>gi|26553501|ref|NP_757435.1| hypothetical protein MYPE490 [Mycoplasma penetrans HF-2] >gi|26453507|dbj|BAC43839.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (264 aa)
Score = 757, Expect = 1.3e-78, Identities = 264/264 (100%), Positives = 264/264 (100%)
  Q:     1 MNNNFFMLLLIIVIPIGIWWWWKKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVKTKK 264
           MNNNFFMLLLIIVIPIGIWWWWKKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVKTKK
  S:     1 MNNNFFMLLLIIVIPIGIWWWWKKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVKTKK 264
>gi|31544332|ref|NP_852910.1| hypothetical protein MGA_0843 [Mycoplasma gallisepticum R] >gi|31541176|gb|AAP56478.1| conserved hypothetical protein [Mycoplasma gallisepticum R] (227 aa)
Score = 200, Expect = 5.0e-14, Identities = 71/205 (34%), Positives = 121/205 (59%)
  Q:     1 MNNNFFMLLLIIVIPIGIWWW--WKKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQKFKKLNI 205
           MN++F  ++L+++IPIG+  +  +K++K+          K    +EVWKTIK +L+ N   G+EI+ S+VAKRP PN  DR L K  +++ K  + E+K  +++KK+ L       +KE  +E Y + F T+ ++      P  IE EV  +   + K++  E+KI I G +D++ E  WI P+K  E+ ++KK  A+ ++ +KL I
  S:     9 MNSSFLFIVLLVIIPIGLISYVIYKRKKSKEPGQFSGKTKEERRNEVWKTIKRYLQDNEMYGREIMYSFVAKRPSPN-DDRKLHKQFKEETKQYLLEHKLSKKDKKQYLDNR----KKEMARERYCIYFQTKDARTQATFDPAIIEAEVLTLPAKS-KRDVPERKIQINGLQDFQKEFSWIEPLKNKEDARLKK--AEDERLRKLEI 207
>gi|13358027|ref|NP_078301.1| hypothetical protein UU464 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762148|ref|YP_001752549.1| hypothetical protein UPA3_0483 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|11282623|pir||E82886 conserved hypothetical UU464 [imported] - Ureaplasma urealyticum >gi|6899458|gb|AAF30876.1|AE002143_1 conserved hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827725|gb|ACA32987.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] (241 aa)
Score = 171, Expect = 1.1e-10, Identities = 67/177 (37%), Positives = 105/177 (59%)
  Q:    23 KKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDP-NVVDRTLPKDLQ-KKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQK 199
           K+++NG +      + + + +EVW TIK +L+S ++KGKE+++SYV KR +P N+V  T  + +  K ++  IK  K    E+ K   +  K  ++ KPKELYVVLF TR +K    D+PRAIECEV+ V++    K +  ++I ++   DYE E  WI PIK  ++    K     +K
  S:    45 KRKQNGENQTSVNNKDKSDTNEVWTTIKKYLRSIDDKGKEVIDSYVVKRAEPHNLVQMTKQQRIDYKNEQKAIKALKTTNPEQYKIEMERIKKEKRAKPKELYVVLFTTRNAKTLIIDEPRAIECEVRLVKI---NKKENRREIDVVRALDYEEEMLWIEPIKAKDDEIYNKRLEADKK 220
>gi|12045225|ref|NP_073036.1| hypothetical protein MG_364 [Mycoplasma genitalium G37] >gi|1723155|sp|P47604|Y364_MYCGE Uncharacterized protein MG364 >gi|3844951|gb|AAC71591.1| expressed protein of unknown function [Mycoplasma genitalium G37] >gi|166078668|gb|ABY79286.1| expressed protein of unknown function [synthetic Mycoplasma genitalium JCVI-1.0] (224 aa)
Score = 170, Expect = 1.5e-10, Identities = 60/158 (37%), Positives = 87/158 (55%)
  Q:    25 RKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPI 182
