVRPCSVPLVIPPEVRPFVILVVGVNGVGKTTTIGKLAKRLQNEGHSVMLAAGDTFRAAAVEQLQTWGERNKI-AVIAQHSGADSASVIYDAVEAARARGVDILIADTAGRLHTKSNLMEELSKIKRIIGRLDETAPHEVLLVLDAGTGQNALSQARLFNEAVGLTGLVLTKLDGTAKGGVIFALARQFGIPIRFIGIGEGIDDLRDFDAVQFIDALFAE 661
>gi|183598034|ref|ZP_02959527.1| hypothetical protein PROSTU_01390 [Providencia stuartii ATCC 25827] >gi|188022813|gb|EDU60853.1| hypothetical protein PROSTU_01390 [Providencia stuartii ATCC 25827] (640 aa)
Score = 553, Expect = 9.1e-55, Identities = 130/327 (39%), Positives = 199/327 (60%)
  Q:    22 EDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E LS + E K  E++    E    + KK   GL K+   L      +    KK+D++ ++ +EE L+  DVGV  T KI D +    + + ++D + +   + +++          +  L I+  +  ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W +R +  +V     G DPASVIF  ++  K +  D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L LDA+ GQ+ + QAK F +   +TGI LTK+DGT+KGG++ SI D F IP++YIG+GE +EDL  F  + F++ +
  S:   317 EVLSEQEEPKQTEQEKPKKEGFFARLKK---GLLKTRQNLGSGFLGLFTG-KKIDDDLFDELEEQLLIADVGVDTTRKIIDNLTAHASRKELKDAEALYSKLREEMSDIL---AGVDKPLVIEDKKPYVILMVGVNGVGKTTTIGKLARQYQSEGKTVMLAAGDTFRAAAVEQLQVWGERNRIPVV-AQHTGADPASVIFDAIQSAKAKGVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEEAPHEIMLTLDASTGQNAVSQAKLFNDAVGLTGITLTKLDGTAKGGVIFSIADQFGIPIRYIGIGEGIEDLRPFKADDFIEAL 635
>gi|151572685|gb|EDN38339.1| hypothetical protein FTDG_01149 [Francisella tularensis subsp. novicida GA99-3548] (343 aa)
Score = 553, Expect = 9.1e-55, Identities = 137/320 (42%), Positives = 202/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I  V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   +R+++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI     +P+++IG+GEK++DL  F+   F   +
  S:    17 KKKNTEIESPIERVQEQDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVAYLRDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQK-LPFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGDRNNTQVVY-QHEGADSASVIYDAISSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTAL 338
>gi|114763008|ref|ZP_01442438.1| Signal recognition particle-docking protein FtsY [Roseovarius sp. HTCC2601] >gi|114544332|gb|EAU47340.1| Signal recognition particle-docking protein FtsY [Roseovarius sp. HTCC2601] (462 aa)
Score = 553, Expect = 9.3e-55, Identities = 112/275 (40%), Positives = 177/275 (64%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           +D++  E++EELLI+ D+GV    +++  I E    + V   + IK  +  ++    + D      L +   +  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + K + E  DL++ DT+GRL N+ +LM+EL KI  VI K D  APH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F   +T
  S:   188 LDDDMLESLEELLIASDMGVDTALRVSANIAEGRYGKRVSTQE-IKAALAAEVAR--VMDPVAKP-LPLYPKKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRQDLMEELAKIVRVIRKKDPDAPHNTLLVLDATTGQNALTQVEIFRQVADVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEEFAAALT 457
>gi|157149052|ref|YP_001456371.1| cell division protein FtsY [Citrobacter koseri ATCC BAA-895] >gi|157086257|gb|ABV15935.1| hypothetical protein CKO_04891 [Citrobacter koseri ATCC BAA-895] (500 aa)
Score = 553, Expect = 9.9e-55, Identities = 131/315 (41%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++  + EV+ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + + D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ I QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   178 EEETPVEEVIQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLHDAEALYGLLKDEMGDILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKAHLMEELKKIVRVMKKLDEDAPHEVMLTIDASTGQNAISQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 495
>gi|71275807|ref|ZP_00652091.1| Cell division transporter substrate-binding protein FtsY [Xylella fastidiosa Dixon] >gi|71900406|ref|ZP_00682539.1| Cell division transporter substrate-binding protein FtsY [Xylella fastidiosa Ann-1] >gi|170730211|ref|YP_001775644.1| cell division protein [Xylella fastidiosa M12] >gi|71163385|gb|EAO13103.1| Cell division transporter substrate-binding protein FtsY [Xylella fastidiosa Dixon] >gi|71729838|gb|EAO31936.1| Cell division transporter substrate-binding protein FtsY [Xylella fastidiosa Ann-1] >gi|167965004|gb|ACA12014.1| cell division protein [Xylella fastidiosa M12] (397 aa)
Score = 553, Expect = 9.9e-55, Identities = 112/290 (38%), Positives = 173/290 (59%)
  Q:    59 STLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           S  ++ I  +     ++DE   + IE  LI+ DVGV  TN I D +R+ +  +   D   +   + +++ T        +  L +K+D    + L++GVNGVGKTT+I K+A  F +    ++L AGDTFRA AV QL  W +R    ++       D ASV++  ++  K  + +++I DT+GRLH +I LM EL KI  V+ K D TAPHE L+V+D T GQ+ + Q + F    N+TG+++TK+DGT+KGG+V ++   F IP+ +I +GE+LED+  FD E FVD +
  S:   102 SLFARNINALFSNNPRLDENLLDEIETALITADVGVSTTNAIVDGLRKRMKAREFADIQTLLAALRNELITIL---RPVSKPLIVKRDALPFVFLVVGVNGVGKTTTIGKLAKWFKRDGYSLMLAAGDTFRAAAVAQLQAWGERNSITVIAQKGPNADAASVVYDALQAAKARSTEVLIADTAGRLHTQIGLMNELSKIRRVLGKLDSTAPHEVLMVIDGTTGQNALSQLRQFHAAVNVTGLVVTKLDGTAKGGVVFTLAREFGIPIHFISIGEQLEDMHFFDPEAFVDAL 389
>gi|119776600|ref|YP_929340.1| cell division protein FtsY [Shewanella amazonensis SB2B] >gi|119769100|gb|ABM01671.1| cell division protein FtsY [Shewanella amazonensis SB2B] (563 aa)
Score = 553, Expect = 1.1e-54, Identities = 130/314 (41%), Positives = 204/314 (64%)
  Q:    35 KQAEILEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +QAE  EV PE Q K            GL ++S  +      + +  KK+D+E +E +EE L+  DVGV  T+K+  ++ E  + + ++D + + E++ +++     Q T     + +  +      ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K +  D++ICDT+GRL NK +LM+EL+K+  V+ K D++APHE +L LDA+ GQ+ I QAK F+E   +TGI +TK+DGT+KGG++ +I D F IP++YIG+GE+++DL  F+   F+D +
  S:   238 EQAE--EVQPEPQAKPVKEGFFARLKRGLMRTSENIGSGFIGLFRG-KKIDDELFEELEEQLLIADVGVETTSKLIKSLTEHASRRQLKDAEALYELLREEM-----QRTLEPVSVPLVPENAQGPYVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVV-AQHTGADSASVLFDALQSAKAKGVDVLICDTAGRLQNKNHLMEELKKVVRVMKKLDESAPHEVMLTLDASTGQNAISQAKLFQEAVGVTGISITKLDGTAKGGVIFAIADKFGIPIRYIGVGEQIDDLRVFNARDFIDAL 554
>gi|99081783|ref|YP_613937.1| signal recognition particle-docking protein FtsY [Silicibacter sp. TM1040] >gi|99038063|gb|ABF64675.1| signal recognition particle-docking protein FtsY [Silicibacter sp. TM1040] (386 aa)
Score = 553, Expect = 1.1e-54, Identities = 111/275 (40%), Positives = 177/275 (64%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           +D++  E++EE+LI+ D+GV    ++T  I E    + V   + I+E++  +I             + +   +  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + K + +  DL++ DT+GRL N+ +LM+EL KI  VI K D  APH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DLS FD E+F   +T
  S:   111 LDDDMLESLEEMLIASDMGVDTALRVTANIAEGRMGRRVSGRE-IRELLAAEIARVM---EPVARPMPLYPSKPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMTKAEADGADLLMIDTAGRLQNRADLMEELAKIVRVIRKKDPNAPHNTLLVLDATTGQNALSQVETFRQLADVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLSPFDPEEFAAALT 380
>gi|157122754|gb|EDO66883.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. holarctica FSC022] (343 aa)
Score = 552, Expect = 1.1e-54, Identities = 136/320 (42%), Positives = 202/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I  V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ D+GV AT++I   +R+++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI     +P+++IG+GEK++DL  F+   F   +
  S:    17 KKKNTEIESPIERVQEKDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADIGVEATDEIVTYLRDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGDRNNTHVVY-QHEGADSASVIYNAIGSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTAL 338
>gi|117620356|ref|YP_854900.1| cell division protein FtsY [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117561763|gb|ABK38711.1| cell division protein FtsY [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (633 aa)
Score = 552, Expect = 1.2e-54, Identities = 113/276 (40%), Positives = 176/276 (63%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D+E +E +E  L++ D+GV  T++I + + +    + ++D + +  ++   +    +   +    +D  K +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W QR     V+    G D ASVI+  ++  +    D++I DT+GRL NK NLM+EL+K+  V+ K DD APHE +L LDA  GQ+ + QAK F E   +TGI LTK+DGT+KGG++ ++ D F IP++YIG+GE ++DL  F    F++ +
  S:   356 KKIDDELFEELETQLLTADLGVDTTSRIIEGLVQHADRKQLKDAEALYGLLKQDM-GEMLAKVEQPLVIDTSK-KPYVILMVGVNGVGKTTTIGKLAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIYDAIEAARSRGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDDAAPHEIMLTLDAGTGQNALSQAKLFSEAVGLTGITLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDFIEAL 628
>gi|163703125|ref|ZP_02121959.1| signal recognition particle-docking protein FtsY [Methylobacterium nodulans ORS 2060] >gi|162430622|gb|EDQ41232.1| signal recognition particle-docking protein FtsY [Methylobacterium nodulans ORS 2060] (437 aa)
Score = 552, Expect = 1.2e-54, Identities = 115/299 (38%), Positives = 189/299 (63%)
  Q:    53 GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAF---DLEKFVDGITKE 351
           GL+++SS LS+ +T +  K +K+D    E +E+ LI  D GV    +I++A+ +   ++    PD ++ I+  ++    ++       LD    +  +LL++GVNG GKTT+I K+A  F  + + V+L AGDTFRA A+EQL +W +R    +V    +G D A + F  ++  ++   D+++ DT+GRL NK  LM ELEKI  VI K D++APH  LLVLDAT+GQ+ I Q + F++   +TG+++TK+DGT++GGI++++   F +PV +IG+GE ++DL  F   D  + + G+ K+
  S:   140 GLRRTSSALSERVTGLFTK-RKLDATTLEELEDALIQADFGVETAMRISEAVGKG-RYEKGIAPDEVRAILATEV-ERALEPVARPLALD-PGAKPFVLLMVGVNGAGKTTTIGKLAQKFRAQGRSVMLAAGDTFRAAAIEQLKVWGERTGAPVV-TRPQGADAAGLAFDALQAARESGTDVLMIDTAGRLQNKAGLMAELEKIVRVIRKLDESAPHAVLLVLDATVGQNAISQVELFQKTAGVTGLVMTKLDGTARGGILVALAAKFGLPVHFIGVGEGVDDLEPFTARDFARAIAGLEKD 436
>gi|126647298|ref|ZP_01719803.1| putative recognition particle-docking protein [Algoriphagus sp. PR1] >gi|126575974|gb|EAZ80252.1| putative recognition particle-docking protein [Algoriphagus sp. PR1] (318 aa)
Score = 552, Expect = 1.2e-54, Identities = 136/304 (44%), Positives = 200/304 (65%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDI---KKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K++  D+GL+KSS  +   +++ V    KVDEE  + +EE+LI+ DVGV  T K+ + I E +      + + + +I+ ++I +  +++ +T   LD    +  +  +++++GVNGVGKTT+I K+AN F    K V+L A DTFRA AV+QL +W  R+    V+      DPASV F  VK+G D   D+VI DT+GRLH K+NLM EL KI  V+ KF   APHE LLVLD + GQ+  +QAK F ++T IT + +TK+DGT+KGG+V+ I D F IPVKYIG+GEK+ DL  F+ ++FVD +
  S:    10 DKKESLDQGLQKSSENIFSKLSKAVVGKSKVDEEVLDELEEILITSDVGVDTTIKVINRIEERVARDKYVNTEELDKILKEEI-SGLLEENNTQDLLDFDIPEGKKPYVIMVVGVNGVGKTTTIGKLANLFKSAGKNVILGAADTFRAAAVDQLILWGDRVGVP-VISHGMNTDPASVAFDAVKQGVDTQADVVIIDTAGRLHTKVNLMNELGKIKRVMQKFIPDAPHEILLVLDGSTGQNAFIQAKEFTKVTEITSLAITKLDGTAKGGVVIGISDQFKIPVKYIGVGEKMTDLQLFNRKEFVDSL 314
>gi|196257125|ref|ZP_03155662.1| signal recognition particle-docking protein FtsY [Cyanothece sp. PCC 7822] >gi|196202520|gb|EDX97338.1| signal recognition particle-docking protein FtsY [Cyanothece sp. PCC 7822] (481 aa)
Score = 552, Expect = 1.2e-54, Identities = 126/316 (39%), Positives = 202/316 (63%)
  Q:    33 IEKQAEILEVLPEKQ----KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNV---EDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + KQ    E + E++    K+  EGL K+  +L   +  IV +   ++++    IE LL+  DVG+ AT+ I +A++E++  +++   +  + +KEII   +D+ F ++      +T  + +KD  NI L+ GVNG GKTT+I K+A+   K     L+VA DTFRA AVEQ+ IW +R   +++    +  DPA+V+F G+   +  N +L++ DT+GRL NK NLM EL KI  +I K    A  E+LLVLDATLGQ+G+ QA+ F E   ++G++LTK+DGT+KGG+ L++    ++P+++IG GE +EDL  F   +FV+ +
  S:   159 LAKQGRAAEDVTEEEINWLKRLREGLGKTRRSLVNQLKAIVGQ-GPLNQDAVTEIEALLLQADVGIEATDYIIEALQEKLREESLPPEQAIEYLKEIIREILDRPFKHF-----EDTAFEPEKDVLNIWLLTGVNGAGKTTTIGKLAHMANKSGYSCLIVAADTFRAAAVEQVKIWGERSGTEVIANPGKNTDPAAVVFDGINAAQSRNVNLLLVDTAGRLQNKKNLMDELAKIRRIIDKKAPKAKVESLLVLDATLGQNGLRQAQVFSEAAKLSGVVLTKLDGTAKGGVALAVAQQLDLPIRFIGAGEGIEDLRPFSSYEFVEAL 478
>gi|57900093|dbj|BAD88155.1| putative chloroplast SRP receptor cpFtsY precursor [Oryza sativa Japonica Group] (363 aa)
Score = 552, Expect = 1.2e-54, Identities = 123/301 (40%), Positives = 182/301 (60%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVD-EEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K   G  K+  +LS  + E++  +   D +   + +EE L+  D G   + +I D +REEI    ++    IKE +  +     +     N  L +   +  +++I+GVNG GKTTS+ K+A  F  +  KVL+ AGDTFRA A +QL +W++R   +IV+ + +   PASV+   VK+GK E +DLV+CDTSGRLH    LM+EL     VI K    AP+E LLVLD T G + + QA+ F ++  +TG +LTK+DGT++GG V+S+ D   IPVK+IG+GE +EDL  FD E FV+ I
  S:    62 EKLFSGFSKTRESLS-VVDELLTYWNLADTDRVLDELEEALLVSDFGPKISFRIVDTLREEIRDGKLKSGAEIKEAL-KRCILELLTSKGGNPELQLGFRKPAVIMIVGVNGGGKTTSLGKLAYRFKNEGVKVLMAAGDTFRAAARDQLEVWAERTGSEIVIDNDKKAKPASVLSQAVKRGKREGFDLVLCDTSGRLHTNYGLMEELVSCKKVIAKALPGAPNEILLVLDGTTGLNMLQQAREFNDVVGVTGFVLTKLDGTARGGCVVSVVDELGIPVKFIGVGEGMEDLQPFDAEAFVEAI 361
>gi|27364571|ref|NP_760099.1| Signal recognition particle GTPase [Vibrio vulnificus CMCP6] >gi|27360690|gb|AAO09626.1|AE016800_231 Signal recognition particle GTPase [Vibrio vulnificus CMCP6] (423 aa)
Score = 552, Expect = 1.2e-54, Identities = 129/304 (42%), Positives = 197/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T KI + + E+ + ++++D + +  ++ +++       +     L +   +T  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D FNIP++YIG+GE +EDL  F+ ++F+D +
  S:   112 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTTLKIIENLTEKASRRDLKDGEALYGLLKEEMAEIL---SKVEQPLQVDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFNIPIRYIGVGEGIEDLRPFETQEFIDAL 418
>gi|194554457|ref|YP_002089484.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa 2192] >gi|126196850|gb|EAZ60913.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa 2192] (362 aa)
Score = 552, Expect = 1.3e-54, Identities = 120/303 (39%), Positives = 194/303 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K++D++  ++IE  L++ DVGV AT  I   + + +  + + D   + + + +++ +  ++  +    +D+ ++   ++L++GVNGVGKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D+TAPHE LLVLDA  GQ+ I QAK F     +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ + FV  +  E
  S:    59 RLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEELASL-LRPVEQPLQVDVARE-PYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAE 358
>gi|93006307|ref|YP_580744.1| signal recognition particle-docking protein FtsY [Psychrobacter cryohalolentis K5] >gi|92393985|gb|ABE75260.1| signal recognition particle-docking protein FtsY [Psychrobacter cryohalolentis K5] (477 aa)
Score = 552, Expect = 1.3e-54, Identities = 123/297 (41%), Positives = 186/297 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           +   GL KS   L++ +  I+   K++D+E  E +E+ L+  D+GV ATN+I  ++ E+      +  DLI    + K     + D  T     +  D +    ++L++GVNGVGKTT+I K+A     + K V+L AGDTFRA A EQL IW +R    +V     G D ASVIF  ++  K +N D++I DT+GRL NK +LM ELEK+  V+ K D +APHE ++VLDA  GQ+ I Q + F ++  +TGI +TK+DGT+KGG+V +I +  ++P++YIG+GE ++DL AF  ++FV
  S:   174 RMKTGLSKSRKNLAEGMVSILIGGKEIDDELLEEVEDQLLVADIGVNATNRIIKSLTEQ-----TDRGDLIYAHSLYKALQTELVDILTPKVAPLIIDSSKKPFVILVVGVNGVGKTTTIGKLAKRLQGEGKSVMLAAGDTFRAAATEQLQIWGERNHIPVV-AQGHGSDSASVIFDAMQSAKAKNIDVLIADTAGRLQNKTHLMAELEKVVRVMRKADPSAPHEGMIVLDAGTGQNAINQVELFNKVVPLTGITITKLDGTAKGGVVFNIAETTDVPIRYIGVGESIDDLRAFSPKQFV 467
>gi|78048306|ref|YP_364481.1| cell division protein FtsY [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78036736|emb|CAJ24429.1| cell division protein FtsY [Xanthomonas campestris pv. vesicatoria str. 85-10] (551 aa)
Score = 552, Expect = 1.4e-54, Identities = 120/323 (37%), Positives = 185/323 (57%)
  Q:    26 AKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD-LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           A  ++ +I  Q + L   P  +  + E L+  +ST +++   +  +  K+D++  + IE  LI+ DVG+ AT  + D +R+ +  +   D   L K +  D I    +Q       +D +  +  ++L +GVNGVGKTT+I K+A  F  +   ++L AGDTFRA AV QL  W  R     V+   +  D ASV F  ++  K    D++I DT+GRLH +  LM EL KI  V+ K D  APHE L+V+D T GQ+ I Q + F     +TG+++TK+DGT+KGG+V ++   FNIP+++ G+GE+ EDL  FD   FVD +
  S:   227 ASTQDDSIVGQRDALPAAPAGKPGWRERLR--NSTFARSFGGLFSRNPKLDDDLLDEIETALITADVGIGATTALIDGLRKRMKSREFVDAQALFKALRADLI--ALLQPVSKPLVID-RSLKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQLQAWGDRNGV-AVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKIRRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFALAREFNIPIRFAGIGERPEDLRVFDPVAFVDAL 544
>gi|77973660|ref|ZP_00829206.1| COG0552: Signal recognition particle GTPase [Yersinia frederiksenii ATCC 33641] (520 aa)
Score = 552, Expect = 1.4e-54, Identities = 117/276 (42%), Positives = 177/276 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D++ ++ +EE L+  DVGV  T KI  ++ E  + + ++D + +   + +++       +  +  LD+      ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W  R K  +V     G D ASVIF  ++  K    D+++ DT+GRL NK +LM+EL+KI  V+ K D  APHE +L LDA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F  + F++ +
  S:   244 KKIDDDLFDELEEQLLIADVGVETTRKIITSLTEHASRKQLKDAEALYGKLKEEMSEIL---SKVDKPLDVSGKSPYVILMVGVNGVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGDRNKIAVV-AQHTGADSASVIFDAIQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDFIEAL 515
>gi|32472944|ref|NP_865938.1| cell division protein FtsY [Rhodopirellula baltica SH 1] >gi|32397623|emb|CAD73624.1| cell division protein FtsY [Rhodopirellula baltica SH 1] (337 aa)
Score = 552, Expect = 1.4e-54, Identities = 126/296 (42%), Positives = 183/296 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVK-KFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRT--NILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           K   GL+K+   L   I ++ K + + VDE+F   +   LI  D+G     +I D + ++   + V   ++++ I  D      I++       D+ K  +   ++L++GVNG GKTTSI K+++H + +  K++L AGDTFRA AVEQL IWS+R+ C+IV     G DPASV +   +K  +   D  I DT+GRL  +  LM+ELEKI  VI K    APHE LLVLDAT GQ+ I QAK F      TGIIL+K+DG++KGG+VL I++ F +PVK++GLGE +ED++ FD + F
  S:    39 KMKTGLQKTRRVLGTDIRDLFKAEGRLVDEDFLGELYARLIRTDMGAGPAGRIRDRVAKDFRGRVVHLEEVVETITQD------IREQLKQDHGDLAKADSPPTVILVVGVNGSGKTTSIGKLSHHLVSQGHKIVLGAGDTFRAAAVEQLTIWSERIGCEIV-TGPSGVDPASVAYQTTEKAVEIGADYAIIDTAGRLQTQGKLMQELEKIRRVIDKKLPGAPHEVLLVLDATAGQNAISQAKGFSNAAGCTGIILSKLDGSAKGGVVLPIREQFELPVKFVGLGEGIEDMTKFDPDTF 330
>gi|152987106|ref|YP_001345863.1| signal recognition particle receptor FtsY [Pseudomonas aeruginosa PA7] >gi|150962264|gb|ABR84289.1| cell division protein FtsY [Pseudomonas aeruginosa PA7] (447 aa)
Score = 552, Expect = 1.4e-54, Identities = 119/303 (39%), Positives = 194/303 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K++D++  ++IE  L++ DVGV AT  I   + + +  + + D   + + + +++ +  ++  +    +D+ ++   ++L++GVNGVGKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D+TAPHE LLVLDA  GQ+ I QA+ F     +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ + FV  +  E
  S:   144 RLRQGLSKTSASIGEGMASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKALQEELASL-LRPVEQPLQVDVARE-PYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNRIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQARQFNLAVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAE 443
>gi|74316394|ref|YP_314134.1| signal recognition particle-docking protein FtsY [Thiobacillus denitrificans ATCC 25259] >gi|74055889|gb|AAZ96329.1| Cell division transporter substrate-binding protein FtsY [Thiobacillus denitrificans ATCC 25259] (376 aa)
Score = 551, Expect = 1.7e-54, Identities = 113/301 (37%), Positives = 184/301 (61%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD----LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++  +GL K+   L   +  +    +K+D E +E +E +LI+ D+GV AT  + D +++++  +N+ +       +K+ ++D +             LD+K  +  IL++ GVNG GKTT+I K+A  +  +   VLL AGDTFRA A EQL +W +R    +V   +E  D A+VIF  ++  +  N D+V+ DT+GRL  +++LM+E+ K+  VI K    APHE LLVLDA  GQ+ + Q KAF +   ++G++LTK+DGT+KGG + ++     +PV+YIG+GE ++DL  FD   FV+ +
  S:    78 QRLKQGLAKTRDRLGGQLAGLFGVGRKIDAELFEELETILITADIGVDATQALLDTLQKKVRRENLTEASELQTALKQALIDMLLPL-------QAPLDVKTHKPFILMLAGVNGAGKTTTIGKLAKLYQAQGLSVLLAAGDTFRAAAREQLQVWGERNGVTVV--SQEKGDSAAVIFDAIQAARARNIDVVLADTAGRLPTQLHLMEEIRKVKRVIEKAIPGAPHEILLVLDANTGQNAVAQVKAFDDALGVSGLVLTKLDGTAKGGAIAAVAQARPLPVRYIGVGETVDDLRPFDARDFVEAV 373
>gi|115522346|ref|YP_779257.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris BisA53] >gi|115516293|gb|ABJ04277.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris BisA53] (316 aa)
Score = 551, Expect = 1.8e-54, Identities = 117/305 (38%), Positives = 188/305 (61%)
  Q:    44 PEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           P   ++   GLK++SS++  A+ E V K +K+D    E IE++L+  D+G   + +I  A+ E    + +   D +KEI+  ++    +        +D  K +  ++L++GVNG GKTT+I K+A     + +KV+L AGDTFRA A+EQL +W +R    +V    +G D AS+ F  + + KDE  D+++ DT+GRL N+  LM ELEK+  VI K D +APH  LLVLDAT+GQ+ + Q +AF     +TG+++TK+DGT++GGI++++ +   +PV +IG+GE ++DL+ F    F   I
  S:    10 PSWWRRLSSGLKRTSSSIGTALAEFVSK-RKLDRAMLEEIEDVLLRADLGTEVSARIAAAVGEGRYDKMISASD-VKEIVAAEV-EKVLAPVARPLVIDGAK-KPFVILMVGVNGSGKTTTIGKLAARLSGEGRKVMLAAGDTFRAAAIEQLKVWGERTGSPVV-AGAQGSDSASLAFNALTQAKDEGRDVLLIDTAGRLQNRTELMNELEKVVRVIRKVDSSAPHAVLLVLDATVGQNALSQVEAFSRTAGVTGLVMTKLDGTARGGILVALAEKHKLPVHFIGVGESVDDLAPFTAPDFAKAI 309
>gi|53713717|ref|YP_099709.1| recognition particle-docking protein FtsY [Bacteroides fragilis YCH46] >gi|60681988|ref|YP_212132.1| putative recognition particle-docking protein [Bacteroides fragilis NCTC 9343] >gi|52216582|dbj|BAD49175.1| recognition particle-docking protein FtsY [Bacteroides fragilis YCH46] >gi|60493422|emb|CAH08208.1| putative recognition particle-docking protein [Bacteroides fragilis NCTC 9343] (319 aa)
