>gi|26553457|ref|NP_757391.1| transposase [Mycoplasma penetrans HF-2] >gi|26453463|dbj|BAC43795.1| transposase [Mycoplasma penetrans HF-2] (201 aa)
Score = 864, Expect = 2.7e-91, Identities = 200/201 (99%), Positives = 201/201 (100%)
  Q:     1 LDKLHLGNIKILLTGVFIMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSLLMELDLKLEMTLNF 201
           +DKLHLGNIKILLTGVFIMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSLLMELDLKLEMTLNF
  S:     1 MDKLHLGNIKILLTGVFIMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSLLMELDLKLEMTLNF 201
>gi|26554410|ref|NP_758344.1| transposase [Mycoplasma penetrans HF-2] >gi|26454420|dbj|BAC44748.1| transposase [Mycoplasma penetrans HF-2] (402 aa)
Score = 792, Expect = 6.6e-83, Identities = 162/167 (97%), Positives = 164/167 (98%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           MAKKEKSS EKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG GVDKDLVSRVTDKILPEILTWQSRPLEDIY ++
  S:     1 MAKKEKSSTEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGVGVDKDLVSRVTDKILPEILTWQSRPLEDIYPII 167
>gi|57234003|ref|YP_182013.1| ISDet4, transposase [Dehalococcoides ethenogenes 195] >gi|57224451|gb|AAW39508.1| ISDet4, transposase [Dehalococcoides ethenogenes 195] (413 aa)
Score = 364, Expect = 3.2e-33, Identities = 69/167 (41%), Positives = 114/167 (68%)
  Q:    19 MAKKEKSS-------AEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           MAK+E++S        E  +E   ++N +D    LK+L  S +E  +  E+D  LGY KWD  +++ ++N R G T KTL ++YG++ +++PRD    +EP++V K+QR ++ +++ II +Y+KGMSTR+I +    +YG  +  DL+ R+TDKILPEI  WQ+RPL+ +Y ++
  S:     1 MAKRERTSDRLPEGWLEGFIEAYDIKNADDIKEALKDLIGSTLECMMQAELDEELGYAKWDSQNKK-TDNSRNGTTPKTLRSEYGEIKIDVPRDRQGEYEPRIVPKYQREIDGLDNQIISMYAKGMSTRDIAEHVKSLYGVELSADLICRITDKILPEIREWQNRPLKPLYAMM 173
>gi|125975153|ref|YP_001039063.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715378|gb|ABN53870.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 357, Expect = 1.7e-32, Identities = 69/165 (41%), Positives = 114/165 (69%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           I+  ++K     L+ +  + + +D    LK+L    I+  L+ E+D HLGYEK+ +++ E  +NYR G T KTL +  G+++++IPRD N+ FEP++V K++R++++IE+ II +Y++GMSTREI +   ++YG  V  ++VS++TDKILPEI  WQ RPL ++Y
  S:     6 IITPEKKELIRNLISEYNITSAKDLQEALKDLLGDTIQNMLEAELDEHLGYEKY-ESTEEAKSNYRNGYTSKTLKSSVGQVEIDIPRDRNAEFEPKIVPKYKRDISEIENKIIAMYARGMSTREINEQIQEIYGFEVSAEMVSKITDKILPEIEEWQKRPLGEVY 169
>gi|125972672|ref|YP_001036582.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125972877|ref|YP_001036787.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125972892|ref|YP_001036802.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125973708|ref|YP_001037618.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125974378|ref|YP_001038288.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125975530|ref|YP_001039440.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|196252067|ref|ZP_03150730.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196253348|ref|ZP_03151979.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196253372|ref|ZP_03152002.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196253836|ref|ZP_03152442.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196254127|ref|ZP_03152710.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|125712897|gb|ABN51389.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713102|gb|ABN51594.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713117|gb|ABN51609.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125713933|gb|ABN52425.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125714603|gb|ABN53095.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715755|gb|ABN54247.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|196196455|gb|EDX91369.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196196752|gb|EDX91643.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196197204|gb|EDX92071.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196197224|gb|EDX92090.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196198490|gb|EDX93324.1| transposase mutator type [Clostridium thermocellum DSM 4150] (407 aa)
Score = 355, Expect = 3.0e-32, Identities = 68/165 (41%), Positives = 114/165 (69%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           I+  ++K     L+ +  + + +D    LK+L    I+  L+ E+D HLGYEK+ +++ E  +NYR G T KTL +  G+++++IPRD N+ FEP++V +++R++++IE+ II +Y++GMSTREI +   ++YG  V  ++VS++TDKILPEI  WQ RPL ++Y
  S:     6 IITPEKKELIRNLISEYNITSAKDLQEALKDLLGDTIQNMLEAELDEHLGYEKY-ESTEEAKSNYRNGYTSKTLKSSVGQVEIDIPRDRNAEFEPKIVPRYKRDISEIENKIIAMYARGMSTREINEQIQEIYGFEVSAEMVSKITDKILPEIEEWQKRPLGEVY 169
>gi|125974403|ref|YP_001038313.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125714628|gb|ABN53120.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 355, Expect = 3.1e-32, Identities = 68/165 (41%), Positives = 114/165 (69%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           I+  ++K     L+ +  + + +D    LK+L    I+  L+ E+D HLGYEK+ +++ E  +NYR G T KTL +  G+++++IPRD N+ FEP++V +++R++++IE+ II +Y++GMSTREI +   ++YG  V  ++VS++TDKILPEI  WQ RPL ++Y
  S:     6 IITPEKKELIRNLISEYNITSAKDLQEALKDLLGDTIQNMLEAELDEHLGYEKY-ESTEEAKSNYRNGYTSKTLKSSVGQVEIDIPRDRNAEFEPKIVPRYKRDISEIENKIIAMYARGMSTREINEQIQEIYGFEVSAEMVSKITDKILPEIEEWQKRPLGEVY 169
>gi|125975694|ref|YP_001039604.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] >gi|125715919|gb|ABN54411.1| transposase, mutator type [Clostridium thermocellum ATCC 27405] (407 aa)
Score = 355, Expect = 3.2e-32, Identities = 68/165 (41%), Positives = 114/165 (69%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           I+  ++K     L+ +  + + +D    LK+L    I+  L+ E+D HLGYEK+ +++ E  +NYR G T KTL +  G+++++IPRD N+ FEP++V +++R++++IE+ II +Y++GMSTREI +   ++YG  V  ++VS++TDKILPEI  WQ RPL ++Y
  S:     6 IITPEKKELIRNLISEYNITSAKDLQEALKDLLGDTIQNMLEAELDEHLGYEKY-ESTEEAKSNYRNGYTSKTLKSSVGQVEIDIPRDRNAEFEPKIVPRYKRDISEIENKIIAMYARGMSTREINEQIQEIYGFEVSAEMVSKITDKILPEIEEWQKRPLGEVY 169
>gi|196253604|ref|ZP_03152224.1| transposase mutator type [Clostridium thermocellum DSM 4150] >gi|196196978|gb|EDX91855.1| transposase mutator type [Clostridium thermocellum DSM 4150] (407 aa)
Score = 354, Expect = 4.2e-32, Identities = 68/165 (41%), Positives = 114/165 (69%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           I+  ++K     L+ +  + + +D    LK+L    I+  L+ E+D HLGYEK+ +++ E  +NYR G T KTL +  G+++++IPRD N+ FEP++V K++R++++IE+ II +Y++GMSTREI +   ++YG  V  ++VS++TDKILP+I  WQ RPL ++Y
  S:     6 IITPEKKELIRNLISEYNITSAKDLQEALKDLLGDTIQNMLEAELDEHLGYEKY-ESTEEAKSNYRNGYTSKTLKSSVGQVEIDIPRDRNAEFEPKIVPKYKRDISEIENKIIAMYARGMSTREINEQIQEIYGFEVSAEMVSKITDKILPQIEEWQKRPLGEVY 169
>gi|40445299|ref|NP_954759.1| transposase [Gordonia westfalica] >gi|40217329|emb|CAE09080.1| putative transposase [Gordonia westfalica] (546 aa)
Score = 353, Expect = 4.9e-32, Identities = 63/140 (45%), Positives = 94/140 (67%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D LLK LTKS +E +LD EM  HLGY+K D   R   N+    +TK+ L    G++ +E+PRD N TF+P +V K +R + D++  ++ LY+KG++T EI   F D+YGA V KD +SR+TD+++ E++ W +RPLE +Y
  S:    59 DGLLKALTKSVLEAALDEEMTEHLGYDKHDVAGRNTGNSRNGTRTKRVLTDACGQVPIEVPRDRNGTFDPVIVGKSKRRVTDVDRVVLSLYAKGLTTGEISAHFADVYGASVSKDTISRITDRVIEEMVGWWARPLEKVY 198
>gi|134299678|ref|YP_001113174.1| transposase, mutator type [Desulfotomaculum reducens MI-1] >gi|134052378|gb|ABO50349.1| transposase, mutator type [Desulfotomaculum reducens MI-1] (403 aa)
Score = 352, Expect = 7.4e-32, Identities = 74/165 (44%), Positives = 105/165 (63%)
  Q:    23 EKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           + SS  K L K G    ED    L++L K  +++  + EMD HLGYEK D       NN R G +KK + T +GK ++EIPRD N  FEPQ+++K+Q   N +E  +I +Y KGMSTR+I+D   D+YG  V   +VSR+TDKI+P ++ WQSRPL+ +Y ++ L
  S:     2 QNSSFIKELAK-GCRTVEDVQEKLRDLFKDTLQEVFEAEMDEHLGYEKHDTAGINSGNN-RNGYSKKNVKTTFGKTELEIPRDRNGEFEPQILKKYQTTSNQLEDQVIAMYGKGMSTRDIEDHMRDIYGIDVSPTMVSRITDKIMPMVIEWQSRPLDRVYPIVFL 164
>gi|86559598|ref|YP_473419.1| transposase [Clostridium perfringens CPE str. F4969] >gi|86475870|dbj|BAE79046.1| transposase [Clostridium perfringens] (383 aa)
Score = 351, Expect = 8.3e-32, Identities = 71/164 (43%), Positives = 108/164 (65%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           M+  EK   +KL +   ++  ED  N +K L    I++ L+ EM+ +LGY K+D  ++  +N+ R GK+KKT+ +  G  D++IPRD   +FEPQ+V+KHQ +++ +E +II +Y+KGMSTR+I +   +MYG  V   L+S +TDKI+P I  WQ RPLE IY
  S:     1 MSYAEKELIKKLAKNSNIKTAEDAQNAIKSLFGGLIQQMLEAEMEEYLGYSKYDYTNKNTTNS-RNGKSKKTVKSDLGLFDLDIPRDREGSFEPQIVKKHQTDISRLESSIIGMYAKGMSTRDIANQVNEMYGMDVSPTLISNITDKIIPSIKEWQCRPLESIY 163
>gi|116662217|ref|YP_829272.1| transposase, mutator type [Arthrobacter sp. FB24] >gi|116612969|gb|ABK05691.1| transposase, mutator type [Arthrobacter sp. FB24] (430 aa)
Score = 350, Expect = 1.1e-31, Identities = 63/140 (45%), Positives = 95/140 (67%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D LLK+LTK+ IE +LD EM  HLGYEK D   ++ +N+    + K  L    G ++V++PRD   TFEP +V+K QR L  ++  ++ LY+KG++T EI   F ++YGA V K+ VSR+TD++L E+  WQ+RPL+++Y
  S:    44 DGLLKQLTKTVIETALDEEMTEHLGYEKHDSAGKQTANSRNGVRPKTVLTETTGPVEVDVPRDRAGTFEPVIVKKRQRRLTGVDEMVLSLYAKGLTTGEISAHFAEIYGASVSKETVSRITDRVLEEMAAWQNRPLDEVY 183
>gi|27817685|emb|CAD61112.1| putative transposase [Cupriavidus oxalaticus] (381 aa)
Score = 344, Expect = 5.9e-31, Identities = 66/163 (40%), Positives = 98/163 (60%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A + + SAE LLE+L  G     + + + ++  KS +E++L  EM  HLGY          + N+R GK+ KT+ T  G L +++PRD   TFEPQL+ KH+R     +  I+ +Y++GM+ REIQ    +MY   V  DL+S VTD ++ E+  WQSRPLE +Y
  S:    14 AAQPQFSAE-LLEQLIPGPVTPAELEGIFQQFKKSVLERALGAEMSHHLGYAPGQAKPEGAAANHRNGKSAKTVLTDAGALRIDVPRDREGTFEPQLIGKHERRFTGFDDKIVAMYARGMTVREIQGFLAEMYSVDVSPDLISSVTDAVMSEVTAWQSRPLESMY 177
>gi|120406908|ref|YP_956737.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119959726|gb|ABM16731.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] (424 aa)
Score = 342, Expect = 1.1e-30, Identities = 66/143 (46%), Positives = 94/143 (65%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           D LL ++TKS +E++LDVE+  HLGYE  D      S N R G  +K + T  G +D+E+PRD N TF+PQ+V K +R L  +E  I+ LY++GMSTR+I +   ++YGA V    +SRVTD +  EI  WQSRP++ +Y +L
  S:    42 DGLLAQITKSVLERALDVEIADHLGYEHGDPAGNG-SGNSRNGHGRKAVLTTAGPVDLEVPRDRNGTFDPQIVPKRKRRLGQVEDMILSLYARGMSTRDITEHLGEVYGATVSAATISRVTDVVADEIAAWQSRPVDPVYPIL 183
>gi|121593335|ref|YP_985231.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120605415|gb|ABM41155.1| transposase, mutator type [Acidovorax sp. JS42] (408 aa)
Score = 341, Expect = 1.4e-30, Identities = 74/169 (43%), Positives = 107/169 (63%)
  Q:    19 MAKKEKSSAEKLLEKLGVENK--EDF---DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M  K+    E+LL  L    K  ED    + LLK+LTK  +E++LD E+  HLG+E+ ++     + N R GK+KKTL  ++G+L +E+PRD + +FEPQL+ KHQ      +  II LY++GM+ REIQ    +MYG  V   L+S VTD +  E+  WQ+RPLE IY ++ L
  S:     1 MNTKKHDVPEELLSGLLANYKKPEDLIGENGLLKQLTKLLVERALDAELTEHLGHER-NEAVANPAGNTRNGKSKKTLKGEFGELPIEVPRDRHGSFEPQLIPKHQTRWAGFDDKIISLYARGMTVREIQAHLEEMYGTEVSPSLISSVTDAVADEVKAWQARPLEPIYPIVYL 173
>gi|121593520|ref|YP_985416.1| transposase, mutator type [Acidovorax sp. JS42] >gi|121596070|ref|YP_987966.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120605600|gb|ABM41340.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120608150|gb|ABM43890.1| transposase, mutator type [Acidovorax sp. JS42] (408 aa)
Score = 341, Expect = 1.4e-30, Identities = 74/169 (43%), Positives = 107/169 (63%)
  Q:    19 MAKKEKSSAEKLLEKLGVENK--EDF---DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M  K+    E+LL  L    K  ED    + LLK+LTK  +E++LD E+  HLG+E+ ++     + N R GK+KKTL  ++G+L +E+PRD + +FEPQL+ KHQ      +  II LY++GM+ REIQ    +MYG  V   L+S VTD +  E+  WQ+RPLE IY ++ L
  S:     1 MNTKKHDVPEELLSGLLANYKKPEDLIGENGLLKQLTKLLVERALDAELTEHLGHER-NEAVANPAGNTRNGKSKKTLKGEFGELPIEVPRDRHGSFEPQLIPKHQTRWAGFDDKIISLYARGMTVREIQAHLEEMYGTEVSPSLISSVTDAVADEVKAWQARPLEPIYPIVYL 173
>gi|121594993|ref|YP_986889.1| transposase, mutator type [Acidovorax sp. JS42] >gi|120607073|gb|ABM42813.1| transposase, mutator type [Acidovorax sp. JS42] (408 aa)
Score = 340, Expect = 1.6e-30, Identities = 74/169 (43%), Positives = 107/169 (63%)
  Q:    19 MAKKEKSSAEKLLEKLGVENK--EDF---DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M  K+    E+LL  L    K  ED    + LLK+LTK  +E++LD E+  HLG+E+ ++     + N R GK+KKTL  ++G+L +E+PRD + +FEPQL+ KHQ      +  II LY++GM+ REIQ    +MYG  V   L+S VTD +  E+  WQ+RPLE IY ++ L
  S:     1 MNTKKHDVPEELLSGLLANYKKPEDLIGENGLLKQLTKLLVERALDAELTEHLGHER-NEAVANPAGNTRNGKSKKTLKGEFGELPIEVPRDRHGSFEPQLIPKHQTRWAGFDDKIISLYARGMTVREIQAHLEEMYGTEVSPSLISSVTDAVADEVKAWQARPLEPIYPIVYL 173
>gi|118462670|ref|YP_881435.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118463114|ref|YP_882436.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464275|ref|YP_882160.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466417|ref|YP_882162.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118163957|gb|ABK64854.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164401|gb|ABK65298.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165562|gb|ABK66459.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167704|gb|ABK68601.1| transposase, Mutator family protein [Mycobacterium avium 104] (424 aa)
Score = 339, Expect = 2.3e-30, Identities = 66/143 (46%), Positives = 94/143 (65%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           D LL ++TKS +E++LDVE+  HLGYE  D      S N R G  +KT+ T  G +D+E+PRD N TF+P +V K +R L  +E  I+ LY++GMSTR+I +   ++YGA V    VSRVT+ +  EI  WQSRP++ +Y +L
  S:    42 DGLLAQITKSVLERALDVEIADHLGYEHGDPAGNG-SGNSRNGHGRKTVLTTAGPVDLEVPRDRNGTFDPVIVPKRKRRLGQVEDMILSLYARGMSTRDITEHLAEVYGASVSAATVSRVTEVVADEIAAWQSRPVDPVYPIL 183
>gi|121535884|ref|ZP_01667682.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] >gi|121305549|gb|EAX46493.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] (408 aa)
Score = 337, Expect = 3.6e-30, Identities = 65/142 (45%), Positives = 95/142 (66%)
  Q:    46 LKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           LK L    +EK L+ EMD HLGYEK        S N R G +KKT+ +++G+ ++++PRD N TFEPQ + K Q   +DIE  ++ +Y+KGMSTR+I+D   D+YG      L+SR+TDK++P ++ WQSRPL+ IY ++ L
  S:    29 LKNLFSGALEKMLEAEMDEHLGYEKHSVLGNN-SGNSRNGYSKKTIKSEWGESEIKVPRDRNGTFEPQAIEKRQTRTDDIEARVMAMYAKGMSTRDIEDHLRDIYGVEASASLISRITDKLMPAVVEWQSRPLDAIYPIVFL 169
>gi|78045274|ref|YP_361525.1| transposase mutator family protein [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|78033778|emb|CAJ19778.1| ISXax1 transposase [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|87248040|gb|ABD36387.1| putative transposase [Xanthomonas axonopodis pv. phaseoli] (408 aa)
Score = 333, Expect = 1.2e-29, Identities = 68/169 (40%), Positives = 107/169 (63%)
  Q:    19 MAKKEKSSAEKLLEKLGVE--NKEDF---DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M+ +     ++LL  L V     ED    + LLK+LTK  +E++LD EM  HLG++K +  +   + N R G+++KTL  ++G+L +EIPRD + +F PQL+ KHQ      +  I+ LY++GM+ REIQ    +MYG  V   L+S VTD ++ E+  WQ+RPL+ +Y ++ L
  S:     1 MSPRTHEVPDELLSSLLVNYTKPEDLIGENGLLKQLTKRLVERALDAEMTEHLGHDKHEPVANA-AGNTRNGRSRKTLKGEFGELPIEIPRDRHGSFAPQLIPKHQTRWAGFDDKILSLYARGMTVREIQSHLEEMYGTEVSPSLISSVTDAVVEEVKAWQARPLDPVYPIVYL 173
>gi|152983493|ref|YP_001351354.1| transposase mutator family protein [Pseudomonas aeruginosa PA7] >gi|152988458|ref|YP_001348426.1| transposase mutator family protein [Pseudomonas aeruginosa PA7] >gi|45360227|gb|AAS59254.1| putative transposase [Pseudomonas aeruginosa] >gi|45360229|gb|AAS59255.1| putative transposase [Pseudomonas aeruginosa] >gi|150958651|gb|ABR80676.1| transposase, Mutator family [Pseudomonas aeruginosa PA7] >gi|150963616|gb|ABR85641.1| transposase, Mutator family [Pseudomonas aeruginosa PA7] (408 aa)
Score = 332, Expect = 1.5e-29, Identities = 69/169 (40%), Positives = 106/169 (62%)
  Q:    19 MAKKEKSSAEKLLEKL--GVENKEDF---DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K   +  ++LL++L    +  ED    D +LK+LTK  +E++LD E+  HLG+ K  Q    +  N R G +KK L  ++G+L +E+PRD + TF+PQ++ KHQ      +  I+ LY++GM+ REIQ    +MYGA V   L+S VTD +  E+  WQSRPL+ +Y ++ L
  S:     1 MNKTPHTITDELLDQLLANYQKPEDLIGTDGILKQLTKKLVERALDAELTHHLGHNK-HQPVSNWMGNTRNGFSKKKLKGEFGELPIEVPRDRHGTFDPQIIEKHQTRWTGFDDKILSLYARGMTVREIQAHLQEMYGAEVSPSLISSVTDAVADEVKAWQSRPLDTVYPIVYL 173
>gi|167036696|ref|YP_001664274.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|167038415|ref|YP_001665993.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855530|gb|ABY93938.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166857249|gb|ABY95657.1| transposase, mutator type [Thermoanaerobacter pseudethanolicus ATCC 33223] (405 aa)
Score = 331, Expect = 1.8e-29, Identities = 64/167 (38%), Positives = 110/167 (65%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M+   K      + +  +++  D    LK L K  I++ L+ E+   LGYE++D+  ++ + N R G T+KT+ T++G+++++IPRD    FEP++V K++R+++ IE  +I LY++GMSTR+I D   D+YG  +  ++VS++T++I+PEI  WQSRPLE IY  +
  S:     1 MSLLTKEQLRNFISENNIQSIPDLYTSLKNLFKDTIQEMLEAELSTELGYERYDKKDKD-TQNSRNGYTQKTVKTQFGEMEIDIPRDRQGEFEPKIVPKYKRDISGIEEKVIALYARGMSTRDIHDQIKDLYGIELSAEMVSKITERIVPEIKEWQSRPLEKIYTFI 166
>gi|111025269|ref|YP_707689.1| transposase mutator family protein [Rhodococcus sp. RHA1] >gi|110824248|gb|ABG99531.1| probable transposase, mutator family protein [Rhodococcus sp. RHA1] (421 aa)
Score = 331, Expect = 1.9e-29, Identities = 65/159 (40%), Positives = 104/159 (65%)
  Q:    27 AEKLLEKLGVENKEDF--DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           A++LL +   E  E    + LL +LT + +E +L+ EMD HLGYEK     R   N+ R G+  KT+ T+ G + +++PRD +++F+PQ+V+K QR L  ++  I+ L +KG++T EI   F D+YGA V K+ +S++TDK+L E+  W  RPL+ +Y +L
  S:    19 AQQLLAQAKAEGVELVGPNGLLNQLTANVLETALEAEMDEHLGYEKHHVTGRNRENS-RNGRRTKTVLTEIGPVQIQVPRDTDASFDPQIVKKRQRRLTGVDEIILSLSAKGLTTGEIAAHFDDVYGASVSKETISKITDKVLTEMAEWSVRPLDPVYPVL 178
>gi|37519902|ref|NP_923279.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|35210894|dbj|BAC88274.1| glr0333 [Gloeobacter violaceus PCC 7421] (405 aa)
Score = 330, Expect = 2.8e-29, Identities = 62/138 (44%), Positives = 96/138 (69%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK+LTK+ IE++L+ E++ HLGY+K +   +  + N R GK++KTL  + G +++ +PRD N+ FEP +VRK Q  L  ++  I+ LY++GM+TR+IQ   L+MYG  V   L+S VTD ++ E+  WQ+RPLE +Y
  S:    29 LLKQLTKAVIERALEAELETHLGYKKHEAAGKG-TGNSRNGKSQKTLQAECGAVELAVPRDRNAEFEPVVVRKGQTRLAGLDEKILALYARGMTTRDIQAQLLEMYGVDVSSTLISNVTDAVMDEVRQWQNRPLEAVY 165
>gi|89893555|ref|YP_517042.1| hypothetical protein DSY0809 [Desulfitobacterium hafniense Y51] >gi|89333003|dbj|BAE82598.1| hypothetical protein [Desulfitobacterium hafniense Y51] (396 aa)
Score = 329, Expect = 2.9e-29, Identities = 66/145 (45%), Positives = 98/145 (67%)
  Q:    41 DFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSN--NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           D  + LK L    IE+ L+ EM+ HLGYEK   NS E +N  N R G  +KT+ + YG  ++ +PRD N  FEP+++ K Q   ++IE  I+ +YSKGMS R+I+D   ++YGA + + L+S++TDKILPE+  WQ+RPLE +Y ++
  S:    16 DIQSKLKRLFAGTIEQMLEAEMEDHLGYEK---NSIEGNNSGNSRNGYNRKTIISDYGASEIAVPRDRNGEFEPKILEKRQTRTDEIEQKILSMYSKGMSQRDIEDTLREIYGAEIPQTLISKITDKILPEVNEWQNRPLESVYPII 159
>gi|118619064|ref|YP_907396.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619530|ref|YP_907862.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571174|gb|ABL05925.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571640|gb|ABL06391.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 328, Expect = 4.0e-29, Identities = 57/138 (41%), Positives = 90/138 (65%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+  + ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNRTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616973|ref|YP_905305.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569083|gb|ABL03834.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 328, Expect = 4.0e-29, Identities = 57/138 (41%), Positives = 90/138 (65%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+  + ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNRTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118619627|ref|YP_907959.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571737|gb|ABL06488.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 328, Expect = 4.1e-29, Identities = 58/138 (42%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L EI  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEITAWHTRPLERVY 196