           +KN  S  GG    R+  DEVWKTIK FL+  NE+GKEI++++VAK+P+P        K  +K    EI+         K E K+      +   +ELY + FVT+ +K+   D  R IE EV   + P   K+  E+ I ILG +++ETE +WI P+
  S:    33 QKNDFSGEGGNRSSRK--DEVWKTIKQFLQEKNERGKEIIKTFVAKKPNP-----LHSKKDRKLFNQEIQAYITSNNLGKSEAKRYKNEQTRLMQRELYCIYFVTKDAKSTEVDDARIIEAEV--YQKPTKTKSTPERLIRILGLKNFETEMQWIQPL 181
>gi|171920914|ref|ZP_02932065.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178922|ref|ZP_02964686.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024079|ref|ZP_02996821.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039608|ref|ZP_02998320.1| hypothetical protein Uures_03094 [Ureaplasma urealyticum serovar 8] >gi|188518291|ref|ZP_03003814.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524345|ref|ZP_03004377.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530997|ref|ZP_03005258.1| hypothetical protein Uurese_01000006_0200002747 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188592780|ref|ZP_03006053.1| hypothetical protein Uureaserovar_02860 [Ureaplasma urealyticum serovar 10] >gi|195867803|ref|ZP_03079803.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903135|gb|EDT49424.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209184|gb|EDU06227.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019122|gb|EDU57162.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998136|gb|EDU67233.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659953|gb|EDX53333.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660500|gb|EDX53757.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (241 aa)
Score = 163, Expect = 1.0e-09, Identities = 64/177 (36%), Positives = 103/177 (58%)
  Q:    23 KKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDL--QKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQK 199
           K+++NG +      + + + +EVW TIK +L+S ++KGKE+++SYV KR +P+ + +   +     K ++  IK  K    E+ K   +  K  ++ KPKELYVVLF TR +K    D+PRAIECEV+ V+V    K +  ++I ++   DY+ E  WI PIK  ++    K     +K
  S:    45 KRKQNGENQANVNNKDKSDTNEVWATIKKYLRSIDDKGKEVIDSYVVKRAEPHNLAQMTKQQKIDYKNEQKAIKALKTTNPEQYKIEMERIKKEKRAKPKELYVVLFTTRNAKTLVVDEPRAIECEVRLVKV---NKKENRREIDVVRALDYDEEMLWIEPIKAKDDEIYNKRLEADKK 220
>gi|188569140|ref|ZP_03005669.1| hypothetical protein Uurealyserovar_02971 [Ureaplasma urealyticum serovar 2] (241 aa)
Score = 161, Expect = 1.5e-09, Identities = 64/177 (36%), Positives = 103/177 (58%)
  Q:    23 KKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDL--QKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQK 199
           K+++NG +      + + + +EVW TIK +L+S ++KGKE+++SYV KR +P+ + +   +     K ++  IK  K    E+ K   +  K  ++ KPKELYVVLF TR +K    D+PRAIECEV+ V+V    K +  ++I ++   DY+ E  WI PIK  ++    K     +K
  S:    45 KRKQNGENQANVNNKDKSDTNEVWATIKKYLRSIDDKGKEVIDSYVVKRAEPHNLAQMTKQQKIDYKNEQKAIKALKTTNPEQYKIEMERIKKEKRAKPKELYVVLFTTRNAKTLVVDEPRAIECEVRLVKV---NKKENRREIDVVRALDYDEEMLWIEPIKAKDDEIYNKRLEADKK 220