Score = 551, Expect = 1.9e-54, Identities = 134/307 (43%), Positives = 185/307 (60%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDT--DTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           EK++  D+GL K+  ++   I   V    KVD+E  +N+EE+LI+ DVGV  T  I   I +        +   +  I+ ++I     ++   D   F    + +  +++++GVNGVGKTT+I K+A  F K  K V L A DTFRA AVEQL IW +R+    V+  K G DPASV F  +      N D+VI DT+GRLHNK+ LM EL KI +V+ K    AP+E LLVLD + GQ+   QAK F   T +T + +TK+DGT+KGG+V+ I D F IPVKYIGLGE +EDL  F  ++FVD +  E
  S:    10 EKKETLDKGLSKTKESVFSKIARAVAGKSKVDDEVLDNLEEVLITSDVGVETTLNIIKRIEKRAAEDKYVNTQELNSILREEIAALLTENNSDDVADFDVPVEKKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGKSVYLGAADTFRAAAVEQLVIWGERVDVP-VIKQKMGADPASVAFDTLSSAVANNADVVIIDTAGRLHNKVGLMNELTKIKNVMKKVVPDAPNEVLLVLDGSTGQNAFEQAKQFTLATEVTAMAITKLDGTAKGGVVIGISDQFKIPVKYIGLGEGMEDLQVFRKKEFVDSLFGE 317
>gi|85706875|ref|ZP_01037966.1| signal recognition particle-docking protein FtsY [Roseovarius sp. 217] >gi|85668668|gb|EAQ23538.1| signal recognition particle-docking protein FtsY [Roseovarius sp. 217] (397 aa)
Score = 550, Expect = 2.0e-54, Identities = 113/289 (39%), Positives = 183/289 (63%)
  Q:    61 LSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           L +   E+  + + +D+   E++EELLI  D+GV    ++T  + E    + +   + IKE++  +I    I D      + I   R  ++L++GVNG GKTT+I K+A  F    K V++ AGDTFRA AVEQL +W +R     V+   EG DPAS+ +  + + + E  DL++ DT+GRL N+ +LM+EL KI  VI K D +APH  LLVLDAT GQ+ + Q   F+++ +++G+I+TK+DGT++GG+++++ D F +P+  IG+GE+++DL+ FD ++F   +T
  S:   110 LGRGAGEVAPR-RVLDDAMLESLEELLIGADMGVDTALRVTANMAEGRMGKRLSTQE-IKELLAQEIAR--IMDPVARP-MPIYAKRPQVVLVVGVNGSGKTTTIGKLAAQFKSAGKSVVIAAGDTFRAAAVEQLQVWGERAGVP-VMTAPEGSDPASLAYDAMTRAEAEGADLLMIDTAGRLQNRADLMEELAKIVRVIRKKDPSAPHNTLLVLDATTGQNALSQVATFQKLADVSGLIMTKLDGTARGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPQEFAAALT 392
>gi|124005298|ref|ZP_01690139.1| signal recognition particle-docking protein FtsY [Microscilla marina ATCC 23134] >gi|123989120|gb|EAY28698.1| signal recognition particle-docking protein FtsY [Microscilla marina ATCC 23134] (319 aa)
Score = 550, Expect = 2.0e-54, Identities = 141/307 (45%), Positives = 199/307 (64%)
  Q:    45 EKQKKFDEGLKKSSST-LSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +K++K D+GL+K+    LSK   ++V K  KVD+E  +++EE+LIS DVGV  T KI + I E +  +     +L   I+ D+I     +    N   F   K  +  +++++GVNGVGKTT+I K+AN F    K+V+L A DTFRA AV+QL +W +R+    V+     +DPASV F  V+KG + N D+VI DT+GRL  K+ LM EL KI  V+ K    APHE LLVLD + GQ+ I QAKAF E T +T + +TK+DGT+KGG+V+ I D F +PVKYIG+GE +EDL  F+  +FVD + K+
  S:    10 KKKEKLDQGLEKTKKNFLSKLGKKLVGK-SKVDDEVLDDLEEVLISSDVGVDTTIKIIERIEERVKKEKFFANEL-DGILKDEIADLLAESNQDNVEEFDLPKNTKPYVIMVVGVNGVGKTTTIGKLANQFKLAGKEVVLGAADTFRAAAVDQLKVWGERVGVP-VIELGMNKDPASVAFDAVEKGVEMNADVVIVDTAGRLQTKVPLMNELSKIKRVMSKVIPEAPHEVLLVLDGSTGQNAISQAKAFTEATEVTALAITKLDGTAKGGVVIGISDQFKVPVKYIGVGEGIEDLQIFNKHEFVDSLFKK 316
>gi|83950639|ref|ZP_00959372.1| signal recognition particle-docking protein FtsY [Roseovarius nubinhibens ISM] >gi|83838538|gb|EAP77834.1| signal recognition particle-docking protein FtsY [Roseovarius nubinhibens ISM] (489 aa)
Score = 550, Expect = 2.0e-54, Identities = 114/277 (41%), Positives = 180/277 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           + +D++  E +EELLI+ D+GV    ++T  + E    + +   + IKE++  +I    ++       L  K  +  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + + + +  DL++ DT+GRL N+ +LM+EL KI  VI K D+TAPH  LLVLDAT GQ+ + Q K F+E+ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E F   +T
  S:   214 RALDDDMLEQLEELLITADMGVDTALRVTANMAEGRMGKRLSTQE-IKELLAAEI-ARIMEPVARPMPLYTKSPQ--VVLVVGVNGSGKTTTIGKLASQFKAAGKSVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMDRAQRDGADLLMIDTAGRLQNRADLMEELAKIVRVIRKKDETAPHNTLLVLDATTGQNALSQVKTFQELADVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPEDFAAALT 485
>gi|170741579|ref|YP_001770234.1| signal recognition particle-docking protein FtsY [Methylobacterium sp. 4-46] >gi|168195853|gb|ACA17800.1| signal recognition particle-docking protein FtsY [Methylobacterium sp. 4-46] (473 aa)
Score = 550, Expect = 2.0e-54, Identities = 115/299 (38%), Positives = 188/299 (62%)
  Q:    53 GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAF---DLEKFVDGITKE 351
           GL+++SS LS+ +T +  K +K+D    E +E+ LI  D GV    +I +A+ +   ++    PD ++ I+  ++    ++       L+    +  +LL++GVNG GKTT+I K+A  F  + + V+L AGDTFRA A+EQL +W +R     VL   +G D A + F  ++  ++   D+++ DT+GRL NK  LM ELEKI  VI K D+TAPH  LLVLDAT+GQ+ I Q + F++   ++G+++TK+DGT++GGI++++   F +PV +IG+GE ++DL  F   D  + + G+ K+
  S:   176 GLRRTSSALSERVTGLFTK-RKLDATTLEELEDALIQADFGVETATRIAEAVGKG-RYEKGISPDEVRAILAAEV-ERALEPVARPLTLE-GAAKPFVLLMVGVNGAGKTTTIGKLAQKFRAQGRSVMLAAGDTFRAAAIEQLKVWGERTGAP-VLSRPQGADAAGLAFDALQAAREAGTDVLMIDTAGRLQNKAGLMAELEKIVRVIRKLDETAPHAVLLVLDATVGQNAISQVELFQKTAGVSGLVMTKLDGTARGGILVALAAKFGLPVHFIGVGEGVDDLEPFTARDFARAIAGLDKD 472
>gi|145300820|ref|YP_001143661.1| cell division protein FtsY [Aeromonas salmonicida subsp. salmonicida A449] >gi|142853592|gb|ABO91913.1| cell division protein FtsY [Aeromonas salmonicida subsp. salmonicida A449] (631 aa)
Score = 550, Expect = 2.1e-54, Identities = 112/276 (40%), Positives = 175/276 (63%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D++ +E +E  L++ D+GV  T +I D + +    + ++D + +  ++   +     Q  +    +D  K +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W QR     V+    G D ASVI+  ++  +    D++I DT+GRL NK NLM+EL+K+  V+ K D+ APHE +L LDA  GQ+ + QAK F E   + GI+LTK+DGT+KGG++ ++ D F IP++YIG+GE ++DL  F    F++ +
  S:   354 KKIDDDLFEELETQLLTADLGVDTTRRIIDGLVQHADRKQLKDAEALYGLLKQDMGAMLAQ-VEQPLVIDTSK-KPYVILMVGVNGVGKTTTIGKLAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIYDAIEAARSRGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDEEAPHEIMLTLDAGTGQNALSQAKLFSEAVGLDGIVLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDFIEAL 626
>gi|21243285|ref|NP_642867.1| cell division protein [Xanthomonas axonopodis pv. citri str. 306] >gi|21108823|gb|AAM37403.1| cell division protein [Xanthomonas axonopodis pv. citri str. 306] (554 aa)
Score = 550, Expect = 2.1e-54, Identities = 119/320 (37%), Positives = 184/320 (57%)
  Q:    29 EEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD-LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++ +I  Q E L   P  +  + E L+  +ST +++   +  +  K+D++  + IE  LI+ DVG+ AT  + D +R+ +  +   D   + K +  D I    +Q       +D +  +  ++L +GVNGVGKTT+I K+A  F  +   ++L AGDTFRA AV QL  W  R     V+   +  D ASV F  ++  K    D++I DT+GRLH +  LM EL KI  V+ K D  APHE L+V+D T GQ+ I Q + F     +TG+++TK+DGT+KGG+V ++   FNIP+++ G+GE+ EDL  FD   FVD +
  S:   233 QDDSIVGQREALPAAPAGKPGWRERLR--NSTFARSFGGLFSRNPKLDDDLLDEIETALITADVGIGATTALIDGLRKRMKSREFVDAQAMFKALRADLI--ALLQPVSKPLVID-RSLKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQLQAWGDRNGV-AVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKIRRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFALAREFNIPIRFAGIGERPEDLRVFDPVAFVDAL 547
>gi|163740777|ref|ZP_02148170.1| signal recognition particle-docking protein FtsY [Phaeobacter gallaeciensis 2.10] >gi|161385768|gb|EDQ10144.1| signal recognition particle-docking protein FtsY [Phaeobacter gallaeciensis 2.10] (415 aa)
Score = 550, Expect = 2.3e-54, Identities = 111/277 (40%), Positives = 179/277 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           + +D++  E +E+LL+  D+GV    ++T  + E    + +   + IKE++  ++    I +      + I   R  ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + + ++E  DL++ DT+GRL N+ +LM+EL KI  VI K D +APH  LLVLDAT GQ+ + Q   F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E F   +T
  S:   139 RALDDDMLEQLEDLLVGADMGVDTALRVTANMAEGRLGKRLSTRE-IKELLAAEVAR--IMEPVARP-MPIYAKRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKKVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMTRAQEEGADLLMIDTAGRLQNRADLMEELAKIVRVIQKKDPSAPHNTLLVLDATTGQNALNQVDTFQKLADVSGLVMTKLDGTAKGGVLVALADRFGLPIHAIGVGEQIDDLAPFDPEDFAAALT 410
>gi|171320171|ref|ZP_02909233.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria MEX-5] >gi|171094585|gb|EDT39637.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria MEX-5] (386 aa)
Score = 550, Expect = 2.4e-54, Identities = 127/311 (40%), Positives = 190/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    74 EAVEIVPPPTQ--DASAKKSWLVRLKTGLAKTGSSITGVFVNTKIDEDLYEELEAALLMSDAGVDATEYLLGALREKVRTGRLTDPQQVKSALHD-LLVELLKPLEKSLMLG--RAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVISKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 384
>gi|56551966|ref|YP_162805.1| signal recognition particle GTPase [Zymomonas mobilis subsp. mobilis ZM4] >gi|56543540|gb|AAV89694.1| signal recognition particle GTPase [Zymomonas mobilis subsp. mobilis ZM4] (310 aa)
Score = 549, Expect = 2.5e-54, Identities = 122/301 (40%), Positives = 192/301 (63%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK   GLK++S  L++ ++ I  K   +D+E  + IEE LI+ D+G     +I + +  E   Q V + + ++E++   + KI     +  + + F      R  ++L++GVNG GKTT+IAK+A+ F + D +V+LVAGDTFRA A+ QL +W++RL+  I+    EG D AS++F GVK+G  +  D +I DT+GRL NK  LM EL KI  V+ + +  APH  +LVLDAT GQ+ + Q + FKEI  ++G+I+TK+DGT++GGI+++  + + +P+  IG+GE ++DL  FD E     I
  S:     9 KKIGFGLKRTSERLTENLSSIALK-AALDDETLDEIEETLIACDLGPGTAGRIRERLAGERFPQGVTELE-VREVVAQEIAKILKPVAKPIEIDAF-----PRPQVILVIGVNGSGKTTTIAKLAHWFQELDYEVMLVAGDTFRAAAIGQLKVWAERLEIPII-SGAEGADAASLVFQGVKEGTAQGTDTLIVDTAGRLQNKSGLMDELAKIKKVLGRLNPAAPHNVILVLDATNGQNALSQIEVFKEIAGVSGLIMTKLDGTARGGIMVAAAEKYGLPIHAIGVGESMDDLRPFDPEAVARAI 304
>gi|167555379|ref|ZP_02348397.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (491 aa)
Score = 549, Expect = 2.7e-54, Identities = 129/315 (40%), Positives = 201/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK++LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDSIQAAKARNVDVLIADTAGRLQNKLHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|83814471|ref|YP_446277.1| signal recognition particle-docking protein FtsY [Salinibacter ruber DSM 13855] >gi|83755865|gb|ABC43978.1| signal recognition particle-docking protein FtsY [Salinibacter ruber DSM 13855] (324 aa)
Score = 549, Expect = 2.7e-54, Identities = 120/306 (39%), Positives = 189/306 (61%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTN--TFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           ++Q+K +EGL K+  +    +  +V+    VD E  + +EE+LI+ DVGV  T  I D +   +          +  +I D+I    ++ ++     F     ++ ++++++GVNGVGKTT+I K+A+ + +  K VL+ AGDTFRA A+EQL IW+ R    ++   K G DPA+V +  ++  +  + D+ I DT+GRLH K  LM EL K+  V+ +    APHE LLVLDA+ GQ+ + QA+ F +  ++TG+ LTK+DGT+KGG+V+ +   F +PVKYIG+GE +EDL  FD + FV G+ K
  S:    14 DEQEKLEEGLDKTRDSFFGKLDRMVRGKDTVDAEVLDELEEILITSDVGVDTTLDIIDHVEARVAQDQYVSAQELNGLIRDEIARLMLEGSEERPADFDAPLPNQPHVIMVVGVNGVGKTTTIGKMAHKYRQAGKSVLMGAGDTFRAAAIEQLEIWADRAGVPLI-KQKHGADPAAVAYDTIEAAEARDADVAIVDTAGRLHTKGGLMDELAKMKRVMGRKIPDAPHEVLLVLDASTGQNALRQAEEFIDSVDVTGLALTKLDGTAKGGVVIGVSHQFQVPVKYIGVGEAVEDLQVFDRKGFVQGLFK 320
>gi|189501986|ref|YP_001957703.1| hypothetical protein Aasi_0573 [Candidatus Amoebophilus asiaticus 5a2] >gi|189497427|gb|ACE05974.1| hypothetical protein Aasi_0573 [Candidatus Amoebophilus asiaticus 5a2] (311 aa)
Score = 549, Expect = 2.7e-54, Identities = 125/307 (40%), Positives = 194/307 (63%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEIT---FQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           + ++K D+ L  + ++      +++     VD+E  + +EELL++ D+G+  T KI D +   +    + NV + + I    ++ + T  +   + NT L       +I+LI+G+NGVGKTT+I K+A  + +  KKV+L A DTFRA A+EQL +W +R+   +V       DP++V +  V+K   E  D+ I DT+GRLH K+NLM EL KI   I K    APHE LLVLDAT GQ+  +Q KAF E T + G+++TK+DGT+KGG+V+ I D F++PVKYIG+GE+++DL  FD ++FV+ + K+
  S:    10 KSKEKLDKALTPTKTSFWNNFNKVLVGKSTVDDEILDRLEELLLTADIGIDTTLKIIDLLEMRVARDKYLNVAELESILREEIESLITI-LNQAEQNTAL------PHIILIVGINGVGKTTTIGKLAALYKQAGKKVILGAADTFRAAAIEQLKMWGERVGVPVVAHSMH-TDPSAVAYDTVQKAIQEQADVAIIDTAGRLHTKVNLMNELSKIRRTIEKLMPAAPHEILLVLDATTGQNAFIQTKAFTEATAVNGLVVTKLDGTAKGGVVIGIIDQFHVPVKYIGVGEQIDDLQLFDEKEFVETLFKQ 311
>gi|78486281|ref|YP_392206.1| signal recognition particle-docking protein FtsY [Thiomicrospira crunogena XCL-2] >gi|78364567|gb|ABB42532.1| signal recognition particle-docking protein FtsY [Thiomicrospira crunogena XCL-2] (373 aa)
Score = 549, Expect = 2.8e-54, Identities = 135/332 (40%), Positives = 214/332 (64%)
  Q:    17 KEGSLEDLSA-KIEEKNIEKQAEILE------------VLPEKQKKFDEGL----KKSSSTLSKAITE----IVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++ + +D+SA K  E+ +EK  EI              V  E QK    GL    K S S   K  TE    +V   K++D++  + +E +L++ DVGV AT+ I   +  +++ + +++P+ + + +  ++ T  + +  T   +  +K+   ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL  W +R +  +V   K G D A+VIF  ++    +N D++I DT+GRLH + NLM+EL+K+  VI K D +APHE +LVLDA  GQ+ + QA+ F E   ITG+ LTK+DGT+KGGI+ ++ +   IPV++IG+GE ++DL  FD  +F + +
  S:    17 QKDTADDISAEKPAEEQLEKAPEIKASSEEAPSQPAKTVSTESQKTTRPGLFSRLKNSLSKTRKGFTENLATLVMGRKEIDDDLLDELEMILLTADVGVEATDTIIQNLTGQVSRKELKEPEKLIQALKQQLET--LLEPVTQPLVLPEKEGPFVILMVGVNGVGKTTTIGKLAKKFQNEGKSVMLAAGDTFRAAAVEQLQTWGERNQVPVV-AQKTGADSAAVIFDAIQSATAKNIDVLIADTAGRLHTQSNLMEELKKVKRVIQKVDSSAPHEVMLVLDAGTGQNALSQAQQFYEAVEITGLTLTKLDGTAKGGIIFALAEKLGIPVRFIGVGEAIDDLRPFDANEFSEAL 366
>gi|153214853|ref|ZP_01949661.1| signal recognition particle-docking protein FtsY [Vibrio cholerae 1587] >gi|124115096|gb|EAY33916.1| signal recognition particle-docking protein FtsY [Vibrio cholerae 1587] (383 aa)
Score = 549, Expect = 2.9e-54, Identities = 129/304 (42%), Positives = 197/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +  + + Q + D + +  ++ +++    +   +    +D +K +T ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    72 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTAKASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KTYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 378
>gi|164688565|ref|ZP_02212593.1| hypothetical protein CLOBAR_02210 [Clostridium bartlettii DSM 16795] >gi|164602978|gb|EDQ96443.1| hypothetical protein CLOBAR_02210 [Clostridium bartlettii DSM 16795] (452 aa)
Score = 549, Expect = 2.9e-54, Identities = 145/319 (45%), Positives = 214/319 (67%)
  Q:    30 EKNIEKQAEILEVLPEKQKKFD---EGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKE---IIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E  I+ + E  E  P+K   FD   +GL K+   ++  I E++K + KVDEE  E++EE+LI+ DVGV  T  I + + + I  + + DP  ++E   +I++ I +        +T LD+    T I+L++GVNGVGKTT+I K+A+ +  + KKVLL AGDTFRA A++QL +W+ R   DI+   +EG DP +VIF  +K  K    D++ICDT+GRLHNK NLM EL K+  ++ +    A  E LLV+DAT GQ+ + QAK+FKE+ +ITG+ LTK+DGT+KGG++L++K   ++PVK IG+GEK+EDL  FD + FVD +
  S:   134 ENQIDDELEEEEEKPKKVSLFDRLKQGLTKAKQGITDRIDEVLKAYTKVDEELLEDLEEVLITADVGVNTTMDIIEKLEDVIRTKKITDPQDVREELKLIIEDILS------KDDTKLDVSHSPT-IILMVGVNGVGKTTTIGKLAHRYKSEGKKVLLAAGDTFRAAAIDQLEVWANRCNVDII-KHQEGADPGAVIFDAIKASKARGVDVLICDTAGRLHNKSNLMNELGKVFKIVDREYPEAKKEVLLVVDATTGQNAVSQAKSFKEVCDITGLALTKLDGTAKGGVILAVKSEVDVPVKLIGVGEKMEDLQDFDSKSFVDAL 450
>gi|84702107|ref|ZP_01016682.1| FtsY, signal recognition particle-docking protein [Parvularcula bermudensis HTCC2503] >gi|84691353|gb|EAQ17193.1| FtsY, signal recognition particle-docking protein [Parvularcula bermudensis HTCC2503] (459 aa)
Score = 549, Expect = 3.0e-54, Identities = 121/291 (41%), Positives = 183/291 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAF 339
           +   GL K+S+ LS  I  I  K K++D++  E +E+LLI  D+GV  T +I   + ++   Q V   D      +  I +  I+ T       +  D T+   ++L+ GVNG GKTT+I K+A  F  + K VLL A DTFRA A+EQL +W +R+    V+  ++G DPA++ +  V K + E  D+V+ DT+GRL N+  LM EL KI  V+ K DD+APH+ +LVLDAT+GQ+ + Q +AF E   ITG+I+TK+DGT++GG+++++ D F +P+  IG+GE +EDL  F
  S:   160 RLRSGLAKTSAKLSGGIGTIFTK-KRLDDDTLEELEDLLIMADIGVPTTTRIITQLAKDKFDQEVSGED------IRAILSREIETTLAPLEAQLAPDGTHGPHVILMTGVNGAGKTTTIGKLAQQFTAEGKSVLLAACDTFRAAAIEQLTVWGERVGVP-VISREQGADPAALAYDAVAKAQAEGIDIVLIDTAGRLQNRRELMDELGKIVRVVKKLDDSAPHDAVLVLDATVGQNALSQTEAFLETAKITGLIMTKLDGTARGGVLVALGDKFGLPIHAIGVGETVEDLQPF 445
>gi|170701094|ref|ZP_02892070.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria IOP40-10] >gi|170133995|gb|EDT02347.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria IOP40-10] (386 aa)
Score = 549, Expect = 3.1e-54, Identities = 127/311 (40%), Positives = 190/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    74 EAVEIVPPPTQ--DASAKKSWLVRLKTGLAKTGSSITGVFVNTKIDEDLYEELEAALLMSDAGVDATEYLLGALREKVKTGRLTDPQQVKSALHD-LLVELLKPLEKSLMLG--RAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVISKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 384
>gi|87121171|ref|ZP_01077062.1| cell division protein FtsY [Marinomonas sp. MED121] >gi|86163663|gb|EAQ64937.1| cell division protein FtsY [Marinomonas sp. MED121] (439 aa)
Score = 549, Expect = 3.2e-54, Identities = 123/304 (40%), Positives = 190/304 (62%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK---KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           ++   GL ++ + L   +  ++   K++D++  E +E  L+  DVGV AT  +   + E++  + ++D D +   +  ++           T  + +   K    ++L++GVNGVGKTT+I K+   F  + KKV+L AGDTFRA AVEQL +W +R +  +V   + G D ASVIF  +   + + +D+VI DT+GRL NK NLM EL K+  V+ K DD APHE +LVLDA  GQ+ I QAK F E   ++GI LTK+DGT+KGGI+ +I   F IP+++IG+GE+++DL AFD + FVD + ++
  S:   133 QRVKAGLSRTRNGLGSGLANLIVGSKQIDDDLLEELETQLLMADVGVEATQSLIATLTEKMNRKELKDADALMAALKHELSQMLASSAKPLTLSEPEVEGKKTPYVILMVGVNGVGKTTTIGKLTKKFQAEGKKVMLAAGDTFRAAAVEQLQVWGERNQVPVV-AQQTGSDSASVIFDAIDSARAKGFDVVIADTAGRLQNKSNLMNELSKVVRVMKKLDDNAPHEVMLVLDAGTGQNAISQAKLFSEAVGVSGITLTKLDGTAKGGIIFAIAKEFEIPIRFIGVGEQVDDLRAFDADVFVDALFEQ 438
>gi|193213473|ref|YP_001999426.1| signal recognition particle-docking protein FtsY [Chlorobaculum parvum NCIB 8327] >gi|193086950|gb|ACF12226.1| signal recognition particle-docking protein FtsY [Chlorobaculum parvum NCIB 8327] (320 aa)
Score = 548, Expect = 3.3e-54, Identities = 133/303 (43%), Positives = 191/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTN--TFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  EGL K+  TL + +  + K   +VD+EF E +E +L++ DVGV  T  I DA+ E    +     D + E+++ +I    ++    +   F      +  +++I+GVNG GKTTS+AK+A+++ K  KKV++ A DTFRA A EQL IW+ R    I+    +G DPASV+F  V     +  D+V+ DT+GRLHNK +LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F    N+TG+I+TK+DGTSKGGIVLSI    N+PVKYIG+GEK++DL  FD   FV+ + ++
  S:    11 RLKEGLTKTRDTLKEKLAVVTKGKTEVDDEFLEELENILVAADVGVETTLDIVDAVTERSKGKTYRSEDELNEMVMGEIRNLLVESGHEHPVDFDAPLSAKPYVIMIVGVNGAGKTTSVAKLAHNYDKAGKKVVIAAADTFRAAAYEQLKIWADRAGVPII-GQGQGADPASVVFDSVSSAVSKGTDVVLVDTAGRLHNKSHLMEELAKIMRVAKKKIPDAPHEVLLVLDGTTGQNAVQQAREFTRFVNVTGLIVTKLDGTSKGGIVLSISRELNLPVKYIGVGEKIDDLQLFDRASFVEALLEK 314
>gi|77359320|ref|YP_338895.1| cell division transporter substrate-binding protein [Pseudoalteromonas haloplanktis TAC125] >gi|76874231|emb|CAI85452.1| Cell division transporter substrate-binding protein FtsY [Pseudoalteromonas haloplanktis TAC125] (651 aa)
Score = 548, Expect = 3.3e-54, Identities = 122/305 (40%), Positives = 187/305 (61%)
  Q:    44 PEKQ---KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           P+K+    +  +GL K+   +      I    KK+D++ +E +E  L++ D+GV  T K+ D + +    + ++D D + E++  ++    +  T     +     +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R     V+    G D ASVIF   +  K  N D++I DT+GRL NK NLM+ELEKI  V+ K D  APHE +L +DA  GQ+ I Q   F +   +TGI L+K+DGT+KGG++ ++ D FNIP++YIG+GE ++DL AF  + F+D +
  S:   340 PKKEGFFSRLKKGLLKTRVNIGSGFASIFSG-KKIDDDLFEELETQLLTADLGVDTTMKLIDRLTDAANRKQLKDGDALYELMKQEMAV--MLKTAEQPLVIPADKKPFVILMVGVNGVGKTTTIGKLAKQFQSEGKSVMLAAGDTFRAAAVEQLQVWGERNSIP-VIAQHTGADSASVIFDAFQAAKARNVDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQNAISQVNLFNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGESIDDLRAFKSDDFIDAL 643
>gi|152978128|ref|YP_001343757.1| signal recognition particle-docking protein FtsY [Actinobacillus succinogenes 130Z] >gi|150839851|gb|ABR73822.1| signal recognition particle-docking protein FtsY [Actinobacillus succinogenes 130Z] (504 aa)
Score = 548, Expect = 3.4e-54, Identities = 125/276 (45%), Positives = 185/276 (67%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D+E +E +EE L+  D+GV  T+KI   + +  T Q ++D DL+ + +  ++    ++       +D  K +  ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W +R    +V     G D ASVIF  ++     N D++I DT+GRL NK NLM EL+KI  VI K+D++APHE +L LDA  GQ+ + QA+ F E   +TGI LTK+DGT+KGG++ +I D FN+P++YIG+GEK+EDL  FD ++F+D +
  S:   226 KKIDDELFEELEEQLLIADIGVPTTSKIITNLEQHATRQQLKDADLLYQQLKQEM-AEILKPVARPLVIDGSK-KPYVILMVGVNGVGKTTTIGKLARQFQQQGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVV-AQSTGSDSASVIFDAMQSASARNIDILIADTAGRLQNKNNLMDELKKIVRVIKKYDESAPHEIMLTLDAGTGQNAVSQARLFNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLRTFDADEFIDAL 498
>gi|163733314|ref|ZP_02140757.1| signal recognition particle-docking protein FtsY [Roseobacter litoralis Och 149] >gi|161393102|gb|EDQ17428.1| signal recognition particle-docking protein FtsY [Roseobacter litoralis Och 149] (485 aa)
Score = 548, Expect = 3.4e-54, Identities = 115/276 (41%), Positives = 177/276 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +D++  E +EELLI+ D+GV    ++   + E    + +   + IKE++  +I             L +      ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + K + +  DL++ DT+GRL N+ +LM+EL KI  VI K D+TAPH  LLVLDAT GQ+ + Q K F +I++++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL AFD E F D +