>gi|114565726|ref|YP_752880.1| hypothetical protein Swol_0155 [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|114336661|gb|ABI67509.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (408 aa)
Score = 328, Expect = 4.5e-29, Identities = 63/148 (42%), Positives = 97/148 (65%)
  Q:    40 EDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           ED  +++K L K  ++  L+ E+D HLGYEK        S N R G +KK++ T YG  ++ +PRD N  FEPQ+++K+Q   N I+  +I +Y+KGMSTR+I++    +YG  +   LVSR+TDKI+P++  WQSRPL+ +Y ++ L
  S:    24 EDIQSMIKALFKDTVQVVLEAEIDEHLGYEKHSIEGNN-SGNSRNGYSKKSIKTNYGVTELNVPRDRNGQFEPQIIKKYQTMANGIDEQVIAMYAKGMSTRDIEEHLKAIYGIDISPSLVSRITDKIMPQVSEWQSRPLDRLYPIVFL 170
>gi|118617174|ref|YP_905506.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569284|gb|ABL04035.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (443 aa)
Score = 327, Expect = 5.1e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    58 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTEEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 195
>gi|118618883|ref|YP_907215.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570993|gb|ABL05744.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 327, Expect = 5.9e-29, Identities = 57/138 (41%), Positives = 90/138 (65%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+  + ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNRTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|90417629|ref|ZP_01225541.1| transposase [Aurantimonas sp. SI85-9A1] >gi|90418007|ref|ZP_01225919.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] >gi|90418095|ref|ZP_01226007.1| transposase [Aurantimonas sp. SI85-9A1] >gi|90337301|gb|EAS50952.1| transposase [Aurantimonas sp. SI85-9A1] >gi|90337679|gb|EAS51330.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] >gi|90337767|gb|EAS51418.1| transposase [Aurantimonas sp. SI85-9A1] (413 aa)
Score = 327, Expect = 6.2e-29, Identities = 69/162 (42%), Positives = 98/162 (60%)
  Q:    21 KKEKSSAEKLLEKL--GVENKEDFD--NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +KE S  + LL++L  G + K  FD   LL  L K+F E++L+ EMD HL  E         + N R G  +KT+ T  GK ++ +PRD   +F+PQL+ K+QR     +  II +Y++GMS REI     D+YG  V  DL+S VTD +L E+  WQ+RPLE +Y
  S:    11 RKEPSIPDALLDQLLSGADPKTAFDPGGLLDGLKKAFAERALNAEMDHHLAGENG-------AGNGRNGYGRKTVTTDSGKFNLAVPRDRQGSFDPQLIAKYQRRFPGFDEKIISMYARGMSNREIVGHLHDLYGVDVSADLISVVTDAVLEEVAAWQARPLEAVY 169
>gi|31792108|ref|NP_854601.1| putative transposase [Mycobacterium bovis AF2122/97] >gi|121636843|ref|YP_977066.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|31617696|emb|CAD93805.1| PUTATIVE TRANSPOSASE [Mycobacterium bovis AF2122/97] >gi|121492490|emb|CAL70958.1| Putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] (439 aa)
Score = 326, Expect = 6.6e-29, Identities = 58/140 (41%), Positives = 89/140 (63%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D LLK LTK+ +E +L  EM  HLGY++     R   N+    + KK +    G++++ +PRD N TFEP +V K +R + D++  ++ LY+KG++T EI   F D+YG  V KD +SR+TD+++ E+  W SRPLE +Y
  S:    52 DGLLKALTKTVLEAALQEEMTEHLGYDRHAAAGRGSGNSRNGSRNKKVITDACGQVEIAVPRDRNGTFEPVIVGKRKRRVTDVDRVVLSLYAKGLTTGEIAAHFADVYGVSVSKDTISRITDRVIEEMQAWWSRPLEKVY 191
>gi|15608060|ref|NP_215435.1| transposase [Mycobacterium tuberculosis H37Rv] >gi|15840343|ref|NP_335380.1| IS1554 transposase [Mycobacterium tuberculosis CDC1551] >gi|148660699|ref|YP_001282222.1| IS2606-like transposase [Mycobacterium tuberculosis H37Ra] >gi|148822129|ref|YP_001286883.1| transposase [Mycobacterium tuberculosis F11] >gi|167967050|ref|ZP_02549327.1| transposase [Mycobacterium tuberculosis H37Ra] >gi|194543281|ref|YP_002078310.1| hypothetical protein TBCG_00912 [Mycobacterium tuberculosis C] >gi|2078069|emb|CAB08502.1| PROBABLE TRANSPOSASE [Mycobacterium tuberculosis H37Rv] >gi|13880507|gb|AAK45194.1| IS1554, transposase [Mycobacterium tuberculosis CDC1551] >gi|124600288|gb|EAY59298.1| hypothetical protein TBCG_00912 [Mycobacterium tuberculosis C] >gi|134149362|gb|EBA41407.1| transposase [Mycobacterium tuberculosis str. Haarlem] >gi|148504851|gb|ABQ72660.1| IS2606-like transposase [Mycobacterium tuberculosis H37Ra] >gi|148720656|gb|ABR05281.1| transposase [Mycobacterium tuberculosis F11] (439 aa)
Score = 326, Expect = 6.6e-29, Identities = 58/140 (41%), Positives = 89/140 (63%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D LLK LTK+ +E +L  EM  HLGY++     R   N+    + KK +    G++++ +PRD N TFEP +V K +R + D++  ++ LY+KG++T EI   F D+YG  V KD +SR+TD+++ E+  W SRPLE +Y
  S:    52 DGLLKALTKTVLEAALQEEMTEHLGYDRHAAAGRGSGNSRNGSRNKKVITDACGQVEIAVPRDRNGTFEPVIVGKRKRRVTDVDRVVLSLYAKGLTTGEIAAHFADVYGVSVSKDTISRITDRVIEEMQAWWSRPLEKVY 191
>gi|90418145|ref|ZP_01226057.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] >gi|90337817|gb|EAS51468.1| transposase, mutator family [Aurantimonas sp. SI85-9A1] (406 aa)
Score = 326, Expect = 6.9e-29, Identities = 69/162 (42%), Positives = 98/162 (60%)
  Q:    21 KKEKSSAEKLLEKL--GVENKEDFD--NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +KE S  + LL++L  G + K  FD   LL  L K+F E++L+ EMD HL  E         + N R G  +KT+ T  GK ++ +PRD   +F+PQL+ K+QR     +  II +Y++GMS REI     D+YG  V  DL+S VTD +L E+  WQ+RPLE +Y
  S:     4 RKEPSIPDALLDQLLSGADPKTAFDPGGLLDGLKKAFAERALNAEMDHHLAGENG-------AGNGRNGYGRKTVTTDSGKFNLAVPRDRQGSFDPQLIAKYQRRFPGFDEKIISMYARGMSNREIVGHLHDLYGVDVSADLISVVTDAVLEEVAAWQARPLEAVY 162
>gi|118618783|ref|YP_907115.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570893|gb|ABL05644.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 326, Expect = 7.4e-29, Identities = 57/138 (41%), Positives = 90/138 (65%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+  + ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNRTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118617457|ref|YP_905789.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569567|gb|ABL04318.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.1e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTEEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616057|ref|YP_904389.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118618575|ref|YP_906907.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568167|gb|ABL02918.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570685|gb|ABL05436.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618184|ref|YP_906516.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118618517|ref|YP_906849.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570294|gb|ABL05045.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570627|gb|ABL05378.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616413|ref|YP_904745.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568523|gb|ABL03274.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118619227|ref|YP_907559.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571337|gb|ABL06088.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118619927|ref|YP_908259.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118572037|gb|ABL06788.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (447 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616763|ref|YP_905095.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118617897|ref|YP_906229.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568873|gb|ABL03624.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570007|gb|ABL04758.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (443 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    58 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 195
>gi|118616730|ref|YP_905062.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619693|ref|YP_908025.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568840|gb|ABL03591.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571803|gb|ABL06554.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618966|ref|YP_907298.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571076|gb|ABL05827.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616359|ref|YP_904691.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568469|gb|ABL03220.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (447 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618576|ref|YP_906908.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570686|gb|ABL05437.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616732|ref|YP_905064.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118616774|ref|YP_905106.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568842|gb|ABL03593.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568884|gb|ABL03635.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616029|ref|YP_904361.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619697|ref|YP_908029.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619794|ref|YP_908126.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568139|gb|ABL02890.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571807|gb|ABL06558.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571904|gb|ABL06655.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616414|ref|YP_904746.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568524|gb|ABL03275.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (443 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    58 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 195
>gi|118618574|ref|YP_906906.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570684|gb|ABL05435.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 325, Expect = 9.5e-29, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|187924286|ref|YP_001895928.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187715480|gb|ACD16704.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 325, Expect = 1.0e-28, Identities = 64/155 (41%), Positives = 93/155 (60%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           E LL+ L  G     +  +L+    K+ IE+++  EM  HLGY    Q   +  +N R G + KTL T YG L V++PRD + +FEP L+ +H+R     +  II +Y++GMS REIQ    + YG GV  D +S VTD+++ E L WQ+RPLE +Y
  S:    26 EGLLDDLVKGPMTPNEVQDLMLAFNKALIERAMGAEMKMHLGYPA-GQPKPDGQSNERNGASGKTLLTDYGPLRVDLPRDRDGSFEPILIPRHERRFTGFDERIIAMYARGMSVREIQAFLAETYGTGVSPDFISSVTDEVMAETLAWQNRPLEPMY 181
>gi|92116933|ref|YP_576662.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|91799827|gb|ABE62202.1| transposase, mutator type [Nitrobacter hamburgensis X14] (366 aa)
Score = 324, Expect = 1.1e-28, Identities = 63/141 (44%), Positives = 90/141 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           LL  L K+  E++L+ EMD HL        S E + N R G  +KT+ T+ GKL+++IPRD  S+F+PQL+ K+QR     +  I+ +Y++GMSTREI     D+YG  V  DL+S VTD +L E+ TWQ RPL+ +Y L+
  S:    32 LLDSLKKALTERALNAEMDHHLA-------SGEDAGNTRNGYGRKTVTTETGKLEIDIPRDRQSSFDPQLIAKYQRRFPGFDDKIVSMYARGMSTREITGHLRDLYGIEVSPDLISTVTDAVLDEVATWQQRPLDPVYPLI 165
>gi|19717573|gb|AAL96208.1|AF482989_1 putative transposase [Xanthomonas oryzae pv. oryzae] (394 aa)
Score = 324, Expect = 1.1e-28, Identities = 59/153 (38%), Positives = 95/153 (62%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ + +G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSAFGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDLYGVEISHGLIAQVTDAVLEEARAWQSRPLEPIYPIVWL 156
>gi|118615942|ref|YP_904274.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118617087|ref|YP_905419.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568052|gb|ABL02803.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569197|gb|ABL03948.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 324, Expect = 1.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNGTRSKTVLTDACGSIEIDVPRDRADTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118617134|ref|YP_905466.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569244|gb|ABL03995.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 324, Expect = 1.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTEEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118617156|ref|YP_905488.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619581|ref|YP_907913.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619675|ref|YP_908007.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569266|gb|ABL04017.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571691|gb|ABL06442.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571785|gb|ABL06536.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 324, Expect = 1.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618748|ref|YP_907080.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570858|gb|ABL05609.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (443 aa)
Score = 324, Expect = 1.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    58 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 195
>gi|49146115|ref|YP_025553.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414749|emb|CAE46842.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 324, Expect = 1.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118619386|ref|YP_907718.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571496|gb|ABL06247.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 324, Expect = 1.2e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118619149|ref|YP_907481.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571259|gb|ABL06010.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 324, Expect = 1.2e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|187924835|ref|YP_001896477.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187716029|gb|ACD17253.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 324, Expect = 1.2e-28, Identities = 64/155 (41%), Positives = 92/155 (59%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           E LL+ L  G     +  +L+    K+ IE+++  EM  HLGY    Q   +   N R G + KTL T YG L V++PRD + +FEP L+ +H+R     +  II +Y++GMS REIQ    + YG GV  D +S VTD+++ E L WQ+RPLE +Y
  S:    26 EGLLDDLVKGPMTPNEVQDLMLAFNKALIERAMGAEMKMHLGYPA-GQPKPDGQGNERNGASGKTLLTDYGPLRVDLPRDRDGSFEPILIPRHERRFTGFDERIIAMYARGMSVREIQAFLAETYGTGVSPDFISSVTDEVMAETLAWQNRPLEPMY 181
>gi|92115742|ref|YP_575471.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|92118496|ref|YP_578225.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|91798636|gb|ABE61011.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|91801390|gb|ABE63765.1| transposase, mutator type [Nitrobacter hamburgensis X14] (407 aa)
Score = 324, Expect = 1.4e-28, Identities = 63/141 (44%), Positives = 90/141 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           LL  L K+  E++L+ EMD HL        S E + N R G  +KT+ T+ GKL+++IPRD  S+F+PQL+ K+QR     +  I+ +Y++GMSTREI     D+YG  V  DL+S VTD +L E+ TWQ RPL+ +Y L+
  S:    32 LLDSLKKALTERALNAEMDHHLA-------SGEDAGNTRNGYGRKTVTTETGKLEIDIPRDRQSSFDPQLIAKYQRRFPGFDDKIVSMYARGMSTREITGHLRDLYGIEVSPDLISTVTDAVLDEVATWQQRPLDPVYPLI 165
>gi|118617550|ref|YP_905882.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569660|gb|ABL04411.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 323, Expect = 1.7e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618326|ref|YP_906658.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570436|gb|ABL05187.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 323, Expect = 1.7e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618568|ref|YP_906900.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570678|gb|ABL05429.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 323, Expect = 1.7e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618578|ref|YP_906910.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570688|gb|ABL05439.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 323, Expect = 1.7e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118617046|ref|YP_905378.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569156|gb|ABL03907.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 323, Expect = 1.7e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|84625610|ref|YP_452982.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84369550|dbj|BAE70708.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 323, Expect = 1.8e-28, Identities = 59/153 (38%), Positives = 95/153 (62%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ + +G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSAFGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHALIAQVTDAVLEEARAWQSRPLEPIYPIVWL 156
>gi|24210994|ref|NP_710165.1| putative transposase [Aeromonas salmonicida subsp. salmonicida] >gi|145301391|ref|YP_001144230.1| IS256 family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145301427|ref|YP_001144266.1| IS256 family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|145301471|ref|YP_001144310.1| IS256 family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|23897238|emb|CAD48423.1| putative transposase [Aeromonas salmonicida subsp. salmonicida] >gi|142856273|gb|ABO92482.1| IS256-family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142856309|gb|ABO92518.1| IS256-family transposase [Aeromonas salmonicida subsp. salmonicida A449] >gi|142856353|gb|ABO92562.1| IS256-family transposase [Aeromonas salmonicida subsp. salmonicida A449] (404 aa)
Score = 323, Expect = 1.8e-28, Identities = 62/152 (40%), Positives = 101/152 (66%)
  Q:    36 VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +++++D   L ++L K  +E +L+ EMD HLGYEK     R   NN R G + K L  ++G++ ++ PRD N++FEPQ VRK Q  L  ++  I+ LY+KG+STR+I D F +MY A +   LVS+VT++++ ++  WQ+RPL+ +Y ++ L
  S:    17 IKSEKDLGTLTQQLIKLTVETALNAEMDEHLGYEKHAPQGRGTGNN-RNGYSTKRLKGQHGEVTIQAPRDRNASFEPQFVRKGQSRLTQMDDQILALYAKGLSTRDIVDAFKEMYDADISAGLVSKVTERVIEQVHEWQNRPLDPLYPIVYL 167
>gi|150389399|ref|YP_001319448.1| transposase, mutator type [Alkaliphilus metalliredigens QYMF] >gi|149949261|gb|ABR47789.1| transposase, mutator type [Alkaliphilus metalliredigens QYMF] (406 aa)
Score = 322, Expect = 2.1e-28, Identities = 62/164 (37%), Positives = 110/164 (67%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           M+   K    +++    ++   D  + LKEL K  +++ L+ E++  LGYEK D+ ++  + N R G ++KT+ +K+G++++E+PRD N  FEP +V K++R+++ IE  +I LY++GMSTR+I D   D+YG  +  ++VS++TDK++P++  WQ+R LE IY
  S:     1 MSTVSKKVLREMITGGDLKTAGDLQSYLKELFKDTLQEMLEAEIESDLGYEKGDRKNKN-TQNRRNGYSEKTVKSKFGEMEIEVPRDRNGEFEPVVVPKNKRDISGIEEKVISLYARGMSTRDIHDQIQDIYGIEISAEMVSKITDKVIPQVKEWQNRALEAIY 163