>gi|13508281|ref|NP_110231.1| hypothetical protein MPN542 [Mycoplasma pneumoniae M129] >gi|2496406|sp|P75236|Y542_MYCPN Uncharacterized protein MG364 homolog >gi|1673971|gb|AAB95948.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (218 aa)
Score = 138, Expect = 8.7e-07, Identities = 52/160 (32%), Positives = 80/160 (50%)
  Q:    23 KKRKNGPSNNGGAIQKRREGDEVWKTIKDFLKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPI 182
           KK        G    +  + DEVWKT+K FL+  NE+GKEI++++VAK P+P        +  ++    E++         K   K+      K K +ELY + F+T+ +K +  D+ R IE EV       G K   E+ I ILG +++  E KWI P+
  S:    30 KKNSQKTEFGGEGGSRASKKDEVWKTVKQFLQEQNERGKEIIKTFVAKNPNP-----LHSRKDRQFFNQEVQAYITAHNLSKTAAKRYRHEQLKLKQRELYCIYFITKDAKTSVFDEARIIEAEVYQKPNKTG-KGAPERLIRILGLKNFNDEMKWIQPL 183
>gi|66880090|ref|ZP_00405076.1| hypothetical protein MgenG_01000554 [Mycoplasma genitalium G-37] (119 aa)
Score = 108, Expect = 2.2e-03, Identities = 42/126 (33%), Positives = 67/126 (53%)
  Q:    53 LKSNNEKGKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKW 178
           ++  NE+GKEI++++VAK+P+P        K  +K    EI+         K E K+      +   +ELY + FVT+ +K+   D  R IE EV   + P   K+  E+ I ILG +++ETE +W
  S:     1 MQEKNERGKEIIKTFVAKKPNP-----LHSKKDRKLFNQEIQAYITSNNLGKSEAKRYKNEQTRLMQRELYCIYFVTKDAKSTEVDDARIIEAEV--YQKPTKTKSTPERLIRILGLKNFETEMQW 119
>gi|3980153|emb|CAA43732.1| unnamed protein product [Mycoplasma genitalium] (85 aa)
Score = 93, Expect = 1.3e-01, Identities = 30/72 (41%), Positives = 44/72 (61%)
  Q:   108 KKEGKTYQKEKPK----ELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWI 179
           K E K Y+ E+ +    ELY + FVT+ +K+   D  R IE EV   + P   K+  E+ I ILG +++ETE +WI
  S:    12 KSEAKRYKNEQTRLMQRELYCIYFVTKDAKSTEVDDARIIEAEV--YQKPTKTKSTPERLIRILGLKNFETEMQWI 85
>gi|118379597|ref|XP_001022964.1| TPR Domain containing protein [Tetrahymena thermophila SB210] >gi|89304731|gb|EAS02719.1| TPR Domain containing protein [Tetrahymena thermophila SB210] (2086 aa)
Score = 91, Expect = 2.1e-01, Identities = 60/229 (26%), Positives = 120/229 (52%)
  Q:    36 IQKRREGDEVWKTIKDFLKSNNEK--GKEIVESYVAKRPDPNVVDRTLPKDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVKTKK 264
           ++K+ E  +  K I+D  K  +E+   K+I    + K+ D     R    DL+KKQ+++ ++NK+LE+ K K  + E K  Q E+ +         +     +EDK R  E E K  +    ++ + +KK+    ER  + E++     + AEE + ++E   +++ ++    K  ++ + K   ++ E+L++   K + +E+KKL + QEK+K+ + +  KK++  + KK
  S:   714 LKKQAEDLKSQKEIEDQKKKLDEELLRKKIETEELRKKQDELQKYRQELDDLKKKQEIQDQKNKELEELKIKYQEAEEKRKQLEEQQLKKQQELDEKKKLQESEDKKRQQEIEEKRKQ----QEAEDKKKLQEAEERKKQQEAEEKRKQQEAEEKRKQQEAEDKKRQQEAEEKKKQQEAEEKKKIQEAEELKL---KQQAEENKKLQEAQEKQKQHEAEERKKQLEAEEKK 937
>gi|109080840|ref|XP_001107961.1| PREDICTED: microtubule-associated protein 1A isoform 1 [Macaca mulatta] (3012 aa)
Score = 89, Expect = 3.4e-01, Identities = 51/178 (28%), Positives = 89/178 (50%)
  Q:    82 PKDLQKKQKLEIKENK-KLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESK-WILPIK-TAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLE-KDPEKLEIYNQKLKEKEDK--------KLLKQQEKEKREKVKWEKKEIV 259