  S:   209 RTLDDDMLEQLEELLIAADMGVDTALRVVANMAEGRVGKKLSVQE-IKELLASEIAQIM---EPVAKPLPLYPRTPQVVLVVGVNGSGKTTTIGKLASQFRAAGKKVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMVKAQQDGADLLLIDTAGRLQNRTDLMEELAKIVRVIRKKDETAPHNTLLVLDATTGQNALNQVKVFSDISDVSGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLDAFDPEDFADAL 479
>gi|163737648|ref|ZP_02145065.1| signal recognition particle-docking protein FtsY [Phaeobacter gallaeciensis BS107] >gi|161389174|gb|EDQ13526.1| signal recognition particle-docking protein FtsY [Phaeobacter gallaeciensis BS107] (415 aa)
Score = 548, Expect = 3.5e-54, Identities = 111/277 (40%), Positives = 179/277 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           + +D++  E +E+LL+  D+GV    ++T  + E    + +   + IKE++  ++    I +      + I   R  ++L++GVNG GKTT+I K+A+ F    KKV++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ F  + + ++E  DL++ DT+GRL N+ +LM+EL KI  VI K D +APH  LLVLDAT GQ+ + Q   F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E F   +T
  S:   139 RALDDDMLEQLEDLLVGADMGVDTALRVTANMAEGRLGKRLSTRE-IKELLAAEVAR--IMEPVARP-MPIYAKRPQVVLVVGVNGSGKTTTIGKLASQFKAVGKKVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAFDAMTRAQEEGADLLMIDTAGRLQNRADLMEELAKIVRVIQKKDPSAPHNTLLVLDATTGQNALNQVDTFQKLADVSGLVMTKLDGTAKGGVLVALADRFGLPIHAIGVGEQIDDLAPFDPEDFAAALT 410
>gi|177672461|ref|ZP_02945223.1| signal recognition particle-docking protein FtsY [Micrococcus luteus NCTC 2665] >gi|172070919|gb|EDT56968.1| signal recognition particle-docking protein FtsY [Micrococcus luteus NCTC 2665] (399 aa)
Score = 548, Expect = 3.8e-54, Identities = 122/293 (41%), Positives = 185/293 (63%)
  Q:    56 KSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KS++   K +  ++ +  ++D++ ++ IEE L+  D+G   T ++ D ++  +T +   DP+ ++ ++ +++        D       + DR  + +++GVNGVGKTT++ K+A   + +D+ V+L A DTFRA A EQL  W  R+  + V  +KEG DPASV F  V+ G  E  D+V+ DT+GRL NK NLM EL KI  VI K  +    E LLVLDAT GQ+G+ QAK F E+ ++TGI+LTK+DGT+KGGIV++I+    +PVK IGLGE  +DL+ F  E FVD +
  S:   107 KSNNVFGKGLLALLSQ-DRIDDDVWDEIEETLLMADLGTEPTLELVDRLKARVTVEGTRDPEQVRTLLREELVAMVDPSMDRRLAATRRGDRPAVTMVVGVNGVGKTTTVGKLARVLVAEDRTVVLGAADTFRAAAAEQLATWGARVGVETVRSEKEGADPASVAFEAVEHGIAEGVDVVLVDTAGRLQNKANLMDELGKIKRVIEKQAEV--DEVLLVLDATTGQNGLTQAKVFAEVVDVTGIVLTKLDGTAKGGIVIAIQRQLGVPVKLIGLGEGPDDLAPFTAEGFVDAL 396
>gi|115352920|ref|YP_774759.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria AMMD] >gi|115282908|gb|ABI88425.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria AMMD] (386 aa)
Score = 548, Expect = 3.8e-54, Identities = 127/311 (40%), Positives = 191/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F+  +F D +
  S:    74 EAVEIVPPPTQ--DASAKKSWLTRLKTGLAKTGSSITGVFVNTKIDEDLYEELEAALLMSDAGVDATEYLLGALREKVKTGRLTDPQQVKSALHD-LLVELLKPLEKSLMLG--RAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVISKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFNAVEFADAL 384
>gi|153886131|ref|ZP_02007286.1| signal recognition particle-docking protein FtsY [Ralstonia pickettii 12D] >gi|151577096|gb|EDN41497.1| signal recognition particle-docking protein FtsY [Ralstonia pickettii 12D] (398 aa)
Score = 548, Expect = 3.9e-54, Identities = 126/323 (39%), Positives = 188/323 (58%)
  Q:    26 AKIEEKNIEKQAEILEVLP------EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           A   +  ++ QA+ +E +P      + +K +   L+   S  SK +T +    K VDE  +E +E  L+  D GV AT  +   +R  I  Q +E  + +K  + D +    +   +    L   +++  +++I GVNG GKTTSI K+  HF    + VLL AGDTFRA A EQL IW QR    +V   +E  DPA+VIF  V   +    D+V+ DT+GRL  +++LM+EL+K+  V  K   TAPHE LLV+D   GQ+ + Q KAF E   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GE++EDL  F   +F D +
  S:    74 APAAQPALDVQADDVETVPTPAVIEQARKGWMSRLRSGLSKTSKGLTTLFVGVK-VDEALFEELETALLMADAGVDATEYLLAELRRRIKAQRIETSEGVKTALRD-LLVELLHPLEKTMVLG--REQPMVIMIAGVNGAGKTTSIGKLCKHFQTYGQSVLLAAGDTFRAAAREQLVIWGQRNNVTVVA--QESGDPAAVIFDAVNAARARGIDIVMADTAGRLPTQLHLMEELKKVRRVTAKAMATAPHETLLVIDGNTGQNALAQVKAFDEALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEQVEDLQPFSAREFADAL 396
>gi|157368470|ref|YP_001476459.1| signal recognition particle-docking protein FtsY [Serratia proteamaculans 568] >gi|157320234|gb|ABV39331.1| signal recognition particle-docking protein FtsY [Serratia proteamaculans 568] (535 aa)
Score = 548, Expect = 3.9e-54, Identities = 129/315 (40%), Positives = 199/315 (63%)
  Q:    34 EKQAEILE--VLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+Q E+L   V  E+++   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI  ++ +  + + ++D + +   + +++     +    +  LD+      ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  K    D+++ DT+GRL NK +LM+EL+KI  V+ K DD APHE +L+LDA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F  + F++ +
  S:   211 EQQPELLAPAVTQEQERPTKEGFFARLKRSLVKTKQNLGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIITSLTQHASRKQLKDAEALYGKLKEEMSEILAK---VDQPLDVGGKNPYVILMVGVNGVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNRIP-VIAQHTGADSASVIFDAVQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDDQAPHEVMLILDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDFIEAL 530
>gi|39939165|ref|NP_950931.1| signal recognition particle-docking protein FtsY [Onion yellows phytoplasma OY-M] >gi|39722274|dbj|BAD04764.1| signal recognition particle-docking protein [Onion yellows phytoplasma OY-M] (347 aa)
Score = 548, Expect = 3.9e-54, Identities = 130/297 (43%), Positives = 191/297 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDR---------TN-------------ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           K+  GLKK+ ++     T ++K+   +++   + +E LLI  D G   T  +  AI++EI    +++P  +  ++V K+F  Y         L+  K++         TN             + L  GVNGVGKTT+I K+A    ++ KKVLL+A DTFRAGAVEQL IW++R+  ++         PASVIF G++  K +NYD+++CDT+GRL NK NLM+EL KI+ VI K    +  +  LVLDAT GQ+ I Q   F + T ++G ILTK+DGTSKGGIV +IK  +N+P KYIG+GEK +DL  FD++ ++
  S:    17 KYQLGLKKTKASFLDFQT-LLKQSNNIEKTLLQALESLLIQADFGTKTTLFLMQAIKDEINQFQIKNPQKLPSVVVSKMFDLYQNMKGMKGILESPKEQEKQNQYSNSTNPKDTFQSQNNLPQMYLFTGVNGVGKTTTIGKMAEALKQEGKKVLLIAADTFRAGAVEQLQIWAKRVGVEVFCKPLPAH-PASVIFEGIELAKSQNYDIILCDTAGRLQNKTNLMQELSKINRVICKHLPASNLQTFLVLDATTGQNAINQVDLFNQATPLSGAILTKLDGTSKGGIVFAIKYLYNLPTKYIGVGEKSQDLITFDVKNYL 333
>gi|187927348|ref|YP_001897835.1| signal recognition particle-docking protein FtsY [Ralstonia pickettii 12J] >gi|187724238|gb|ACD25403.1| signal recognition particle-docking protein FtsY [Ralstonia pickettii 12J] (394 aa)
Score = 548, Expect = 3.9e-54, Identities = 122/307 (39%), Positives = 179/307 (58%)
  Q:    42 VLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           V+ + +K +   L+   S  SK +T +    K VDE  +E +E  L+  D GV AT  +   +R  I  Q +E  + +K  + D +    +   +    L   +++  +++I GVNG GKTTSI K+  HF    + VLL AGDTFRA A EQL IW QR    +V   +E  DPA+VIF  V   +    D+V+ DT+GRL  +++LM+EL+K+  V  K   TAPHE LLV+D   GQ+ + Q KAF E   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GE++EDL  F   +F D +
  S:    92 VIEQARKGWMSRLRSGLSKTSKGLTTLFVGVK-VDEALFEELETALLMADAGVDATEYLLGELRRRIKAQRIETAEGVKTALRD-LLVELLHPLEKTMVLG--REQPMVIMIAGVNGAGKTTSIGKLCKHFQTYGQSVLLAAGDTFRAAAREQLVIWGQRNNVTVVA--QESGDPAAVIFDAVNAARARGIDIVMADTAGRLPTQLHLMEELKKVRRVTAKAMATAPHETLLVIDGNTGQNALAQVKAFDEALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEQVEDLQPFSAREFADAL 392
>gi|77461558|ref|YP_351065.1| signal recognition particle-docking protein FtsY [Pseudomonas fluorescens PfO-1] >gi|77385561|gb|ABA77074.1| signal recognition particle-docking protein FtsY [Pseudomonas fluorescens PfO-1] (515 aa)
Score = 548, Expect = 4.0e-54, Identities = 121/303 (39%), Positives = 189/303 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDI-KKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +  +GL K+S+++ + +  +    K +D++  +++E  L++ DVGV AT+ I   + +++  + + D D + + +  ++             L I  +++  ++L++GVNG GKTT+I K+A     + KKV+L AGDTFRA AVEQL +W +R K   V+    G D ASVIF  V+  K    D++I DT+GRLH K NLM+EL+K+  VI K D  APHE LLVLDA  GQ+ I QAK F +   +TG+ LTK+DGT+KGG++ ++   F +P++YIG+GE ++DL  F+ E FV  +  E
  S:   212 RLKQGLSKTSASIGEGMASLFLGKKAIDDDLLDDLETRLLTADVGVEATSVIIQRLTQKVARKELADSDALYKSLQAELAAML---KPVEQPLKIASRNKPFVILVVGVNGAGKTTTIGKLAKKLQLEGKKVMLAAGDTFRAAAVEQLQVWGERNKIP-VIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQAKQFNQTVELTGLALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAE 511
>gi|15838508|ref|NP_299196.1| cell division protein [Xylella fastidiosa 9a5c] >gi|9107008|gb|AAF84716.1|AE004011_1 cell division protein [Xylella fastidiosa 9a5c] (397 aa)
Score = 548, Expect = 4.2e-54, Identities = 110/290 (37%), Positives = 172/290 (59%)
  Q:    59 STLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           S  ++ I  +     ++DE   + IE  LI+ DVGV  TN + D +R+ +  +   D   +   + +++          +  L +K+D    + L++GVNGVGKTT+I K+A  F +    ++L AGDTFRA AV QL  W +R    ++       D ASV++  ++  K  + +++I DT+GRLH +I LM EL KI  V+ K D TAPHE L+V+D T GQ+ + Q + F    N+TG+++TK+DGT+KGG+V ++   F IP+ +I +GE+LED+  FD E FVD +
  S:   102 SLFARNINALFSNNPRLDENLLDEIETALITADVGVSTTNALVDGLRKRMKAREFADIQTLLAALRNELIAIL---RPVSKPLIVKRDALPFVFLVVGVNGVGKTTTIGKLAKWFKRDGYSLMLAAGDTFRAAAVAQLQAWGERNSITVIAQKGPNADAASVVYDALQAAKARSTEVLIADTAGRLHTQIGLMNELSKIRRVLGKLDSTAPHEVLMVIDGTTGQNALSQLRQFHAAVNVTGLVVTKLDGTAKGGVVFTLAREFGIPIHFISIGEQLEDMHFFDPEAFVDAL 389
>gi|113866393|ref|YP_724882.1| signal recognition particle receptor FtsY [Ralstonia eutropha H16] >gi|113525169|emb|CAJ91514.1| signal recognition particle receptor FtsY [Ralstonia eutropha H16] (386 aa)
Score = 548, Expect = 4.2e-54, Identities = 117/300 (39%), Positives = 183/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+S  +      +     KVDE  +E +E  L+  D GV AT  +   +R+ +  + +E  + +K  +  ++ T  ++  +    + + +++  +++I GVNG GKTTSI K+  HF + D+KVLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   K    D+V+ DT+GRL  +++LM+EL+K+  VI K   +APHE LLV+DA  GQ+ + Q +AF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F  ++F + +
  S:    95 RLRTGLSKTSRNIGTLFVGV-----KVDEALFEELETALLMADAGVEATEYLLGELRKRVKAERIETAEGVKAAL-RELLTQLLRPLEKT--MALGREQPLVMMIAGVNGAGKTTSIGKLCKHFQRYDQKVLLAAGDTFRAAAREQLTIWGERNNVTVVA--QESGDPAAVIFDAVNAAKARGIDIVMADTAGRLPTQLHLMEELKKVKRVISKAMPSAPHEVLLVIDANTGQNALQQTRAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKADEFAEAL 384
>gi|50842926|ref|YP_056153.1| signal recognition particle receptor [Propionibacterium acnes KPA171202] >gi|50840528|gb|AAT83195.1| signal recognition particle receptor [Propionibacterium acnes KPA171202] (396 aa)
Score = 548, Expect = 4.3e-54, Identities = 116/265 (43%), Positives = 167/265 (63%)
  Q:    84 EELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAP-HENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E  LI+ D+GV  T ++ + +R E+    + DP   +E++  ++      D D +  LD  + +  ++L++GVNG GKTT+  K+A   + + K VLL A DTFRA A EQL  W +R+    V  D  G DPASV +  V+ G DE  D+V+ DT+GRLH K  LM EL K+  VI K    AP  E LLVLDAT GQ+G+ QA+ F E+ ++TGI+L+K+DG++KGGIV+ ++    +PVK IGLGE  +DL+ FD + FV G+
  S:   127 ETTLITSDLGVGPTTELVEKLRSELAIDGISDPAHAREVLHHELVELVGSDMDRSINLDRLEGKPAVVLMVGVNGTGKTTTCGKLARVLVAEGKTVLLGAADTFRAAAGEQLETWGERVGVRTVRKDA-GADPASVAYEAVQTGIDEGVDVVLVDTAGRLHTKAGLMDELGKVKRVIEKL---APVSEVLLVLDATTGQNGLAQARVFSEVVDVTGIVLSKLDGSAKGGIVVQVQRELGVPVKLIGLGEGADDLAPFDADNFVTGL 388
>gi|108804224|ref|YP_644161.1| signal recognition particle-docking protein FtsY [Rubrobacter xylanophilus DSM 9941] >gi|108765467|gb|ABG04349.1| signal recognition particle-docking protein FtsY [Rubrobacter xylanophilus DSM 9941] (348 aa)
Score = 547, Expect = 4.5e-54, Identities = 116/277 (41%), Positives = 177/277 (63%)
  Q:    76 DEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           DEEF+E +EE+LI+ DVGV  T K+   + +E   +N+     ++ ++V+    +  +  +    +D+   R  ++L++GVNG GKTT+I K+A H     + V+  AGDTFRA A+EQL  W +R+   +V  ++ G D A+V    V+  K E  +++I DT+GRLH K+NLM ELEK+  VI +    APHE LL +DAT GQ+G+ QA+ FKE+  +TG++LTK+DGT+KGGI L+I D   +P+K + +GE +EDL  FD  +F + +  EL
  S:    80 DEEFWERVEEILIASDVGVPTTAKLVQRLEQEALEKNITGAGELRRLLVE----HAARMLEGPVEIDLSH-RPTVILMVGVNGTGKTTTIGKLARHL--PARSVMFAAGDTFRAAAIEQLQKWGERVGAPVVARER-GADAAAVAHDAVEAAKREGVEVLIVDTAGRLHTKVNLMAELEKVRRVIGRQLPGAPHEVLLTVDATTGQNGLRQARMFKEVAGVTGVVLTKLDGTAKGGIALAIADEVGLPIKLVSVGEGVEDLHPFDARQFAEALFGEL 348
>gi|71065494|ref|YP_264221.1| signal recognition particle-docking protein FtsY [Psychrobacter arcticus 273-4] >gi|71038479|gb|AAZ18787.1| signal recognition particle-docking protein FtsY [Psychrobacter arcticus 273-4] (478 aa)
Score = 547, Expect = 4.6e-54, Identities = 123/297 (41%), Positives = 186/297 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           +   GL KS   L++ +  I+   K++D+E  E +E+ L+  D+GV ATN+I  ++ E+      +  DLI    + K     + D  T     +  D +    ++L++GVNGVGKTT+I K+A     + K V+L AGDTFRA A EQL IW +R    +V     G D ASVIF  ++  K +N D++I DT+GRL NK +LM ELEK+  V+ K D +APHE ++VLDA  GQ+ I Q + F ++  +TGI +TK+DGT+KGG+V +I +  ++P++YIG+GE ++DL AF  ++FV
  S:   175 RMKTGLSKSRKNLAEGMVGILIGGKEIDDELLEEVEDQLLVADIGVNATNRIIKSLTEQ-----TDRGDLIYAHSLYKALQTELVDILTPKVAPLIIDTSKQPFVILVVGVNGVGKTTTIGKLAKRLQGEGKSVMLAAGDTFRAAATEQLQIWGERNNIPVV-AQGHGSDSASVIFDAMQSAKAKNIDVLIADTAGRLQNKTHLMAELEKVVRVMRKADSSAPHEGMIVLDAGTGQNAINQVELFNKVVPLTGITITKLDGTAKGGVVFNIAETTDVPIRYIGVGESIDDLRAFSPKQFV 468
>gi|39933286|ref|NP_945562.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris CGA009] >gi|167367464|ref|ZP_02301606.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris TIE-1] >gi|192288638|ref|YP_001989243.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris TIE-1] >gi|39652911|emb|CAE25653.1| putative cell division protein FtsY [Rhodopseudomonas palustris CGA009] >gi|192282387|gb|ACE98767.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris TIE-1] (315 aa)
Score = 547, Expect = 4.8e-54, Identities = 116/301 (38%), Positives = 187/301 (62%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++   GLK++SS++  A++E V K +K+D    E IE++L+  D+G     +I  A+ E    + +   D +KEI+   V+K+     Q  + +       ++  ++L++GVNG GKTT+I K++  F  +  KV+L AGDTFRA A++QL +W  R    +V    +G D A + F  +   K++  D+++ DT+GRL N+  LM ELEK+  VI K D TAPH  LLVLDAT+GQ+ + Q +AF +   +TG+++TK+DGT++GGI+++I +   +PV +IG+GE +EDL+ F    F   I
  S:    14 RRLSSGLKRTSSSIGTALSEFVSK-RKLDRAMLEEIEDVLLRADLGTEVAARIAKAVGEGRYDKMISASD-VKEIVAAEVEKVLAPVAQPLEVDA-----GNKPFVILMVGVNGSGKTTTIGKLSARFASEGHKVMLAAGDTFRAAAIDQLKVWGDRTGTPVV-AGAQGSDAAGLAFNALTAAKEQGRDVLLIDTAGRLQNRTELMSELEKVVRVIKKVDATAPHAVLLVLDATVGQNALSQVEAFTKTAGVTGLVMTKLDGTARGGILVAIAEKHKLPVHFIGVGEGVEDLAPFTARDFAKAI 309
>gi|153824163|ref|ZP_01976830.1| signal recognition particle-docking protein FtsY [Vibrio cholerae B33] >gi|126518315|gb|EAZ75540.1| signal recognition particle-docking protein FtsY [Vibrio cholerae B33] (303 aa)
Score = 547, Expect = 4.9e-54, Identities = 123/278 (44%), Positives = 184/278 (66%)
  Q:    71 KFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K KK+D++ +E +EE L+  DVG+  T+KI   +    + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    24 KGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTARASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 298
>gi|89256930|ref|YP_514292.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. holarctica] >gi|89144761|emb|CAJ80096.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. holarctica LVS] (331 aa)
Score = 547, Expect = 5.1e-54, Identities = 136/320 (42%), Positives = 202/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I +V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   + +++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI     +P+++IG+GEK++DL  F+   F   +
  S:     5 KKKNTEIESPIEKVQEKDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVTYLCDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGDRNNTHVVY-QHEGADSASVIYNAIGSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTAL 326
>gi|119473191|ref|ZP_01614888.1| Cell division transporter substrate-binding protein FtsY [Alteromonadales bacterium TW-7] >gi|119444555|gb|EAW25870.1| Cell division transporter substrate-binding protein FtsY [Alteromonadales bacterium TW-7] (750 aa)
Score = 547, Expect = 5.1e-54, Identities = 118/300 (39%), Positives = 184/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  +GL K+   +    + I    KK+D++ +E +E  L++ D+GV  T K+ D + +    + ++D D + E++  ++    +  T         + +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R     V+    G D ASV+F   +  K  N D++I DT+GRL NK NLM+ELEKI  V+ K D  APHE +L +DA  GQ+ I Q   F +   +TGI L+K+DGT+KGG++ ++ D FNIP++YIG+GE ++DL +F  + F+D +
  S:   447 RLKKGLLKTRVNIGAGFSSIFSG-KKIDDDLFEELETQLLTADLGVDTTMKLIDRLTDGANRKQLKDGDALYELMKQEMAA--MLKTAEQPLTIPAEKKPFVILMVGVNGVGKTTTIGKLAKQFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNSIP-VIAQHTGADSASVVFDAFQAAKARNVDVLIADTAGRLQNKDNLMQELEKIARVMKKIDPDAPHEVMLTIDAGTGQNAISQVNLFNQCVGLTGITLSKLDGTAKGGVIFAVADKFNIPIRYIGVGEGIDDLRSFKSDDFIDAL 742
>gi|160872800|ref|ZP_02062932.1| signal recognition particle-docking protein FtsY [Rickettsiella grylli] >gi|159121599|gb|EDP46937.1| signal recognition particle-docking protein FtsY [Rickettsiella grylli] (329 aa)
Score = 547, Expect = 5.2e-54, Identities = 118/317 (37%), Positives = 193/317 (60%)
  Q:    32 NIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           N+ +  E LE       +    L K+    ++ +  ++   KK+D E  + I +LL+  DVG   T  I   +  ++   ++ D  +I +++  ++    +Q  +    +D    +  ++L++GVNGVGKTTSI K+A +  K+ KKV+L AGDTFRA A EQL IW++R +  I+    +G D ASVI+   +  K  N D++I DT+GR H K NLM+EL+KI  V+ K D +APHE +L+LDA  GQ+ +MQA+ F E   +TG++LTK+DGT+KGG++ +I +   +P++++GLGE + D+  F  ++FV+ +
  S:     2 NVREGNESLERKDHFLYRIKNSLLKTRHQFTENLAHLLFGKKKIDAELIDEIVDLLLMADVGSTVTEAIIQRLTVKLERNHLTDGQVIWDVLKQQL-GELLQPCEAPLMID-STHKPMVILVVGVNGVGKTTSIGKLAYYLKKQGKKVMLAAGDTFRAAATEQLTIWAERNQIPII-AQHQGADSASVIYDAFQAAKARNIDVLIADTAGRFHTKNNLMQELQKIKKVMGKLDVSAPHEIMLILDANTGQNALMQAQVFHEALGLTGLMLTKLDGTAKGGVIFAIAEKLGLPIRFVGLGEAMSDIHVFSAKEFVEAL 315
>gi|148358595|ref|YP_001249802.1| cell division membrane protein FtsY [Legionella pneumophila str. Corby] >gi|148280368|gb|ABQ54456.1| cell division membrane protein FtsY [Legionella pneumophila str. Corby] (355 aa)
Score = 547, Expect = 5.4e-54, Identities = 128/344 (37%), Positives = 205/344 (59%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQK----KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +FK+  N          +D +    E  +E+  E+    P  ++    +F +GL K+   L + I+ ++   K++ +E  E +E LLIS D+G+  T  +   + E +  + + + + + + +    F   +   +    ++ +     ++L++GVNG GKTT+I K+A  F K+ KKV+L AGDTFRA AVEQL++W +R     V+    G D ASVIF  ++  K    D++I DT+GRLH + NLM+EL+K+  V+ K D  APHE +LVLDA++GQ+ + QAK F E   +TGI +TK+DGT+KGGI+ +I ++  IP +Y+G+GE +EDL  FD  +FV  I
  S:     4 WFKRNQNSEPNLDTEEQQDHAESSMESRLEEPQELTVKEPSPKESIFARFRKGLSKTRHQLGEGISRLLLGKKEISQELLEELETLLISADLGLDTTQDVLKQLNEGLARKQLSNGEAVYQTLKTN-FATILSPEEKPLSIETEDGSPFVILMVGVNGAGKTTTIGKLAKQFQKQGKKVMLAAGDTFRAAAVEQLHVWGERNGIP-VIAQHTGADSASVIFDALQAAKARKIDVLIADTAGRLHTQSNLMEELKKVKRVMQKLDPKAPHETMLVLDASIGQNALAQAKQFHEAVQLTGITMTKLDGTAKGGILFAIANDLGIPFRYLGVGEGIEDLRPFDAAQFVSAI 349
>gi|172061768|ref|YP_001809420.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria MC40-6] >gi|171994285|gb|ACB65204.1| signal recognition particle-docking protein FtsY [Burkholderia ambifaria MC40-6] (386 aa)
Score = 547, Expect = 5.6e-54, Identities = 127/311 (40%), Positives = 190/311 (61%)
  Q:    38 EILEVLPEKQKKFDEGLKKS-----SSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E +E++P   +  D   KKS      + L+K  + I   F   K+DE+ YE +E  L+  D GV AT  +  A+RE++    + DP  +K  + D +    ++  + +  L   + +  +++I GVNG GKTTSI K+A H    D+ VLL AGDTFRA A EQL +W +R    +V   +E  DPA+VIF  V   +    D+++ DT+GRL  +++LM+EL+K+  VI K  D APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F   +F D +
  S:    74 EAVEIVPPPTQ--DASAKKSWLTRLKTGLAKTGSSITGVFVNTKIDEDLYEELEAALLMSDAGVDATEYLLGALREKVKTGRLTDPQQVKSALHD-LLVELLKPLEKSLMLG--RAQPLVMMITGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDTFRAAAREQLAVWGERNNVTVV--QQESGDPAAVIFDAVSAARARKIDVMMADTAGRLPTQLHLMEELKKVKRVISKAHDGAPHEVLLVIDANTGQNALTQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAVEFADAL 384
>gi|77961777|ref|ZP_00825608.1| COG0552: Signal recognition particle GTPase [Yersinia mollaretii ATCC 43969] (759 aa)
Score = 546, Expect = 5.7e-54, Identities = 118/276 (42%), Positives = 178/276 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D++ +E +EE L+  DVGV  T KI  ++ E  + + ++D + +   + +++       +  +  LD+      ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R K  +V     G D ASVIF  ++  K    D+++ DT+GRL NK +LM+EL+KI  V+ K D  APHE +L LDA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F  + F++ +
  S:   258 KKIDDDLFEELEEQLLIADVGVETTRKIITSLTEHASRKQLKDAEALYGKLKEEMSEIL---STVDKPLDVSGKNPFVILMVGVNGVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNKIAVV-AQHTGADSASVIFDAIQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDFIEAL 529
>gi|168241723|ref|ZP_02666655.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194449622|ref|YP_002047596.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194407926|gb|ACF68145.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] (491 aa)
Score = 546, Expect = 5.8e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDASVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|91203371|emb|CAJ71024.1| strongly similar to the signal recognition particle receptor of E. coli. [Candidatus Kuenenia stuttgartiensis] (423 aa)