>gi|118616563|ref|YP_904895.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568673|gb|ABL03424.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (447 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP+ V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKTVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118619528|ref|YP_907860.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571638|gb|ABL06389.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616969|ref|YP_905301.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569079|gb|ABL03830.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618198|ref|YP_906530.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570308|gb|ABL05059.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118618314|ref|YP_906646.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570424|gb|ABL05175.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118617231|ref|YP_905563.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569341|gb|ABL04092.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118619509|ref|YP_907841.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571619|gb|ABL06370.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616865|ref|YP_905197.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118618253|ref|YP_906585.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568975|gb|ABL03726.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570363|gb|ABL05114.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118617752|ref|YP_906084.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569862|gb|ABL04613.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.1e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118617090|ref|YP_905422.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569200|gb|ABL03951.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 322, Expect = 2.2e-28, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGFIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|84624620|ref|YP_451992.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368560|dbj|BAE69718.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 322, Expect = 2.2e-28, Identities = 59/153 (38%), Positives = 95/153 (62%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ + +G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSAFGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHALIAQVTDAVLEEARAWQSRPLEPIYPIVWL 156
>gi|118620052|ref|YP_908384.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118572162|gb|ABL06913.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 321, Expect = 2.6e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP+ V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKTVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|67458784|ref|YP_246408.1| transposase [Rickettsia felis URRWXCal2] >gi|67004317|gb|AAY61243.1| Transposase [Rickettsia felis URRWXCal2] (317 aa)
Score = 321, Expect = 2.7e-28, Identities = 68/167 (40%), Positives = 110/167 (65%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDF------DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M +K+ ++ E+ ++ L + N  D       D LLKE+TK  +E++L  EM+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+S++TD I+ ++  WQSRPL+ +Y ++
  S:    20 MTQKQNAAMEQAIDLL-INNDTDVSILFREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQITDDIIEDVKLWQSRPLDPVYAIV 188
>gi|67458550|ref|YP_246174.1| transposase [Rickettsia felis URRWXCal2] >gi|67458712|ref|YP_246336.1| transposase [Rickettsia felis URRWXCal2] >gi|67459273|ref|YP_246897.1| transposase [Rickettsia felis URRWXCal2] >gi|67459319|ref|YP_246943.1| transposase [Rickettsia felis URRWXCal2] >gi|67459390|ref|YP_247014.1| transposase [Rickettsia felis URRWXCal2] >gi|67459574|ref|YP_247198.1| transposase [Rickettsia felis URRWXCal2] >gi|67459785|ref|YP_247409.1| transposase [Rickettsia felis URRWXCal2] >gi|67004083|gb|AAY61009.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004245|gb|AAY61171.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004806|gb|AAY61732.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004852|gb|AAY61778.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004923|gb|AAY61849.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005107|gb|AAY62033.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005318|gb|AAY62244.1| Transposase [Rickettsia felis URRWXCal2] (317 aa)
Score = 321, Expect = 2.8e-28, Identities = 68/167 (40%), Positives = 110/167 (65%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDF------DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M +K+ ++ E+ ++ L + N  D       D LLKE+TK  +E++L  EM+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+S++TD I+ ++  WQSRPL+ +Y ++
  S:    20 MTQKQNAAMEQAIDLL-INNDTDVSILFREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQITDDIIEDVKLWQSRPLDPVYAIV 188
>gi|67458498|ref|YP_246122.1| transposase [Rickettsia felis URRWXCal2] >gi|67458980|ref|YP_246604.1| transposase [Rickettsia felis URRWXCal2] >gi|67459312|ref|YP_246936.1| transposase [Rickettsia felis URRWXCal2] >gi|67459322|ref|YP_246946.1| transposase [Rickettsia felis URRWXCal2] >gi|67459531|ref|YP_247155.1| transposase [Rickettsia felis URRWXCal2] >gi|67459596|ref|YP_247220.1| transposase [Rickettsia felis URRWXCal2] >gi|67004031|gb|AAY60957.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004513|gb|AAY61439.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004845|gb|AAY61771.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004855|gb|AAY61781.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005064|gb|AAY61990.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005129|gb|AAY62055.1| Transposase [Rickettsia felis URRWXCal2] (317 aa)
Score = 321, Expect = 2.8e-28, Identities = 68/167 (40%), Positives = 110/167 (65%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDF------DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M +K+ ++ E+ ++ L + N  D       D LLKE+TK  +E++L  EM+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+S++TD I+ ++  WQSRPL+ +Y ++
  S:    20 MTQKQNAAMEQAIDLL-INNDTDVSILFREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQITDDIIEDVKLWQSRPLDPVYAIV 188
>gi|118617855|ref|YP_906187.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569965|gb|ABL04716.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 321, Expect = 2.8e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +T++ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTETVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|67458495|ref|YP_246119.1| transposase [Rickettsia felis URRWXCal2] >gi|67004028|gb|AAY60954.1| Transposase [Rickettsia felis URRWXCal2] (282 aa)
Score = 321, Expect = 3.0e-28, Identities = 68/167 (40%), Positives = 110/167 (65%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDF------DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M +K+ ++ E+ ++ L + N  D       D LLKE+TK  +E++L  EM+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+S++TD I+ ++  WQSRPL+ +Y ++
  S:    20 MTQKQNAAMEQAIDLL-INNDTDVSILFREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQITDDIIEDVKLWQSRPLDPVYAIV 188
>gi|118618356|ref|YP_906688.1| fusion protein of transposase for IS2606 and sialic acid-transport integral membrane protein NanT [Mycobacterium ulcerans Agy99] >gi|118570466|gb|ABL05217.1| fusion protein of transposase for IS2606 and sialic acid-transport integral membrane protein NanT [Mycobacterium ulcerans Agy99] (981 aa)
Score = 321, Expect = 3.0e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLG+++ D+      N+  + ++K  L    G +++++PRD   TFEP+ V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGHDRHDRAGYGSGNSRNRTRSKTVLTDACGSIEIDVPRDRAGTFEPKTVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|3859500|gb|AAC72813.1| probable transposase [Mycobacterium ulcerans] (444 aa)
Score = 320, Expect = 3.2e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD ++  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEDLSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|58425004|gb|AAW74041.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (414 aa)
Score = 320, Expect = 3.4e-28, Identities = 61/160 (38%), Positives = 100/160 (62%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           + +L++L  G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:    18 KTMLDELTSGCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVLEEARAWQSRPLEAIYPIVWL 175
>gi|90421165|ref|ZP_01229066.1| transposase [Aurantimonas sp. SI85-9A1] >gi|90334542|gb|EAS48325.1| transposase [Aurantimonas sp. SI85-9A1] (235 aa)
Score = 320, Expect = 3.4e-28, Identities = 69/162 (42%), Positives = 98/162 (60%)
  Q:    21 KKEKSSAEKLLEKL--GVENKEDFD--NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +KE S  + LL++L  G + K  FD   LL  L K+F E++L+ EMD HL  E         + N R G  +KT+ T  GK ++ +PRD   +F+PQL+ K+QR     +  II +Y++GMS REI     D+YG  V  DL+S VTD +L E+  WQ+RPLE +Y
  S:     4 RKEPSIPDALLDQLLSGADPKTAFDPGGLLDGLKKAFAERALNAEMDHHLAGENG-------AGNGRNGYGRKTVTTDSGKFNLAVPRDRQGSFDPQLIAKYQRRFPGFDEKIISMYARGMSNREIVGHLHDLYGVDVSADLISVVTDAVLEEVAAWQARPLEAVY 162
>gi|118619677|ref|YP_908009.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571787|gb|ABL06538.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (447 aa)
Score = 320, Expect = 3.6e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V K+ VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKNTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616726|ref|YP_905058.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568836|gb|ABL03587.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 320, Expect = 3.6e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +L+ E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALNEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|118616396|ref|YP_904728.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118568506|gb|ABL03257.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (447 aa)
Score = 320, Expect = 3.6e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V K+ VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKNTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|150015561|ref|YP_001307815.1| transposase, mutator type [Clostridium beijerinckii NCIMB 8052] >gi|149902026|gb|ABR32859.1| transposase, mutator type [Clostridium beijerinckii NCIMB 8052] (406 aa)
Score = 320, Expect = 3.6e-28, Identities = 62/156 (39%), Positives = 100/156 (64%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +L    ++  ED  N LK+L    +++ L+ EM+ HLGY K D  ++  SN+ R GK+ KT+ +  G  D+++PRD   +FEP +V+KHQ +++ +E  +I +Y+KGM+TR+I     D+YG      L+S +TDK++P +  WQSRPLE IY ++
  S:    12 ILSNSDIKTTEDIQNTLKDLFGGVLQQMLESEMESHLGYAKHDYENKNTSNS-RNGKSTKTMKSNLGLFDLDVPRDREGSFEPAIVKKHQTDVSHLESAVIGMYAKGMTTRDIATQINDIYGMDASPTLISNITDKVIPMLKEWQSRPLESIYPII 166
>gi|114775608|ref|ZP_01451176.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114778621|ref|ZP_01453437.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114778792|ref|ZP_01453599.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114550923|gb|EAU53487.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114551086|gb|EAU53647.1| putative transposase [Mariprofundus ferrooxydans PV-1] >gi|114553719|gb|EAU56100.1| putative transposase [Mariprofundus ferrooxydans PV-1] (406 aa)
Score = 320, Expect = 3.7e-28, Identities = 70/169 (41%), Positives = 108/169 (63%)
  Q:    19 MAKKEKSSA-EKLLEKLG--VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K EK +  E +  +L   V+ +ED  NL ++L K  +E +L  EM+ HLGY     + R  S+N R G + K L   +G++++E+PRD +S+FEP++V K Q  L   +  I+ LY+KGMSTR+I   F +MYGA V   L+S+VT+ +L  ++ WQ+RPL+ +Y +L L
  S:     1 MKKNEKRNELEAIARELAKHVKTEEDLSNLSRDLVKMTVEAALGGEMEAHLGYAP---SERSDSSNSRNGYSTKRLIGGHGEVEIEVPRDRHSSFEPRIVEKGQSRLTQFDDQILALYAKGMSTRDIVAAFKEMYGADVSAGLISKVTESVLERVVEWQNRPLDTLYPILYL 169
>gi|118617916|ref|YP_906248.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570026|gb|ABL04777.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 320, Expect = 4.0e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLG+++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGHDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|71065445|ref|YP_264172.1| transposase mutator family protein [Psychrobacter arcticus 273-4] >gi|71066537|ref|YP_265264.1| transposase mutator family protein [Psychrobacter arcticus 273-4] >gi|71038430|gb|AAZ18738.1| transposase, mutator family [Psychrobacter arcticus 273-4] >gi|71039522|gb|AAZ19830.1| transposase, mutator family [Psychrobacter arcticus 273-4] (404 aa)
Score = 320, Expect = 4.0e-28, Identities = 67/164 (40%), Positives = 104/164 (63%)
  Q:    24 KSSAEKLLEKLG--VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +S  +KL E++   + + +D  +  K+L +SFI+ +L+ EM+ HLGY K ++  +    N R G TKKT+ +  G L++  PRD +S+FEP LVRKHQ  ++ ++  II  Y+KG +T EI D   ++Y   +   LVSRVTD IL +I  WQ+RPL  +Y ++ L
  S:     4 QSDIKKLAEQMASSMNSFDDIKDFQKQLMQSFIDTALEAEMEDHLGYPKHEKADKP---NKRNGHTKKTVRSDTGDLEISTPRDRDSSFEPALVRKHQTRVSGLDDKIIFFYAKGQTTTEIVDTIKELYDVDISSSLVSRVTDNILDDITAWQNRPLSSVYPIVYL 166
>gi|122879047|ref|YP_199426.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (401 aa)
Score = 319, Expect = 4.1e-28, Identities = 61/160 (38%), Positives = 100/160 (62%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           + +L++L  G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:     5 KTMLDELTSGCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVLEEARAWQSRPLEAIYPIVWL 162
>gi|118618447|ref|YP_906779.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118618732|ref|YP_907064.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118619586|ref|YP_907918.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570557|gb|ABL05308.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570842|gb|ABL05593.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571696|gb|ABL06447.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 319, Expect = 4.3e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|118617854|ref|YP_906186.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569964|gb|ABL04715.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 319, Expect = 5.0e-28, Identities = 56/138 (40%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLG+++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGHDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 196
>gi|84622372|ref|YP_449744.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|27762619|gb|AAO20849.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae] >gi|84366312|dbj|BAE67470.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 319, Expect = 5.2e-28, Identities = 59/153 (38%), Positives = 94/153 (61%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVLEEARAWQSRPLEAIYPIVWL 156
>gi|92118299|ref|YP_578028.1| transposase, mutator type [Nitrobacter hamburgensis X14] >gi|91801193|gb|ABE63568.1| transposase, mutator type [Nitrobacter hamburgensis X14] (366 aa)
Score = 318, Expect = 5.4e-28, Identities = 62/141 (43%), Positives = 89/141 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           LL  L K+  E++L+ EMD HL        S E + N R G  +KT+ T+ GKL+++IPRD  S+F+PQL+ K+QR     +  I+ +Y +GMSTR+I     D+YG  V  DL+S VTD +L E+ TWQ RPL+ +Y L+
  S:    32 LLDSLKKALTERALNAEMDHHLA-------SGEDAGNTRNGYGRKTVTTETGKLEIDIPRDRQSSFDPQLIAKYQRRFPGFDDKIVSMYERGMSTRQITGHLRDLYGIEVSPDLISTVTDAVLDEVATWQQRPLDPVYPLI 165
>gi|84623823|ref|YP_451195.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84624000|ref|YP_451372.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367763|dbj|BAE68921.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367940|dbj|BAE69098.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 318, Expect = 5.6e-28, Identities = 59/153 (38%), Positives = 94/153 (61%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVLEEARAWQSRPLEAIYPIVWL 156
>gi|71065104|ref|YP_263831.1| transposase mutator family protein [Psychrobacter arcticus 273-4] >gi|71038089|gb|AAZ18397.1| transposase, mutator family [Psychrobacter arcticus 273-4] (402 aa)
Score = 318, Expect = 6.5e-28, Identities = 67/164 (40%), Positives = 102/164 (62%)
  Q:    24 KSSAEKLLEKLG--VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +S  +KL E++   + + +D  +  K+L +SFI+ +L+ EM+ HLGY K ++  +    N R G TKKT+ +  G L++  PRD +  FEP LVRKHQ  ++ ++  II  Y+KG +T EI +   D+Y   +   LVSRVTD IL +I  WQ+RPL  IY ++ L
  S:     4 QSDIKKLAEQMASSMNSFDDIKDFQKQLMQSFIDTALEAEMEDHLGYPKHEKADKP---NKRNGHTKKTVRSDSGVLEISTPRDRDGDFEPALVRKHQTRISGLDDKIISFYAKGQTTTEIVETIKDIYDVDISSSLVSRVTDNILEDITAWQNRPLSSIYPIVYL 166
>gi|49146153|ref|YP_025591.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414787|emb|CAE46880.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 318, Expect = 6.9e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V K+ VSR+TD +L EI  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKNTVSRITDCVLEEITAWHTRPLERVY 196
>gi|118618589|ref|YP_906921.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118618884|ref|YP_907216.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570699|gb|ABL05450.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570994|gb|ABL05745.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 317, Expect = 7.7e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|118618814|ref|YP_907146.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570924|gb|ABL05675.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (443 aa)
Score = 317, Expect = 7.7e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    58 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 195
>gi|49146110|ref|YP_025548.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414744|emb|CAE46837.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 317, Expect = 7.7e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|58426964|gb|AAW76001.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (413 aa)
Score = 317, Expect = 8.1e-28, Identities = 61/160 (38%), Positives = 100/160 (62%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           + +L++L  G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E NI+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    18 KTMLDELTSGCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSC----GNVRNGKSRKTVQSALGELHIETPRDRAGTFAPQLVKKRQVRLAGMEENILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 175
>gi|58426307|gb|AAW75344.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (422 aa)
Score = 316, Expect = 9.5e-28, Identities = 60/160 (37%), Positives = 99/160 (61%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           + +L++L  G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    18 KTMLDELTSGCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 175
>gi|49146134|ref|YP_025572.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414768|emb|CAE46861.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 316, Expect = 9.9e-28, Identities = 57/138 (41%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGFIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|67458457|ref|YP_246081.1| transposase [Rickettsia felis URRWXCal2] >gi|67003990|gb|AAY60916.1| Transposase [Rickettsia felis URRWXCal2] (306 aa)
Score = 316, Expect = 1.1e-27, Identities = 67/167 (40%), Positives = 109/167 (65%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDF------DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M +K+ ++ E+ ++ L + N  D       D LLKE+TK  +E++L  EM+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+S++ D I+ ++  WQSRPL+ +Y ++
  S:    20 MTQKQNAAMEQAIDLL-INNDTDVSILFREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQIIDDIIEDVKLWQSRPLDPVYAIV 188
>gi|49146139|ref|YP_025577.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414773|emb|CAE46866.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 316, Expect = 1.1e-27, Identities = 57/138 (41%), Positives = 87/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP+ V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKTVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|90309326|gb|ABD93710.1| TnpA [Edwardsiella ictaluri] >gi|162404915|gb|ABX88888.1| transposase [Edwardsiella ictaluri] (413 aa)
Score = 316, Expect = 1.1e-27, Identities = 67/173 (38%), Positives = 110/173 (63%)
  Q:    15 GVFIMAKKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G F+  K+ ++ A +L + L   ++   FD LLK+++   +E +L+ EM  HLGY   D+N  +   N R G + KT+ T  G L++  PRD + +FEPQLV+K+Q  +  +++ I+ LY+KGM+TREI   F ++Y A V   LVS+VTD ++ ++  WQ+RPL+ +Y ++ L
  S:     9 GYFMNEKQLQALANELAKNLKTPDDLSQFDRLLKKIS---VEAALNAEMSHHLGY---DKNQPKPGANSRNGYSTKTVTTGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMDNQILSLYAKGMTTREIAAAFKELYDADVSPALVSKVTDAVMEQVTEWQNRPLDAVYPIVYL 176
>gi|122879208|ref|YP_201386.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (400 aa)