           PKD   +QK  + E K K+ +E  K L ++ +  + + P++              TE K R +E   +  + P  K    E+K  I  ++D   E K W L  K  A E  IK    K Q  ++ ++++  K +K K LE K PEK++   +KL+   +K         L+++ +  K+E+  W  +++V
  S:  1682 PKDKDLEQKDRVLEKKDKIPEEIDKALDQKVRRVEHKAPEDTV------------TEMKGRDLE---QTDKAPEQKHQAQEQKDKISEKKDQALEQKYWALGQKDEALEQNIKALEEKDQTQEQESLLQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKALGLEESLVQEGKARKQEEKYWRGQDVV 1856
>gi|119613012|gb|EAW92606.1| microtubule-associated protein 1A, isoform CRA_a [Homo sapiens] (3027 aa)
Score = 89, Expect = 3.6e-01, Identities = 41/179 (22%), Positives = 92/179 (51%)
  Q:    83 KDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKE---YAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVK 261
           KDL++K ++ +++ +K+ +EK K L ++ ++ + + P++  V     R  +   +   +  + + +  +V   K    E+K   LG++D   E      I+  EEN   +E     ++ K +K  +++    +K+K +E   EKLE   +K K    ++ L Q+ + + ++ K+ + + VV+
  S:  1700 KDLEQKDRV-LEQKEKIPEEKDKALDQKVRSVEHKAPEDT-VAEMKDRDLEQTDKAPEQKHQAQEQKDKVSEKKDQALEQKYWALGQKDEALEQN----IQALEENHQTQEQESLVQEDKTRKPKMLEEKSPEKVKAME---EKLEALLEKTKALGLEESLVQEGRAREQEEKYWRGQDVVQ 1872
>gi|109080838|ref|XP_001108014.1| PREDICTED: microtubule-associated protein 1A isoform 2 [Macaca mulatta] (3042 aa)
Score = 89, Expect = 3.7e-01, Identities = 51/178 (28%), Positives = 89/178 (50%)
  Q:    82 PKDLQKKQKLEIKENK-KLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESK-WILPIK-TAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLE-KDPEKLEIYNQKLKEKEDK--------KLLKQQEKEKREKVKWEKKEIV 259
           PKD   +QK  + E K K+ +E  K L ++ +  + + P++              TE K R +E   +  + P  K    E+K  I  ++D   E K W L  K  A E  IK    K Q  ++ ++++  K +K K LE K PEK++   +KL+   +K         L+++ +  K+E+  W  +++V
  S:  1712 PKDKDLEQKDRVLEKKDKIPEEIDKALDQKVRRVEHKAPEDTV------------TEMKGRDLE---QTDKAPEQKHQAQEQKDKISEKKDQALEQKYWALGQKDEALEQNIKALEEKDQTQEQESLLQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKALGLEESLVQEGKARKQEEKYWRGQDVV 1886
>gi|119613013|gb|EAW92607.1| microtubule-associated protein 1A, isoform CRA_b [Homo sapiens] (2984 aa)
Score = 89, Expect = 4.1e-01, Identities = 41/179 (22%), Positives = 92/179 (51%)
  Q:    83 KDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKE---YAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVK 261
           KDL++K ++ +++ +K+ +EK K L ++ ++ + + P++  V     R  +   +   +  + + +  +V   K    E+K   LG++D   E      I+  EEN   +E     ++ K +K  +++    +K+K +E   EKLE   +K K    ++ L Q+ + + ++ K+ + + VV+
  S:  1700 KDLEQKDRV-LEQKEKIPEEKDKALDQKVRSVEHKAPEDT-VAEMKDRDLEQTDKAPEQKHQAQEQKDKVSEKKDQALEQKYWALGQKDEALEQN----IQALEENHQTQEQESLVQEDKTRKPKMLEEKSPEKVKAME---EKLEALLEKTKALGLEESLVQEGRAREQEEKYWRGQDVVQ 1872
>gi|163781042|gb|ABY40809.1| microtubule-associated protein 1A (predicted) [Papio anubis] (2818 aa)
Score = 87, Expect = 7.0e-01, Identities = 51/177 (28%), Positives = 93/177 (52%)