Score = 546, Expect = 5.9e-54, Identities = 136/325 (41%), Positives = 205/325 (63%)
  Q:    27 KIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK--KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           +I+EK + K+  +   +P K KK   GL+K+       + + +   + +DE   E +E++LI  D+GV    K+ + IRE    + + +   I + I D++     +D   +   DI+    R  +++++GVNGVGKTTSIAK+A+  +K+ KKV+L AGDTFRA AV+QL+IW +R+  DIV   + G DPA+V +  ++       D++I DT+GRLH   NLMKEL KI  VI K    APHE LLVLDAT GQ+ I QA+ F+E  ++TGI L K+DGT+KGGIVL + +   IPVK+IGLGE+ +D+  F+ + FV+ + ++
  S:   108 EIKEKPVIKKEPV--AVPGKLKK---GLEKTRGRFWLRLKDFLSFRQGIDESALEELEDILIGADIGVRPVQKLIEEIREAWKEKAITETSQINDFIKDRL-----KDGLHSWQTDIQYADKRPTVIMVVGVNGVGKTTSIAKLASFLMKEGKKVMLAAGDTFRAAAVDQLDIWCKRIGADIV-KHQTGSDPAAVAYDAMEASIARGVDVLIVDTAGRLHTHDNLMKELIKIKRVIKKKIPDAPHEVLLVLDATTGQNAISQARMFREAVDVTGIFLAKLDGTAKGGIVLGMCNETEIPVKFIGLGEQADDIERFNPDLFVETLLEQ 423
>gi|146313500|ref|YP_001178574.1| cell division protein FtsY [Enterobacter sp. 638] >gi|145320376|gb|ABP62523.1| signal recognition particle-docking protein FtsY [Enterobacter sp. 638] (511 aa)
Score = 546, Expect = 5.9e-54, Identities = 131/315 (41%), Positives = 199/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E    + E++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI  ++ E  + + + D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L LDA+ GQ+ I QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   189 EADEPVEEIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIASLTEGASRKQLRDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKMARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEDAPHEIMLTLDASTGQNAISQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKSDDFIEAL 506
>gi|168232718|ref|ZP_02657776.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|194470486|ref|ZP_03076470.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194456850|gb|EDX45689.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] (491 aa)
Score = 546, Expect = 6.0e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|163726292|ref|ZP_02133807.1| signal recognition particle-docking protein FtsY [Desulfatibacillum alkenivorans AK-01] >gi|161400502|gb|EDQ24755.1| signal recognition particle-docking protein FtsY [Desulfatibacillum alkenivorans AK-01] (359 aa)
Score = 546, Expect = 6.0e-54, Identities = 122/300 (40%), Positives = 187/300 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  + L K+   L+  I +      ++ E+  E +EE LI+ D+GV     + + + E++  + + +   ++  + D +    I+    N  L  KK    +++++GVNGVGKTT+I K+A +F K+ KKV+LVA DTFRA AVEQL IW++R    IV   ++  DPA+V + GV   +    D+VI DT+GRLH ++NLM+EL+KI    HK    +PHE  LV+DA  GQ+ + QAK F E   +TG+ILTK+DGT+KGGIV+SI  + ++P++YIGLGEK EDL  F+  +F+  +
  S:    63 RLKDKLAKTRDVLNTPIEDFFITKTELTEDSLEELEETLITADMGVNTVMDLMEPVAEKVNKKQITNSKELRAALTDAMLDL-IKPVHENKELPNKKPL--VIMVVGVNGVGKTTTIGKLAANFKKQGKKVMLVAADTFRAAAVEQLEIWAERAGVQIV-RHRDNSDPAAVAYDGVAAAEARGMDVVIIDTAGRLHTQVNLMEELKKIRRSCHKSLPGSPHETWLVIDANTGQNAVSQAKLFHEAIGVTGMILTKVDGTAKGGIVVSICHDMDVPIRYIGLGEKAEDLREFEAREFIKAL 358
>gi|77165401|ref|YP_343926.1| cell division transporter substrate-binding protein FtsY [Nitrosococcus oceani ATCC 19707] >gi|76883715|gb|ABA58396.1| signal recognition particle-docking protein FtsY [Nitrosococcus oceani ATCC 19707] (362 aa)
Score = 546, Expect = 6.1e-54, Identities = 130/348 (37%), Positives = 205/348 (58%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQ---KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           FFK+   K K  ++ S   L     E   E  +E      EKQ   K+  + L ++   L+  I +++   K +D+E  E IE  L+  D+GV AT  I + +    + + ++D + + E + + +       T  N  L I    +  ++L++GVNGVGKTT+I K+A  F  + + V+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  V+  +    D++I DT+GRLH + NLM+EL+K+  V+ K +  APHE +L +DA  GQ+ + QA+ F E  ++TGIILTK+DGT+KGG++ +I     +P+++IG+GE ++DL  F+ E+FV+ +   L
  S:     4 FFKR---KRKSPEQNSEATLPPVAAEATREASSETGA--GEKQSLFKRLRDRLGRTRGNLTGGIADLMLGKKSIDDELLEEIETQLLIADLGVEATQAIIEDLTIRTSREQLQDAEALMEALRENMQELL---TPCNQPLIIPAAIKPFVILMVGVNGVGKTTTIGKLAKKFQAEGRSVMLAAGDTFRAAAVEQLQVWGERNQVP-VMAQHSGADSASVIFDAVQSAQVRGIDVLIADTAGRLHTQTNLMEELKKVKRVMGKVNPHAPHEIMLTVDAGTGQNALNQARQFHEAVDLTGIILTKLDGTAKGGVIFAIAKKMGLPIRFIGVGEGIDDLRPFNAEEFVNALLTPL 346
>gi|54298660|ref|YP_125029.1| hypothetical protein lpp2724 [Legionella pneumophila str. Paris] >gi|53752445|emb|CAH13877.1| hypothetical protein [Legionella pneumophila str. Paris] (355 aa)
Score = 546, Expect = 6.2e-54, Identities = 128/344 (37%), Positives = 207/344 (60%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQK----KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +FK+  N          +D +    E  +E+  E+    P  ++    +F +GL K+   L + I+ ++   K++ +E  E +E LLIS D+G+  T  +   + E +  + + + + + + +   + T   Q+    + ++ +     ++L++GVNG GKTT+I K+A  F K+ K+V+L AGDTFRA AVEQL++W +R     V+    G D ASVIF  ++  K    D++I DT+GRLH + NLM+EL+K+  V+ K D  APHE +LVLDA++GQ+ + QAK F E   +TGI +TK+DGT+KGGI+ +I ++  IP +Y+G+GE +EDL  FD  +FV  I
  S:     4 WFKRNQNSEPNLDTEEQQDHAESSMESRLEEPQELTVKEPSPKESIFARFRKGLSKTRHQLGEGISRLLLGKKEISQELLEELETLLISADLGLDTTQDVLKQLNEGLARKQLSNGEAVYQTLKTNLQTILSQEEKPLS-IETEDGSPFVILMVGVNGAGKTTTIGKLAKQFQKQGKRVMLAAGDTFRAAAVEQLHVWGERNGIP-VIAQHTGADSASVIFDALQAAKARKIDVLIADTAGRLHTQSNLMEELKKVKRVMQKLDPKAPHETMLVLDASIGQNALAQAKQFHEAVQLTGITMTKLDGTAKGGILFAIANDLGIPFRYLGVGEGIEDLRPFDAAQFVSAI 349
>gi|16766857|ref|NP_462472.1| cell division protein FtsY [Salmonella typhimurium LT2] >gi|161616619|ref|YP_001590584.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167541760|ref|ZP_02337336.1| hypothetical protein Sentent_00700 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167990787|ref|ZP_02571886.1| hypothetical protein Sententer_01000004_0100005037 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168473414|ref|ZP_02702437.1| hypothetical protein Salmoentericaenterica_02045 [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|16422131|gb|AAL22431.1| GTPase domain of cell division membrane protein [Salmonella typhimurium LT2] >gi|161365983|gb|ABX69751.1| hypothetical protein SPAB_04436 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] (491 aa)
Score = 546, Expect = 6.4e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|86747488|ref|YP_483984.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris HaA2] >gi|86570516|gb|ABD05073.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris HaA2] (315 aa)
Score = 546, Expect = 6.4e-54, Identities = 115/305 (37%), Positives = 190/305 (62%)
  Q:    44 PEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           P   ++   GLK++SS++  A++E + K +K+D    + IE++L+  D+G     +I+DA+ E    + +   D +KEI+  ++    +        +D  K +  ++L++GVNG GKTT+I K++  +  +  KV++ AGDTFRA A+EQL +W +R     V+   +G D AS+ F  +   K++  D+++ DT+GRL N+  LM EL K+  VI K DDTAPH  LLVLDAT+GQ+ + Q +AF +   +TG+++TK+DGT++GGI+++I +   +PV +IG+GE +EDL+ F    F   I
  S:    10 PSWWRRLSSGLKRTSSSIGTALSEFISK-RKLDRAMLDEIEDVLLRADLGTEVATRISDAVGEGRYDKMISAGD-VKEIVAAEV-EKVLAPVAKPLVIDRAK-KPFVVLVVGVNGSGKTTTIGKLSARYAAEGHKVMMAAGDTFRAAAIEQLKVWGERTGTP-VIAGAQGSDSASLAFNALTTAKEQARDVLLIDTAGRLQNRTELMNELGKVVRVIKKVDDTAPHAVLLVLDATVGQNALSQVEAFTKTAGVTGLVMTKLDGTARGGILVAIAEKHKLPVHFIGVGEGVEDLAPFTARDFAQAI 309
>gi|150422163|gb|EDN14129.1| signal recognition particle-docking protein FtsY [Vibrio cholerae AM-19226] (389 aa)
Score = 546, Expect = 6.5e-54, Identities = 128/304 (42%), Positives = 196/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +  + + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    78 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTAKASRQQLRDGEALYGLLKEEM-AEILSQVEQPLLIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 384
>gi|115315294|ref|YP_764017.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. holarctica OSU18] >gi|167009994|ref|ZP_02274925.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. holarctica FSC200] >gi|169656723|ref|YP_001429185.2| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. holarctica FTNF002-00] >gi|115130193|gb|ABI83380.1| signal recognition particle receptor FtsY [Francisella tularensis subsp. holarctica OSU18] >gi|134254005|gb|EBA53099.1| signal recognition particle receptor ftsY [Francisella tularensis subsp. holarctica 257] >gi|164551791|gb|ABU62229.2| signal recognition particle-docking protein FtsY [Francisella tularensis subsp. holarctica FTNF002-00] (343 aa)
Score = 546, Expect = 6.6e-54, Identities = 136/320 (42%), Positives = 202/320 (63%)
  Q:    29 EEKNIEKQAEILEVLPEKQKK-----FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++KN E ++ I +V  +  KK        GL K+++     ++ I+   K VDEE  E+IE  L++ DVGV AT++I   + +++    ++  D + +II  K+ T  I   +    +D +K    ++L++GVNGVGKTT+I K+      + K V+L AGDTFRA AVEQL  W  R    +V    EG D ASVI+  +   K +  D+VI DT+GRLHNK NLM+EL+K+  VI K D+TAPHE +LV+DAT G + + QA+AF +I N+TGI +TK+DGT+KGGIV SI     +P+++IG+GEK++DL  F+   F   +
  S:    17 KKKNTEIESPIEKVQEKDNKKGLFSRLQAGLSKTANKFGSGLSTILMGQKVVDEELLEDIEMQLLTADVGVEATDEIVTYLCDKVARNELQTADKLNQIIQQKL-TEIILPCEKPLEVDTQKS-PFVILVVGVNGVGKTTTIGKLTKKLQSQGKSVILAAGDTFRAAAVEQLREWGDRNNTHVVY-QHEGADSASVIYNAIGSAKSKGIDVVIADTAGRLHNKDNLMQELKKVVKVIKKTDETAPHEIMLVVDATTGGNALNQAEAFNQIVNLTGITITKLDGTAKGGIVFSIAKKLGLPLRFIGVGEKIDDLQVFNARDFTTAL 338
>gi|194442699|ref|YP_002042816.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194401362|gb|ACF61584.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Newport str. SL254] (491 aa)
Score = 546, Expect = 6.8e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|16762733|ref|NP_458350.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144220|ref|NP_807562.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|25300177|pir||AG0991 cell division protein [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505039|emb|CAD08059.1| cell division protein [Salmonella enterica subsp. enterica serovar Typhi] >gi|29139857|gb|AAO71422.1| cell division protein [Salmonella enterica subsp. enterica serovar Typhi Ty2] (491 aa)
Score = 546, Expect = 6.8e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|148652808|ref|YP_001279901.1| signal recognition particle-docking protein FtsY [Psychrobacter sp. PRwf-1] >gi|148571892|gb|ABQ93951.1| signal recognition particle-docking protein FtsY [Psychrobacter sp. PRwf-1] (397 aa)
Score = 546, Expect = 6.8e-54, Identities = 124/297 (41%), Positives = 187/297 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREE-----ITFQNVEDPDLIKEI--IVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           +   GL KS   L++ +  I+   K++D+E  E +E+ L+  D+GV AT+KI  ++ E+     + + +     L KE+  I++      I DT    F         ++L++GVNGVGKTT+I K+A     + K V+L AGDTFRA A EQL +W +R    +V     G D ASV+F  ++  K +N D++I DT+GRL NK +LM ELEK+  ++ K D TAPHE ++VLDA  GQ+ I Q K F +   +TGI +TK+DGT+KGG+V +I +  +IP++YIG+GE ++DL AF  ++FV
  S:    96 RMKSGLSKSRKNLAEGVANILIGGKEIDDELLEEVEDQLLVADIGVEATDKIIKSLTEQTARGDLIYSHSLYKALQKELVEILEPKVAPLIIDTSKKPF---------VILVVGVNGVGKTTTIGKLAKRLQGEGKSVMLAAGDTFRAAATEQLQVWGERNNIPVV-AQGHGADSASVVFDAMQSAKAKNIDVLIADTAGRLQNKTHLMAELEKVVRIMRKSDPTAPHEGMIVLDAGTGQNAINQVKIFNDAVPLTGITITKLDGTAKGGVVFNIANTTDIPIRYIGVGESIDDLRAFSPKQFV 389
>gi|86133831|ref|ZP_01052413.1| putative recognition particle-docking protein [Tenacibaculum sp. MED152] >gi|85820694|gb|EAQ41841.1| putative recognition particle-docking protein [Polaribacter dokdonensis MED152] (323 aa)
Score = 546, Expect = 6.9e-54, Identities = 129/306 (42%), Positives = 192/306 (62%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIK---------KDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           EK++  D+GL+K+  +    +++ V    KVD++  +N+EE+L++ DVGV  T K+ D I   +        D +  I+ ++I    + +T+     D           K    +L+++GVNGVGKTT+I K+A+ F K+  KV+L A DTFRA A++QL +W+ R    I+  +  G DPASV F  +     ++ D+VI DT+GRLHNK+NLM EL KI  V+ K    APH+ LLVLD + GQ+   QAK F + T +T + +TK+DGT+KGG+V+ I D F IPVKYIG+GE ++DL  F+  +FVD   K
  S:    11 EKKETLDKGLEKTKESFFGKLSKAVAGKSKVDDDVLDNLEEVLVASDVGVNTTLKVIDRIEARVAKDKYVGTDELNAILREEI-AGLLSETNVGNETDFTIPEIPKKEGKKMPYVLMVVGVNGVGKTTTIGKLASQFKKQGLKVVLGAADTFRAAAIDQLQVWADRTDVPIIRQEM-GSDPASVAFDTLTSAVKQDADVVIIDTAGRLHNKVNLMNELTKIKRVMQKVVSDAPHDVLLVLDGSTGQNAFEQAKQFTKATEVTSLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIDDLQVFNKVEFVDSFFK 323
>gi|168260700|ref|ZP_02682673.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] >gi|168465148|ref|ZP_02699040.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|195632106|gb|EDX50590.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Newport str. SL317] (491 aa)
Score = 546, Expect = 6.9e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|168224692|ref|ZP_02649923.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] (491 aa)
Score = 546, Expect = 6.9e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|34763139|ref|ZP_00144108.1| Cell division protein ftsY [Fusobacterium nucleatum subsp. vincentii ATCC 49256] >gi|27887202|gb|EAA24304.1| Cell division protein ftsY [Fusobacterium nucleatum subsp. vincentii ATCC 49256] (344 aa)
Score = 545, Expect = 7.3e-54, Identities = 142/340 (41%), Positives = 218/340 (64%)
  Q:     9 IVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLP----EKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + +KL GKK+       A  E++ IEK++  +E+       ++    + L KS       +  I     KVD+  YE +E+LL+  DVG+  T  + D + +E+  + V++ + + EI+  ++ + ++   D+  +L  K ++ N++LI+GVNGVGKTT+I K+A  +    KKVLL AGDTFRA AVEQL  W++R   DIV   +EG DPASV++  + + +    D+VI DT+GRLHNK NLM+ELEKI+++I K      +E+LLV+D T GQ+G+ QAK F  +T++TG I+TK+DGT+KGGIV S+ +    P+K+IGLGEK+ DL  F+ + FV+ I
  S:     3 LFDKLFGKKDKEEIKEQADKEKETIEKESNKVEIEEEKEENQKVNISQRLTKSKEGFFSKLKNIFTSKSKVDDSIYEELEDLLLQSDVGLSMTTNLIDQLEKEVKSKKVDNTEEVYEIL-KRLMSEFLLSQDSKIYL--KDNKINVILIVGVNGVGKTTTIGKLALKYKNLGKKVLLGAGDTFRAAAVEQLEEWAKRADVDIV-KGREGADPASVVYDTLSRAESTKADVVIIDTAGRLHNKANLMRELEKINNIIKKKIREQEYESLLVIDGTTGQNGLNQAKEFNSVTDLTGFIVTKLDGTAKGGIVFSVSEELKKPIKFIGLGEKIGDLIEFNAKDFVEAI 342
>gi|188582090|ref|YP_001925535.1| signal recognition particle-docking protein FtsY [Methylobacterium populi BJ001] >gi|179345588|gb|ACB81000.1| signal recognition particle-docking protein FtsY [Methylobacterium populi BJ001] (493 aa)
Score = 545, Expect = 7.7e-54, Identities = 117/307 (38%), Positives = 191/307 (62%)
  Q:    45 EKQ---KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAF---DLEKFVDGITKE 351
           EKQ    +   G++++SS LS  +T +  K +K+D    E++E+ LI  D GV    ++++A+ +   ++    PD ++ I+  +I    ++   T   +D  K +  ++L +GVNG GKTT+I K++  F  + + V+L AGDTFRA A+EQL +W +R     V+   +G D A + F   K+ ++   D+++ DT+GRL NK  LM ELEKI  VI K D  APH  LLVLDAT+GQ+ + Q + F +   ++G+++TK+DGT++GGI++++   F +PV +IG+GE +EDL  F   D  + + G+ KE
  S:   186 EKQGWWSRLTAGMRRTSSALSDRVTGLFTK-RKLDATTLEDLEDALIQADFGVETAMRMSEAVGKG-RYEKGISPDEVRAILATEI-ERALEPVATPIAIDSAK-KPYVILTVGVNGAGKTTTIGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGERTGTP-VISRAQGSDAAGLAFDAFKEARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHATLLVLDATVGQNALSQVELFSQAAPVSGLVMTKLDGTARGGILVALAAKFGLPVHFIGVGEGVEDLEPFAARDFARAITGLPKE 493
>gi|149202012|ref|ZP_01878986.1| signal recognition particle-docking protein FtsY [Roseovarius sp. TM1035] >gi|149145060|gb|EDM33089.1| signal recognition particle-docking protein FtsY [Roseovarius sp. TM1035] (403 aa)
Score = 545, Expect = 7.8e-54, Identities = 111/275 (40%), Positives = 177/275 (64%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           +D+   E++EELLI+ D+GV    ++T  + E    + +   + IKE++  +I    I +      + I   R  ++L++GVNG GKTT+I K+A  F    K V++ AGDTFRA AVEQL +W QR     V+   EG DPAS+ F  + + + E  DL++ DT+GRL N+ +LM+EL KI  VI K D +APH  LLVLDAT GQ+ + Q   F+++ +++G+++TK+DGT++GG+++++ D F +P+  IG+GE+++DL+ FD + F   +T
  S:   129 LDDAMLESLEELLIAADMGVDTALRVTANMAEGRMGKRLSTQE-IKELLAQEIAR--IMEPVARP-MPIYAKRPQVVLVVGVNGSGKTTTIGKLAAQFKGAGKSVVIAAGDTFRAAAVEQLQVWGQRAGVP-VMTAPEGSDPASLAFDAMTRAEAEGADLLMIDTAGRLQNRADLMEELAKIVRVIRKKDPSAPHNTLLVLDATTGQNALSQVATFQKLADVSGLVMTKLDGTARGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPQDFAAALT 398
>gi|168220309|ref|ZP_02645541.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Agona str. SL483] (491 aa)
Score = 545, Expect = 7.9e-54, Identities = 129/315 (40%), Positives = 200/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|148251983|ref|YP_001236568.1| signal recognition particle-docking protein FtsY [Bradyrhizobium sp. BTAi1] >gi|146404156|gb|ABQ32662.1| signal recognition particle-docking protein FtsY [Bradyrhizobium sp. BTAi1] (315 aa)
Score = 545, Expect = 8.6e-54, Identities = 114/301 (37%), Positives = 185/301 (61%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++   GLK++S  L  A+ ++V K +K+D    ++IE++L+  D+G     +I +A+     +      D +K ++   V+K+ +   +             +  ++L++GVNG GKTT+I K+A  F    K+V+L AGDTFRA A+EQL +W +R K   V+   +G D AS+ FT +   K++  D+++ DT+GRL NK  LM ELEK+  VI K D +APH  LLVLDAT+GQ+ + Q +AF     +TG+++TK+DGT++GGI++++ + F +PV +IG+GE ++DL  F    F   I
  S:    15 RRLSAGLKRTSGALGTAVADLVTK-RKLDRAMLDDIEDVLLRADLGTQVAARIAEAVGAG-RYDKAISADEVKAVVATEVEKVLSPVAKPLVVEA-----SHKPFVILVVGVNGSGKTTTIGKLAAKFASDGKQVMLAAGDTFRAAAIEQLKVWGERTKAP-VIAGAQGSDSASLAFTAITAAKEQARDILLIDTAGRLQNKAELMNELEKVVRVIRKVDASAPHAVLLVLDATVGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALSEKFKLPVHFIGVGEGVDDLQPFAARDFARAI 310
>gi|164414409|ref|NP_001105732.1| chloroplast SRP receptor cpFtsY precursor [Zea mays] >gi|33413157|emb|CAD70570.1| chloroplast SRP receptor cpFtsY precursor [Zea mays] (362 aa)
Score = 545, Expect = 8.8e-54, Identities = 119/301 (39%), Positives = 182/301 (60%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVD-EEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K   G  K+   LS  + E++  +   D +   +++EE L+  D G   + +I D +REEI    ++    IK  +  +     +     N+ L++   +  +++I+GVNG GKTTS+ K+A  F  +  KVL+ AGDTFRA A +QL +W++R   +IV+ + +   P +V+   VK+GK E +D+V+CDTSGRLH    LM+EL     V+ K    AP+E LLVLD T G + + QA+ F ++  +TG ILTK+DGT++GG V+S+ D   IPVK+IG+GE +EDL  FD E FV+ I
  S:    61 EKLFSGFSKTRENLS-VVDELLTYWNLADTDRVLDDLEEALLVSDFGPKISFRIVDTLREEIRDGKLKSGAEIKAAL-KRCILELLTSKGGNSELNLGFRKPAVIMIVGVNGGGKTTSLGKLAYRFKNEGVKVLMAAGDTFRAAARDQLEVWAERTGSEIVIDNDKKAQPPAVLSQAVKRGKREGFDVVLCDTSGRLHTNYGLMEELVSCKKVLAKALPGAPNEILLVLDGTTGLNMLQQAREFNDVVGVTGFILTKLDGTARGGCVVSVVDELGIPVKFIGVGEGMEDLQPFDAEAFVEAI 360
>gi|121587716|ref|ZP_01677477.1| signal recognition particle-docking protein FtsY [Vibrio cholerae 2740-80] >gi|121548015|gb|EAX58093.1| signal recognition particle-docking protein FtsY [Vibrio cholerae 2740-80] (395 aa)
Score = 545, Expect = 9.2e-54, Identities = 128/304 (42%), Positives = 195/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +    + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    84 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTARASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 390
>gi|15640178|ref|NP_229805.1| cell division protein FtsY [Vibrio cholerae O1 biovar eltor str. N16961] >gi|9654548|gb|AAF93324.1| cell division protein FtsY [Vibrio cholerae O1 biovar El Tor str. N16961] (391 aa)
Score = 545, Expect = 9.2e-54, Identities = 128/304 (42%), Positives = 195/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +    + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    80 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTARASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 386
>gi|153224866|ref|ZP_01954618.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MAK 757] >gi|194531349|ref|YP_002066810.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MO10] >gi|124117446|gb|EAY36189.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MAK 757] >gi|125617277|gb|EAZ45852.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MO10] (393 aa)
Score = 545, Expect = 9.2e-54, Identities = 128/304 (42%), Positives = 195/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +    + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    82 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTARASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 388
>gi|147673157|ref|YP_001218274.1| signal recognition particle-docking protein FtsY [Vibrio cholerae O395] >gi|146315040|gb|ABQ19579.1| signal recognition particle-docking protein FtsY [Vibrio cholerae O395] (387 aa)
Score = 545, Expect = 9.2e-54, Identities = 128/304 (42%), Positives = 195/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +    + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    76 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTARASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 382
>gi|121728299|ref|ZP_01681330.1| signal recognition particle-docking protein FtsY [Vibrio cholerae V52] >gi|121629429|gb|EAX61858.1| signal recognition particle-docking protein FtsY [Vibrio cholerae V52] (397 aa)
Score = 545, Expect = 9.2e-54, Identities = 128/304 (42%), Positives = 195/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +    + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    86 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTARASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 392
>gi|153840071|ref|ZP_01992738.1| cell division protein FtsY [Vibrio parahaemolyticus AQ3810] >gi|149746343|gb|EDM57398.1| cell division protein FtsY [Vibrio parahaemolyticus AQ3810] (403 aa)
Score = 545, Expect = 9.5e-54, Identities = 129/313 (41%), Positives = 200/313 (63%)