Score = 315, Expect = 1.2e-27, Identities = 59/153 (38%), Positives = 94/153 (61%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E NI+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    14 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSC----GNVRNGKSRKTVQSALGELHIETPRDRAGTFAPQLVKKRQVRLAGMEENILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 162
>gi|187925389|ref|YP_001897031.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187716583|gb|ACD17807.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 315, Expect = 1.3e-27, Identities = 63/155 (40%), Positives = 91/155 (58%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           E LL+ L  G     +  +L+    K+ IE+++  EM  HLGY    Q   +   N R G + KTL T YG L V++PRD + +FEP L+ +H+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E L WQ+RPLE +Y
  S:    26 EGLLDDLVKGPMTPNEVQDLMLAFNKALIERAMGAEMKMHLGYPA-GQPKPDGQGNERNGASGKTLLTDYGPLRVDLPRDRDGSFEPILIPRHERRFTGFDERIIAMYARGMSVREIQAFLAETYGTEVSPDFISSVTDEVMAETLAWQNRPLEPMY 181
>gi|187922787|ref|YP_001894429.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187923569|ref|YP_001895211.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187713981|gb|ACD15205.1| transposase mutator type [Burkholderia phytofirmans PsJN] >gi|187714763|gb|ACD15987.1| transposase mutator type [Burkholderia phytofirmans PsJN] (425 aa)
Score = 315, Expect = 1.3e-27, Identities = 63/155 (40%), Positives = 91/155 (58%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           E LL+ L  G     +  +L+    K+ IE+++  EM  HLGY    Q   +   N R G + KTL T YG L V++PRD + +FEP L+ +H+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E L WQ+RPLE +Y
  S:    26 EGLLDDLVKGPMTPNEVQDLMLAFNKALIERAMGAEMKMHLGYPA-GQPKPDGQGNERNGASGKTLLTDYGPLRVDLPRDRDGSFEPILIPRHERRFTGFDERIIAMYARGMSVREIQAFLAETYGTEVSPDFISSVTDEVMAETLAWQNRPLEPMY 181
>gi|134295927|ref|YP_001119662.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134139084|gb|ABO54827.1| transposase, mutator type [Burkholderia vietnamiensis G4] (426 aa)
Score = 314, Expect = 1.7e-27, Identities = 63/155 (40%), Positives = 94/155 (60%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++LL++L  G     +  +L+    K+ IE+++  EM+ HLGY    Q+      N R G + KT+ T  G + VE+PRD + +FEP L+ KH+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E LTWQSRPLE +Y
  S:    27 KELLDQLVKGPMTPAEVQDLMLAFNKAVIERAMGAEMNLHLGYRP-GQSKPPGQANERNGASGKTVITDRGPVRVEVPRDRDGSFEPILIPKHERRFTGFDERIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMAEALTWQSRPLETMY 182
>gi|134294370|ref|YP_001118105.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134137527|gb|ABO53270.1| transposase, mutator type [Burkholderia vietnamiensis G4] (422 aa)
Score = 314, Expect = 1.7e-27, Identities = 63/155 (40%), Positives = 94/155 (60%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++LL++L  G     +  +L+    K+ IE+++  EM+ HLGY    Q+      N R G + KT+ T  G + VE+PRD + +FEP L+ KH+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E LTWQSRPLE +Y
  S:    27 KELLDQLVKGPMTPAEVQDLMLAFNKAVIERAMGAEMNLHLGYRP-GQSKPPGQANERNGASGKTVITDRGPVRVEVPRDRDGSFEPILIPKHERRFTGFDERIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMAEALTWQSRPLETMY 182
>gi|134294141|ref|YP_001117876.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134137298|gb|ABO53041.1| transposase, mutator type [Burkholderia vietnamiensis G4] (394 aa)
Score = 314, Expect = 1.7e-27, Identities = 63/155 (40%), Positives = 94/155 (60%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++LL++L  G     +  +L+    K+ IE+++  EM+ HLGY    Q+      N R G + KT+ T  G + VE+PRD + +FEP L+ KH+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E LTWQSRPLE +Y
  S:    27 KELLDQLVKGPMTPAEVQDLMLAFNKAVIERAMGAEMNLHLGYRP-GQSKPPGQANERNGASGKTVITDRGPVRVEVPRDRDGSFEPILIPKHERRFTGFDERIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMAEALTWQSRPLETMY 182
>gi|134293690|ref|YP_001117426.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134136847|gb|ABO57961.1| transposase, mutator type [Burkholderia vietnamiensis G4] (426 aa)
Score = 314, Expect = 1.7e-27, Identities = 63/155 (40%), Positives = 94/155 (60%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++LL++L  G     +  +L+    K+ IE+++  EM+ HLGY    Q+      N R G + KT+ T  G + VE+PRD + +FEP L+ KH+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E LTWQSRPLE +Y
  S:    27 KELLDQLVKGPMTPAEVQDLMLAFNKAVIERAMGAEMNLHLGYRP-GQSKPPGQANERNGASGKTVITDRGPVRVEVPRDRDGSFEPILIPKHERRFTGFDERIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMAEALTWQSRPLETMY 182
>gi|69244022|ref|ZP_00602600.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68196748|gb|EAN11173.1| Transposase, mutator type [Enterococcus faecium DO] (441 aa)
Score = 314, Expect = 1.9e-27, Identities = 61/171 (35%), Positives = 108/171 (63%)
  Q:    15 GVFIMAKKEKSS-----AEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           G + MA+K+++      AE +L     E+ ED  ++LK++     EK L  E++ HLGY+   +  ++  +N R G   KTL T +GK+++++PRD  ++FEP+L+   +R+++DIE  ++ +Y++GMS  +I     D+YG  +  +++S +TD +LPE+  WQ+RPL   Y  L
  S:     8 GDYTMARKKRNPDAEKLAESILNTYQPESVEDMQDVLKDVFGPLFEKMLQGELNNHLGYDAHSKEPKK-HDNRRNGYGNKTLKTSFGKVNIDVPRDREASFEPELIPNRKRDVSDIEGKVLSMYARGMSQCDIAATVEDIYGFDISHEMISDITDAVLPELEEWQARPLAKCYAFL 182
>gi|49146106|ref|YP_025544.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414740|emb|CAE46833.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 313, Expect = 2.1e-27, Identities = 56/138 (40%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T +I   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGDISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|10567527|gb|AAG18473.1|AF143819_2 transposase-like protein; TnpA [Escherichia coli] (402 aa)
Score = 313, Expect = 2.1e-27, Identities = 68/167 (40%), Positives = 107/167 (64%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+ ++ A +L + L   E+   FD LLK+L+   +E +L+ EM  HLGYEK   N      N R G + KT+ T  G L++  PRD + TFEPQLV+K+Q  +  +++ I+ LY+KGM+TREI   F ++Y A V   L+S+VTD ++ +++ WQ+RPL+ +Y ++ L
  S:     4 KQLQTLANELAKNLKTPEDLSQFDRLLKKLS---VEAALNAEMTHHLGYEK---NQSRPGANSRNGYSTKTVITGDGPLELRTPRDRDGTFEPQLVKKNQTRITGMDNQILSLYAKGMTTREIAAAFKELYDADVSPALISKVTDAVMEQVVEWQNRPLDAVYPIVYL 165
>gi|118617280|ref|YP_905612.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118569390|gb|ABL04141.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 313, Expect = 2.3e-27, Identities = 56/138 (40%), Positives = 88/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VS +TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSWITDRVLEEMTAWHTRPLERVY 196
>gi|84624248|ref|YP_451620.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84368188|dbj|BAE69346.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 312, Expect = 2.9e-27, Identities = 58/153 (37%), Positives = 93/153 (60%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 156
>gi|84623634|ref|YP_451006.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84367574|dbj|BAE68732.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 312, Expect = 2.9e-27, Identities = 58/153 (37%), Positives = 93/153 (60%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 156
>gi|49146120|ref|YP_025558.1| transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] >gi|42414754|emb|CAE46847.1| probable transposase for the insertion element IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 312, Expect = 2.9e-27, Identities = 56/138 (40%), Positives = 87/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+ D +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRIADCVLEEMTAWHTRPLERVY 196
>gi|33334431|gb|AAQ12271.1| transposase; TnpA [primary endosymbiont of Sitophilus zeamais] (397 aa)
Score = 311, Expect = 3.9e-27, Identities = 66/167 (39%), Positives = 107/167 (64%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+ ++ A +L + L + EN   FD LLK+++   +E +L+ EM  HLGY   D+N  +   N   G + KT+ T  G L +  PRD + +FEPQLV+K+Q  +  +++ I+ LY+KGM+TREI   F ++Y A V   LVS+VTD ++ +++ WQ+RPL+ +Y ++ L
  S:     4 KQLQALANELAKSLKIPENLSHFDRLLKKIS---VEAALNAEMTHHLGY---DKNQPKPGTNAHNGYSTKTVTTGDGPLALRTPRDRDGSFEPQLVKKNQTRITGMDNQILSLYAKGMTTREIAATFKELYDADVSPALVSKVTDAVMEQVVEWQNRPLDAVYPIVYL 165
>gi|58425603|gb|AAW74640.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (413 aa)
Score = 310, Expect = 4.7e-27, Identities = 58/153 (37%), Positives = 93/153 (60%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    27 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 175
>gi|58426504|gb|AAW75541.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58426688|gb|AAW75725.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (413 aa)
Score = 310, Expect = 4.8e-27, Identities = 58/153 (37%), Positives = 93/153 (60%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    27 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 175
>gi|122879192|ref|YP_201110.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (400 aa)
Score = 310, Expect = 4.9e-27, Identities = 58/153 (37%), Positives = 93/153 (60%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    14 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 162
>gi|122879097|ref|YP_200025.6| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (400 aa)
Score = 310, Expect = 4.9e-27, Identities = 58/153 (37%), Positives = 93/153 (60%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    14 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 162
>gi|47174902|gb|AAT12436.1| TnpA [Salmonella enterica] (402 aa)
Score = 309, Expect = 6.8e-27, Identities = 67/167 (40%), Positives = 106/167 (63%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+ ++ A +L + L   E+   FD LLK+L+   +E +L+ EM  HLGYEK   N      N R G + KT+ T  G L++  PRD +  FEPQLV+K+Q  +  +++ I+ LY+KGM+TREI   F ++Y A V   L+S+VTD ++ +++ WQ+RPL+ +Y ++ L
  S:     4 KQLQALANELAKNLKTPEDLSQFDRLLKKLS---VEAALNAEMTHHLGYEK---NQSRPGANSRNGYSTKTVITGDGPLELRTPRDRDGAFEPQLVKKNQTRITGMDNQILSLYAKGMTTREIATAFKELYDADVSPALISKVTDAVMEQVVEWQNRPLDAVYPIVYL 165
>gi|118619379|ref|YP_907711.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118571489|gb|ABL06240.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 309, Expect = 7.4e-27, Identities = 56/138 (40%), Positives = 87/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLG ++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGCDRHDRAGYGSGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|114706499|ref|ZP_01439400.1| TRm3 transposase [Fulvimarina pelagi HTCC2506] >gi|114537891|gb|EAU41014.1| TRm3 transposase [Fulvimarina pelagi HTCC2506] (277 aa)
Score = 308, Expect = 7.7e-27, Identities = 65/165 (39%), Positives = 100/165 (60%)
  Q:    21 KKEKSSAEKLLEKL--GVENKEDFD--NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           ++E + ++ LL++L  G +    FD   LL  L K+  E++L+ EMD HL  EK        + N   G  KKT+ +  GK ++ +PRD  S+F+PQL+ K+QR     +  ++ +Y++GMS REI     D+YG  V  DL+S VTD +L E+  WQ+RPLE +Y L+
  S:     4 RQEPNISDALLDQLLLGADPTTAFDPGGLLDGLKKAPAERALNAEMDHHLAGEKG-------AGNGCNGYGKKTVTSDSGKFELSVPRDRQSSFDPQLIAKYQRRFPGFDEKVVSMYARGMSNREIVGHLHDLYGVNVSPDLISAVTDAVLDEVAAWQARPLEPVYPLV 165
>gi|118617932|ref|YP_906264.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570042|gb|ABL04793.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 307, Expect = 1.1e-26, Identities = 56/138 (40%), Positives = 87/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLG ++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGCDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|118618381|ref|YP_906713.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570491|gb|ABL05242.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (444 aa)
Score = 307, Expect = 1.1e-26, Identities = 56/138 (40%), Positives = 87/138 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLG ++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIEIALDEELSEHLGCDRHDRAGYGSGNSRNGTRSKTVLTDACGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 196
>gi|107021956|ref|YP_620283.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107022754|ref|YP_621081.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107022757|ref|YP_621084.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107027633|ref|YP_625144.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116689705|ref|YP_835328.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116693655|ref|YP_839188.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|170736153|ref|YP_001777413.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|105892145|gb|ABF75310.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105892943|gb|ABF76108.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105892946|gb|ABF76111.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105897007|gb|ABF80171.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116647794|gb|ABK08435.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116651655|gb|ABK12295.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|169818341|gb|ACA92923.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (419 aa)
Score = 307, Expect = 1.1e-26, Identities = 62/148 (41%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  N+   +  L  L K+  E++L  E+  HLGYEK D        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLNRATINEQLAALKKAIFERALGGELTHHLGYEKGDAKPAG-RTNHRNGTSRKRITTDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDSVIDEVREWQQRPLEPMY 176
>gi|148551055|ref|YP_001260485.1| transposase, mutator type [Sphingomonas wittichii RW1] >gi|148503466|gb|ABQ71718.1| transposase, mutator type [Sphingomonas wittichii RW1] (407 aa)
Score = 307, Expect = 1.1e-26, Identities = 60/141 (42%), Positives = 87/141 (61%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           LL  L K+  E+ L+ EMD HL  E       + + N R G  +KT+ T  GKL +++PRD  S+F+PQL+ K+QR     +  I+ +Y++GM+TREI     D+YG  V  DL+S VTD +L E+ TWQ RPL+ +Y L+
  S:    32 LLDSLKKALTERVLNAEMDHHLAGE-------DGAGNMRNGYGRKTVMTDTGKLAIDVPRDRQSSFDPQLIAKYQRRFPGFDDKIVSMYARGMTTREITRHLHDLYGIDVSPDLISTVTDAVLDEVATWQQRPLDPVYPLV 165
>gi|170734626|ref|YP_001773740.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|170735276|ref|YP_001774390.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|170735573|ref|YP_001776833.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|194557185|ref|YP_002092211.1| Transposase [Burkholderia cenocepacia PC184] >gi|194558134|ref|YP_002093160.1| Transposase [Burkholderia cenocepacia PC184] >gi|124870976|gb|EAY62692.1| Transposase [Burkholderia cenocepacia PC184] >gi|124871925|gb|EAY63641.1| Transposase [Burkholderia cenocepacia PC184] >gi|169817761|gb|ACA92343.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169820664|gb|ACA95245.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169821314|gb|ACA95895.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (426 aa)
Score = 307, Expect = 1.1e-26, Identities = 61/155 (39%), Positives = 94/155 (60%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++LL++L  G     +  +L+    K+ IE+++  EM+ HLGY    Q+      N R G + KT+ T  G + VE+PRD + +FEP L+ KH+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E L+WQ+RPLE +Y
  S:    27 KELLDQLVKGPMTPTEVQDLMLAFNKAIIERAMGAEMNLHLGYPS-GQSKPTGQANERNGASGKTVITDRGPVRVEVPRDRDGSFEPILIPKHERRFTGFDERIIAMYARGMSVREIQGFLAEHYGTEVSPDFISSVTDEVMAEALSWQNRPLEPMY 182
>gi|29376391|ref|NP_815545.1| IS256 family transposase [Enterococcus faecalis V583] >gi|29343854|gb|AAO81615.1| transposase, IS256 family [Enterococcus faecalis V583] (430 aa)
Score = 307, Expect = 1.1e-26, Identities = 60/167 (35%), Positives = 105/167 (62%)
  Q:    19 MAKKEKSS-----AEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           MA+K+++      AE +L     E+ +D  + LK++     EK L  E++ HLGY+   +  +E  +N R G   KTL T +G++ +++PRD  ++FEP+L+ K +R+++DIE  ++ +Y++GMS R+I      +YG  +  +++S +TD +LPE+  WQ+RPL   Y  L
  S:     1 MARKKRNPDAEKLAESILNAYQPESVDDMQDALKDVFGPLFEKMLQGELNNHLGYDAHSKEPKE-HDNRRNGYGTKTLKTSFGEVAIDVPRDREASFEPELIPKRKRDVSDIEGKVLSMYARGMSQRDIAATVEAIYGFDISHEMISDITDAVLPELEEWQARPLAKCYAFL 171
>gi|69244012|ref|ZP_00602590.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68196738|gb|EAN11163.1| Transposase, mutator type [Enterococcus faecium DO] (399 aa)
Score = 307, Expect = 1.3e-26, Identities = 60/167 (35%), Positives = 106/167 (63%)
  Q:    19 MAKKEKSS-----AEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           MA+K+++      AE +L     E+ ED  ++LK++     EK L  E++ HLGY+   +  ++  +N R G   KTL T +GK+++++PRD  ++FEP+L+   +R+++DIE  ++ +Y++GMS  +I     D+YG  +  +++S +TD +LPE+  WQ+RPL   Y  L
  S:     1 MARKKRNPDAEKLAESILNTYQPESVEDMQDVLKDVFGPLFEKMLQGELNNHLGYDAHSKEPKK-HDNRRNGYGNKTLKTSFGKVNIDVPRDREASFEPELIPNRKRDVSDIEGKVLSMYARGMSQCDIAATVEDIYGFDISHEMISDITDAVLPELEEWQARPLAKCYAFL 171
>gi|83720678|ref|YP_443771.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83654503|gb|ABC38566.1| transposase, Mutator family [Burkholderia thailandensis E264] (396 aa)
Score = 307, Expect = 1.3e-26, Identities = 61/148 (41%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK D        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGDAKPAG-RTNHRNGTSRKRITTDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|77973488|ref|ZP_00829035.1| COG3328: Transposase and inactivated derivatives [Yersinia frederiksenii ATCC 33641] (402 aa)
Score = 305, Expect = 2.2e-26, Identities = 65/167 (38%), Positives = 109/167 (65%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+ ++ A +L + L   ++   FD LLK+++   +E +L+ E+  HLGY   D+N  +   N R G T+KT+ T  G L++  PRD + +FEPQLV+K+Q  +  +++ I+ LY+KGM+TREI   F ++Y A V   LVS+VTD ++ +++ WQ+RPL+ +Y ++ L
  S:     4 KQLQALANELAKNLKTPKDLNQFDRLLKKIS---VEAALNAEITHHLGY---DKNQLKPGTNARNGYTQKTVITGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMDNQILSLYAKGMTTREIAAAFKELYDADVSSALVSKVTDAVMEQVVEWQNRPLDAVYPIVYL 165
>gi|83956442|ref|ZP_00964863.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839327|gb|EAP78514.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] (392 aa)
Score = 304, Expect = 2.3e-26, Identities = 64/155 (41%), Positives = 101/155 (65%)
  Q:    28 EKLLEKLGVENKEDFD-----NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSN---NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +KLL++L +E +   D      +L ELTK+  E++L  EM+ HLG E+ ++   E  N   N R G ++KT+ T  GK+ ++IPRD N TF+P L+ K+QR   + +  I+ +Y++GM+TREIQ    ++YG      L+S +T+ ++ E+  WQSRPLE  Y
  S:     5 KKLLDEL-MEGRSSGDLFGKEGILAELTKALAERALTAEMEEHLGAER-EEGVAEGQNHPPNRRNGSSQKTVTTDSGKVILDIPRDRNGTFDPLLIAKYQRRFPEFDRKIVSMYARGMTTREIQGHIEEIYGFEASPSLISVITEAVMDEVTAWQSRPLEPCY 165
>gi|118443604|ref|YP_877034.1| transposase mutator family protein [Clostridium novyi NT] >gi|118134060|gb|ABK61104.1| transposase, Mutator family [Clostridium novyi NT] (384 aa)
Score = 304, Expect = 2.4e-26, Identities = 54/140 (38%), Positives = 95/140 (67%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           + L++ + K  I+  L+ EM+ HLG +K+++N    S NYR G +KK + + +G +DV+IPRD N+ FEP++++K++   N+++  +I LY++G+STR+IQ    D+YG  +   +VS++TDK++     WQ+R L+ IY
  S:    28 NGLIQRMLKDVIQNILEAEMEDHLGRDKYERNPENNSKNYRNGYSKKNIRSSFGDIDVDIPRDRNAEFEPKVIKKYETVCNELDKKVIGLYARGISTRDIQAEIEDLYGITISPSMVSKITDKVIGAATAWQNRTLDRIY 167
>gi|83855151|ref|ZP_00948681.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83954230|ref|ZP_00962950.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83955838|ref|ZP_00964380.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83956074|ref|ZP_00964556.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83956084|ref|ZP_00964566.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839640|gb|EAP78819.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839650|gb|EAP78829.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83839843|gb|EAP79020.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83841267|gb|EAP80437.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] >gi|83842994|gb|EAP82161.1| TRm3 transposase [Sulfitobacter sp. NAS-14.1] (407 aa)
Score = 304, Expect = 2.5e-26, Identities = 64/155 (41%), Positives = 101/155 (65%)
  Q:    28 EKLLEKLGVENKEDFD-----NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSN---NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +KLL++L +E +   D      +L ELTK+  E++L  EM+ HLG E+ ++   E  N   N R G ++KT+ T  GK+ ++IPRD N TF+P L+ K+QR   + +  I+ +Y++GM+TREIQ    ++YG      L+S +T+ ++ E+  WQSRPLE  Y