  Q:    83 KDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNN-TEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESK-WILPIK-TAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLE-KDPEKLEIYNQKLKEKEDK--------KLLKQQEKEKREKVKWEKKEIV 259
           KDL++K ++  K++K LE + K   +K+    + +K  +  V     +  ++  TE K R +E   +  + P  K    E+K  I  ++D   E K W L  K  A E  IK    K Q  ++ ++++  K +K K LE K PEK++   +KL+   +K         L+++ +  K+E+  W  +++V
  S:  1477 KDLEQKDRVLEKKDKALEPKDKDLEQKDRIPEEIDKALDQKVRGVEHKAPEDTVTEMKGRDLE---QTDKAPEQKHQAQEQKDKISEKKDQALEQKYWALGQKDEALEQNIKALEEKDQTQEQESLLQQDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKALGLEESLVQEGKARKQEEKYWRGQDVV 1662
>gi|95147555|ref|NP_002364.5| microtubule-associated protein 1A [Homo sapiens] >gi|119613014|gb|EAW92608.1| microtubule-associated protein 1A, isoform CRA_c [Homo sapiens] (2803 aa)
Score = 87, Expect = 7.3e-01, Identities = 41/179 (22%), Positives = 92/179 (51%)
  Q:    83 KDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKE---YAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVK 261
           KDL++K ++ +++ +K+ +EK K L ++ ++ + + P++  V     R  +   +   +  + + +  +V   K    E+K   LG++D   E      I+  EEN   +E     ++ K +K  +++    +K+K +E   EKLE   +K K    ++ L Q+ + + ++ K+ + + VV+
  S:  1476 KDLEQKDRV-LEQKEKIPEEKDKALDQKVRSVEHKAPEDT-VAEMKDRDLEQTDKAPEQKHQAQEQKDKVSEKKDQALEQKYWALGQKDEALEQN----IQALEENHQTQEQESLVQEDKTRKPKMLEEKSPEKVKAME---EKLEALLEKTKALGLEESLVQEGRAREQEEKYWRGQDVVQ 1648
>gi|172046662|sp|P78559|MAP1A_HUMAN Microtubule-associated protein 1A (MAP 1A) (Proliferation-related protein p80) [Contains: MAP1 light chain LC2] (2805 aa)
Score = 87, Expect = 7.5e-01, Identities = 41/179 (22%), Positives = 92/179 (51%)
  Q:    83 KDLQKKQKLEIKENKKLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESKWILPIKTAEENKIKKE---YAKQQKFKKLNIIKTVKDKKIKNLEKDPEKLEIYNQKLKEKEDKKLLKQQEKEKREKVKWEKKEIVVK 261
           KDL++K ++ +++ +K+ +EK K L ++ ++ + + P++  V     R  +   +   +  + + +  +V   K    E+K   LG++D   E      I+  EEN   +E     ++ K +K  +++    +K+K +E   EKLE   +K K    ++ L Q+ + + ++ K+ + + VV+
  S:  1476 KDLEQKDRV-LEQKEKIPEEKDKALDQKVRSVEHKAPEDT-VAEMKDRDLEQTDKAPEQKHQAQEQKDKVSEKKDQALEQKYWALGQKDEALEQN----IQALEENHQTQEQESLVQEDKTRKPKMLEEKSPEKVKAME---EKLEALLEKTKALGLEESLVQEGRAREQEEKYWRGQDVVQ 1648
>gi|109080844|ref|XP_001108069.1| PREDICTED: microtubule-associated protein 1A isoform 3 [Macaca mulatta] (2774 aa)
Score = 86, Expect = 8.0e-01, Identities = 51/178 (28%), Positives = 89/178 (50%)
  Q:    82 PKDLQKKQKLEIKENK-KLEQEKKKELKKEGKTYQKEKPKELYVVLFVTRTSKNNTEDKPRAIECEVKNVRVPNGKKNQTEKKIVILGERDYETESK-WILPIK-TAEENKIKKEYAKQQKFKKLNIIKTVKDKKIKNLE-KDPEKLEIYNQKLKEKEDK--------KLLKQQEKEKREKVKWEKKEIV 259
           PKD   +QK  + E K K+ +E  K L ++ +  + + P++              TE K R +E   +  + P  K    E+K  I  ++D   E K W L  K  A E  IK    K Q  ++ ++++  K +K K LE K PEK++   +KL+   +K         L+++ +  K+E+  W  +++V
  S:  1444 PKDKDLEQKDRVLEKKDKIPEEIDKALDQKVRRVEHKAPEDTV------------TEMKGRDLE---QTDKAPEQKHQAQEQKDKISEKKDQALEQKYWALGQKDEALEQNIKALEEKDQTQEQESLLQEDKTRKPKMLEEKSPEKVKAMEEKLEALLEKTKALGLEESLVQEGKARKQEEKYWRGQDVV 1618