  Q:    36 QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           Q  +   + E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T KI + + E+ +  +++D + +  ++ +++       +     L+I   +T  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  +TGI LTK+DGT+KGG++ +I D F+IP++YIG+GE +EDL  F+ ++F+D +
  S:    83 QVPVAPRIQEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMDTTTKIINNLTEKASRGDLKDGEALYGLLKEEMAEIL---SKVEQPLEIDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFETQEFIDAL 398
>gi|153830010|ref|ZP_01982677.1| signal recognition particle-docking protein FtsY [Vibrio cholerae 623-39] >gi|148874495|gb|EDL72630.1| signal recognition particle-docking protein FtsY [Vibrio cholerae 623-39] (385 aa)
Score = 545, Expect = 9.5e-54, Identities = 128/304 (42%), Positives = 196/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +  + + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    74 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTAKASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 380
>gi|28899730|ref|NP_799335.1| cell division protein FtsY [Vibrio parahaemolyticus RIMD 2210633] >gi|28807982|dbj|BAC61219.1| cell division protein FtsY [Vibrio parahaemolyticus RIMD 2210633] (405 aa)
Score = 545, Expect = 9.5e-54, Identities = 129/313 (41%), Positives = 200/313 (63%)
  Q:    36 QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           Q  +   + E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T KI + + E+ +  +++D + +  ++ +++       +     L+I   +T  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  +TGI LTK+DGT+KGG++ +I D F+IP++YIG+GE +EDL  F+ ++F+D +
  S:    85 QVPVAPRIQEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMDTTTKIINNLTEKASRGDLKDGEALYGLLKEEMAEIL---SKVEQPLEIDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFSIPIRYIGVGEGIEDLRPFETQEFIDAL 400
>gi|126461266|ref|YP_001042380.1| signal recognition particle-docking protein FtsY [Rhodobacter sphaeroides ATCC 17029] >gi|126102930|gb|ABN75608.1| signal recognition particle-docking protein FtsY [Rhodobacter sphaeroides ATCC 17029] (379 aa)
Score = 545, Expect = 9.5e-54, Identities = 113/270 (41%), Positives = 174/270 (64%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           +D+   E++EE+LI  D+GV    ++T  I E    + V   + IKE +  +I             + +   R  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W +R     VL   EG DPAS+ F  + K + E  DL++ DT+GRL N+ +LM+EL KI  VIHK D  APH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F
  S:   106 LDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSARE-IKEALAAEIARIL---EPVARPMPLYPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQLQVWGRRAGVP-VLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEELSKIVRVIHKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGVLVALADRFGLPIHAIGVGEQIDDLAPFDPEEF 370
>gi|153803614|ref|ZP_01958200.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MZO-3] >gi|124120853|gb|EAY39596.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MZO-3] (391 aa)
Score = 544, Expect = 9.8e-54, Identities = 128/304 (42%), Positives = 196/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +  + + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    80 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTAKASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 386
>gi|146276684|ref|YP_001166843.1| signal recognition particle-docking protein FtsY [Rhodobacter sphaeroides ATCC 17025] >gi|145554925|gb|ABP69538.1| signal recognition particle-docking protein FtsY [Rhodobacter sphaeroides ATCC 17025] (410 aa)
Score = 544, Expect = 9.8e-54, Identities = 112/270 (41%), Positives = 173/270 (64%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           +D+   E++EE+LI  D+GV    ++T  I E    + V   + IKE +  +I             + +   R  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W +R     VL   EG DPAS+ F  + K + E  DL++ DT+GRL N+ +LM+EL KI  VI K D  APH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F
  S:   137 LDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSSRE-IKEALATEIARIL---EPVARPMPLYPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQLQVWGRRAGVP-VLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRTDLMEELSKIVRVIRKKDPDAPHNTLLVLDATTGQNALSQVEIFRKLADVSGLVMTKLDGTAKGGVLVALADRFGLPIHAIGVGEQIDDLAPFDPEEF 401
>gi|125620885|gb|EAZ49238.1| signal recognition particle-docking protein FtsY [Vibrio cholerae V51] (393 aa)
Score = 544, Expect = 1.0e-53, Identities = 123/278 (44%), Positives = 185/278 (66%)
  Q:    71 KFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K KK+D++ +E +EE L+  DVG+  T+KI   +  + + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DGT+KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:   114 KGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTAKASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGMDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGTAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 388
>gi|88858436|ref|ZP_01133078.1| Cell division transporter substrate-binding protein FtsY [Pseudoalteromonas tunicata D2] >gi|88820053|gb|EAR29866.1| Cell division transporter substrate-binding protein FtsY [Pseudoalteromonas tunicata D2] (565 aa)
Score = 544, Expect = 1.0e-53, Identities = 130/314 (41%), Positives = 193/314 (61%)
  Q:    35 KQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++A+I  +  E+  K D    +   +L K    I   F      KK+D+E +E +E  L++ D+GV  T K+   + E    + ++D D + +++   + ++     Q  DT      K     ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W QR   DI V+    G D ASVIF   +  K    D++I DT+GRL NK NLM+ELEKI  V+ K D  APHE +L +DA  GQ+ I Q   F +   +TGI LTK+DGT+KGG++ ++ D FNIP++YIG+GE ++DL AF  ++F++ +
  S:   243 QEAKIQALPAEESPKKDSFFSRLKKSLIKTKQSIGSGFINIFSGKKIDDELFEELETQLLTADLGVDTTLKLIARLTEAADRKQLKDGDALYDLLKQEMAQMLKSAEQALDTE-----KATGPFVILMVGVNGVGKTTTIGKLAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQR--NDIPVIAQHTGADSASVIFDAFQAAKARKVDILIADTAGRLQNKDNLMQELEKIARVMKKLDPDAPHEVMLTIDAGTGQNAISQVDLFNKAVGLTGISLTKLDGTAKGGVIFAVADKFNIPIRYIGVGEGIDDLRAFKSDEFINAL 559
>gi|78189179|ref|YP_379517.1| cell division transporter substrate-binding protein FtsY [Chlorobium chlorochromatii CaD3] >gi|78171378|gb|ABB28474.1| signal recognition particle-docking protein FtsY [Chlorobium chlorochromatii CaD3] (317 aa)
Score = 544, Expect = 1.1e-53, Identities = 132/303 (43%), Positives = 190/303 (62%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNT--FLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  +  EGL+K+  TL + ++ I K   ++D+EF E +E +L+  DVGV  T  I DAI E    +       +  +++D+I     + +D +   F      +  ++L++GVNG GKTTSIAK+A+++ +  KKV++ A DTFRA A EQL IW+ R    ++    +G DPASV+F  V      N D+V+ DT+GRLHNK +LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F +   +TG+++TK+DGTSKGGIVLSI  +  +PVKYIG+GEK++DL  FD   FV  +
  S:     8 KLSRLKEGLEKTRDTLREKLSVITKGKTEIDDEFLEELETILVGADVGVETTLAIVDAITERAKKETYHSETELNRMLIDEIQQMLQESSDEHPVDFDAPLPAKPYVILVVGVNGAGKTTSIAKLAHNYDQAGKKVIIAAADTFRAAAYEQLQIWADRAGVPMI-GQGQGADPASVVFDAVSAAVSRNADVVLVDTAGRLHNKSHLMEELAKIMRVAKKRIPEAPHEVLLVLDGTTGQNAVQQAQEFTKFVQVTGLVVTKLDGTSKGGIVLSISRDLKLPVKYIGVGEKIDDLQLFDRRNFVGAL 311
>gi|15966990|ref|NP_387343.1| putative cell division protein [Sinorhizobium meliloti 1021] >gi|15076263|emb|CAC47816.1| Putative cell division protein [Sinorhizobium meliloti 1021] (548 aa)
Score = 544, Expect = 1.1e-53, Identities = 117/296 (39%), Positives = 185/296 (62%)
  Q:    53 GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GL ++SS L+  I  +  K +K+DE   +++E+LLI  D+GV    +ITD +  E   ++V   D +  I+  +I T  +        LD+   + +++L++GVNG GKTT+I K+A        KV+L AGDTFRA A+EQL IW++R K +IV   K G D A + +   ++ +++  D++I DT+GRL NK  LM ELEKI  V+ K D  APH  L  LDAT GQ+ + Q + F+ +  ++G+I+TK+DGT++GGI+++I     +PV +IG+GE ++DL  F+ ++F + I
  S:   252 GLARTSSQLTGQIASLFTK-RKLDEATLQDLEDLLIQADLGVETAMRITDTLASERYGKDVSGED-VSRIMAGEI-TKVLAPVARPLELDLSH-KPHVILVVGVNGTGKTTTIGKLAAKLSGAGLKVMLAAGDTFRAAAIEQLKIWAERTKSEIV-SSKLGADAAGLAYEAFQRAREQKADVLIIDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALQQVEIFRNVAGVSGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGIDDLEPFEAKEFAEAI 542
>gi|86136625|ref|ZP_01055204.1| signal recognition particle-docking protein FtsY [Roseobacter sp. MED193] >gi|85827499|gb|EAQ47695.1| signal recognition particle-docking protein FtsY [Roseobacter sp. MED193] (355 aa)
Score = 544, Expect = 1.2e-53, Identities = 120/332 (36%), Positives = 203/332 (61%)
  Q:    18 EGSLEDLSAKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITE--IVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           EG   + +A +E + I+      +  P  +     GL      L + +      ++ + +D++  E +EELLI+ D+GV    ++T  + E    + +   + IKE++   V ++  +  +       + +   R  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W  R     VL   EG DPAS+ +  + + ++E  DL++ DT+GRL N+ +LM+EL KI  VI K D+TAPH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F   +T
  S:    28 EGGGTEQAAAVETRVIDAPPSATQTAPASEAAQPSGL------LGRLVGRGGTAEQRRTLDDDMLEQLEELLIAADMGVDTALRVTANMAEGRLGKKLSARE-IKELLAAEVARVMEHVAKP------MPLYAHRPQVVLVVGVNGSGKTTTIGKLASQFKAAGKNVVIAAGDTFRAAAVEQLQVWGDRAGVP-VLTAPEGSDPASLAYDAMTRAQEEGADLLMIDTAGRLQNRADLMEELSKIIRVIRKKDETAPHNTLLVLDATTGQNALSQVETFQKLADVSGLVMTKLDGTAKGGVLVALADKFALPIHAIGVGEQIDDLAPFDPEEFAAALT 350
>gi|90421736|ref|YP_530106.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris BisB18] >gi|90103750|gb|ABD85787.1| signal recognition particle-docking protein FtsY [Rhodopseudomonas palustris BisB18] (316 aa)
Score = 544, Expect = 1.2e-53, Identities = 117/305 (38%), Positives = 187/305 (61%)
  Q:    44 PEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           P   ++   GLK++SS++  A+ E V K +K+D    + IE++L+  D+G   + +I  A+      + +   D +K I+   V+K+     Q    +        +  ++L++GVNG GKTT+I K+A  F  + +KV+L AGDTFRA A+EQL +W +R     V+   +G D A + FT +   KD+  D+++ DT+GRL NK  LM ELEK+  VI K D TAPH  LLVLDAT+GQ+ + Q +AF     +TG+++TK+DGT++GGI++++ + + +PV ++G+GE +EDL+ F    F   I
  S:    10 PSWWRRLSSGLKRTSSSIGTALAEFVTK-RKLDRAMLDEIEDVLLRADLGTEVSARIAAAVGVGRYDKMISAGD-VKTIVAAEVEKVLAPVAQPLVIDA-----AHKPFVILMVGVNGSGKTTTIGKLAAKFAAEGRKVMLAAGDTFRAAAIEQLKVWGERTGAP-VISGTQGSDSAGLAFTALTAAKDDRRDVLLIDTAGRLQNKAELMNELEKVVRVIKKVDATAPHAVLLVLDATVGQNALSQVEAFSRTAGVTGLVMTKLDGTARGGILVALAEKYKLPVHFVGVGESVEDLAPFTAADFAKAI 309
>gi|29655188|ref|NP_820880.1| signal recognition particle-docking protein FtsY [Coxiella burnetii RSA 493] >gi|154706782|ref|YP_001423641.1| signal recognition particle-docking protein FtsY [Coxiella burnetii Dugway 5J108-111] >gi|29542460|gb|AAO91394.1| signal recognition particle-docking protein FtsY [Coxiella burnetii RSA 493] >gi|154356068|gb|ABS77530.1| signal recognition particle-docking protein FtsY [Coxiella burnetii Dugway 5J108-111] (324 aa)
Score = 544, Expect = 1.2e-53, Identities = 122/303 (40%), Positives = 192/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           + +E LK++ S L+  ++ +V   K +D    E +E +L+S D+G+ AT  I + + +++  +++ DP  + + +  KI    I +      L+I      ++L +GVNGVGKTT+IAK+A+ +  + K+V+L AGDTFRA A+EQL  W QR     V+  + G D ASVI+  ++     +YDL+I DT+GRLH + +LM EL KI  V+ K +  APHE LLVLDA  GQ+ I QA+ F E   +TGI +TK+DGT+KGG++ +I     +P+++IG+GEK+EDL  F+ ++F+  + KE
  S:    27 RLNESLKRTRSRLTDGLSNLVLGKKTIDASLLEELEMILLSADIGIEATQSILNNLSQQVARKSLSDPKALIDAL--KIELLNILEP-CQKHLEISAS-PFVILTVGVNGVGKTTTIAKLAHFYQSQKKRVMLAAGDTFRAAAIEQLQTWGQRNNAP-VIAQQPGADSASVIYDAMEAATARHYDLLIADTAGRLHTQSHLMDELAKIKRVMKKINPDAPHETLLVLDAGTGQNAINQAEQFHEHIGLTGIAITKLDGTAKGGVIFAIAKKMQLPIRFIGMGEKIEDLKPFNAKEFIAALFKE 324
>gi|110597634|ref|ZP_01385919.1| signal recognition particle-docking protein FtsY [Chlorobium ferrooxidans DSM 13031] >gi|110340754|gb|EAT59231.1| signal recognition particle-docking protein FtsY [Chlorobium ferrooxidans DSM 13031] (317 aa)
Score = 543, Expect = 1.3e-53, Identities = 133/303 (43%), Positives = 191/303 (63%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD---RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  K  EGL K+  TL   ++ I +   ++DEEF E +E +L++ DVGV  T  I DAI E    +       +  +++++I    +Q++  +  +D       +  ++LI+GVNG GKTTS+AK+A+++ K  KKV++ A DTFRA A EQL IW+ R    + L   +G DPASV++  V      N D+V+ DT+GRLHNK +LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F +   +TG+++TK+DGTSKGGIVLSI     +PVKYIG+GEK++DL  FD  +FV  +
  S:     8 KLSKLTEGLGKTRDTLRDKLSVITQGKTEIDEEFLEELETILVAADVGVETTLGIVDAITERAKQETYRSETELNNMLMEEI-QQLLQESGVDHPVDFDAPLPAKPYVILIVGVNGAGKTTSVAKLAHNYDKAGKKVIIAAADTFRAAAYEQLQIWADRAGVPM-LGQAQGSDPASVVYDAVSAAVARNADVVLVDTAGRLHNKSHLMEELAKIMRVAKKKIPEAPHEVLLVLDGTTGQNAVQQAREFTKFVKVTGLVVTKLDGTSKGGIVLSISRELGLPVKYIGVGEKIDDLQLFDRAEFVGAL 311
>gi|56415470|ref|YP_152545.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|56129727|gb|AAV79233.1| cell division protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] (491 aa)
Score = 543, Expect = 1.3e-53, Identities = 129/315 (40%), Positives = 199/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F    F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKAGDFIEAL 486
>gi|94970363|ref|YP_592411.1| signal recognition particle-docking protein FtsY [Acidobacteria bacterium Ellin345] >gi|94552413|gb|ABF42337.1| signal recognition particle-docking protein FtsY [Acidobacteria bacterium Ellin345] (320 aa)
Score = 543, Expect = 1.4e-53, Identities = 114/301 (37%), Positives = 188/301 (62%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++  E + ++  +L++ I + V    ++D+     +E  LI+ D+G + T ++  A+++++  + V+  D IK ++  +I    + +    + +        ++L++GVNG GKTT+I K++N    + K+VLL A DTFRA A++QL +W +R   + V+  K G DP++V+F  ++  K    D VI DT+GRLH K NLM ELEK+     KF  +APHE LLV+DAT GQ+G+ QAK F E   +TGI+LTK+DGT+KGG+V++I     +PV+Y+G+GEK+ D+  F+   FV+ +
  S:    20 QRMKEAVTRTRESLTERIEDAVGVRPEIDDYTLNELELTLIAADLGSVTTAEVLQALKDKVDRKQVQSTDEIKGVLKAEILRL-LNEAAAKSPVRTVDQPPEVILVVGVNGTGKTTTIGKLSNLLRAQGKQVLLCAADTFRAAAIDQLEVWGERTGVE-VIKTKPGGDPSAVLFDALQAAKARAVDYVIVDTAGRLHTKQNLMLELEKMKRTAQKFIPSAPHEVLLVMDATTGQNGLQQAKLFTESAGVTGIVLTKLDGTAKGGVVVAISRELGLPVRYVGVGEKIGDILPFNANDFVESL 318
>gi|117922404|ref|YP_871596.1| signal recognition particle-docking protein FtsY [Shewanella sp. ANA-3] >gi|117614736|gb|ABK50190.1| signal recognition particle-docking protein FtsY [Shewanella sp. ANA-3] (562 aa)
Score = 543, Expect = 1.4e-53, Identities = 125/319 (39%), Positives = 206/319 (64%)
  Q:    30 EKNIEKQAEILEVLPEKQKKF---DEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ +E+Q E  +  P K+  F     GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T+++  ++ E  + + ++D + + E++ D++     Q T     + +  +  N   ++L++GVNGVGKTT+I K+A  + ++ K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D  APHE +L LDA+ GQ+ I QA+ F+E   +TG+ ++K+DGT+KGG+V +I D F IP++YIG+GE+++DL  F+ ++F+D +
  S:   238 EQPLEQQPEP-QAKPAKESFFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTSRLIKSLTEHASRKQLKDAEALYELLRDEM-----QKTLDPVAIPLVPENANGPYVILMVGVNGVGKTTTIGKLAKQYQRQGKTVMLAAGDTFRAAAVEQLQVWGQRNNIPVV-AQHTGADSASVLFDALQAAKARKIDILIADTAGRLQNKSHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQLFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEFIDAL 554
>gi|120600697|ref|YP_965271.1| signal recognition particle-docking protein FtsY [Shewanella sp. W3-18-1] >gi|120560790|gb|ABM26717.1| signal recognition particle-docking protein FtsY [Shewanella sp. W3-18-1] (480 aa)
Score = 543, Expect = 1.5e-53, Identities = 123/308 (39%), Positives = 200/308 (64%)
  Q:    41 EVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ PE Q++            GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T ++ + + E  + + ++D + + +++ D++     Q T     + +  +  N   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D  APHE +L LDA+ GQ+ I QAK F+E   +TG+ ++K+DGT+KGG+V +I D FNIP++YIG+GE+++DL  F+ ++F+D +
  S:   160 ELQPEPQERPVKEGLFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTTRLINKLTEHASRKQLKDAEALYDLLRDEL-----QKTLDPVAIPLVPNNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVV-AQHTGADSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAKLFQEAVGVTGLTISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDAL 472
>gi|146337532|ref|YP_001202580.1| cell division transporter substrate-binding protein FtsY (Signal recognition particle receptor) [Bradyrhizobium sp. ORS278] >gi|146190338|emb|CAL74334.1| Cell division transporter substrate-binding protein FtsY (Signal recognition particle receptor) [Bradyrhizobium sp. ORS278] (315 aa)
Score = 543, Expect = 1.6e-53, Identities = 113/301 (37%), Positives = 186/301 (61%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++  +GLK++S  L  A+ ++V K +K+D    ++IE++L+  D+G     +I +A+     +      D +K ++   V+K+ +   +             +  ++L++GVNG GKTT+I K+A  F  + K V+L AGDTFRA A+EQL +W +R K   V+   +G D AS+ F  +   K++  D+++ DT+GRL NK  LM ELEK+  VI K D +APH  LLVLDAT+GQ+ + Q +AF     +TG+++TK+DGT++GGI++++ + F +PV +IG+GE ++DL  F  + F   I
  S:    15 RRLSDGLKRTSGALGTAVADLVTK-RKLDRAMLDDIEDVLLRADLGTQVAARIAEAVGAG-RYDKAISADEVKAVVATEVEKVLSPVAKPLTIE-----PGHKPFVILVVGVNGSGKTTTIGKLAQKFASEGKHVMLAAGDTFRAAAIEQLKVWGERTKAP-VIAGAQGSDSASLAFNAITAAKEQGRDILLIDTAGRLQNKAELMNELEKVVRVIRKVDASAPHAVLLVLDATVGQNALSQVEAFHRTAGVTGLVMTKLDGTARGGILVALSEKFKLPVHFIGVGEGVDDLQPFAAKDFARAI 310
>gi|52842876|ref|YP_096675.1| cell division membrane protein FtsY [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|52629987|gb|AAU28728.1| cell division membrane protein FtsY [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (368 aa)
Score = 542, Expect = 1.7e-53, Identities = 129/344 (37%), Positives = 206/344 (59%)
  Q:     5 FFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQK----KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +FK+  N          +D +    E  +E+  E+    P  ++    +F +GL K+   L + I+ ++   K++ +E  E +E LLIS D+G+  T  +   + E +  + + + + +   +   + T   Q+    + ++ +     ++L++GVNG GKTT+I K+A  F K+ KKV+L AGDTFRA AVEQL++W +R     V+    G D ASVIF  ++  K    D++I DT+GRLH + NLM+EL+K+  V+ K D  APHE +LVLDA++GQ+ + QAK F E   +TGI +TK+DGT+KGGI+ +I ++  IP +Y+G+GE +EDL  FD  +FV  I
  S:    17 WFKRNQNSEPNLDAEEQQDHAKSSMESRLEEPQELTVKEPSPKESIFARFRKGLSKTRHQLGEGISRLLLGKKEISQELLEELETLLISADLGLDTTQDVLKQLNEGLARKQLSNGEAVYLTLKTNLQTILSQEEKPLS-IETEDGSPFVILMVGVNGAGKTTTIGKLAKQFQKQGKKVMLAAGDTFRAAAVEQLHVWGERNGIP-VIAQHTGADSASVIFDALQAAKARKIDVLIADTAGRLHTQSNLMEELKKVKRVMQKLDPKAPHETMLVLDASIGQNALAQAKQFHEAVQLTGITMTKLDGTAKGGILFAIANDLGIPFRYLGVGEGIEDLRPFDAAQFVSAI 362
>gi|115442343|ref|NP_001045451.1| Os01g0958100 [Oryza sativa (japonica cultivar-group)] >gi|113534982|dbj|BAF07365.1| Os01g0958100 [Oryza sativa (japonica cultivar-group)] (347 aa)
Score = 542, Expect = 1.8e-53, Identities = 123/301 (40%), Positives = 182/301 (60%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVD-EEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K   G  K+  +LS  + E++  +   D +   + +EE L+  D G   + +I D +REEI    ++    IKE +  +     +     N  L +   +  +++I+GVNG GKTTS+ K+A  F  +  KVL+ AGDTFRA A +QL +W++R   +IV+ + +   PASV+   VK+GK E +DLV+CDTSGRLH    LM+EL     VI K    AP+E LLVLD T G + + QA+ F ++  +TG +LTK+DGT++GG V+S+ D   IPVK+IG+GE +EDL  FD E FV+ I
  S:    46 EKLFSGFSKTRESLS-VVDELLTYWNLADTDRVLDELEEALLVSDFGPKISFRIVDTLREEIRDGKLKSGAEIKEAL-KRCILELLTSKGGNPELQLGFRKPAVIMIVGVNGGGKTTSLGKLAYRFKNEGVKVLMAAGDTFRAAARDQLEVWAERTGSEIVIDNDKKAKPASVLSQAVKRGKREGFDLVLCDTSGRLHTNYGLMEELVSCKKVIAKALPGAPNEILLVLDGTTGLNMLQQAREFNDVVGVTGFVLTKLDGTARGGCVVSVVDELGIPVKFIGVGEGMEDLQPFDAEAFVEAI 345
>gi|84500000|ref|ZP_00998266.1| signal recognition particle-docking protein FtsY [Oceanicola batsensis HTCC2597] >gi|84391934|gb|EAQ04202.1| signal recognition particle-docking protein FtsY [Oceanicola batsensis HTCC2597] (440 aa)
Score = 542, Expect = 1.9e-53, Identities = 111/277 (40%), Positives = 180/277 (64%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGIT 349
           + +D++  E +EELLI+ D+GV    ++   + E    + +   + IK ++ D++ T  ++       L  KK +  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL IW  R     VL   EG DPA++ +  ++K + E  DL++ DT+GRL N+ +LM+EL KI  V+ K D +APH  LLVLDAT GQ+ + Q + F+++ ++TG+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD   F   +T
  S:   161 RALDDDMLEQLEELLIASDMGVDTALRVASNMAEGRMGRRLSTAE-IKGLLADEV-TRIMEPVARPLPLFPKKPQ--VVLVVGVNGSGKTTTIGKLASQFRGAGKSVVIAAGDTFRAAAVEQLEIWGDRAGVP-VLKAAEGSDPAALAYDALEKAEAEGADLLMIDTAGRLQNRADLMEELAKIVRVLRKRDPSAPHNTLLVLDATTGQNALSQVETFRKMADVTGLVMTKLDGTAKGGVLVALADKFGLPIHAIGVGEQIDDLAPFDPGDFARALT 432
>gi|165922511|ref|ZP_02219682.1| signal recognition particle-docking protein FtsY [Coxiella burnetii RSA 334] >gi|165916716|gb|EDR35320.1| signal recognition particle-docking protein FtsY [Coxiella burnetii RSA 334] (324 aa)
Score = 542, Expect = 2.0e-53, Identities = 122/303 (40%), Positives = 193/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           + +E LK++ S L+  ++ +V   K +D    E +E +L+S D+G+ AT  I + + ++++ +++ DP  + + +  KI    I +      L+I      ++L +GVNGVGKTT+IAK+A+ +  + K+V+L AGDTFRA A+EQL  W QR     V   + G D ASVI+  ++     +YDL+I DT+GRLH + +LM EL KI  V+ K +  APHE LLVLDA  GQ+ I QA+ F E   +TGI +TK+DGT+KGG++ +I     +P+++IG+GEK+EDL +F+ ++F+  + KE
  S:    27 RLNESLKRTRSRLTDGLSNLVLGKKTIDASLLEELEMILLSADIGIEATQSILNNLSQQVSRKSLSDPKALIDAL--KIELLNILEP-CQKHLEISAS-PFVILTVGVNGVGKTTTIAKLAHFYQSQKKRVMLAAGDTFRAAAIEQLQTWGQRNNAP-VSAQQPGADSASVIYDAMEAATARHYDLLIADTAGRLHTQSHLMDELAKIKRVMKKINPDAPHETLLVLDAGTGQNAINQAEQFHEHIGLTGIAITKLDGTAKGGVIFAIAKKMQLPIRFIGMGEKIEDLKSFNAKEFIAALFKE 324