  S:     5 KKLLDEL-MEGRSSGDLFGKEGILAELTKALAERALTAEMEEHLGAER-EEGVAEGQNHPPNRRNGSSQKTVTTDSGKVILDIPRDRNGTFDPLLIAKYQRRFPEFDRKIVSMYARGMTTREIQGHIEEIYGFEASPSLISVITEAVMDEVTAWQSRPLEPCY 165
>gi|193070420|ref|ZP_03051361.1| IS1414, transposase [Escherichia coli E110019] >gi|192956239|gb|EDV86701.1| IS1414, transposase [Escherichia coli E110019] (402 aa)
Score = 304, Expect = 2.5e-26, Identities = 65/167 (38%), Positives = 108/167 (64%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+ ++ A +L + L   E+   FD LLK+++   +E +L+ EM  HLGY   D+N  +   N R G + KT+ T  G L++  PRD + +FEPQLV+K+Q  +  +++ I+ LY+KG++TREI   F ++Y A V   LVS+VTD ++ +++ WQ+RPL+ +Y ++ L
  S:     4 KQLQALANELAKNLKTPEDLSQFDRLLKKIS---VEAALNAEMSHHLGY---DKNQPKPGANSRNGYSTKTVITGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMDNQILSLYAKGLTTREIAAAFKELYDADVSPALVSKVTDAVMEQVVEWQNRPLDAVYPIVYL 165
>gi|194563858|ref|YP_002098881.1| Transposase [Burkholderia dolosa AUO158] >gi|124895482|gb|EAY69362.1| Transposase [Burkholderia dolosa AUO158] (389 aa)
Score = 304, Expect = 2.9e-26, Identities = 57/142 (40%), Positives = 86/142 (60%)
  Q:    41 DFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +  +L+    K+ IE+++  EM+ HLGY    Q+      N R G + KT+ T  G + V++PRD + +FEP L+ KH+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E L+WQSRPLE +Y
  S:     5 EVQDLMLAFNKAVIERAMGAEMNLHLGYPS-GQSKPAGQANERNGASGKTVITDRGPVRVKVPRDRDGSFEPILIAKHERRFTGFDERIIAMYARGMSVREIQAFLAESYGTEVSPDFISSVTDEVMAEALSWQSRPLETMY 145
>gi|111025080|ref|YP_707500.1| transposase mutator family protein [Rhodococcus sp. RHA1] >gi|110824059|gb|ABG99342.1| probable transposase, mutator family protein [Rhodococcus sp. RHA1] (204 aa)
Score = 303, Expect = 3.0e-26, Identities = 63/153 (41%), Positives = 100/153 (65%)
  Q:    27 AEKLLEKLGVENKEDF--DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           A++LL +   E  E    + LL +LT + +E +L+ EMD HLGYEK     R   N+ R G+  KT+ T+ G + +++PRD +++F+PQ+V+K QR L  ++  I+ L +KG++T EI   F D+YGA V K+ +S++TDK+L E+  W  RPL+
  S:    19 AQQLLAQAKAEGVELVGPNGLLNQLTANVLETALEAEMDEHLGYEKHHVTGRNRENS-RNGRRTKTVLTEIGPVQIQVPRDTDASFDPQIVKKRQRRLTGVDEIILSLSAKGLTTGEIAAHFDDVYGASVSKETISKITDKVLTEMAEWSVRPLD 172
>gi|194562685|ref|YP_002097708.1| Transposase [Burkholderia dolosa AUO158] >gi|194563080|ref|YP_002098103.1| Transposase [Burkholderia dolosa AUO158] >gi|194563317|ref|YP_002098340.1| Transposase [Burkholderia dolosa AUO158] >gi|194563811|ref|YP_002098834.1| Transposase [Burkholderia dolosa AUO158] >gi|124894309|gb|EAY68189.1| Transposase [Burkholderia dolosa AUO158] >gi|124894704|gb|EAY68584.1| Transposase [Burkholderia dolosa AUO158] >gi|124894941|gb|EAY68821.1| Transposase [Burkholderia dolosa AUO158] >gi|124895435|gb|EAY69315.1| Transposase [Burkholderia dolosa AUO158] (419 aa)
Score = 303, Expect = 3.0e-26, Identities = 61/148 (41%), Positives = 86/148 (58%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK +      S N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGEAKPAS-STNHRNGTSRKRIATDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|24372299|ref|NP_716341.1| transposase mutator family protein [Shewanella oneidensis MR-1] >gi|24346232|gb|AAN53786.1|AE015516_8 transposase, mutator family [Shewanella oneidensis MR-1] (403 aa)
Score = 303, Expect = 3.4e-26, Identities = 56/143 (39%), Positives = 94/143 (65%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +L++LTK   E++L+ EM+ HLGY K D      + N R GK++K++ + +G +++E PRD N +FEP+L++K ++ L   +  I+ LY++GMSTR+IQ  F + YG  V    +S++T+ +L E+  WQ RPL  +Y ++ L
  S:    27 ILRQLTKKLAERALEAEMELHLGYAKHDAAGFN-TGNSRNGKSRKSVRSIHGDIELETPRDRNGSFEPKLIKKGEKQLGGFDERIVSLYARGMSTRDIQAHFEETYGVEVSPTFISQITNAVLDEVKAWQLRPLAPVYPIVYL 168
>gi|107022256|ref|YP_620583.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|107026954|ref|YP_624465.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116689201|ref|YP_834824.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116691849|ref|YP_837382.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|105892445|gb|ABF75610.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|105896328|gb|ABF79492.1| transposase, mutator type [Burkholderia cenocepacia AU 1054] >gi|116647290|gb|ABK07931.1| transposase, mutator type [Burkholderia cenocepacia HI2424] >gi|116649849|gb|ABK10489.1| transposase, mutator type [Burkholderia cenocepacia HI2424] (416 aa)
Score = 303, Expect = 3.5e-26, Identities = 60/154 (38%), Positives = 91/154 (59%)
  Q:    29 KLLEKLG--VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +LLE+ G      E  +     L K+ IE++L  EM+ HLGY          + N R GK  KT+ T+ G + +E+PRD + +FEP L+ KH+R     +  I+ +Y++GM+ REIQ   L+ YG  V  D +S VTD+++ E+  WQ+RPLE +Y
  S:    18 ELLEQFGNGPMTAEAINAATLALKKALIERALGGEMNHHLGYPPGAAKPAN-ATNQRNGKGAKTVLTEDGPIRIEVPRDRDGSFEPILIPKHERRFTGFDDKIVAMYARGMTVREIQGFLLEQYGTEVSPDFISSVTDEVMAEVTAWQARPLEPMY 172
>gi|114762674|ref|ZP_01442108.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114766511|ref|ZP_01445469.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114766531|ref|ZP_01445488.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114541221|gb|EAU44272.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114541278|gb|EAU44328.1| TRm3 transposase [Roseovarius sp. HTCC2601] >gi|114544584|gb|EAU47590.1| TRm3 transposase [Roseovarius sp. HTCC2601] (407 aa)
Score = 302, Expect = 4.2e-26, Identities = 57/140 (40%), Positives = 89/140 (63%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSN--NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D +L ELTK+  E++L  E++ HL  E+ D  +   S   N R G ++KT+ T  GK+ ++IPRD N +F+P L+ K+QR   + +  II +Y++GM+TREIQ    ++YG      L+S +TD ++ E+  WQ+RPLE  Y
  S:    24 DGVLAELTKALAERALSAELEEHLTEERADPPAEGASQAPNRRNGSSQKTVTTDSGKVVLDIPRDRNGSFDPVLIAKYQRRFPEFDTKIISMYARGMTTREIQGHIEEIYGIEASPSLISAITDAVMDEVTAWQNRPLEPCY 165
>gi|83717566|ref|YP_438631.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83717711|ref|YP_438558.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83718506|ref|YP_443626.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83719544|ref|YP_443262.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83719830|ref|YP_441482.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83720922|ref|YP_441651.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83651391|gb|ABC35455.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83651536|gb|ABC35600.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83652331|gb|ABC36394.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83653369|gb|ABC37432.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83653655|gb|ABC37718.1| transposase, Mutator family [Burkholderia thailandensis E264] >gi|83654747|gb|ABC38810.1| transposase, Mutator family [Burkholderia thailandensis E264] (419 aa)
Score = 302, Expect = 4.3e-26, Identities = 61/148 (41%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK D        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGDAKPAG-RTNHRNGTSRKRITTDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|114707592|ref|ZP_01440487.1| TRm3 transposase [Fulvimarina pelagi HTCC2506] >gi|114536836|gb|EAU39965.1| TRm3 transposase [Fulvimarina pelagi HTCC2506] (265 aa)
Score = 302, Expect = 4.4e-26, Identities = 62/152 (40%), Positives = 90/152 (59%)
  Q:    34 LGVENKEDFD--NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           LG +    FD   LL  L K+  E++L+ EMD HL  EK        + N   G  KKT+ +  GK ++ +PRD  S+F+PQL+ K+QR     +  ++ +Y++GMS REI     D+YG  V  DL+S VTD +L E+  WQ+RPLE +Y L+
  S:     7 LGADPTTAFDPGGLLDGLKKAPAERALNAEMDHHLAGEKG-------AGNGCNGYGKKTVTSDSGKFELSVPRDRQSSFDPQLIAKYQRRFPGFDEKVVSMYARGMSNREIVGHLHDLYGVNVSPDLISAVTDAVLDEVAAWQARPLEPVYPLV 153
>gi|115759367|ref|XP_001184078.1| PREDICTED: similar to transposase, Mutator family [Strongylocentrotus purpuratus] >gi|115947402|ref|XP_001193370.1| PREDICTED: similar to transposase, Mutator family [Strongylocentrotus purpuratus] (394 aa)
Score = 302, Expect = 4.7e-26, Identities = 58/153 (37%), Positives = 96/153 (62%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G++  ED + +     K  IE +L+ E+  HLGYEK   +  +  +N R G + KT+ T+ G+L ++IPRD   +FEPQ+++KHQ  +  ++  I+ LY+KGM+ REI   F +MY A V   L+S+VTD ++ ++  WQ+R L+ +Y ++ L
  S:     8 GLKTPEDLNQMTAVFKKFMIETALNTELSDHLGYEK---HQPKKGSNSRNGFSSKTITTQDGQLALDIPRDREGSFEPQIIKKHQTRITSMDDQILSLYAKGMTNREIVAFFKEMYDADVSASLISKVTDAVIEQVTEWQNRALDSLYPVVYL 157
>gi|77627608|dbj|BAE46568.1| possible transposase [Corynebacterium cyclohexanicum] (336 aa)
Score = 301, Expect = 6.1e-26, Identities = 58/148 (39%), Positives = 92/148 (62%)
  Q:    40 EDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           E  D L+++L K+ +E+ +  E+  HLGYEK D ++  F N+ R G   KT+ T  G +++ +PRD + TF P LV K  R L+ ++  II LY+ GM+ R+I+   +   G  V ++ +S+VTD++L E+L WQ RPLE  Y ++ L
  S:    44 EGRDGLIQQLIKAGLERGMQAELSDHLGYEKGDPDAALFPNS-RNGSFPKTVGTIAGDVELAVPRDRDGTFTPMLVPKGARRLSGLDDMIISLYAGGMTVRDIEHHLVSTVGTEVSRETISKVTDEVLDEVLAWQRRPLESFYPVIYL 190
>gi|50955020|ref|YP_062308.1| transposase, undefined [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50951502|gb|AAT89203.1| transposase, undefined [Leifsonia xyli subsp. xyli str. CTCB07] (196 aa)
Score = 301, Expect = 6.2e-26, Identities = 57/145 (39%), Positives = 91/145 (62%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY--ILLSLLM 189
           L++ LTKS +E  LD E   HLGY K D       N+    ++K  +    G + +E+PR    +FEP++VRKHQR L  ++  I+ L ++G++T EI  +F ++YGA V KD +SR+TDK+  E+ +W +RPL  +Y  + +SL++
  S:    50 LMRALTKSVLETVLDEEFAEHLGYGKHDVAGYHTGNSRNGTRSKTVITDAVGPVVIEVPRGREGSFEPKIVRKHQRRLGQVDEIILSLTARGLTTGEISALFAEIYGASVSKDTISRITDKVSEEMTSWLTRPLGSVYAAVFISLML 196
>gi|25026796|ref|NP_736850.1| putative transposase [Corynebacterium efficiens YS-314] >gi|25027581|ref|NP_737635.1| putative transposase [Corynebacterium efficiens YS-314] >gi|25028021|ref|NP_738075.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23492075|dbj|BAC17050.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23492863|dbj|BAC17835.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23493304|dbj|BAC18275.1| putative transposase [Corynebacterium efficiens YS-314] (447 aa)
Score = 300, Expect = 7.1e-26, Identities = 58/159 (36%), Positives = 98/159 (61%)
  Q:    29 KLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSN--NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           KL+++LG     D ++L++ L ++ I + L+ EMD HLGY   D++ +  +   N+R G   K +++ YG +DV +PRD N +F P +V K  R L D++  II LY+ GM+ R+IQ   +   G  +  + +S +TD +L E++ WQ+R L+D Y ++ L
  S:    30 KLIDELGTSTT-DANDLVRGLLQASINRGLNAEMDAHLGYGHSDRDGKTAAGQGNHRNGYYPKRVDSNYGPIDVAVPRDRNGSFLPTMVPKGSRRLTDVDDMIISLYAGGMTVRDIQHHMITSMGVDISHETISAITDAVLDEVMIWQNRQLDDFYPVIFL 189
>gi|94309425|ref|YP_582635.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|94310206|ref|YP_583416.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|94310445|ref|YP_583655.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|94311206|ref|YP_584416.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|6562841|emb|CAB62562.1| unnamed protein product [Cupriavidus necator] >gi|93353277|gb|ABF07366.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|93354058|gb|ABF08147.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|93354297|gb|ABF08386.1| transposase, mutator type [Ralstonia metallidurans CH34] >gi|93355058|gb|ABF09147.1| transposase, mutator type [Ralstonia metallidurans CH34] (416 aa)
Score = 299, Expect = 8.8e-26, Identities = 54/134 (40%), Positives = 82/134 (61%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           L K+ IE++L  EM+ HLGY          +N  R GK  KT+ T+ G + +E+PRD + +FEP L+ KH+R     +  I+ +Y++GM+ REIQ    + YG  V  D +S VTD+++ E+  WQ+RPLE +Y
  S:    40 LKKALIERALGGEMNHHLGYSPGAAKPAAVTNQ-RNGKGAKTVLTEDGPIRIEVPRDRDGSFEPLLIPKHERRFTGFDDKIVAMYARGMTVREIQGFLQEQYGTEVSPDFISSVTDEVMAEVTAWQARPLEQMY 172
>gi|110802712|ref|YP_698367.1| ISCpe3, transposase [Clostridium perfringens SM101] >gi|110803360|ref|YP_697957.1| ISCpe3, transposase [Clostridium perfringens SM101] >gi|110683213|gb|ABG86583.1| ISCpe3, transposase [Clostridium perfringens SM101] >gi|110683861|gb|ABG87231.1| ISCpe3, transposase [Clostridium perfringens SM101] (407 aa)
Score = 299, Expect = 9.7e-26, Identities = 61/161 (37%), Positives = 100/161 (62%)
  Q:    22 KEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KE +  E++     VE+    + L+K L K  +++ LD EM+ HLG  K+++ S E S NYR G + KT+ + YG ++++IPRD N  F P  V+K++++ N+ +  II LY++GMSTR+IQ    ++YG  +    +S +TDK+L     WQ+R L+ +Y
  S:     3 KEINYQEEIKNCKSVEDLVGKNGLMKRLFKDVMQQLLDAEMEEHLGRTKYERCSEENSKNYRNGTSNKTVRSSYGDVELDIPRDRNGDFNPVSVKKYKKDCNEFDQKIIGLYARGMSTRDIQSEMEELYGIELSPSAISHITDKVLVAAAEWQNRMLDKVY 163
>gi|50955722|ref|YP_063010.1| transposase, undefined [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50952204|gb|AAT89905.1| transposase, undefined [Leifsonia xyli subsp. xyli str. CTCB07] (192 aa)
Score = 299, Expect = 9.7e-26, Identities = 57/145 (39%), Positives = 91/145 (62%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY--ILLSLLM 189
           L++ LTKS +E  LD E   HLGY K D       N+    ++K  +    G + +E+PR    +FEP++VRKHQR L  ++  I+ L ++G++T EI  +F ++YGA V KD +SR+TDK+  E+ +W +RPL  +Y  + +SL++
  S:    46 LMRALTKSVLETVLDEEFAEHLGYGKHDVAGYHTGNSRNGTRSKTVITDAVGPVVIEVPRGREGSFEPKIVRKHQRRLGQVDEIILSLTARGLTTGEISALFAEIYGASVSKDTISRITDKVSEEMTSWLTRPLGSVYAAVFISLML 192
>gi|134292980|ref|YP_001116716.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134136137|gb|ABO57251.1| transposase, mutator type [Burkholderia vietnamiensis G4] (419 aa)
Score = 298, Expect = 1.1e-25, Identities = 60/148 (40%), Positives = 84/148 (56%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +     L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   LDMYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRASINEQFAALKKAIFERALGGELTHHLGYEKGEAKPVG-RTNHRNGTSRKRIATDNDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLDMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|84622929|ref|YP_450301.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84366869|dbj|BAE68027.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (394 aa)
Score = 298, Expect = 1.2e-25, Identities = 56/153 (36%), Positives = 91/153 (59%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G +  +D + L  ++ +  I +SL+ EM  H+G+    ++      N R GK++KT+ +  G+L +E PR    TF PQLV+K Q     +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:     8 GCKTPQDVEKLFSQMLQHMINRSLEAEMQAHVGHAPHGRSG----GNVRNGKSRKTVQSALGELQIETPRGRAGTFAPQLVKKRQVRPAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 156
>gi|71725316|ref|YP_272269.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71733232|ref|YP_273594.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736400|ref|YP_272992.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737293|ref|YP_276388.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553785|gb|AAZ32996.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556953|gb|AAZ36164.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557846|gb|AAZ37057.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558906|gb|AAZ38115.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 298, Expect = 1.3e-25, Identities = 60/163 (36%), Positives = 95/163 (58%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +  +E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPKE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|161521325|ref|YP_001584752.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161522769|ref|YP_001585698.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189348385|ref|YP_001941581.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] >gi|189352507|ref|YP_001948134.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] >gi|160345375|gb|ABX18460.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160346322|gb|ABX19406.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189336529|dbj|BAG45598.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] >gi|189338523|dbj|BAG47591.1| ISBmu12b transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 298, Expect = 1.3e-25, Identities = 60/148 (40%), Positives = 84/148 (56%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +     L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   LDMYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRASINEQFAALKKAIFERALGGELTHHLGYEKGEAKPVG-RTNHRNGTSRKRIATDNDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLDMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|194565394|ref|YP_002100416.1| Transposase [Burkholderia dolosa AUO158] >gi|124899054|gb|EAY70897.1| Transposase [Burkholderia dolosa AUO158] (334 aa)
Score = 298, Expect = 1.3e-25, Identities = 61/148 (41%), Positives = 86/148 (58%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK +      S N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGEAKPAS-STNHRNGTSRKRIVTDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|170734248|ref|YP_001766195.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169817490|gb|ACA92073.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (415 aa)
Score = 298, Expect = 1.3e-25, Identities = 59/155 (38%), Positives = 95/155 (61%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++LL++L  G  +  +  +L+    K+ IE+++  EM+ HLGY    +      +N R G + KT+ T  G + V++PRD + +FEP L+ KH+R     +  II +Y++GMS REIQ    + YG  V  D +S VTD+++ E L+WQ+RPLE +Y
  S:    27 KELLDQLVKGPMSPAEVQDLMLAFNKAVIERAMGAEMNLHLGYPP-GRPKPPGQDNERNGASGKTVITDRGPVRVDVPRDRDGSFEPILIPKHERRFTGFDERIIAMYARGMSVREIQGFLAEHYGTEVSPDFISSVTDEVMAEALSWQNRPLEPMY 182
>gi|31790976|ref|NP_857611.1| hypothetical protein pEJ30_p02 [Erwinia sp. Ejp 556] >gi|31580582|gb|AAP51293.1| TnpA [Erwinia sp. Ejp 556] (402 aa)
Score = 297, Expect = 1.6e-25, Identities = 63/167 (37%), Positives = 105/167 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TF+PQL++K Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+RPL+ +Y ++ L
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTDHLGHEK---NAPKTGSNTRNGYSSKTLLCDDGEIELSTPRDRENTFQPQLIKKSQTRITQMDSQILSLYAKGMTTREIVATFREMYDADVSPTLISKVTDAVKEQVAEWQTRPLDALYPIVYL 165
>gi|119357032|ref|YP_911676.1| transposase, mutator type [Chlorobium phaeobacteroides DSM 266] >gi|119354381|gb|ABL65252.1| transposase, mutator type [Chlorobium phaeobacteroides DSM 266] (411 aa)
Score = 297, Expect = 1.8e-25, Identities = 68/164 (41%), Positives = 101/164 (61%)
  Q:    19 MAKK-------EKSSAEKLL-EKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           MAKK       +K+  ++L+ E  G +   D   LL +L K FIE++L+ EMD HLGY K        S N R G   KT+     +L++  PRD NSTFEPQL+ K Q+     +  I+ +Y++GMS R++Q + L++Y   V + L+S VTD +L ++  WQSRPL+ +Y
  S:     1 MAKKKAPIPDAQKALIDQLIRESGGPQALFDKGGLLDQLKKRFIEQALEAEMDEHLGYPKHAPMVPN-SGNARNGHGSKTIIVDSDQLEISPPRDRNSTFEPQLIPKRQKRFKGFDEKILAMYARGMSVRDMQAMLLELYEVEVSEALISSVTDTVLDDVRAWQSRPLDRVY 171
>gi|62860881|gb|AAY16474.1| putative transposase [Bifidobacterium breve] (429 aa)
Score = 296, Expect = 2.1e-25, Identities = 58/140 (41%), Positives = 90/140 (64%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNT-KYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D LLK+ TKS +E +LD EM  HLG  K  ++    + N R G T KT+ T   G + +E+PRD + +FEP +VRK QR L  ++  ++ LY++G++  EI   F ++YGA V ++ VSR+T++++ E   W SRPL+ +Y
  S:    47 DGLLKQFTKSVLETALDEEMTEHLGCAKHKKSKDGRAANTRNGTTAKTVVTDSVGPVRIEVPRDRDGSFEPVVVRKRQRRLPGVDEVVLSLYARGLTAGEISAHFQEIYGADVSRETVSRITERVVAEKDEWCSRPLDRVY 187
>gi|83719149|ref|YP_443404.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83652974|gb|ABC37037.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 296, Expect = 2.3e-25, Identities = 65/165 (39%), Positives = 98/165 (59%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  HL  E   +  R  + N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHLAAET--EQGR--AGNHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|83717124|ref|YP_438473.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83650949|gb|ABC35013.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 296, Expect = 2.3e-25, Identities = 65/165 (39%), Positives = 98/165 (59%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  HL  E   +  R  + N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHLAAET--EQGR--AGNHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|83716872|ref|YP_439279.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83650697|gb|ABC34761.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 296, Expect = 2.3e-25, Identities = 65/165 (39%), Positives = 98/165 (59%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  HL  E   +  R  + N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHLAAET--EQGR--AGNHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|71734427|ref|YP_276481.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734976|ref|YP_276211.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735744|ref|YP_276346.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737963|ref|YP_273334.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554980|gb|AAZ34191.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555529|gb|AAZ34740.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556297|gb|AAZ35508.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558516|gb|AAZ37727.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 296, Expect = 2.4e-25, Identities = 60/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71737316|ref|YP_272430.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557869|gb|AAZ37080.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 296, Expect = 2.4e-25, Identities = 60/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71733393|ref|YP_274639.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71733885|ref|YP_275782.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734015|ref|YP_276478.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734629|ref|YP_276931.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734728|ref|YP_274235.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734743|ref|YP_272642.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735601|ref|YP_275727.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735911|ref|YP_273844.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736124|ref|YP_275488.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736596|ref|YP_276279.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736877|ref|YP_274215.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736940|ref|YP_274737.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71736957|ref|YP_274970.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737479|ref|YP_275598.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737662|ref|YP_275160.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737835|ref|YP_274986.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71737912|ref|YP_274374.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71738077|ref|YP_274517.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553946|gb|AAZ33157.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554438|gb|AAZ33649.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554568|gb|AAZ33779.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555182|gb|AAZ34393.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555281|gb|AAZ34492.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555296|gb|AAZ34507.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556154|gb|AAZ35365.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556464|gb|AAZ35675.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556677|gb|AAZ35888.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557149|gb|AAZ36360.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557430|gb|AAZ36641.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557493|gb|AAZ36704.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557510|gb|AAZ36721.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558032|gb|AAZ37243.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558215|gb|AAZ37426.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558388|gb|AAZ37599.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558465|gb|AAZ37676.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558630|gb|AAZ37841.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 296, Expect = 2.4e-25, Identities = 60/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71737692|ref|YP_277275.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558245|gb|AAZ37456.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 296, Expect = 2.4e-25, Identities = 60/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71733357|ref|YP_277022.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553910|gb|AAZ33121.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 296, Expect = 2.4e-25, Identities = 60/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|83721043|ref|YP_443633.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83654868|gb|ABC38931.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 295, Expect = 2.5e-25, Identities = 65/165 (39%), Positives = 98/165 (59%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  HL  E   +  R  + N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHLAAET--EQGR--AGNHRNGTSPKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|170722481|ref|YP_001750169.1| transposase mutator type [Pseudomonas putida W619] >gi|169760484|gb|ACA73800.1| transposase mutator type [Pseudomonas putida W619] (415 aa)
Score = 295, Expect = 2.8e-25, Identities = 62/155 (40%), Positives = 91/155 (58%)
  Q:    28 EKLLEKLG--VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++LLE+ G  +   E  ++      K+ IE++L  E+  HLGY    Q   E   N R GK+ KT+ T  G L +EIPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD+++ EI TWQ RPLE +Y
  S:    16 KELLEQFGEGLMTAEAIEDASAAFKKALIERALHAELGHHLGYPPGAQRP-EDETNQRNGKSGKTVLTGDGPLRLEIPRDRDGSFAPILIPKHERRYTGFDDKIIAMYARGMTVREIRAFLSEQYGTEVSPDFISSVTDEVMEEIGTWQQRPLEPMY 171
>gi|16519908|ref|NP_444028.1| Y4pO [Rhizobium sp. NGR234] >gi|2501307|sp|P55620|Y4PO_RHISN Probable transposase for insertion sequence element ISRM3-like >gi|2182585|gb|AAB91825.1| Y4pO [Rhizobium sp. NGR234] (400 aa)
Score = 295, Expect = 2.9e-25, Identities = 66/158 (41%), Positives = 99/158 (62%)
  Q:    28 EKLLEKL--GVENKEDF--DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           ++LL++L  G +  E F  D LL +L K+  E+ L+ E+D HL  E+    S   + N R G +KKT+ T   K+ + IPRD   TF+P+L+ ++QR   D +  II +Y++GM+ REIQ    D+YG  V  DL+S VTD++L  +  WQ+RPLE  Y L+
  S:     5 KELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELDEHLDVER----SEGTAANRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDDKIISMYARGMTVREIQGHLEDIYGIDVSPDLISAVTDQVLEAVGEWQNRPLELCYPLV 162
>gi|161523536|ref|YP_001578548.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189351692|ref|YP_001947320.1| ISBmu12e transposase [Burkholderia multivorans ATCC 17616] >gi|160340965|gb|ABX14051.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189335714|dbj|BAG44784.1| ISBmu12e transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 295, Expect = 3.0e-25, Identities = 60/148 (40%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGEAKPVG-RTNHRNGTSRKRIATDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|161521267|ref|YP_001584694.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189352561|ref|YP_001948188.1| ISBmu12a transposase [Burkholderia multivorans ATCC 17616] >gi|160345317|gb|ABX18402.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189336583|dbj|BAG45652.1| ISBmu12a transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 295, Expect = 3.0e-25, Identities = 59/148 (39%), Positives = 84/148 (56%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +     L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRASINEQFAALKKAIFERALGGELTHHLGYEKGEAKPAG-RTNHRNGTSRKRIATDNDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|161526105|ref|YP_001581117.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189349181|ref|YP_001944809.1| ISBmu12d transposase [Burkholderia multivorans ATCC 17616] >gi|160343534|gb|ABX16620.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189333203|dbj|BAG42273.1| ISBmu12d transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 295, Expect = 3.0e-25, Identities = 60/148 (40%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGEAKPVG-RTNHRNGTSRKRIATDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|170733132|ref|YP_001765079.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169816374|gb|ACA90957.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (419 aa)
Score = 294, Expect = 3.3e-25, Identities = 60/148 (40%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGEAKPGG-RTNHRNGTSRKRVATDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|170733128|ref|YP_001765075.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|169816370|gb|ACA90953.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (419 aa)
Score = 294, Expect = 3.3e-25, Identities = 60/148 (40%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGEAKPGG-RTNHRNGTSRKRVATDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|118617997|ref|YP_906329.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] >gi|118570107|gb|ABL04858.1| transposase for IS2606 [Mycobacterium ulcerans Agy99] (462 aa)
Score = 294, Expect = 3.3e-25, Identities = 57/138 (41%), Positives = 89/138 (64%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSR------------------VTDKILPEILTWQSRPLEDIY 182
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++  ++ LY++G++T EI   F  +Y A V KD VSR                  +TD++L E+  W +RPLE +Y
  S:    59 LLKAMTKTVIETALDEELSEHLGYDRHDRAGYGNGNSRNGTRSKTVLTDGCGSIEIDVPRDRAGTFEPKIVEKRQRRLTDVDEVVLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDRVLYDAAVSKDTVSRITDRVLEEMTAWHTRPLERVY 214
>gi|194437962|ref|ZP_03070056.1| IS1414, transposase [Escherichia coli 101-1] >gi|194423183|gb|EDX39176.1| IS1414, transposase [Escherichia coli 101-1] (398 aa)
Score = 294, Expect = 3.5e-25, Identities = 63/162 (38%), Positives = 101/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           K+ ++ A +L + L   E+   FD LLK+++   +E +L+ EM  H GYEK   N      N R G + KT+ T  G L++  PRD + TFEPQ V+K+Q  +  +++ I+ LY+KGM+TREI   F ++Y A +   L+S+VTD ++ +++ WQ+RPL  +Y
  S:     4 KQLQALANELAKNLKTPEDLSQFDRLLKKIS---VEAALNAEMTHHPGYEK---NQSRPGTNSRNGYSTKTIITGDGPLELRTPRDRDGTFEPQRVKKNQTRITGMDNQILSLYAKGMTTREIAAAFKELYDADISPALISKVTDAMMEQVVEWQNRPLGAVY 160
>gi|161521343|ref|YP_001584770.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189352490|ref|YP_001948117.1| ISBmu12c transposase [Burkholderia multivorans ATCC 17616] >gi|4128219|gb|AAD03556.1| transposase [Burkholderia cepacia] >gi|160345393|gb|ABX18478.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189336512|dbj|BAG45581.1| ISBmu12c transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 294, Expect = 3.8e-25, Identities = 59/148 (39%), Positives = 84/148 (56%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +     L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRASINEQFAALKKAIFERALGGELTHHLGYEKGEAKPVG-RTNHRNGTSRKRIATDNDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|161524088|ref|YP_001579100.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189351152|ref|YP_001946780.1| ISBmu12f transposase [Burkholderia multivorans ATCC 17616] >gi|160341517|gb|ABX14603.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189335174|dbj|BAG44244.1| ISBmu12f transposase [Burkholderia multivorans ATCC 17616] (419 aa)
Score = 293, Expect = 4.2e-25, Identities = 60/148 (40%), Positives = 85/148 (57%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +  L  L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRATINEQLAALKKAIFERALGGELTHHLGYEKGEAKPVG-RTNHRNGTSRKRIATDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|73539864|ref|YP_294384.1| transposase [Ralstonia eutropha JMP134] >gi|73540274|ref|YP_294794.1| transposase [Ralstonia eutropha JMP134] >gi|73540344|ref|YP_294864.1| transposase [Ralstonia eutropha JMP134] >gi|73541887|ref|YP_296407.1| transposase [Ralstonia eutropha JMP134] >gi|72117277|gb|AAZ59540.1| Transposase, mutator type [Ralstonia eutropha JMP134] >gi|72117687|gb|AAZ59950.1| Transposase, mutator type [Ralstonia eutropha JMP134] >gi|72117757|gb|AAZ60020.1| Transposase, mutator type [Ralstonia eutropha JMP134] >gi|72119300|gb|AAZ61563.1| Transposase, mutator type [Ralstonia eutropha JMP134] (419 aa)
Score = 293, Expect = 4.6e-25, Identities = 55/132 (41%), Positives = 82/132 (62%)
  Q:    51 KSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           K+ IE++L  E+  HLGY    +     +N  R GK+ KT+ T  G L V+IPRD + +F+P L+ KH+R     +  II +Y++GM+ REIQ    + YG  V  + +S VTD ++ E++TWQSRPLE +Y
  S:    45 KALIERALGAELGHHLGYPAGAERPAGTANQ-RNGKSAKTVLTDDGPLRVDIPRDRDGSFDPILIPKHERRFTGFDDKIIAMYARGMTVREIQAFLAEQYGTEVSPEFISSVTDAVMDEVITWQSRPLEVMY 175
>gi|1477486|gb|AAC44170.1| transposase [Burkholderia cepacia] (419 aa)
Score = 293, Expect = 5.1e-25, Identities = 58/148 (39%), Positives = 84/148 (56%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +     L K+  E++L  E+  HLGYEK D        N+R G ++K + T    LD+EIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  + +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRASINEQFAALKKAIFERALGGELTHHLGYEKGDAKPAG-RTNHRNGTSRKRIATDDDLLDIEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPEFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|114331699|ref|YP_747921.1| transposase, mutator type [Nitrosomonas eutropha C91] >gi|114308713|gb|ABI59956.1| transposase, mutator type [Nitrosomonas eutropha C91] (225 aa)
Score = 293, Expect = 5.3e-25, Identities = 58/130 (44%), Positives = 83/130 (63%)
  Q:    54 IEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYI 183
           +++SL+      LGY + D   R  S+N R G + K L   +GK+ +E+PRD   TFEPQ+VRK Q  L  ++  I+ LY+KGMSTR+I D F +MY A V   LVS+VT+++L  +  WQ+R L+DI I
  S:     1 MKQSLEPSWTSILGYARHDPAGRG-SDNRRNGTSSKQLKGAHGKVGIEVPRDRAGTFEPQIVRKGQTRLTQMDDQILALYAKGMSTRDIVDAFREMYDADVSPTLVSKVTERVLDAVTEWQNRGLQDILI 129
>gi|71735230|ref|YP_272359.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555783|gb|AAZ34994.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 293, Expect = 5.4e-25, Identities = 54/132 (40%), Positives = 81/132 (61%)
  Q:    51 KSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           K+ IE++L  E+  HLGY +  +  +E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    45 KALIERALGAELGHHLGYPQGAERPKE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|148243735|ref|YP_001219975.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400298|gb|ABQ28833.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 293, Expect = 5.5e-25, Identities = 55/142 (38%), Positives = 88/142 (61%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +L+  L K+  E++L  EMD HL  E   +NSR        G  +K+++T  GK+++ IPRD   +F+PQL+ K+QR     +  II +Y++GMSTREI +   ++YG     +L+S +TD +L E+ +WQ RPL+ +Y L+
  S:    31 DLVNALKKALAERALSAEMDYHLSDEAEAENSR-------NGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYPLV 165
>gi|148243766|ref|YP_001220006.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400329|gb|ABQ28864.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 292, Expect = 5.9e-25, Identities = 55/142 (38%), Positives = 88/142 (61%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +L+  L K+  E++L  EMD HL  E   +NSR        G  +K+++T  GK+++ IPRD   +F+PQL+ K+QR     +  II +Y++GMSTREI +   ++YG     +L+S +TD +L E+ +WQ RPL+ +Y L+
  S:    31 DLVNALKKALAERALSAEMDYHLSDEAEAENSR-------NGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYPLV 165
>gi|148259816|ref|YP_001233943.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146401497|gb|ABQ30024.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 292, Expect = 6.2e-25, Identities = 55/142 (38%), Positives = 88/142 (61%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +L+  L K+  E++L  EMD HL  E   +NSR        G  +K+++T  GK+++ IPRD   +F+PQL+ K+QR     +  II +Y++GMSTREI +   ++YG     +L+S +TD +L E+ +WQ RPL+ +Y L+
  S:    31 DLVNTLKKALAERALSAEMDYHLSDEAEAENSR-------NGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYPLV 165
>gi|53802661|ref|YP_112568.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] >gi|53804473|ref|YP_113683.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] >gi|53756422|gb|AAU90713.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] >gi|53758234|gb|AAU92525.1| ISMca5, transposase [Methylococcus capsulatus str. Bath] (411 aa)
Score = 292, Expect = 6.8e-25, Identities = 53/134 (39%), Positives = 81/134 (60%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           L K+ IE++L  E+  HLGY        + +N  R GK+ KT+ T+ G L +E+PRD   +FEP L+ KH+R     +  I+ +Y++GM+ REIQ    + YG  V  + +S VTD+++ E+  WQ RPLE +Y
  S:    45 LKKALIERALGAELSYHLGYPPGSARPEDAANQ-RNGKSAKTVLTQDGPLRIEVPRDRAGSFEPILIPKHERRFTGFDDKIVAMYARGMTVREIQGFLAEQYGTEVSPEFISCVTDEVMAEVTAWQGRPLEPMY 177
>gi|148259788|ref|YP_001233915.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146401469|gb|ABQ29996.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 292, Expect = 7.1e-25, Identities = 55/142 (38%), Positives = 88/142 (61%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +L+  L K+  E++L  EMD HL  E   +NSR        G  +K+++T  GK+++ IPRD   +F+PQL+ K+QR     +  II +Y++GMSTREI +   ++YG     +L+S +TD +L E+ +WQ RPL+ +Y L+
  S:    31 DLVNTLKKALAERALSAEMDYHLSDEAEAENSR-------NGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYPLV 165
>gi|71735405|ref|YP_274647.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735909|ref|YP_274386.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555958|gb|AAZ35169.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556462|gb|AAZ35673.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 291, Expect = 8.0e-25, Identities = 59/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ I+++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIKRALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|108793603|ref|YP_636759.1| transposase [Yersinia pestis Antiqua] >gi|167402259|ref|ZP_02307730.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|108782150|gb|ABG16207.1| transposase [Yersinia pestis Antiqua] >gi|167048361|gb|EDR59769.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] (402 aa)
Score = 291, Expect = 8.3e-25, Identities = 63/162 (38%), Positives = 103/162 (63%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++N+ D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKNEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|54310846|gb|AAV33659.1| TnpA [Comamonas sp. JS46] (411 aa)
Score = 291, Expect = 8.8e-25, Identities = 52/132 (39%), Positives = 80/132 (60%)
  Q:    51 KSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           K+ IE++L  EM  HLGY        E + N+R G++ KT+ T+ G L +E+PRD   +FEP L+ KH+R     +  II +Y++GM+ REI+    + Y   V  + +S VTD+++ E+  WQ RPLE +Y
  S:    41 KALIERALGAEMSHHLGYPPGAARPEE-AGNHRNGRSAKTVLTEDGPLRIEVPRDRQGSFEPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLAEQYATEVSPEFISSVTDEVMAEVTAWQGRPLEPMY 171
>gi|172060861|ref|YP_001808513.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|172065068|ref|YP_001815780.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|171993378|gb|ACB64297.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|171997310|gb|ACB68227.1| transposase mutator type [Burkholderia ambifaria MC40-6] (416 aa)
Score = 290, Expect = 1.0e-24, Identities = 57/154 (37%), Positives = 91/154 (59%)
  Q:    29 KLLEKLG--VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +LLE+ G      E  +     L K+ IE++L  EM+ HLGY          +N  R G+  KT+ T+ G + +E+PRD + +FEP L+ KH+R     +  I+ +Y++GM+ REIQ   L+ YG  V  + +S VTD+++ E+  W++RPLE +Y