>gi|28210933|ref|NP_781877.1| signal recognition particle receptor ftsY [Clostridium tetani E88] >gi|28203372|gb|AAO35814.1| signal recognition particle receptor ftsY [Clostridium tetani E88] (303 aa)
Score = 541, Expect = 2.2e-53, Identities = 134/300 (44%), Positives = 198/300 (66%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD----LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K  EGL K+    +  I+ ++  +  +DE+ +E +EE+LI+ D+GV  +  I D +RE+I  + ++DP      +KE+I+D +        + N+   I +    I+L++GVNGVGKTTSI K+++       KVL+ AGDTFRA A+EQL +WSQR   DI+   +EG DPA+V+F  ++  K    D++ICDT+GRLHNK NLM EL KI+ ++ +    A  +  LVLDAT GQ+ + QAK F ++ N+ GIILTK+DGT+KGGIV+SIK   NIPVK IG+GE ++DL  F+  +FV+ +
  S:     8 KLKEGLTKTKDNFTGKISSMLNLYVNIDEDLFEELEEILITSDIGVETSLDIIDNLREKIKEKKIKDPKEVIPCLKEVIIDML------GDEENSI--IPEKTPEIILVIGVNGVGKTTSIGKMSHKLKNNGFKVLMAAGDTFRAAAIEQLEVWSQRAGVDII-RQQEGSDPAAVVFDSIQAAKARKTDVLICDTAGRLHNKKNLMDELSKINRIVEREYSEANKKTYLVLDATTGQNALQQAKQFTQVCNVDGIILTKLDGTAKGGIVISIKHQLNIPVKLIGVGEGIDDLQNFNSREFVEAL 302
>gi|153826285|ref|ZP_01978952.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MZO-2] >gi|149739953|gb|EDM54132.1| signal recognition particle-docking protein FtsY [Vibrio cholerae MZO-2] (395 aa)
Score = 541, Expect = 2.3e-53, Identities = 127/304 (41%), Positives = 196/304 (64%)
  Q:    45 EKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T+KI   +  + + Q + D + +  ++ +++    +   +    +D +K +  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R +   V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  ITGI LTK+DG++KGG++ +I D F IP++YIG+GEK++DL  F  ++F+D +
  S:    84 EQEKPTESFFARLKRSLSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMDTTSKIIANLTAKASRQQLRDGEALYGLLKEEM-AEILSQVEQPLVIDTEK-KPYVILMVGVNGVGKTTTIGKLAKQFQAQGKKVMLAAGDTFRAAAVEQLQVWGERNQVP-VIAQHTGADSASVIYDAIEAAKARGIDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITGITLTKLDGSAKGGVIFAIADQFQIPIRYIGVGEKIDDLRPFATQEFIDAL 390
>gi|186475077|ref|YP_001856547.1| signal recognition particle-docking protein FtsY [Burkholderia phymatum STM815] >gi|184191536|gb|ACC69501.1| signal recognition particle-docking protein FtsY [Burkholderia phymatum STM815] (392 aa)
Score = 541, Expect = 2.4e-53, Identities = 121/295 (41%), Positives = 181/295 (61%)
  Q:    54 LKKSSSTLSKAITEIVKKF--KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKE----IIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           L +  S LSK  + I   F   ++DE+ YE +E  L+  D GV AT  + + +RE++  + + DP  +K     ++VD +             L +      +++I GVNG GKTTSI K+A H  + ++ VLL AGDTFRA A EQL IW +R   ++++  +E  DPA+VIF  V   +    ++V+ DT+GRL  +++LM+EL K+  VI K    APHE LLV+DA  GQ+ + Q KAF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F  E+F D +
  S:    99 LTRLRSGLSKTSSSITGIFVGTRIDEDLYEELETALLMSDAGVDATEYLLETLREKVRSERLTDPQQVKSALRTLLVDLL-------KPLEKSLTLGHYHPTVMMIAGVNGAGKTTSIGKLAKHMQRFNQSVLLAAGDTFRAAAREQLAIWGER--NNVMVVQQESGDPAAVIFDAVGAARARKINVVMADTAGRLPTQLHLMEELRKVKRVIGKAMAGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFSAEEFSDAL 390
>gi|153209355|ref|ZP_01947362.1| signal recognition particle-docking protein FtsY [Coxiella burnetii 'MSU Goat Q177'] >gi|120575388|gb|EAX32012.1| signal recognition particle-docking protein FtsY [Coxiella burnetii 'MSU Goat Q177'] (324 aa)
Score = 541, Expect = 2.5e-53, Identities = 122/303 (40%), Positives = 192/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           + +E LK++ S L+  ++ +V   K +D    E +E +L+S D+G+ AT  I + + ++++ +++ DP  + + +  KI    I +      L+I      ++L +GVNGVGKTT+IAK+A+ +  + K+V+L AGDTFRA A+EQL  W QR     V   + G D ASVI+  ++     +YDL+I DT+GRLH + +LM EL KI  V+ K +  APHE LLVLDA  GQ+ I QA+ F E   +TGI +TK+DGT+KGG++ +I     +P+++IG+GEK+EDL  F+ ++F+  + KE
  S:    27 RLNESLKRTRSRLTDGLSNLVLGKKTIDASLLEELEMILLSADIGIEATQSILNNLSQQVSRKSLSDPKALIDAL--KIELLNILEP-CQKHLEISAS-PFVILTVGVNGVGKTTTIAKLAHFYQSQKKRVMLAAGDTFRAAAIEQLQTWGQRNNAP-VSAQQPGADSASVIYDAMEAATARHYDLLIADTAGRLHTQSHLMDELAKIKRVMKKINPDAPHETLLVLDAGTGQNAINQAEQFHEHIGLTGIAITKLDGTAKGGVIFAIAKKMQLPIRFIGMGEKIEDLKPFNAKEFIAALFKE 324
>gi|194684895|emb|CAR47054.1| cell division protein [Proteus mirabilis HI4320] (612 aa)
Score = 541, Expect = 2.5e-53, Identities = 129/334 (38%), Positives = 210/334 (62%)
  Q:    15 GKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQ---KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
            + +   ED+ A  EE  ++K  E  +  P+K+    +  +GL K+   L      + +  KK+D+E +E +EE L+  DVG+  T+KI +++ +  + ++++D + +   + +++          +  L+I+  +  ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W +R     V+    G DPASVIF  ++  + +  D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L LDA+ GQ+ + QAK F E   +TG+ LTK+DGT+KGG++ SI D F IP++YIG+GE +EDL  F  + F++ +
  S:   278 AQAQAEAEDIVALREEVLVDKPVE--QERPKKEGFFSRLKKGLLKTRQNLGSGFMGLFRG-KKIDDELFEELEEQLLIADVGMDTTSKIINSLTQHASRKDLKDAESLYGKLREEMGDIL---NKVDKPLNIEGKKPFVILMVGVNGVGKTTTIGKLARQYQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIP-VIAQHTGADPASVIFDAIQSAQAKGVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTLDASTGQNAVSQAKLFNETVGLTGLTLTKLDGTAKGGVIFSIADQFGIPIRYIGVGEGIEDLRPFKADDFIEAL 607
>gi|167549211|ref|ZP_02342970.1| hypothetical protein Sentente_01790 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (491 aa)
Score = 541, Expect = 2.5e-53, Identities = 128/315 (40%), Positives = 199/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+   +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDEPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|13377875|gb|AAK20880.1|AF334761_1 cell division protein FtsY [Aeromonas hydrophila] (333 aa)
Score = 541, Expect = 2.5e-53, Identities = 113/276 (40%), Positives = 175/276 (63%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D+E +E +E  L++ D+GV  T +I D + +    + ++D + +  ++   +     Q  +    +D  K +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W QR     V+    G D ASVI+  ++  +    D++I DT+GRL NK NLM+EL+K+  V+ K D+ APHE +L LDA  GQ+ + QAK F E   + GI+LTK+DGT+KGG++ ++ D F IP++YIG+GE ++DL  F    F++ +
  S:    56 KKIDDELFEELETQLLTADLGVDTTRRIIDGLVQHADRKQLKDAEALYGLLKQDMGAMLAQ-VEQPLVIDTSK-KPYVILMVGVNGVGKTTTIGKLAKQFQAEGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIYDAIEAARSRGADVLIADTAGRLQNKSNLMEELKKVVRVMKKLDEEAPHEVMLTLDAGTGQNALSQAKLFSEAVGLDGIVLTKLDGTAKGGVIFAVADKFQIPIRYIGVGEGIDDLRPFVANDFIEAL 328
>gi|156972628|ref|YP_001443535.1| signal recognition particle GTPase [Vibrio harveyi ATCC BAA-1116] >gi|156524222|gb|ABU69308.1| hypothetical protein VIBHAR_00280 [Vibrio harveyi ATCC BAA-1116] (408 aa)
Score = 541, Expect = 2.7e-53, Identities = 129/313 (41%), Positives = 199/313 (63%)
  Q:    36 QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           Q  +   + E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T KI + + E+ +  +++D + +  ++ +++     +       L+I   +T  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F+ ++F+D +
  S:    88 QVAVAPRVQEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMETTTKIINNLTEKASRGDLKDGEALYGLLKEEMAEILAK---VEQPLEIDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFETQEFIDAL 403
>gi|168818612|ref|ZP_02830612.1| hypothetical protein Salentericaenterica_04456 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (491 aa)
Score = 541, Expect = 2.7e-53, Identities = 128/315 (40%), Positives = 199/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+   +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDEPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|15603384|ref|NP_246458.1| hypothetical protein PM1519 [Pasteurella multocida subsp. multocida str. Pm70] >gi|12721906|gb|AAK03603.1| FtsY [Pasteurella multocida subsp. multocida str. Pm70] (459 aa)
Score = 541, Expect = 2.7e-53, Identities = 121/276 (43%), Positives = 180/276 (65%)
  Q:    73 KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           KK+D+  +E +EE L+  D+GV    KI + + +  + Q +++ DL+ + +  K+    I        +  +  +  ++L++GVNGVGKTT+I K+A  F  + K V+L AGDTFRA AVEQL +W +R    +V     G D ASVIF  ++     + D++I DT+GRL NK NLM EL+KI  V+ K+D+TAPHE +L LDA  GQ+ I QAK F E   +TGI LTK+DGT+KGG++ +I D FN+P++YIG+GEK+EDL  F+ ++F+D +
  S:   176 KKIDDALFEELEEQLLIADLGVPTATKIINNLTQHASHQQLKEADLLYQQL--KVEMAEILKPVAQPLVIDQSKKPYVILMVGVNGVGKTTTIGKLARQFQNEGKSVMLAAGDTFRAAAVEQLQVWGERNSIPVV-AQSTGSDSASVIFDAMQSAAARHVDVLIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTGQNAISQAKLFHEAVGLTGITLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIEDLRPFNADEFIDAL 448
>gi|152965360|ref|YP_001361144.1| signal recognition particle-docking protein FtsY [Kineococcus radiotolerans SRS30216] >gi|151359877|gb|ABS02880.1| signal recognition particle-docking protein FtsY [Kineococcus radiotolerans SRS30216] (391 aa)
Score = 540, Expect = 2.8e-53, Identities = 123/274 (44%), Positives = 177/274 (64%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +DE  +E +EE L+  DVG   T +I DA+RE +      +P L++E++ +++      D D         DR  +++++GVNG GKTT++ K+A   + +DK V+L A DTFRA A EQL  W  R+    V  DK+G DPASV F  VK+G D+  D+VI DT+GRL NK+ LM EL K+  V+ +       E LLVLDAT GQ+G+ QA  F E+ ++TGI+LTK+DGT+KGGIV++++ + ++PVK IGLGE  +DL+ FD E FVD +
  S:   118 LDEATWEEVEETLLLADVGFGPTTEIVDALRERVKVLGTREPALLREMLREELLRAVGTDVDRTLRTTRHADRPAVIMVVGVNGTGKTTTVGKLARVLVAEDKDVVLGAADTFRAAAAEQLATWGDRVGVPTVRSDKDGADPASVAFDAVKQGIDDEVDVVIVDTAGRLQNKVGLMDELGKVKRVVERHGPV--DEVLLVLDATTGQNGLRQAAVFSEVVDVTGIVLTKLDGTAKGGIVVAVQRSLDVPVKLIGLGEGPDDLAPFDPEAFVDAL 389
>gi|88797601|ref|ZP_01113190.1| signal recognition particle receptor FtsY [Reinekea sp. MED297] >gi|88779773|gb|EAR10959.1| signal recognition particle receptor FtsY [Reinekea sp. MED297] (330 aa)
Score = 540, Expect = 2.8e-53, Identities = 130/323 (40%), Positives = 195/323 (60%)
  Q:    26 AKIEEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K ++K   ++++  +  P   ++   GL K+ S  S  +   +   K +D++  E +E LL+S DVG+ AT  I D + E  + + + D + +   + + +     Q T     L I   +   ++L++GVNGVGKTT+I K+   F  + K V+L AGDTFRA AVEQL  W +R     V+    G D ASVIF  V+  K    D++I DT+GRLHNK NLM ELEK+  V+ K DD+APHE LLVLDA  GQ+ + QA++F +   +TGI LTK+DGT++GGI+ ++   F IPV++IG+GE+ EDL  F  ++FV  +
  S:     5 SKRKDKQPSQESQNNDSKPSWFQRVKNGLSKTRSGFSNGLATALLGRKTLDDDTLEELETLLLSSDVGIEATQTILDDLVERTSRKELNDNNALMNALRETLVE---QLTPVEQPLQIDTGKQPFVILVVGVNGVGKTTTIGKMTQRFQSEGKSVMLAAGDTFRAAAVEQLQTWGERHNVP-VIAQHTGADSASVIFDAVQAAKSRGVDVLIADTAGRLHNKDNLMAELEKVLRVMKKIDDSAPHEVLLVLDAGTGQNAVAQAESFTKAAPLTGIALTKLDGTARGGIIFALARKFGIPVRFIGVGEQAEDLDRFSAQEFVSAL 324
>gi|124546042|ref|ZP_01705158.1| signal recognition particle-docking protein FtsY [Shewanella putrefaciens 200] >gi|124510281|gb|EAY54351.1| signal recognition particle-docking protein FtsY [Shewanella putrefaciens 200] (480 aa)
Score = 540, Expect = 2.9e-53, Identities = 122/309 (39%), Positives = 201/309 (65%)
  Q:    40 LEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +E+ PE Q++            GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T ++ + + E  + + ++D + + +++ D++     Q T     + +  +  N   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D  APHE +L LDA+ GQ+ I QA+ F+E   +TG+ ++K+DGT+KGG+V +I D FNIP++YIG+GE+++DL  F+ ++F+D +
  S:   159 VELQPEPQERPVKEGLFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTTRLINKLTEHASRKQLKDAEALYDLLRDEL-----QKTLDPVAIPLVPNNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVV-AQHTGADSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQLFQEAVGVTGLTISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDAL 472
>gi|157373360|ref|YP_001471960.1| signal recognition particle-docking protein FtsY [Shewanella sediminis HAW-EB3] >gi|157315734|gb|ABV34832.1| signal recognition particle-docking protein FtsY [Shewanella sediminis HAW-EB3] (540 aa)
Score = 540, Expect = 2.9e-53, Identities = 129/319 (40%), Positives = 206/319 (64%)
  Q:    30 EKNIEKQAEILEVLPEKQ---KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+  EKQ E  E  P K+    +   GLK++S  +      +    KK+D++ +E +EE L+  DVGV  T ++ D++ E+ + + ++D + + EI+ D++     Q T     + +  +  +   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  +  N D++I DT+GRL NK +LM EL+K+  V+ K D++APHE +L LDA+ GQ+ I QA+ FK+   +TGI ++K+DGT+KGG++ +I D F IP+++IG+GE+++DL  FD + FVD +
  S:   214 EQETEKQPEPQEK-PTKEGFFARLKRGLKRTSENIGSGFVSLFSG-KKIDDDLFEELEEQLLIADVGVETTTRLIDSLTEQASRKQLKDGEALYEILRDEM-----QKTLEPVSIPLVPESADGPFVILMVGVNGVGKTTTIGKLAKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVV-AQHTGADSASVLFDALQAARARNIDILIADTAGRLQNKAHLMDELKKVIRVMKKQDESAPHEVMLTLDASTGQNAISQAELFKKAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDFVDAL 530
>gi|126661952|ref|ZP_01732951.1| putative recognition particle-docking protein [Flavobacteria bacterium BAL38] >gi|126625331|gb|EAZ96020.1| putative recognition particle-docking protein [Flavobacteria bacterium BAL38] (326 aa)
Score = 540, Expect = 3.0e-53, Identities = 132/309 (42%), Positives = 198/309 (64%)
  Q:    42 VLPEKQKK-FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ-DTDTNTFLDIKKD-RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITK 350
           VL E++K+  D+GL+K+ ++    +T+ V    KVD +  +N+EE+L+S DVGV  T KI + I E ++       D +  I+ ++I +   + ++   T  DI K+ +  +++++GVNGVGKTT+I K+A  F K    V+L A DTFRA A++QL IW+ R+   IV   + G DPASV F  ++    +N D+VI DT+GRLHNK+ LM EL K+  V+ K  +  P++ LLVLD + GQ+   QAK F   T ++ + +TK+DGT+KGG+V+ I D F IPVKYIG+GE +EDL  F+  +FVD   K
  S:    16 VLNEQEKQSLDKGLEKTKTSFFSKLTKAVAGKSKVDADVLDNLEEILVSSDVGVNTTLKIIERIEERVSKDKYLGTDELNGILREEIASLLSETNSGEATQFDIPKNTKPYVIMVVGVNGVGKTTTIGKLAYQFKKAGYNVVLGAADTFRAAAIDQLQIWADRVGVPIV-KQQMGSDPASVAFDTLQSAVAQNADIVIIDTAGRLHNKVGLMNELSKVKKVMQKVVENTPNDVLLVLDGSTGQNAFEQAKQFTAATEVSCLAVTKLDGTAKGGVVIGISDQFQIPVKYIGVGEGIEDLQVFNKYEFVDSFFK 326
>gi|91212953|ref|YP_542939.1| cell division protein FtsY [Escherichia coli UTI89] >gi|91074527|gb|ABE09408.1| cell division protein FtsY [Escherichia coli UTI89] (498 aa)
Score = 540, Expect = 3.1e-53, Identities = 128/315 (40%), Positives = 199/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++  + E+  E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + + D + +  ++ +++     +    +  L+++     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D  APHE +L +DA+ GQ+G+ QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   176 EEEQPVEEIAQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAK---VDEPLNVEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNGVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 493
>gi|166711627|ref|ZP_02242834.1| cell division protein [Xanthomonas oryzae pv. oryzicola BLS256] (553 aa)
Score = 540, Expect = 3.1e-53, Identities = 117/320 (36%), Positives = 183/320 (57%)
  Q:    29 EEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD-LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  +I  Q + L   P  +  + E L+  +ST +++   +  +  K+D++  + IE  LI+ DVG+ AT  + + +R+ +  +   D   + K +  D I    +Q       +D +  +  ++L +GVNGVGKTT+I K+A  F  +   ++L AGDTFRA AV QL  W  R     V+   +  D ASV F  ++  K    D++I DT+GRLH +  LM EL KI  V+ K D  APHE L+V+D T GQ+ I Q + F     +TG+++TK+DGT+KGG+V ++   FNIP+++ G+GE+ EDL  FD   FVD +
  S:   232 DSDSIVGQHDALPAAPAGKPGWRERLR--NSTFARSFGGLFSRNPKLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFIDAQAMFKALRADLI--ALLQPVSKPLVID-RARKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQLQAWGDRNGV-AVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKIRRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFALAREFNIPIRFAGIGERPEDLRVFDPVAFVDAL 546
>gi|113972101|ref|YP_735894.1| signal recognition particle-docking protein FtsY [Shewanella sp. MR-4] >gi|113886785|gb|ABI40837.1| signal recognition particle-docking protein FtsY [Shewanella sp. MR-4] (582 aa)
Score = 540, Expect = 3.2e-53, Identities = 124/319 (38%), Positives = 206/319 (64%)
  Q:    30 EKNIEKQAEILEVLPEKQKKF---DEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ +E+Q E  +  P K+  F     GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T+++  ++ E  + + ++D + + +++ D++     Q T     + +  +  N   ++L++GVNGVGKTT+I K+A  + ++ K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D  APHE +L LDA+ GQ+ I QA+ F+E   +TG+ ++K+DGT+KGG+V +I D F IP++YIG+GE+++DL  F+ ++F+D +
  S:   258 EQPLEQQPEP-QAKPAKESFFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTSRLIQSLTEHASRKQLKDAEALYDLLRDEM-----QKTLDPVAIPLVPENANGPYVILMVGVNGVGKTTTIGKLAKQYQRQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVV-AQHTGADSASVLFDALQAAKARKIDILIADTAGRLQNKSHLMEELKKVVRVMKKLDLEAPHEVMLTLDASTGQNAISQAQLFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEFIDAL 574
>gi|168235165|ref|ZP_02660223.1| cell division protein FtsY [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|194736508|ref|YP_002116506.1| signal recognition particle-docking protein FtsY [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|194712010|gb|ACF91231.1| signal recognition particle-docking protein FtsY [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (491 aa)
Score = 540, Expect = 3.4e-53, Identities = 128/315 (40%), Positives = 199/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ A +  ++ E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++  ++     +    +  L+I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   169 EEDAPVEAIVQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKGEMGEILAK---VDEPLNIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 486
>gi|163748790|ref|ZP_02156042.1| cell division protein FtsY [Shewanella benthica KT99] >gi|161331564|gb|EDQ02369.1| cell division protein FtsY [Shewanella benthica KT99] (456 aa)
Score = 540, Expect = 3.4e-53, Identities = 128/308 (41%), Positives = 203/308 (65%)
  Q:    41 EVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E  PE QKK            GLK++S  +      + K  KK+D++ +E +EE L+  DVGV  T ++ D++ E+ + + ++D + + E++ +++     Q T     + +  +  +   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR   DI V+    G D ASV+F  ++  +  N D++I DT+GRL NK++LM EL+KI  V+ K D+ APHE +L LDA  GQ+ I QA+ FK+   +TGI ++K+DGT+KGG++ +I D F IP+++IG+GE+++DL  FD + F+D +
  S:   134 EKQPEPQKKPVKEGFFARLKRGLKRTSENIGSGFIGLFKG-KKIDDDLFEELEEQLLIADVGVETTTRLIDSLTEQASRKQLKDGEALYELLREEM-----QKTLEPVSIPLVPESADGPFVILMVGVNGVGKTTTIGKLAKQYQAEGKSVMLAAGDTFRAAAVEQLQVWGQR--NDIPVIAQHTGADSASVLFDALQAARARNIDVLIADTAGRLQNKVHLMDELKKIVRVMKKLDENAPHEVMLTLDAGTGQNAISQAELFKKAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDFIDAL 446
>gi|117625742|ref|YP_859065.1| cell division protein FtsY [Escherichia coli APEC O1] >gi|115514866|gb|ABJ02941.1| cell division protein FtsY [Escherichia coli APEC O1] (498 aa)
Score = 540, Expect = 3.4e-53, Identities = 128/315 (40%), Positives = 199/315 (63%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++  + E+  E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + + D + +  ++ +++     +    +  L+++     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D  APHE +L +DA+ GQ+G+ QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   176 EEEQPVEEIAQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAK---VDEPLNVEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNGVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 493
>gi|148323276|gb|EDK88526.1| cell division protein FtsY [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (344 aa)
Score = 540, Expect = 3.5e-53, Identities = 132/295 (44%), Positives = 195/295 (66%)
  Q:    54 LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           L KS       +  I     KVD+  YE +E+LL+  DVG+  T  + + + +E+    V++ D + EI+  ++ + ++   D+  +L  K ++ N++LI+GVNGVGKTT+I K+A  + K  KKVLL AGDTFRA AVEQL  W++R   DIV   +EG DPASV++  + + +    D+VI DT+GRLHNK NLM+ELEKI+++I K      +E+LLV+D T GQ+G+ QAK F  +T++TG I+TK+DGT+KGGIV S+ +    P+K+IGLGEK+ DL  F+ + FV+ I
  S:    52 LTKSKEGFFSKLKNIFTSKSKVDDSIYEELEDLLLQSDVGLSMTTNLINQLEKEVKANKVDNTDEVYEIL-KRLMSEFLLSQDSKIYL--KDNKINVILIVGVNGVGKTTTIGKLALKYKKLGKKVLLGAGDTFRAAAVEQLEEWAKRADVDIV-KGREGADPASVVYDTLSRAEATKADVVIIDTAGRLHNKANLMRELEKINNIIKKKIGEQEYESLLVIDGTTGQNGLNQAKEFNSVTDLTGFIVTKLDGTAKGGIVFSVSEELKKPIKFIGLGEKIGDLIEFNAKDFVEAI 342
>gi|24114724|ref|NP_709234.1| cell division protein FtsY [Shigella flexneri 2a str. 301] >gi|30065259|ref|NP_839430.1| cell division protein FtsY [Shigella flexneri 2a str. 2457T] >gi|24053940|gb|AAN44941.1| cell division membrane protein [Shigella flexneri 2a str. 301] >gi|30043521|gb|AAP19241.1| cell division membrane protein [Shigella flexneri 2a str. 2457T] (498 aa)
Score = 540, Expect = 3.5e-53, Identities = 127/315 (40%), Positives = 198/315 (62%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++  + E+  E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + + D + +  ++ +++     +    +  L+++     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D  APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   176 EEEQPVAEIAQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAK---VDEPLNVEDKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 493
>gi|148978744|ref|ZP_01815124.1| cell division protein FtsY [Vibrionales bacterium SWAT-3] >gi|145962165|gb|EDK27449.1| cell division protein FtsY [Vibrionales bacterium SWAT-3] (411 aa)
Score = 540, Expect = 3.5e-53, Identities = 138/313 (44%), Positives = 200/313 (63%)
  Q:    36 QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD----LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           QA++ EV  +  + F   LK+S   LS+    I   F      KK+D++ +E +EE L+  DVG+  T KI + + E+ +  +++D +    L+KE + D      +   +    +D  K    ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W QR     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F E+  +TGI LTK+DGT+KGG++ SI D F IP++YIG+GE ++DL  F+ + F++ +