  S:    18 ELLEQFGNGPMTAEAINAATLALKKALIERALGGEMNHHLGYAPGAAKPASVTNQ-RNGRGAKTVLTEDGPIRIEVPRDRDGSFEPLLIPKHERRFTGFDDKIVAMYARGMTVREIQGFVLEQYGTEVSPEFISSVTDEVVAEVTAWRARPLEPMY 172
>gi|26246249|ref|NP_752288.1| transposase [Escherichia coli CFT073] >gi|26106647|gb|AAN78832.1|AE016756_15 Putative Transposase within prophage [Escherichia coli CFT073] (374 aa)
Score = 290, Expect = 1.0e-24, Identities = 57/139 (41%), Positives = 91/139 (65%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KT+    G++++  PRD  +TFEPQL++KHQ  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+RPL+ +Y ++ L
  S:     2 LTKLTVETALNAELTDHLGHEK---NAPKSGSNTRNGYSSKTVLCDDGEIELNTPRDRENTFEPQLIKKHQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVSEWQNRPLDALYPIVYL 137
>gi|695779|emb|CAA55110.1| unnamed protein product [Yersinia pestis] (270 aa)
Score = 290, Expect = 1.2e-24, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|108807256|ref|YP_651172.1| hypothetical protein YPA_1260 [Yersinia pestis Antiqua] >gi|108812402|ref|YP_648169.1| hypothetical protein YPN_2241 [Yersinia pestis Nepal516] >gi|145598535|ref|YP_001162611.1| hypothetical protein YPDSF_1243 [Yersinia pestis Pestoides F] >gi|167467989|ref|ZP_02332693.1| hypothetical protein YpesF_08839 [Yersinia pestis FV-1] >gi|186895262|ref|YP_001872374.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|108776050|gb|ABG18569.1| hypothetical protein YPN_2241 [Yersinia pestis Nepal516] >gi|108779169|gb|ABG13227.1| hypothetical protein YPA_1260 [Yersinia pestis Antiqua] >gi|145210231|gb|ABP39638.1| hypothetical protein YPDSF_1243 [Yersinia pestis Pestoides F] >gi|186698288|gb|ACC88917.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] (286 aa)
Score = 290, Expect = 1.2e-24, Identities = 63/167 (37%), Positives = 106/167 (63%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEP+L++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+RPL+ +Y ++ L
  S:     4 KKLKALAAELAK--GLKTEADLNVFSRMLTKLTVETALNAELTEHLGHEK---NTPKTGSNTRNGYSSKTLLCDDGEIELSTPRDSENTFEPKLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVTEWQNRPLDALYPIVYL 165
>gi|82913654|ref|XP_728730.1| transposase [Plasmodium yoelii yoelii str. 17XNL] >gi|23485229|gb|EAA20295.1| transposase, Mutator family [Plasmodium yoelii yoelii] (411 aa)
Score = 290, Expect = 1.2e-24, Identities = 53/134 (39%), Positives = 80/134 (59%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           L K+ IE++L  E+  HLGY        + +N  R GK+ KT+ T  G L +E+PRD   +FEP L+ KH+R     +  I+ +Y++GM+ REIQ    + YG  V  + +S VTD+++ E+  WQ RPLE +Y
  S:    45 LKKALIERALGAELSYHLGYPPGSARPEDAANQ-RNGKSAKTVLTXDGPLRIEVPRDRAGSFEPILIPKHERRFTGFDDKIVAMYARGMTVREIQGXLAEQYGTEVSPEFISCVTDEVMAEVTAWQGRPLEPMY 177
>gi|148262327|ref|YP_001229033.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148264923|ref|YP_001231629.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265724|ref|YP_001232430.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146395827|gb|ABQ24460.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146398423|gb|ABQ27056.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399224|gb|ABQ27857.1| transposase, mutator type [Geobacter uraniireducens Rf4] (404 aa)
Score = 289, Expect = 1.3e-24, Identities = 57/140 (40%), Positives = 90/140 (64%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           + LLK+LTK+ ++++L  EM  HLG+EK    S +   N R G + KT+   +G + +E+PRD +S+FEP ++ K Q    + +  II LYS+G++TREIQ    ++YG  V   L+S VT+ +  E+ TWQ+RPL+ +Y
  S:    25 NGLLKQLTKAVLQRALQAEMTLHLGHEKHASVSAK-GGNARNGSSAKTIKGDFGTMPIEVPRDRDSSFEPVIIPKGQTRFAEFDDKIISLYSRGLTTREIQGHLEEIYGVEVSPALISIVTEAVAEEVKTWQNRPLDALY 163
>gi|83718984|ref|YP_443738.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83652809|gb|ABC36872.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 289, Expect = 1.3e-24, Identities = 64/165 (38%), Positives = 97/165 (58%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  H   E   +  R  + N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHPAAET--EQGR--AGNHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|71734517|ref|YP_273759.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555070|gb|AAZ34281.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 289, Expect = 1.3e-24, Identities = 59/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E + N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERP-EGATNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71736612|ref|YP_273622.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557165|gb|AAZ36376.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 289, Expect = 1.3e-24, Identities = 59/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E + N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERP-EGATNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71733412|ref|YP_276857.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71733651|ref|YP_273104.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734946|ref|YP_274130.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735807|ref|YP_276836.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71553965|gb|AAZ33176.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554204|gb|AAZ33415.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555499|gb|AAZ34710.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556360|gb|AAZ35571.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 289, Expect = 1.3e-24, Identities = 59/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E + N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERP-EGATNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71736568|ref|YP_272917.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71557121|gb|AAZ36332.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 289, Expect = 1.4e-24, Identities = 59/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +  +E S N R GK+ KT+ T  G L ++IPRD + +F   L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPKE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFASILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71733459|ref|YP_272361.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554012|gb|AAZ33223.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 289, Expect = 1.4e-24, Identities = 59/163 (36%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +  +E S N R GK+ KT+ T  G L ++IPRD + +F   L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPKE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFASILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|83719319|ref|YP_442869.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83653144|gb|ABC37207.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 289, Expect = 1.6e-24, Identities = 64/165 (38%), Positives = 97/165 (58%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  H   E   +  R  + N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHPAAET--EQGR--AGNHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|148259307|ref|YP_001233434.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400988|gb|ABQ29515.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 288, Expect = 1.9e-24, Identities = 55/142 (38%), Positives = 87/142 (61%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +L+  L K+  E++L  EMD HL  E   +NSR        G  +K+++T  GK+++ IPRD   +F+PQL+ K QR     +  II +Y++GMSTREI +   ++YG     +L+S +TD +L E+ +WQ RPL+ +Y L+
  S:    31 DLVNALKKALAERALSAEMDYHLSDEAEAENSR-------NGYGRKSVSTGTGKIEIAIPRDRAGSFDPQLIAKCQRRFPGFDDKIISMYARGMSTREIAEHLREIYGMDASAELISTITDAVLDEVTSWQQRPLDPVYPLV 165
>gi|68536874|ref|YP_251579.1| transposase for IS3525 [Corynebacterium jeikeium K411] >gi|68264473|emb|CAI37961.1| transposase for IS3525 [Corynebacterium jeikeium K411] (275 aa)
Score = 288, Expect = 2.0e-24, Identities = 56/159 (35%), Positives = 98/159 (61%)
  Q:    29 KLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREF--SNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           KL++ LG     D ++L++ + ++ I + L+ EMD +LGYE  D++++    ++NYR G   KT+++ YG + V++PRD   TF P +V K  R L D++  I+ LY+ GM+ R+IQ          +  + +S VTD +L E++ WQ+R L++ Y ++ L
  S:    30 KLIDDLGTSTT-DANDLVRGMLQASITRGLNAEMDAYLGYESGDRSAKAAAGTDNYRNGSYPKTVDSNYGPVTVDVPRDRAGTFLPTMVPKGSRRLTDVDDMIVSLYAGGMTIRDIQHHMATAMRVDISHETISAVTDAVLDEVMIWQNRQLDEFYPVIFL 189
>gi|170736824|ref|YP_001778084.1| transposase mutator type [Burkholderia cenocepacia MC0-3] >gi|194560443|ref|YP_002095468.1| Transposase, mutator type [Burkholderia cenocepacia PC184] >gi|124875959|gb|EAY65949.1| Transposase, mutator type [Burkholderia cenocepacia PC184] >gi|169819012|gb|ACA93594.1| transposase mutator type [Burkholderia cenocepacia MC0-3] (416 aa)
Score = 288, Expect = 2.0e-24, Identities = 53/134 (39%), Positives = 80/134 (59%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           L K+ IE++L  EM  HLGY          +N  R G   KT+ T+ G + +E+PRD + +FEP L+ KH+R     +  I+ +Y++GM+ REIQ    + YG  V  D +S VTD+++ E+  WQ+RPLE +Y
  S:    40 LKKALIERALGGEMSHHLGYPPGAAKPGAVTNQ-RNGSGAKTVLTEDGPIRIEVPRDRDGSFEPLLIPKHERRFTGFDDKIVAMYARGMTVREIQGFLQEQYGTEVSPDFISSVTDEVMVEVTAWQARPLEPMY 172
>gi|134292999|ref|YP_001116735.1| transposase, mutator type [Burkholderia vietnamiensis G4] >gi|134136156|gb|ABO57270.1| transposase, mutator type [Burkholderia vietnamiensis G4] (235 aa)
Score = 287, Expect = 2.1e-24, Identities = 59/148 (39%), Positives = 84/148 (56%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G  ++   +     L K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS REIQ   L+MYG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    30 GTLDRASINEQFAALKKAIFERALGGELTHHLGYEKGEAKPAG-RTNHRNGTSRKRIATDNDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDKIIAMYARGMSVREIQGFLLEMYGIEVSPDFISTVTDAVIDEVREWQQRPLEPMY 176
>gi|108807939|ref|YP_651855.1| putative transposase [Yersinia pestis Antiqua] >gi|108779852|gb|ABG13910.1| putative transposase [Yersinia pestis Antiqua] (270 aa)
Score = 287, Expect = 2.3e-24, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|83720568|ref|YP_442870.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83654393|gb|ABC38456.1| transposase, Mutator family [Burkholderia thailandensis E264] (252 aa)
Score = 287, Expect = 2.4e-24, Identities = 64/165 (38%), Positives = 97/165 (58%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  HL  E      +  + N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHLAAE----TEQGRAGNHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|71733944|ref|YP_275394.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554497|gb|AAZ33708.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 287, Expect = 2.6e-24, Identities = 59/163 (36%), Positives = 93/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F   L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFASILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|46323|emb|CAA45248.1| transposase [Sinorhizobium meliloti] (400 aa)
Score = 287, Expect = 2.7e-24, Identities = 65/163 (39%), Positives = 97/163 (59%)
  Q:    23 EKSSAEKLLEKLGVENKEDF--DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           EK   ++LL  +G +  E F  D LL +L K+  E+ L+ E+D HL  E+ +        N R G +KKT+ T   K+ + IPRD   TF+P+L+ ++QR   D +  II +Y++GM+ REIQ    ++YG  V  DL+S VTD +L  +  WQ+RPLE  Y L+
  S:     4 EKELLDQLL--VGRDPSEVFGKDGLLDDLKKALSERILNAELDDHLDVERLEGGPA----NRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDDKIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYPLV 162
>gi|15963917|ref|NP_384270.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15965775|ref|NP_386128.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15966732|ref|NP_387085.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|16262658|ref|NP_435451.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|16262693|ref|NP_435486.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|16262808|ref|NP_435601.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|16263195|ref|NP_435988.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|136132|sp|P80011|TRA3_RHIME Transposase for insertion sequence element ISRM3 >gi|149112|gb|AAA98142.1| transposase [Sinorhizobium meliloti] >gi|14523278|gb|AAK64863.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|14523317|gb|AAK64898.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|14523442|gb|AAK65013.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|14523863|gb|AAK65400.1| TRm3 transposase [Sinorhizobium meliloti 1021] >gi|15073092|emb|CAC41551.1| Transposase for insertion sequence element ISRm3 [Sinorhizobium meliloti 1021] >gi|15075044|emb|CAC46601.1| Transposase for insertion sequence element ISRm3 [Sinorhizobium meliloti 1021] >gi|15076004|emb|CAC47558.1| Transposase for insertion sequence element ISRm3 [Sinorhizobium meliloti 1021] (400 aa)
Score = 286, Expect = 3.0e-24, Identities = 64/158 (40%), Positives = 97/158 (61%)
  Q:    28 EKLLEKL--GVENKEDF--DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           ++LL++L  G +  E F  D LL +L K+  E+ L+ E+D HL  E+ +        N R G +KKT+ T   K+ + IPRD   TF+P+L+ ++QR   D +  II +Y++GM+ REIQ    ++YG  V  DL+S VTD +L  +  WQ+RPLE  Y L+
  S:     5 KELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELDDHLDVERLEGGPA----NRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDDKIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYPLV 162
>gi|148262191|ref|YP_001228897.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148264212|ref|YP_001230918.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148264600|ref|YP_001231306.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265131|ref|YP_001231837.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265685|ref|YP_001232391.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265723|ref|YP_001232429.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148265933|ref|YP_001232639.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|148266091|ref|YP_001232797.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146395691|gb|ABQ24324.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146397712|gb|ABQ26345.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146398100|gb|ABQ26733.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146398631|gb|ABQ27264.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399185|gb|ABQ27818.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399223|gb|ABQ27856.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399433|gb|ABQ28066.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146399591|gb|ABQ28224.1| transposase, mutator type [Geobacter uraniireducens Rf4] (404 aa)
Score = 286, Expect = 3.1e-24, Identities = 56/140 (40%), Positives = 89/140 (63%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           + LLK+LTK+ ++++L  EM  HLG+EK    S +   N R G + KT+   +G + +E+PRD +S+FEP ++ K Q    + +  II LYS+G++TREIQ    ++YG  V   L+S VT+ +  E+  WQ+RPL+ +Y
  S:    25 NGLLKQLTKAVLQRALQAEMTLHLGHEKHASVSAK-GGNARNGSSAKTIKGDFGTMPIEVPRDRDSSFEPVIIPKGQTRFAEFDDKIISLYSRGLTTREIQGHLEEIYGVEVSPALISIVTEAVAEEVKAWQNRPLDALY 163
>gi|148262189|ref|YP_001228895.1| transposase, mutator type [Geobacter uraniireducens Rf4] >gi|146395689|gb|ABQ24322.1| transposase, mutator type [Geobacter uraniireducens Rf4] (393 aa)
Score = 286, Expect = 3.2e-24, Identities = 56/140 (40%), Positives = 89/140 (63%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           + LLK+LTK+ ++++L  EM  HLG+EK    S +   N R G + KT+   +G + +E+PRD +S+FEP ++ K Q    + +  II LYS+G++TREIQ    ++YG  V   L+S VT+ +  E+  WQ+RPL+ +Y
  S:    25 NGLLKQLTKAVLQRALQAEMTLHLGHEKHASVSAK-GGNARNGSSAKTIKGDFGTMPIEVPRDRDSSFEPVIIPKGQTRFAEFDDKIISLYSRGLTTREIQGHLEEIYGVEVSPALISIVTEAVAEEVKAWQNRPLDALY 163
>gi|108812063|ref|YP_647830.1| transposase [Yersinia pestis Nepal516] >gi|108775711|gb|ABG18230.1| transposase [Yersinia pestis Nepal516] (402 aa)
Score = 286, Expect = 3.3e-24, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|16082872|ref|NP_395426.1| putative transposase [Yersinia pestis CO92] >gi|16120364|ref|NP_403677.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121766|ref|NP_405079.1| transposase [Yersinia pestis CO92] >gi|16121832|ref|NP_405145.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121852|ref|NP_405165.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121857|ref|NP_405170.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121889|ref|NP_405202.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16121986|ref|NP_405299.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122230|ref|NP_405543.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122342|ref|NP_405655.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122371|ref|NP_405684.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122402|ref|NP_405715.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122424|ref|NP_405737.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122668|ref|NP_405981.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122788|ref|NP_406101.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122864|ref|NP_406177.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122987|ref|NP_406300.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16122998|ref|NP_406311.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16123054|ref|NP_406367.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16123126|ref|NP_406439.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|16124008|ref|NP_407321.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|22124269|ref|NP_667692.1| transposase [Yersinia pestis KIM] >gi|22125036|ref|NP_668459.1| transposase [Yersinia pestis KIM] >gi|22125270|ref|NP_668693.1| transposase [Yersinia pestis KIM] >gi|22125439|ref|NP_668862.1| transposase [Yersinia pestis KIM] >gi|22125511|ref|NP_668934.1| transposase [Yersinia pestis KIM] >gi|22125637|ref|NP_669060.1| transposase [Yersinia pestis KIM] >gi|22125642|ref|NP_669065.1| transposase [Yersinia pestis KIM] >gi|22125675|ref|NP_669098.1| transposase [Yersinia pestis KIM] >gi|22125782|ref|NP_669205.1| transposase [Yersinia pestis KIM] >gi|22126039|ref|NP_669462.1| transposase [Yersinia pestis KIM] >gi|22126071|ref|NP_669494.1| transposase [Yersinia pestis KIM] >gi|22126097|ref|NP_669520.1| transposase [Yersinia pestis KIM] >gi|22126208|ref|NP_669631.1| transposase [Yersinia pestis KIM] >gi|22126461|ref|NP_669884.1| transposase [Yersinia pestis KIM] >gi|22126487|ref|NP_669910.1| transposase [Yersinia pestis KIM] >gi|22126554|ref|NP_669977.1| transposase [Yersinia pestis KIM] >gi|31795243|ref|NP_857700.1| transposase [Yersinia pestis KIM] >gi|31795392|ref|NP_857845.1| transposase [Yersinia pestis KIM] >gi|45440804|ref|NP_992343.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45440984|ref|NP_992523.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441208|ref|NP_992747.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441514|ref|NP_993053.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441563|ref|NP_993102.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441611|ref|NP_993150.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441623|ref|NP_993162.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441639|ref|NP_993178.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441740|ref|NP_993279.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45441794|ref|NP_993333.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442024|ref|NP_993563.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442057|ref|NP_993596.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442223|ref|NP_993762.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442348|ref|NP_993887.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442525|ref|NP_994064.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442619|ref|NP_994158.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45442719|ref|NP_994258.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45443233|ref|NP_994772.