  S:    94 QAQVEEVQEKPTESFFARLKRS---LSRTKANIGAGFFGLFKGKKIDDDLFEELEEQLLIADVGMNTTVKIIENLTEKASRNDLKDGEALYGLLKEEMAD-----ILSQVEQPLVVDTTKT-PYVILMVGVNGVGKTTTIGKLAKQFQNEGKKVMLAAGDTFRAAAVEQLQVWGQRNDVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSEVAPVTGITLTKLDGTAKGGVIFSIADQFQIPIRYIGVGEGIDDLRPFESKDFIEAL 406
>gi|161831407|ref|YP_001597722.1| signal recognition particle-docking protein FtsY [Coxiella burnetii RSA 331] >gi|161763274|gb|ABX78916.1| signal recognition particle-docking protein FtsY [Coxiella burnetii RSA 331] (324 aa)
Score = 540, Expect = 3.6e-53, Identities = 121/303 (39%), Positives = 191/303 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           + +E LK++ S L+  ++ +V   K +D    E +E +L+S D+G+ AT  I + + +++  +++ DP  + + +  KI    I +      L+I      ++L +GVNGVGKTT+IAK+A+ +  + K+V+L AGDTFRA A+EQL  W QR     V+  + G D ASVI+  ++     +YDL+I DT+GRLH + +LM EL KI  V+ K +  APHE LL LDA  GQ+ I QA+ F E   +TGI +TK+DGT+KGG++ +I     +P+++IG+GEK+EDL  F+ ++F+  + KE
  S:    27 RLNESLKRTRSRLTDGLSNLVLGKKTIDASLLEELEMILLSADIGIEATQSILNNLSQQVARKSLSDPKALIDAL--KIELLNILEP-CQKHLEISAS-PFVILTVGVNGVGKTTTIAKLAHFYQSQKKRVMLAAGDTFRAAAIEQLQTWGQRNNAP-VIAQQPGADSASVIYDAMEAATARHYDLLIADTAGRLHTQSHLMDELAKIKRVMKKINPDAPHETLLALDAGTGQNAINQAEQFHEHIGLTGIAITKLDGTAKGGVIFAIAKKMQLPIRFIGMGEKIEDLKPFNAKEFIAALFKE 324
>gi|19704409|ref|NP_603971.1| Signal recognition particle receptor FtsY [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19714667|gb|AAL95270.1| Signal recognition particle receptor FtsY [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (333 aa)
Score = 540, Expect = 3.6e-53, Identities = 129/295 (43%), Positives = 194/295 (65%)
  Q:    54 LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           L KS       +  I     KVD+  YE +E+LL+  DVG+  T  + + + +E+    V++ + + EI+  ++ + ++   D+  +L  K ++ N++LI+GVNGVGKTT+I K+A  +    KKVLL AGDTFRA AVEQL  W++R   DI+   +EG DPASV++  + + +    D+VI DT+GRLHNK NLM+ELEKI+++I K      +E+LLV+D T GQ+G+ QAK F  +T++TG I+TK+DGT+KGGIV S+ +    P+K+IGLGEK+ DL  F+ + FV+ I
  S:    41 LTKSKEGFFSKLKNIFTSKSKVDDSIYEELEDLLLQSDVGLNMTTNLINQLEKEVKSNKVDNTEEVYEIL-KRLMSEFLLSQDSKIYL--KDNKINVILIVGVNGVGKTTTIGKLALKYKNLGKKVLLGAGDTFRAAAVEQLEEWAKRADVDII-KGREGADPASVVYDTLSRAEATKADIVIIDTAGRLHNKANLMRELEKINNIIKKKIGEQEYESLLVIDGTTGQNGLNQAKEFNSVTDLTGFIVTKLDGTAKGGIVFSVSEELKKPIKFIGLGEKIGDLIEFNAKDFVEAI 331
>gi|146291397|ref|YP_001181821.1| signal recognition particle-docking protein FtsY [Shewanella putrefaciens CN-32] >gi|145563087|gb|ABP74022.1| signal recognition particle-docking protein FtsY [Shewanella putrefaciens CN-32] (482 aa)
Score = 539, Expect = 3.8e-53, Identities = 122/308 (39%), Positives = 200/308 (64%)
  Q:    41 EVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ PE Q++            GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T ++ + + E  + + ++D + + +++ D++     Q T     + +  +  N   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D  APHE +L LDA+ GQ+ I QA+ F+E   +TG+ ++K+DGT+KGG+V +I D FNIP++YIG+GE+++DL  F+ ++F+D +
  S:   162 ELQPEPQERPVKEGLFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTTRLINKLTEHASRKQLKDAEALYDLLRDEL-----QKTLDPVAIPLVPNNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVV-AQHTGADSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQLFQEAVGVTGLTISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDAL 474
>gi|161505886|ref|YP_001572998.1| cell division protein FtsY [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] >gi|160867233|gb|ABX23856.1| hypothetical protein SARI_04065 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] (497 aa)
Score = 539, Expect = 4.2e-53, Identities = 128/315 (40%), Positives = 198/315 (62%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++  +  +  E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + ++D + +  ++ D++     +    +  L I+     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D+ APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   175 EEETPVEAIAQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIIANLTEGASRKQLKDAEALYGLLKDEMGEILAK---VDEPLTIEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNVDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDEEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 492
>gi|119475398|ref|ZP_01615751.1| signal recognition particle receptor FtsY [marine gamma proteobacterium HTCC2143] >gi|119451601|gb|EAW32834.1| signal recognition particle receptor FtsY [marine gamma proteobacterium HTCC2143] (398 aa)
Score = 539, Expect = 4.2e-53, Identities = 121/297 (40%), Positives = 186/297 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFV 345
           +  +GLK+++   S  +  +    K++DEE  E +E  L+  DVGV AT  I + + ++++ + + DP  +   +  ++        +     + KK    ++L++GVNGVGKTT+I K+   F  + K V+L AGDTFRA AVEQL +W +R     V+    G D ASVIF  V+  +    D++I DT+GRLHNK NLM+EL+K+  V+ K D TAPHE +LVLDA  GQ+ + QAKAF+E+  +TGI +TK+DGT+KGGI+ +I     +P+++IG+GE+++DL  F  + FV
  S:    98 RLKQGLKRTTDGFSSGMGTLFLGKKEIDEELLEELETQLLIADVGVEATRDIMETLAKQVSRRELADPQALYRGLQKELAELLEHSREPLQIDETKKPY--VILVVGVNGVGKTTTIGKLGKRFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIFDAVQAAQARKVDVLIADTAGRLHNKDNLMEELKKVVRVMGKLDSTAPHEVMLVLDAGTGQNALSQAKAFQEVVGVTGITVTKLDGTAKGGIIFAISKQLQLPIRFIGVGEQIDDLRPFAADDFV 391
>gi|58582766|ref|YP_201782.1| cell division protein [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427360|gb|AAW76397.1| cell division protein [Xanthomonas oryzae pv. oryzae KACC10331] (601 aa)
Score = 539, Expect = 4.2e-53, Identities = 116/320 (36%), Positives = 183/320 (57%)
  Q:    29 EEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD-LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  +I  Q + +   P  +  + E L+  +ST +++   +  +  K+D++  + IE  LI+ DVG+ AT  + + +R+ +  +   D   + K +  D I    +Q       +D +  +  ++L +GVNGVGKTT+I K+A  F  +   ++L AGDTFRA AV QL  W  R     V+   +  D ASV F  ++  K    D++I DT+GRLH +  LM EL KI  V+ K D  APHE L+V+D T GQ+ I Q + F     +TG+++TK+DGT+KGG+V ++   FNIP+++ G+GE+ EDL  FD   FVD +
  S:   280 DSDSIVGQHDAMPAAPAGKPGWRERLR--NSTFARSFGGLFSRNPKLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLI--ALLQPVSKPLVID-RARKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQLQAWGDRNGV-AVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKIRRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFALAREFNIPIRFAGIGERPEDLRVFDPVAFVDAL 594
>gi|84624642|ref|YP_452014.1| cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368582|dbj|BAE69740.1| cell division protein [Xanthomonas oryzae pv. oryzae MAFF 311018] (601 aa)
Score = 539, Expect = 4.2e-53, Identities = 116/320 (36%), Positives = 183/320 (57%)
  Q:    29 EEKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPD-LIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +  +I  Q + +   P  +  + E L+  +ST +++   +  +  K+D++  + IE  LI+ DVG+ AT  + + +R+ +  +   D   + K +  D I    +Q       +D +  +  ++L +GVNGVGKTT+I K+A  F  +   ++L AGDTFRA AV QL  W  R     V+   +  D ASV F  ++  K    D++I DT+GRLH +  LM EL KI  V+ K D  APHE L+V+D T GQ+ I Q + F     +TG+++TK+DGT+KGG+V ++   FNIP+++ G+GE+ EDL  FD   FVD +
  S:   280 DSDSIVGQHDAMPAAPAGKPGWRERLR--NSTFARSFGGLFSRNPKLDDDLLDEIETALITADVGIGATTALIEGLRKRMKSREFVDAQAMFKALRADLI--ALLQPVSKPLVID-RARKPFVVLTVGVNGVGKTTTIGKLAKRFKDEGNSLMLAAGDTFRAAAVAQLQAWGDRNGV-AVIAQGQNADAASVAFDALQAAKARGTDVLIADTAGRLHTQTGLMNELGKIRRVLGKIDAAAPHEVLMVIDGTTGQNAISQLRQFHAAVGVTGLVVTKLDGTAKGGVVFALAREFNIPIRFAGIGERPEDLRVFDPVAFVDAL 594
>gi|150398285|ref|YP_001328752.1| signal recognition particle-docking protein FtsY [Sinorhizobium medicae WSM419] >gi|150029800|gb|ABR61917.1| signal recognition particle-docking protein FtsY [Sinorhizobium medicae WSM419] (520 aa)
Score = 539, Expect = 4.3e-53, Identities = 116/296 (39%), Positives = 185/296 (62%)
  Q:    53 GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GL ++SS L+  I  +  K +K+DE   +++E+LLI  D+GV    +ITDA+  E   ++V   D +  I+  +I T  +        LD+   + +++L++GVNG GKTT+I K+A        KV++ AGDTFRA A+EQL IW++R + +IV   K G D A + +   ++ +++  D++I DT+GRL NK  LM ELEKI  V+ K D  APH  L  LDAT GQ+ + Q + F+ +  ++G+I+TK+DGT++GGI+++I     +PV +IG+GE ++DL  F+ + F + I
  S:   224 GLARTSSQLTGQIASLFTK-RKLDEATLQDLEDLLIQADLGVETAMRITDALASERYGKDVSGED-VSRIMAGEI-TKVLAPVAKPLELDLNH-KPHVILVVGVNGTGKTTTIGKLAAKLSGAGLKVMMAAGDTFRAAAIEQLKIWAERTRSEIV-SSKLGADAAGLAYEAFQRAREQKADVLIIDTAGRLQNKAELMAELEKIVRVLGKLDPDAPHTVLQTLDATTGQNALQQVEIFRNVAGVSGLIMTKLDGTARGGILVAISAKHKLPVYFIGVGEGVDDLEPFEAKDFAEAI 514
>gi|77462389|ref|YP_351893.1| Signal recognition particle-docking protein FtsY [Rhodobacter sphaeroides 2.4.1] >gi|77386807|gb|ABA77992.1| signal recognition particle-docking protein FtsY [Rhodobacter sphaeroides 2.4.1] (393 aa)
Score = 539, Expect = 4.3e-53, Identities = 112/270 (41%), Positives = 173/270 (64%)
  Q:    75 VDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKF 344
           +D+   E++EE+LI  D+GV    ++T  I E    + V   + IKE +  +I             + +   R  ++L++GVNG GKTT+I K+A+ F    K V++ AGDTFRA AVEQL +W +R     VL   EG DPAS+ F  + K + E  DL++ DT+GRL N+ +LM+EL KI  VI K D  APH  LLVLDAT GQ+ + Q + F+++ +++G+++TK+DGT+KGG+++++ D F +P+  IG+GE+++DL+ FD E+F
  S:   120 LDDAMLESLEEVLIQADMGVETALRVTANIAEGRYGRRVSARE-IKEALAAEIARIL---EPVARPMPLYPSRPQVVLVVGVNGSGKTTTIGKLASQFRAAGKSVVIAAGDTFRAAAVEQLQVWGRRAGVP-VLTAPEGSDPASLAFDAMTKAQAEGADLLMIDTAGRLQNRADLMEELSKIVRVIRKKDPDAPHNTLLVLDATTGQNALNQVEIFRKLADVSGLVMTKLDGTAKGGVLVALADRFGLPIHAIGVGEQIDDLAPFDPEEF 384
>gi|160877397|ref|YP_001556713.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS195] >gi|160862919|gb|ABX51453.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS195] (540 aa)
Score = 539, Expect = 4.6e-53, Identities = 124/310 (40%), Positives = 202/310 (65%)
  Q:    39 ILEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           ++E+ PE Q +            GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T ++   + E+ + + ++D + + +++ +++     Q T     + +  D  N   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR   DI V+    G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D   PHE +L LDA+ GQ+ I QA+ F+E   +TGI ++K+DGT+KGG+V +I D FNIP++YIG+GE+++DL  F+ ++F+D +
  S:   218 VVELQPEPQARPVKEGLFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQASRKQLKDAEALYDLLREEM-----QKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQR--NDITVIAQHTGADSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQEAVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDAL 532
>gi|156449450|ref|ZP_02055833.1| signal recognition particle-docking protein FtsY [Methylobacterium chloromethanicum CM4] >gi|156191987|gb|EDO24173.1| signal recognition particle-docking protein FtsY [Methylobacterium chloromethanicum CM4] (488 aa)
Score = 539, Expect = 4.6e-53, Identities = 116/307 (37%), Positives = 189/307 (61%)
  Q:    45 EKQ---KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAF---DLEKFVDGITKE 351
           EKQ    +   G++++SS LS  +T +  K +K+D    E++E+ LI  D GV    ++++A+ +   ++    PD ++ I+  +I    ++       +D  K +  ++L +GVNG GKTT+I K++  F  + + V+L AGDTFRA A+EQL +W  R     V+   +G D A + F   K+ ++   D+++ DT+GRL NK  LM ELEKI  VI K D  APH  LLVLDAT+GQ+ + Q + F +   ++G+++TK+DGT++GGI++++   F +PV +IG+GE +EDL  F   D  + + G+ KE
  S:   181 EKQGWWSRLTAGMRRTSSALSDRVTGLFTK-RKLDATTLEDLEDALIQADFGVETATRMSEAVGKG-RYEKGISPDEVRAILATEI-ERALEPVALPIEIDSAK-KPYVILTVGVNGAGKTTTIGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGDRTGTP-VISRAQGSDAAGLAFDAFKEARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHATLLVLDATVGQNALSQVELFSQAAPVSGLVMTKLDGTARGGILVALATKFGLPVHFIGVGEGVEDLEPFAARDFARAITGLPKE 488
>gi|153835089|ref|ZP_01987756.1| cell division protein FtsY [Vibrio harveyi HY01] >gi|148868439|gb|EDL67547.1| cell division protein FtsY [Vibrio harveyi HY01] (410 aa)
Score = 539, Expect = 4.6e-53, Identities = 129/313 (41%), Positives = 199/313 (63%)
  Q:    36 QAEILEVLPEKQKKFDEGLKKSSSTLSKAITEIVKKF------KKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           Q  +   + E++K  +    +   +LS+    I   F      KK+D++ +E +EE L+  DVG+  T KI + + E+ +  +++D + +  ++ +++     +       L+I   +T  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F+ ++F+D +
  S:    90 QVAVAPRVQEQEKPTESFFARLKRSLSRTKANIGAGFFGLFSGKKIDDDLFEELEEQLLIADVGMETTTKIINNLTEKASRGDLKDGEALYGLLKEEMAEILAK---VEQPLEIDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQNQGKKVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFEIPIRYIGVGEGIEDLRPFETQEFIDAL 405
>gi|160880574|ref|YP_001559542.1| signal recognition particle-docking protein FtsY [Clostridium phytofermentans ISDg] >gi|160429240|gb|ABX42803.1| signal recognition particle-docking protein FtsY [Clostridium phytofermentans ISDg] (310 aa)
Score = 538, Expect = 4.8e-53, Identities = 125/300 (41%), Positives = 188/300 (62%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+   +  +I  I      +D++FYE +EE LI  D+G+ AT  I + ++ ++    +++P   +++++  +        +   F    ++  +++L++GVNGVGKTTS+ K+A       KKV++ A DTFRA A+EQL  W+ R   DI+   KEG DPA+VI+  V   K  N D++ICDT+GRLHNK NLM+EL KI  VI +    A  E L+VLD T GQ+ + QAK F E+ +ITGI+LTK+DGT+KGGI ++I+    IPVKYIG+GE+++DL  FD + FV  +
  S:    10 RLASGLAKTRDNVISSIESIFTGSSNIDDDFYEELEETLIMADLGINATTAIIENLKNKVKENKIKEPSECRDLLMASMREQMSLQENAYEF----ENHKSVVLLIGVNGVGKTTSVGKLAGQLKDSGKKVMVAAADTFRAAAIEQLTEWANRAHVDII-AQKEGSDPAAVIYDAVTAAKSRNVDILICDTAGRLHNKKNLMEELRKIDRVIEREYPGAYRETLVVLDGTTGQNALAQAKQFNEVADITGIVLTKLDGTAKGGIAIAIQSELKIPVKYIGVGEQIDDLQKFDPDDFVKAL 304
>gi|118581717|ref|YP_902967.1| signal recognition particle-docking protein FtsY [Pelobacter propionicus DSM 2379] >gi|118504427|gb|ABL00910.1| signal recognition particle-docking protein FtsY [Pelobacter propionicus DSM 2379] (381 aa)
Score = 538, Expect = 4.9e-53, Identities = 134/345 (38%), Positives = 214/345 (62%)
  Q:     4 GFFKKIVNKLKGKKEGSLEDLSAKIEEKNIEKQAEILEVLPEKQ---------------------------------KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           GFF+ +++KL G    S  + +   +E+ +E      E +P ++                                 ++  +GL+K+   L   I  +V   K++D +  E +EE+LI+ DVGV  T ++   + + +    ++D   +K  + ++I    ++    +  LDI   R  +LL++GVNGVGKTT+I K+A+ F    K VLL A DTFRA A EQL +W +R   + V+  KEG DP++V+F   K     + D++I DT+GR+H K+NLM+E++KI  VI +    APHE LLV+DA  GQ+ + QA+ FKE   +TGI LTK+DGT+KGG+V+++   F +PV+YIG+GE ++DL  F  ++F D +
  S:     8 GFFRGLIDKLSGTAPPSAAETAEPAQERELE---SCRETVPHQEPQPCPEPAAPAALPVPPPPQPAPAEPPPKPGFFERLKQGLQKTKEGLVGRIDALVLGKKEIDADTLEELEEILITSDVGVKTTVELIRTLEQRLGRNELKDGQALKNALKEEIL---LRLNAHHGQLDIGSRRPFVLLVIGVNGVGKTTTIGKLASRFTGSGKTVLLAAADTFRAAAAEQLVVWGERSGVE-VIRHKEGADPSAVVFDACKAAVARDVDILIVDTAGRMHTKVNLMEEMKKIRRVIDREIPGAPHETLLVVDAATGQNAVSQARLFKEAAGVTGIALTKLDGTAKGGVVVAVSHEFALPVRYIGVGEAIDDLRDFSPQEFTDAL 378
>gi|170718906|ref|YP_001784077.1| signal recognition particle-docking protein FtsY [Haemophilus somnus 2336] >gi|168827035|gb|ACA32406.1| signal recognition particle-docking protein FtsY [Haemophilus somnus 2336] (447 aa)
Score = 538, Expect = 5.5e-53, Identities = 134/320 (41%), Positives = 206/320 (64%)
  Q:    29 EEKNIEKQAEILEVLPEKQKKFDE---------GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++       + EV+P++Q+K  E         GL K+   +      +    KK+D+E +E +EE L+  D+GV  T KI + + +  + + +++ DL+ + +  ++    ++  +    LD  K +  ++L++GVNGVGKTT+I K+AN F ++ K V+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  ++     N D++I DT+GRL NK NLM EL+KI  VI K D+TAPHE +L LD+  GQ+ I QAK F E   +TGI LTK+DGT+KGG++ +I D FN+P++YIG+GEK++DL  F  ++F+D +
  S:   118 EQREETTITSVKEVIPQEQEKPAENGFFSRLVKGLLKTKQNIGIGFRSLFLG-KKIDDELFEELEEQLLIADIGVPTTTKIINNLIQHASRKQLQEADLLYQQLKVEL-ADILKPVEQPLQLDNSK-KPYVILMVGVNGVGKTTTIGKLANQFQRQGKSVMLAAGDTFRAAAVEQLQVWGERNQIP-VIAQSTGSDSASVIFDAMQSAAARNIDVLIADTAGRLQNKNNLMDELKKIVRVIKKCDETAPHEIMLTLDSGTGQNAISQAKLFNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIDDLRPFQADEFIDAL 442
>gi|163852142|ref|YP_001640185.1| signal recognition particle-docking protein FtsY [Methylobacterium extorquens PA1] >gi|163663747|gb|ABY31114.1| signal recognition particle-docking protein FtsY [Methylobacterium extorquens PA1] (488 aa)
Score = 538, Expect = 5.5e-53, Identities = 116/307 (37%), Positives = 189/307 (61%)
  Q:    45 EKQ---KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAF---DLEKFVDGITKE 351
           EKQ    +   G++++SS LS  +T +  K +K+D    E++E+ LI  D GV    ++++A+ +   ++    PD ++ I+  +I    ++       +D  K +  ++L +GVNG GKTT+I K++  F  + + V+L AGDTFRA A+EQL +W  R     V+   +G D A + F   K+ ++   D+++ DT+GRL NK  LM ELEKI  VI K D  APH  LLVLDAT+GQ+ + Q + F +   ++G+++TK+DGT++GGI++++   F +PV +IG+GE +EDL  F   D  + + G+ KE
  S:   181 EKQGWWSRLTAGMRRTSSALSDRVTGLFTK-RKLDATTLEDLEDALIQADFGVETAARMSEAVGKG-RYEKGISPDEVRAILATEI-ERALEPVALPIEIDSAK-KPYVILTVGVNGAGKTTTIGKLSLKFKAEGRSVMLAAGDTFRAAAIEQLRVWGDRTGTP-VISRAQGSDAAGLAFDAFKEARENGTDVLLIDTAGRLQNKAGLMAELEKIVRVIRKLDPEAPHSTLLVLDATVGQNALSQVELFSQAAPVSGLVMTKLDGTARGGILVALATKFGLPVHFIGVGEGVEDLEPFAARDFARAITGLPKE 488
>gi|24376059|ref|NP_720102.1| cell division protein FtsY [Shewanella oneidensis MR-1] >gi|24351075|gb|AAN57546.1|AE015890_7 cell division protein FtsY [Shewanella oneidensis MR-1] (510 aa)
Score = 538, Expect = 5.5e-53, Identities = 128/327 (39%), Positives = 207/327 (63%)
  Q:    22 EDLSAKIEEKNIEKQAEILEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E L+A+  E    +  + LE  PE Q K            GL ++S  +      + +  KK+D+E +E +EE L+  DVGV  T ++  ++ E  + + ++D + + +++ D++     Q T     + +  +  N   ++L++GVNGVGKTT+I K+A  + ++ K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D  APHE +L LDA+ GQ+ I QA+ F+E   +TG+ ++K+DGT+KGG+V +I D F IP++YIG+GE+++DL  F+ ++F+D +
  S:   171 EQLAAEKAEAEQIQVEQPLEQQPEPQAKPAKESFFARLKRGLMRTSENIGSGFIGLFRG-KKIDDELFEELEEQLLIADVGVETTGRLIKSLTEHASRKQLKDAEALYDLLRDEM-----QKTLDPVAIPLVPENANGPFVILMVGVNGVGKTTTIGKLAKQYQRQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVV-AQHTGADSASVLFDALQAAKARKIDVLIADTAGRLQNKSHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQLFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEFIDAL 502
>gi|110800008|ref|YP_696402.1| signal recognition particle-docking protein FtsY [Clostridium perfringens ATCC 13124] >gi|168207934|ref|ZP_02633939.1| signal recognition particle-docking protein FtsY [Clostridium perfringens E str. JGS1987] >gi|168214192|ref|ZP_02639817.1| signal recognition particle-docking protein FtsY [Clostridium perfringens CPE str. F4969] >gi|182625848|ref|ZP_02953614.1| signal recognition particle-docking protein FtsY [Clostridium perfringens D str. JGS1721] >gi|110674655|gb|ABG83642.1| signal recognition particle-docking protein FtsY [Clostridium perfringens ATCC 13124] >gi|170660748|gb|EDT13431.1| signal recognition particle-docking protein FtsY [Clostridium perfringens E str. JGS1987] >gi|170714304|gb|EDT26486.1| signal recognition particle-docking protein FtsY [Clostridium perfringens CPE str. F4969] >gi|177908882|gb|EDT71374.1| signal recognition particle-docking protein FtsY [Clostridium perfringens D str. JGS1721] (304 aa)
Score = 538, Expect = 5.6e-53, Identities = 138/300 (46%), Positives = 192/300 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K   GL K+   L+  I E +     +D++ YE +EE LI  D+G+  T +I D ++ +I  + + D +++K  + + I    ++        D +K    ++LI+GVNGVGKTTSI KIA       KKVLL A DTFRA A++QL+IWSQR   DIV   +EG DPA+V+F  V+  K  + DL+ICDT+GRLHNK NLM EL KI+ +I +       E LLVLD T GQ+ ++QAK F E   I GIILTK+DGT+KGG+V+SIK+  NIPVKYIG+GE +EDL  F+ ++F + +
  S:     8 KLKTGLTKTRDNLTDKINEALNLAVTIDDDMYEELEEALIMSDIGMDTTVEIIDRLKAKIRKEKINDVEMVKPALKEVIAEMMLEGDSEEEEEDNEK---KVMLIIGVNGVGKTTSIGKIAARNKNNGKKVLLAAADTFRAAAIDQLDIWSQRANVDIV-KHQEGSDPAAVVFDAVQAAKARDVDLLICDTAGRLHNKKNLMDELAKINRIIDRELGDRKKETLLVLDGTTGQNAVIQAKQFMEACPIDGIILTKLDGTAKGGVVISIKNTLNIPVKYIGVGEGVEDLQKFNAKEFAEAL 303
>gi|194538815|ref|YP_002073884.1| signal recognition particle-docking protein FtsY, putative [Vibrio sp. Ex25] >gi|151937370|gb|EDN56232.1| signal recognition particle-docking protein FtsY, putative [Vibrio sp. Ex25] (407 aa)
Score = 538, Expect = 5.8e-53, Identities = 116/258 (44%), Positives = 172/258 (66%)
  Q:    91 DVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN-ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           DVG+  T KI + + E+ T  +++D + +  ++ +++       +     L+I  ++T  ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+    G D ASVI+  ++  K    D+VI DT+GRL NK NLM+EL KI  V+ K DD+APHE +L LDA  GQ+ I QAK F ++  +TGI LTK+DGT+KGG++ +I D F IP++YIG+GE +EDL  F+ ++F+D +
  S:   148 DVGMNTTTKIINNLTEKATRGDLKDGEALYGLLKEEMAEIL---SKVEQPLEIDSNKTPYVILMVGVNGVGKTTTIGKLAKQFQTQGKKVMLAAGDTFRAAAVEQLQVWGERNNVP-VIAQHTGADSASVIYDAIEAAKARGVDVVIADTAGRLQNKANLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPLTGITLTKLDGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFETQEFIDAL 402
>gi|42522713|ref|NP_968093.1| signal recognition particle-docking protein FtsY [Bdellovibrio bacteriovorus HD100] >gi|39573909|emb|CAE79086.1| signal recognition particle-docking protein FtsY [Bdellovibrio bacteriovorus HD100] (402 aa)
Score = 538, Expect = 6.1e-53, Identities = 122/307 (39%), Positives = 187/307 (60%)
  Q:    42 VLPEKQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTN------TFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEG-QDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           V+ EK       LKK+   L   I  + K   +   +  E IEE+L + D+G     ++  AI ++++ +   D D ++E + ++I   +     T+      + +    +   +L+I+GVNG GKTTSI KI+     + KKVL+ AGDTFRA A  QL +W+ R + +I  P  EG  DP++V F  V KGK + YD+VI DT+GRLH + NLM+E++K+  V+ K    APHE L+VLDA  GQ+ +MQAK F     +TG +LTKMDGT+KGG+ + +    +IP+K IG+GE+++DL  F  ++FV+ +
  S:    91 VIEEKAVDLAVALKKTEENLFGRIRNLFKS--ETSNKHLEEIEEILYTSDLGPATVQRLMGAIEDKLSKKERADYDTVREALKEEIKNIFQGSHSTSVGTGILSKIQFAAEGPTVLMIVGVNGAGKTTSIGKISAQLAAEGKKVLVAAGDTFRAAAGGQLKVWTDRAQVEIFSP--EGVTDPSAVAFDAVAKGKAQGYDVVIVDTAGRLHTQANLMEEIKKMKRVMSKVIPEAPHETLIVLDANSGQNALMQAKEFHNALTLTGAVLTKMDGTAKGGVAVGLAQELHIPIKLIGVGERIQDLRTFSSQEFVNSL 400
>gi|157349224|emb|CAO24370.1| unnamed protein product [Vitis vinifera] (367 aa)
Score = 537, Expect = 6.6e-53, Identities = 118/301 (39%), Positives = 185/301 (61%)
  Q:    48 KKFDEGLKKSSSTLSKAITEIVKKFKKVD-EEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +K   G  K+   L+  I E++  +   D +   + +EE L+  D G   T KI +++R++I    ++    IK+ +   +    +    + T L +   +  +++I+GVNG GKTTS+ K+A    K+  KVL+ AGDTFRA A +QL IW++R  C+IV+ + E    +SV+   VK+GK++ +D+V+CDTSGRLH   +LM+EL      + K    AP+E LLVLD T G + + QA+ F E+  I+G+ILTK+DG+++GG V+S+ D   IPVK++G+GE +EDL  FD E FV+ I
  S:    66 EKLFSGFSKTRDNLA-VIDELLLYWNLADTDRVLDELEEALLVSDFGPRITIKIVESLRDDILAGKLKSGSEIKDALKKSVLDL-LTKKGSKTALQLGFRKPAVVIIVGVNGGGKTTSLGKLAYKLKKEGAKVLMAAGDTFRAAASDQLEIWAERTGCEIVVAEGEKAKASSVLSQAVKRGKEQGFDIVLCDTSGRLHTNYSLMEELIACKKAVGKVVSGAPNEILLVLDGTTGLNMLPQAREFNEVVGISGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEVFVNAI 365
>gi|110802156|ref|YP_699002.1| signal recognition particle-docking protein FtsY [Clostridium perfringens SM101] >gi|110682657|gb|ABG86027.1| signal recognition particle-docking protein FtsY [Clostridium perfringens SM101] (304 aa)
Score = 537, Expect = 6.9e-53, Identities = 138/300 (46%), Positives = 192/300 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K   GL K+   L+  I E +     +D++ YE +EE LI  D+G+  T +I D ++ +I  + + D +++K  + + I    ++        D +K    ++LI+GVNGVGKTTSI KIA       KKVLL A DTFRA A++QL+IWSQR   DIV   +EG DPA+V+F  V+  K  + DL+ICDT+GRLHNK NLM EL KI+ +I +       E LLVLD T GQ+ ++QAK F E   I GIILTK+DGT+KGG+V+SIK+  NIPVKYIG+GE +EDL  F+ ++F + +
  S:     8 KLKTGLTKTRDNLTDKINEALNLAVTIDDDMYEELEEALIMSDIGMDTTIEIIDRLKAKIRKEKINDVEMVKPALKEVIAEMMLEGDSEEEEEDNEK---KVMLIIGVNGVGKTTSIGKIAARNKNNGKKVLLAAADTFRAAAIDQLDIWSQRANVDIV-KHQEGSDPAAVVFDAVQAAKARDVDLLICDTAGRLHNKKNLMDELAKINRIIDRELGDRKKETLLVLDGTTGQNAVIQAKQFMEACPIDGIILTKLDGTAKGGVVISIKNTLNIPVKYIGVGEGVEDLQKFNAKEFAEAL 303
>gi|18310697|ref|NP_562631.1| signal recognition particle-docking protein FtsY [Clostridium perfringens str. 13] >gi|18145378|dbj|BAB81421.1| signal recognition particle protein [Clostridium perfringens str. 13] (304 aa)
Score = 537, Expect = 6.9e-53, Identities = 138/300 (46%), Positives = 192/300 (64%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K   GL K+   L+  I E +     +D++ YE +EE LI  D+G+  T +I D ++ +I  + + D +++K  + + I    ++        D +K    ++LI+GVNGVGKTTSI KIA       KKVLL A DTFRA A++QL+IWSQR   DIV   +EG DPA+V+F  V+  K  + DL+ICDT+GRLHNK NLM EL KI+ +I +       E LLVLD T GQ+ ++QAK F E   I GIILTK+DGT+KGG+V+SIK+  NIPVKYIG+GE +EDL  F+ ++F + +
  S:     8 KLKTGLTKTRDNLTDKINEALNLAVTIDDDMYEELEEALIMSDIGMDTTIEIIDRLKAKIRKEKINDVEMVKPALKEVIAEMMLEGDYEEEEEDNEK---KVMLIIGVNGVGKTTSIGKIAARNKNNGKKVLLAAADTFRAAAIDQLDIWSQRANVDIV-KHQEGSDPAAVVFDAVQAAKARDVDLLICDTAGRLHNKKNLMDELAKINRIIDRELGDRKKETLLVLDGTTGQNAVIQAKQFMEACPIDGIILTKLDGTAKGGVVISIKNTLNIPVKYIGVGEGVEDLQKFNAKEFAEAL 303
>gi|113460560|ref|YP_718624.1| signal recognition particle-docking protein FtsY [Haemophilus somnus 129PT] >gi|112822603|gb|ABI24692.1| signal recognition particle-docking protein FtsY [Haemophilus somnus 129PT] (447 aa)
Score = 537, Expect = 7.4e-53, Identities = 134/320 (41%), Positives = 206/320 (64%)
  Q:    29 EEKNIEKQAEILEVLPEKQKKFDE---------GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++       + EV+P++Q+K  E         GL K+   +      +    KK+D+E +E +EE L+  D+GV  T KI + + +  + + +++ DL+ + +  ++    ++  +    LD  K +  ++L++GVNGVGKTT+I K+AN F ++ K V+L AGDTFRA AVEQL +W +R +   V+    G D ASVIF  ++     N D++I DT+GRL NK NLM EL+KI  VI K D+TAPHE +L LD+  GQ+ I QAK F E   +TGI LTK+DGT+KGG++ +I D FN+P++YIG+GEK++DL  F  ++F+D +
  S:   118 EQREETTITSVKEVIPQEQEKTAENGFFSRLVKGLLKTKQNIGIGFRSLFLG-KKIDDELFEELEEQLLIADIGVPTTTKIINNLIQHASRKQLQEADLLYQQLKVEL-ADILKPVEQPLQLDNSK-KPYVILMVGVNGVGKTTTIGKLANQFQRQGKSVMLAAGDTFRAAAVEQLQVWGERNQIP-VIAQSTGSDSASVIFDAMQSAVARNIDVLIADTAGRLQNKNNLMDELKKIVRVIKKCDETAPHEIMLTLDSGTGQNAISQAKLFNEAVGLTGISLTKLDGTAKGGVIFAIADQFNLPIRYIGVGEKIDDLRPFQADEFIDAL 442
>gi|114049331|ref|YP_739881.1| signal recognition particle-docking protein FtsY [Shewanella sp. MR-7] >gi|113890773|gb|ABI44824.1| signal recognition particle-docking protein FtsY [Shewanella sp. MR-7] (584 aa)
Score = 537, Expect = 7.5e-53, Identities = 124/319 (38%), Positives = 206/319 (64%)
  Q:    30 EKNIEKQAEILEVLPEKQKKF---DEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E+ +E+Q E  +  P K+  F     GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T+++  ++ E  + + ++D + + +++ D++     Q T     + +  +  N   ++L++GVNGVGKTT+I K+A  + ++ K V+L AGDTFRA AVEQL +W QR    +V     G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D  APHE +L LDA+ GQ+ I QA+ F+E   +TG+ ++K+DGT+KGG+V +I D F IP++YIG+GE+++DL  F+ ++F+D +
  S:   260 EQPLEQQPEP-QAKPVKESFFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTSRLIQSLTEHASRKQLKDAEALYDLLRDEM-----QKTLDPVAIPLVPENANGPYVILMVGVNGVGKTTTIGKLAKQYQRQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVV-AQHTGADSASVLFDALQAAKARKIDVLIADTAGRLQNKSHLMEELKKVVRVMKKLDPEAPHEVMLTLDASTGQNAISQAQLFQEAVGVTGMTISKLDGTAKGGVVFAIADKFKIPLRYIGVGEQIDDLRTFNSKEFIDAL 576
>gi|168210652|ref|ZP_02636277.1| signal recognition particle-docking protein FtsY [Clostridium perfringens B str. ATCC 3626] >gi|168217002|ref|ZP_02642627.1| signal recognition particle-docking protein FtsY [Clostridium perfringens NCTC 8239] >gi|170711266|gb|EDT23448.1| signal recognition particle-docking protein FtsY [Clostridium perfringens B str. ATCC 3626] >gi|182380866|gb|EDT78345.1| signal recognition particle-docking protein FtsY [Clostridium perfringens NCTC 8239] (304 aa)
Score = 536, Expect = 8.6e-53, Identities = 136/300 (45%), Positives = 189/300 (63%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           K   GL K+   L+  I E +     +D++ YE +EE LI  D+G+  T +I D ++ +I  + + D +++K  + + I    ++                ++LI+GVNGVGKTTSI KIA       KKVLL A DTFRA A++QL+IWSQR   DIV   +EG DPA+V+F  V+  K  + DL+ICDT+GRLHNK NLM EL KI+ +I +       E LLVLD T GQ+ ++QAK F E   I GIILTK+DGT+KGG+V+SIK+  NIPVKYIG+GE +EDL  F+ ++F + +
  S:     8 KLKTGLTKTRDNLTDKINEALNLAVTIDDDMYEELEEALIMSDIGMDTTVEIIDRLKAKIRKEKINDVEMVKPALKEVIAEMMLEGDSEEE---EDDKEKKVMLIIGVNGVGKTTSIGKIAARNKNNGKKVLLAAADTFRAAAIDQLDIWSQRANVDIV-KHQEGSDPAAVVFDAVQAAKARDVDLLICDTAGRLHNKKNLMDELAKINRIIDRELGDRKKETLLVLDGTTGQNAVIQAKQFMEACPIDGIILTKLDGTAKGGVVISIKNTLNIPVKYIGVGEGVEDLQKFNAKEFAEAL 303
>gi|153002662|ref|YP_001368343.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS185] >gi|151367280|gb|ABS10280.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS185] (611 aa)
Score = 536, Expect = 8.6e-53, Identities = 124/310 (40%), Positives = 201/310 (64%)
  Q:    39 ILEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + E+ PE Q +            GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T ++   + E+ + + ++D + + +++ +++     Q T     + +  D  N   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR   DI V+    G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D   PHE +L LDA+ GQ+ I QA+ F+E   +TGI ++K+DGT+KGG+V +I D FNIP++YIG+GE+++DL  F+ ++F+D +
  S:   289 VTELQPEPQARPVKEGLFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQASRKQLKDAEALYDLLREEM-----QKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQR--NDITVIAQHTGADSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQEAVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDAL 603
>gi|126172425|ref|YP_001048574.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS155] >gi|125995630|gb|ABN59705.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS155] (621 aa)
Score = 536, Expect = 8.7e-53, Identities = 124/310 (40%), Positives = 201/310 (64%)
  Q:    39 ILEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + E+ PE Q +            GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T ++   + E+ + + ++D + + +++ +++     Q T     + +  D  N   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR   DI V+    G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D   PHE +L LDA+ GQ+ I QA+ F+E   +TGI ++K+DGT+KGG+V +I D FNIP++YIG+GE+++DL  F+ ++F+D +
  S:   299 VTELQPEPQARPVKEGLFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQASRKQLKDAEALYDLLREEM-----QKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQR--NDITVIAQHTGADSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQEAVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDAL 613
>gi|149116686|ref|ZP_01843405.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS223] >gi|146863332|gb|EDK48874.1| signal recognition particle-docking protein FtsY [Shewanella baltica OS223] (615 aa)
Score = 536, Expect = 8.8e-53, Identities = 124/310 (40%), Positives = 201/310 (64%)
  Q:    39 ILEVLPEKQKK---------FDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTN---ILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDI-VLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           + E+ PE Q +            GL ++S  +      + +  KK+D++ +E +EE L+  DVGV  T ++   + E+ + + ++D + + +++ +++     Q T     + +  D  N   ++L++GVNGVGKTT+I K+A  +  + K V+L AGDTFRA AVEQL +W QR   DI V+    G D ASV+F  ++  K    D++I DT+GRL NK +LM+EL+K+  V+ K D   PHE +L LDA+ GQ+ I QA+ F+E   +TGI ++K+DGT+KGG+V +I D FNIP++YIG+GE+++DL  F+ ++F+D +
  S:   293 VTELQPEPQARPVKEGLFARLKRGLMRTSENIGSGFIGLFRG-KKIDDDLFEELEEQLLIADVGVETTTRLIKNLTEQASRKQLKDAEALYDLLREEM-----QKTLDPVAIPLVPDNANGPFVILMVGVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQR--NDITVIAQHTGADSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPDTPHEVMLTLDASTGQNAISQAQLFQEAVGVTGITISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQIDDLRTFNSKEFIDAL 607
>gi|85373608|ref|YP_457670.1| signal recognition particle GTPase [Erythrobacter litoralis HTCC2594] >gi|84786691|gb|ABC62873.1| signal recognition particle GTPase [Erythrobacter litoralis HTCC2594] (304 aa)
Score = 536, Expect = 9.3e-53, Identities = 117/296 (39%), Positives = 187/296 (63%)
  Q:    53 GLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII--VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFD---LEKFVDGI 348
           G KK+S  LS+ +T  V     +D+   E +E+ LI  D+G  A ++I + ++E+     + + +L K +   + +I     +  +   F      R  ++L++GVNG GKTT+IAK+A+  +++D +V+L AGDTFRA A+EQL  W+ R+   IV    +G DPAS++F GVK G D   D ++ DT+GRL NK  LM EL KI  V+ + +  APH+ +LVLDAT GQ+ + Q   FKE+  +TG+I+TK+DGT++GG++++  + + +P+  IG+GE ++DL  FD   + K + GI
  S:    10 GFKKTSDRLSENLTTAVST-ATLDDATLEEVEDALIMSDLGPAAASRIREKLKEKRFGLQISERELKKAVADEIAEILRPVAKPLEITAF-----PRPQVILVIGVNGSGKTTTIAKLAHWLVEEDYEVMLAAGDTFRAAAIEQLATWADRVGVPIV-KGPQGGDPASIVFDGVKAGTDRGTDALVVDTAGRLQNKRELMDELAKIRKVLGRLNPEAPHDVILVLDATNGQNALSQIDVFKEVAGVTGLIMTKLDGTARGGVLVAAAEQYGLPIHAIGVGETIDDLRPFDPDLVAKVIAGI 303
>gi|58337571|ref|YP_194156.1| cell division protein [Lactobacillus acidophilus NCFM] >gi|58254888|gb|AAV43125.1| cell division protein [Lactobacillus acidophilus NCFM] (431 aa)
Score = 536, Expect = 9.6e-53, Identities = 132/308 (42%), Positives = 197/308 (63%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQ--DTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKELV 353
           +++ +++GL+K++      +     KF+ VDE+F++++E+LLI  DVG     ++T+ +REE   QN +  D +K++IV+K+   Y +  +           D+ N+ L +GVNG GKTT+I K+A  F  + K V+L A DTFRAGAVEQL  W +R+   +V   KE  DPASV++   ++   E  D ++ DT+GRL NK NLM ELEKI   I K     P E LLVLD + GQ+ ++QAK F + T +TG++LTK+DG+SKGG+VL+I++  N+PVK +GLGEK EDL+ FD   +  G+   LV
  S:   123 QEELYEKGLEKTNKGFGARLNAFFAKFRTVDEDFFDDLEDLLIESDVGYETAEQLTEELREEAKLQNAKSRDELKQVIVEKLVDLYDKGGNNKDEKLEYNSDDKPNVYLFVGVNGAGKTTTIGKLAKRFKDEGKSVILAAADTFRAGAVEQLVEWGKRVDVPVV-TGKEKADPASVVYDATERAIKEKVDYLLVDTAGRLQNKKNLMAELEKIQRTIQKLLPDQPTETLLVLDGSTGQNALLQAKDFDKTTKLTGLVLTKLDGSSKGGVVLAIRNEMNLPVKLVGLGEKPEDLADFDAANYAIGLFHGLV 431
>gi|94309226|ref|YP_582436.1| signal recognition particle-docking protein FtsY [Ralstonia metallidurans CH34] >gi|93353078|gb|ABF07167.1| signal recognition particle-docking protein FtsY [Ralstonia metallidurans CH34] (340 aa)
Score = 536, Expect = 9.8e-53, Identities = 117/300 (39%), Positives = 179/300 (59%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL K+S  +      +     KVDE  +E +E  L+  D GV AT  +   +R  I    +E  + +K  + D + T  ++  +    +++ +++  +++I GVNG GKTTSI K+  HF    + VLL AGDTFRA A EQL IW +R    +V   +E  DPA+VIF  V   +    D+V+ DT+GRL  +++LM+EL+K+  VI K   TAPHE LLV+DA  GQ+ + Q +AF +   +TG+I+TK+DGT+KGGI+ +I     +PV +IG+GEK+EDL  F  ++F + +
  S:    49 RLRAGLSKTSRNIGVLFVGV-----KVDEALFEELETALLMADAGVEATEYLLGELRRRIKNDRIETAEGVKAALKD-LLTQLLKPLEKT--MELGREQPLVMMIAGVNGAGKTTSIGKLCKHFQSYHQSVLLAAGDTFRAAAREQLTIWGERNNVTVVA--QESGDPAAVIFDAVNAARARKIDIVMADTAGRLPTQLHLMEELKKVKRVIGKSMPTAPHEVLLVIDANTGQNALAQTRAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEKVEDLQPFKADEFAEAL 338
>gi|16131336|ref|NP_417921.1| fused Signal Recognition Particle (SRP) receptor: membrane binding protein/conserved protein [Escherichia coli str. K-12 substr. MG1655] >gi|89110548|ref|AP_004328.1| fused Signal Recognition Particle (SRP) receptor [Escherichia coli W3110] >gi|170082978|ref|YP_001732298.1| fused Signal recognition particle (SRP) receptor: membrane binding protein; protein [Escherichia coli str. K12 substr. DH10B] >gi|120576|sp|P10121|FTSY_ECOLI Cell division protein ftsY >gi|41498|emb|CAA27984.1| unnamed protein product [Escherichia coli] >gi|466600|gb|AAB18439.1| CG Site No. 18295 [Escherichia coli] >gi|1789874|gb|AAC76489.1| fused Signal Recognition Particle (SRP) receptor: membrane binding protein/conserved protein [Escherichia coli str. K-12 substr. MG1655] >gi|85676579|dbj|BAE77829.1| fused Signal Recognition Particle (SRP) receptor [Escherichia coli W3110] >gi|169890813|gb|ACB04520.1| fused Signal Recognition Particle (SRP) receptor: membrane binding protein; conserved protein [Escherichia coli str. K12 substr. DH10B] (497 aa)
Score = 535, Expect = 1.1e-52, Identities = 127/315 (40%), Positives = 198/315 (62%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++  + E+  E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + + D + +  ++ +++     +    +  L+++     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D  APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   175 EEEQPVEEIAQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAK---VDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 492
>gi|163782277|ref|ZP_02177275.1| cell division protein FtsY [Hydrogenivirga sp. 128-5-R1-1] >gi|159882310|gb|EDP75816.1| cell division protein FtsY [Hydrogenivirga sp. 128-5-R1-1] (460 aa)
Score = 535, Expect = 1.1e-52, Identities = 139/334 (41%), Positives = 217/334 (64%)
  Q:    15 GKKEGSLEDLSAKIE----------EKNIEKQAEILEVLPEKQKKFDEGLKKSSSTLSKAIT-EIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           G++E +LE L   ++          EK I +  + L ++ EK++   + LKK      +++   IV + +KVD+E +E +EELL+  DVGV     + + +R+    +N++  + +KEI  +K+    ++  +    L  +K +  ++L +GVNG GKTT+I K+A+ F K+ K+VLLVA DTFRA A+EQL +W+QR   DI     EG DPASV++ GV +   E +D+V+ DT+GRLH K  L++EL K+  VI K     P E LLVLDAT+GQ+ I QAK FKE  +I+GI++TK+DG++KGG V++I     IP+K IG+GE ++DL  F ++++VD +
  S:   117 GQREKALEVLERALKIAPPSKREELEKKIYELKKALGLVEEKKESLLDKLKKGLRKTKESVEFGIVFRGRKVDDELFEELEELLVKADVGVKTAVNLVEDLRKTAIRKNIKSSEELKEITKEKV-KELLRGCEGKLNLPTEK-KPVVVLFLGVNGSGKTTTIGKLAHRFTKEGKRVLLVAADTFRAAAIEQLEVWAQRSGADIT-KKHEGADPASVVYEGVDRAIREGHDVVLIDTAGRLHTKEPLIQELRKVKKVIQKLAPEEPSETLLVLDATIGQNSIQQAKVFKEAVDISGIVVTKLDGSAKGGAVIAICRELKIPIKLIGVGEGIDDLQPFSVDEYVDAL 458
>gi|78187767|ref|YP_375810.1| cell division transporter substrate-binding protein FtsY [Pelodictyon luteolum DSM 273] >gi|78167669|gb|ABB24767.1| signal recognition particle-docking protein FtsY [Pelodictyon luteolum DSM 273] (317 aa)
Score = 535, Expect = 1.2e-52, Identities = 129/307 (42%), Positives = 193/307 (62%)
  Q:    46 KQKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKD---RTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKEL 352
           K  +  EGL K+  TL + +  + K   ++D+EF E +E +L+  DVGV  T  I +AI      +     + +  +++D+I +  ++D+     ++       R +++LI+GVNG GKTTS+AK+A+++ +  KKV++ A DTFRA A EQL +W++R    ++    +G DPASV+F  V        D+V+ DT+GRLHNK +LM+EL KI  V  K    APHE LLVLD T GQ+ + QA+ F +  ++TGII+TK+DGT+KGGIVLSI     +PVKYIG+GEK++DL  FD  +FV  +   L
  S:     8 KLSRLTEGLGKTRETLREKLAVVTKGKTEIDDEFLEELENILVGADVGVEMTLDIVEAITLRAKRETYRSEEELNRMLLDEI-SGMLRDSSLEHPVEFDAPLAARPHVILIVGVNGAGKTTSVAKLASNYERAGKKVVIAAADTFRAAAYEQLQVWAERAGVPLI-GQGQGADPASVVFDAVSSAVARGTDVVLVDTAGRLHNKSHLMEELAKIMRVAKKKIPEAPHEVLLVLDGTTGQNAVQQAREFMKFVHVTGIIVTKLDGTAKGGIVLSISRELKLPVKYIGVGEKIDDLQLFDRRQFVAALLGRL 315
>gi|74314064|ref|YP_312483.1| cell division protein FtsY [Shigella sonnei Ss046] >gi|73857541|gb|AAZ90248.1| cell division membrane protein [Shigella sonnei Ss046] (498 aa)
Score = 535, Expect = 1.2e-52, Identities = 127/315 (40%), Positives = 198/315 (62%)
  Q:    34 EKQAEILEVLPEKQKKFDEG--------LKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           E++  + E+  E++K   EG        L K+   L      + +  KK+D++ +E +EE L+  DVGV  T KI   + E  + + + D + +  ++ +++     +    +  L+++     ++L++GVNGVGKTT+I K+A  F ++ K V+L AGDTFRA AVEQL +W QR     V+    G D ASVIF  ++  K  N D++I DT+GRL NK +LM+EL+KI  V+ K D  APHE +L +DA+ GQ+ + QAK F E   +TGI LTK+DGT+KGG++ S+ D F IP++YIG+GE++EDL  F  + F++ +
  S:   176 EEEQPVEEIAQEQEKPTKEGFFARLKRSLLKTKENLGSGFISLFRG-KKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAK---VDEPLNVEGKTPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIP-VIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEAL 493
>gi|154244370|ref|YP_001415328.1| signal recognition particle-docking protein FtsY [Xanthobacter autotrophicus Py2] >gi|154158455|gb|ABS65671.1| signal recognition particle-docking protein FtsY [Xanthobacter autotrophicus Py2] (529 aa)
Score = 535, Expect = 1.2e-52, Identities = 115/300 (38%), Positives = 183/300 (61%)
  Q:    49 KFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGI 348
           +   GL +++S+L + IT++V K +K+D +  E +E++LI  D+GV  + +I + + +      +  P+ +K +I   V++I     Q    +T       +  ++L++GVNG GKTT+I K+A  +  + KKV+L AGDTFRA A+EQL +W  R     V+  ++G D A V    V + +    D+++ DT+GRL N+  LM ELEK+  VI K + +APH  LLVLDAT+GQ+ + Q +AF  I  +TG+++TK+DGT++GGI+++I     +PV  IG+GE  EDL  F    F   I
  S:   231 RLASGLARTASSLGQGITDLVSK-RKLDADTLEELEDVLIRADLGVETSMRIVETVGKG-RHDKMISPEEVKRLIAEEVERILIPVAQPLVVDT-----AHKPFVVLMVGVNGSGKTTTIGKLAAQWRTEGKKVVLAAGDTFRAAAIEQLKVWGTRTGA-TVIAREQGSDAAGVAHEAVVEARAAGADILMVDTAGRLQNRTELMAELEKVVRVIKKLEPSAPHAVLLVLDATVGQNALSQVEAFTRIAGVTGMVMTKLDGTARGGILVAIAAKHKLPVHLIGVGEAAEDLQPFAARDFARAI 525
>gi|109900243|ref|YP_663498.1| signal recognition particle-docking protein FtsY [Pseudoalteromonas atlantica T6c] >gi|109702524|gb|ABG42444.1| signal recognition particle-docking protein FtsY [Pseudoalteromonas atlantica T6c] (485 aa)
Score = 535, Expect = 1.2e-52, Identities = 127/334 (38%), Positives = 204/334 (61%)
  Q:    18 EGSLEDLSAKIEEKNIEKQAEIL-------EVLPEKQ------KKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEIIVDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFDLEKFVDGITKE 351
           E S  DL   +E + +E Q E++       E  PEK        K  + L ++   L      + +  K +D++ +E +E  L+  DVG+  T+KI   + +      ++D + + +++  ++ +  +Q+  +       +D   ++L++GVNGVGKTT+I K+A  F  + KKV+L AGDTFRA AVEQL +W +R     V+  K G D ASVI+  ++  K  N D++I DT+GRL NK +LM+EL+K+  V+ K +  APHE +L LDA  GQ+ + Q K F +   +TGI LTK+DGT+KGG++ ++ D F IP++YIG+GE ++DL  F  ++FV+ +  E
  S:   133 EMSEADLQPVVEHE-LESQPELVPESKAKPEEEPEKPVKMGLFAKLRQSLSRTKENLGSGFISLFRG-KAIDDDLFEELETQLLVADVGIDTTSKIISRLTDSAKRNQLKDGEALYQLLKQQM-SNILQEV-SQPLEPKSEDGPFVILMVGVNGVGKTTTIGKMAKQFQSQGKKVMLAAGDTFRAAAVEQLQVWGERNNIP-VIAQKTGSDSASVIYDALESAKARNVDVLIADTAGRLQNKDHLMEELKKVVRVMRKINPNAPHEVMLTLDAATGQNAVSQTKLFNQAVGLTGITLTKLDGTAKGGVIFALADQFKIPIRYIGVGEGIDDLRPFASDEFVEALFAE 474
>gi|148555838|ref|YP_001263420.1| signal recognition particle-docking protein FtsY [Sphingomonas wittichii RW1] >gi|148501028|gb|ABQ69282.1| signal recognition particle-docking protein FtsY [Sphingomonas wittichii RW1] (311 aa)
Score = 535, Expect = 1.2e-52, Identities = 118/294 (40%), Positives = 185/294 (62%)
  Q:    47 QKKFDEGLKKSSSTLSKAITEIVKKFKKVDEEFYENIEELLISYDVGVLATNKITDAIREEITFQNVEDPDLIKEII---VDKIFTYYIQDTDTNTFLDIKKDRTNILLIMGVNGVGKTTSIAKIANHFIKKDKKVLLVAGDTFRAGAVEQLNIWSQRLKCDIVLPDKEGQDPASVIFTGVKKGKDENYDLVICDTSGRLHNKINLMKELEKIHSVIHKFDDTAPHENLLVLDATLGQSGIMQAKAFKEITNITGIILTKMDGTSKGGIVLSIKDNFNIPVKYIGLGEKLEDLSAFD 340
            +K   G +K+S  L + +T +  K   +DE   + IEE LI+ D+G     +I   ++ E+ F+   D   ++EI+   ++K+     +  +   F      R  ++L++GVNG GKTT+IAK+A+   ++D  V+LVAGDTFRA A+ QL +W+ R+   I+   KEG D A ++F GVK+G ++  D++I DT+GRL NK  LM EL KI  V+ + +  APH+ LLVLDAT GQ+ + Q + FKE   +TG+I+TK+DGT++GG++++  +   +PV  IGLGE ++DL  FD
  S:     7 HEKLFGGFRKTSDRLGENLTGLFGK-AALDEATLDEIEEALIASDLGPATAGRIRARLKGEM-FEKGLDERALREIVAQEIEKVLAPVAKPLEIEAF-----PRPQVILVIGVNGSGKTTTIAKLAHMLQEQDYAVMLVAGDTFRAAAIGQLKVWADRIGVPII-SGKEGGDAAGLVFEGVKQGTEKGIDVLIVDTAGRLQNKAGLMDELAKIRRVLGRLNTAAPHDVLLVLDATTGQNALSQIEIFKETAGVTGLIMTKLDGTARGGVLVAAAERTGMPVHAIGLGEGVDDLKPFD 295