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45478710|ref|NP_995566.1| transposase [Yersinia pestis biovar Microtus str. 91001] >gi|51594542|ref|YP_068733.1| putative transposase for IS285 insertion element [Yersinia pseudotuberculosis IP 32953] >gi|51595054|ref|YP_069245.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51595127|ref|YP_069318.1| putative transposase-like protein [Yersinia pseudotuberculosis IP 32953] >gi|51596422|ref|YP_070613.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51597611|ref|YP_071802.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|52788138|ref|YP_093966.1| putative transposase [Yersinia pestis] >gi|108793807|ref|YP_636652.1| transposase [Yersinia pestis Nepal516] >gi|108806141|ref|YP_650057.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108806786|ref|YP_650702.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108806853|ref|YP_650769.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108806877|ref|YP_650793.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807097|ref|YP_651013.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807366|ref|YP_651282.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807491|ref|YP_651407.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807523|ref|YP_651439.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807548|ref|YP_651464.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807786|ref|YP_651702.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807897|ref|YP_651813.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108807941|ref|YP_651857.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808127|ref|YP_652043.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808296|ref|YP_652212.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808376|ref|YP_652292.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808523|ref|YP_652439.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108808536|ref|YP_652452.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108810254|ref|YP_646021.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811207|ref|YP_646974.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811438|ref|YP_647205.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811631|ref|YP_647398.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811739|ref|YP_647506.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811768|ref|YP_647535.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811799|ref|YP_647566.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811824|ref|YP_647591.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811895|ref|YP_647662.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108811933|ref|YP_647700.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812171|ref|YP_647938.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812201|ref|YP_647968.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812206|ref|YP_647973.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812557|ref|YP_648324.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812580|ref|YP_648347.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812646|ref|YP_648413.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108812968|ref|YP_648735.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|145597155|ref|YP_001154619.1| transposase [Yersinia pestis Pestoides F] >gi|145597268|ref|YP_001154738.1| transposase [Yersinia pestis Pestoides F] >gi|145597287|ref|YP_001154757.1| transposase [Yersinia pestis Pestoides F] >gi|145597366|ref|YP_001161441.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598008|ref|YP_001162084.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598237|ref|YP_001162313.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598256|ref|YP_001162332.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598261|ref|YP_001162337.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598430|ref|YP_001162506.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598450|ref|YP_001162526.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598499|ref|YP_001162575.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145598701|ref|YP_001162777.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599003|ref|YP_001163079.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599108|ref|YP_001163184.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599144|ref|YP_001163220.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599326|ref|YP_001163402.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599484|ref|YP_001163560.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599762|ref|YP_001163838.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145599951|ref|YP_001164027.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145600358|ref|YP_001164434.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|149192809|ref|YP_001294040.1| putative transposase [Yersinia pestis CA88-4125] >gi|149365190|ref|ZP_01887225.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365257|ref|ZP_01887292.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365267|ref|ZP_01887302.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365322|ref|ZP_01887357.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365450|ref|ZP_01887485.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365524|ref|ZP_01887559.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365644|ref|ZP_01887679.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365885|ref|ZP_01887920.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365907|ref|ZP_01887942.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365938|ref|ZP_01887973.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149365968|ref|ZP_01888003.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366081|ref|ZP_01888116.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366319|ref|ZP_01888353.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366414|ref|ZP_01888448.1| transposase [Yersinia pestis CA88-4125] >gi|149366480|ref|ZP_01888514.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366500|ref|ZP_01888534.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366505|ref|ZP_01888539.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149366537|ref|ZP_01888571.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|150260925|ref|ZP_01917653.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|153997071|ref|ZP_02022204.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|162417845|ref|YP_001604621.1| IS256 family transposase [Yersinia pestis Angola] >gi|162418218|ref|YP_001605010.1| IS285, transposase [Yersinia pestis Angola] >gi|162418255|ref|YP_001607206.1| IS285, transposase [Yersinia pestis Angola] >gi|162418320|ref|YP_001606767.1| IS285, transposase [Yersinia pestis Angola] >gi|162418742|ref|YP_001606376.1| IS285, transposase [Yersinia pestis Angola] >gi|162418970|ref|YP_001606759.1| IS285, transposase [Yersinia pestis Angola] >gi|162419053|ref|YP_001606599.1| IS285, transposase [Yersinia pestis Angola] >gi|162419073|ref|YP_001605450.1| IS285, transposase [Yersinia pestis Angola] >gi|162419145|ref|YP_001607838.1| IS285, transposase [Yersinia pestis Angola] >gi|162419473|ref|YP_001607281.1| IS285, transposase [Yersinia pestis Angola] >gi|162419595|ref|YP_001605786.1| IS285, transposase [Yersinia pestis Angola] >gi|162419784|ref|YP_001607249.1| IS285, transposase [Yersinia pestis Angola] >gi|162419904|ref|YP_001604831.1| IS285, transposase [Yersinia pestis Angola] >gi|162419905|ref|YP_001606200.1| IS285, transposase [Yersinia pestis Angola] >gi|162419940|ref|YP_001605467.1| IS285, transposase [Yersinia pestis Angola] >gi|162419950|ref|YP_001607090.1| IS285, transposase [Yersinia pestis Angola] >gi|162420006|ref|YP_001606796.1| IS285, transposase [Yersinia pestis Angola] >gi|162420022|ref|YP_001604658.1| IS285, transposase [Yersinia pestis Angola] >gi|162420149|ref|YP_001606639.1| IS285, transposase [Yersinia pestis Angola] >gi|162420289|ref|YP_001606410.1| IS285, transposase [Yersinia pestis Angola] >gi|162420295|ref|YP_001608375.1| IS285, transposase [Yersinia pestis Angola] >gi|162420474|ref|YP_001605006.1| IS285, transposase [Yersinia pestis Angola] >gi|162420528|ref|YP_001605155.1| IS285, transposase [Yersinia pestis Angola] >gi|162420567|ref|YP_001604811.1| IS285, transposase [Yersinia pestis Angola] >gi|162420644|ref|YP_001608406.1| IS285, transposase [Yersinia pestis Angola] >gi|162420732|ref|YP_001607046.1| IS285, transposase [Yersinia pestis Angola] >gi|162420753|ref|YP_001606400.1| IS285, transposase [Yersinia pestis Angola] >gi|162420928|ref|YP_001607375.1| IS285, transposase [Yersinia pestis Angola] >gi|162420987|ref|YP_001606963.1| IS285, transposase [Yersinia pestis Angola] >gi|162421021|ref|YP_001607092.1| IS285, transposase [Yersinia pestis Angola] >gi|162421318|ref|YP_001606621.1| IS285, transposase [Yersinia pestis Angola] >gi|162421351|ref|YP_001604774.1| IS285, transposase [Yersinia pestis Angola] >gi|162421653|ref|YP_001605201.1| IS285, transposase [Yersinia pestis Angola] >gi|165924353|ref|ZP_02220185.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165924569|ref|ZP_02220401.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165924704|ref|ZP_02220536.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925166|ref|ZP_02220998.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925197|ref|ZP_02221029.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925330|ref|ZP_02221162.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925404|ref|ZP_02221236.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925470|ref|ZP_02221302.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925480|ref|ZP_02221312.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925624|ref|ZP_02221456.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165925945|ref|ZP_02221777.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926206|ref|ZP_02222038.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926334|ref|ZP_02222166.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926382|ref|ZP_02222214.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165926829|ref|ZP_02222661.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927437|ref|ZP_02223269.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927455|ref|ZP_02223287.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927682|ref|ZP_02223514.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165927708|ref|ZP_02223540.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937019|ref|ZP_02225584.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165937062|ref|ZP_02225627.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165937094|ref|ZP_02225659.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165937713|ref|ZP_02226275.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938204|ref|ZP_02226763.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938247|ref|ZP_02226806.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938366|ref|ZP_02226924.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938505|ref|ZP_02227062.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938507|ref|ZP_02227064.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165938819|ref|ZP_02227373.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939226|ref|ZP_02227776.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939340|ref|ZP_02227888.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939381|ref|ZP_02227929.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939445|ref|ZP_02227992.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939497|ref|ZP_02228043.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939560|ref|ZP_02228105.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939658|ref|ZP_02228202.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939665|ref|ZP_02228208.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165939934|ref|ZP_02228472.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165940166|ref|ZP_02228698.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165940174|ref|ZP_02228706.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|166008053|ref|ZP_02228951.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008228|ref|ZP_02229126.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008236|ref|ZP_02229134.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008321|ref|ZP_02229219.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008416|ref|ZP_02229314.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008522|ref|ZP_02229420.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008562|ref|ZP_02229460.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166008591|ref|ZP_02229489.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009091|ref|ZP_02229989.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009108|ref|ZP_02230006.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009256|ref|ZP_02230154.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009259|ref|ZP_02230157.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009271|ref|ZP_02230169.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009375|ref|ZP_02230273.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166009459|ref|ZP_02230357.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166011432|ref|ZP_02232330.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166011777|ref|ZP_02232675.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166011820|ref|ZP_02232718.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166012175|ref|ZP_02233073.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166210434|ref|ZP_02236469.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210456|ref|ZP_02236491.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210505|ref|ZP_02236540.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210538|ref|ZP_02236573.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210624|ref|ZP_02236659.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210964|ref|ZP_02236999.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166210972|ref|ZP_02237007.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211062|ref|ZP_02237097.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211279|ref|ZP_02237314.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211329|ref|ZP_02237364.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211565|ref|ZP_02237600.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166211744|ref|ZP_02237779.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166212261|ref|ZP_02238296.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166213580|ref|ZP_02239615.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166213602|ref|ZP_02239637.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166214486|ref|ZP_02240521.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398436|ref|ZP_02303960.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167398590|ref|ZP_02304114.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167398753|ref|ZP_02304277.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167399169|ref|ZP_02304693.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167399392|ref|ZP_02304916.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400244|ref|ZP_02305757.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400245|ref|ZP_02305758.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400267|ref|ZP_02305780.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400316|ref|ZP_02305829.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400771|ref|ZP_02306277.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400859|ref|ZP_02306365.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167400877|ref|ZP_02306383.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167401429|ref|ZP_02306926.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167401455|ref|ZP_02306952.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167401799|ref|ZP_02307290.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167402042|ref|ZP_02307521.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167402384|ref|ZP_02307847.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167402399|ref|ZP_02307862.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167419209|ref|ZP_02310962.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420297|ref|ZP_02312050.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420352|ref|ZP_02312105.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420370|ref|ZP_02312123.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420392|ref|ZP_02312145.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167420443|ref|ZP_02312196.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421094|ref|ZP_02312847.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421358|ref|ZP_02313111.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421388|ref|ZP_02313141.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421398|ref|ZP_02313151.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421728|ref|ZP_02313481.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421738|ref|ZP_02313491.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421783|ref|ZP_02313536.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421790|ref|ZP_02313543.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167421850|ref|ZP_02313603.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167422268|ref|ZP_02314021.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167422540|ref|ZP_02314293.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167422595|ref|ZP_02314348.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423089|ref|ZP_02314842.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167423856|ref|ZP_02315609.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424198|ref|ZP_02315951.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424247|ref|ZP_02316000.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424392|ref|ZP_02316145.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424665|ref|ZP_02316418.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424771|ref|ZP_02316524.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424790|ref|ZP_02316543.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167424935|ref|ZP_02316688.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167425898|ref|ZP_02317651.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167426565|ref|ZP_02318318.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167426913|ref|ZP_02318666.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167427001|ref|ZP_02318754.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167427021|ref|ZP_02318774.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167427140|ref|ZP_02318893.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167466849|ref|ZP_02331553.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468202|ref|ZP_02332906.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468728|ref|ZP_02333432.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468946|ref|ZP_02333650.1| IS285, transposase [Yersinia pestis FV-1] >gi|167468962|ref|ZP_02333666.1| IS285, transposase [Yersinia pestis FV-1] >gi|167470020|ref|ZP_02334724.1| IS285, transposase [Yersinia pestis FV-1] >gi|167470598|ref|ZP_02335302.1| IS285, transposase [Yersinia pestis FV-1] >gi|167470668|ref|ZP_02335372.1| IS285, transposase [Yersinia pestis FV-1] >gi|170022678|ref|YP_001719183.1| transposase mutator type [Yersinia pseudotuberculosis YPIII] >gi|186893541|ref|YP_001870653.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186894859|ref|YP_001871971.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186895101|ref|YP_001872213.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186895880|ref|YP_001872992.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186897561|ref|YP_001874672.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|21957038|gb|AAM83943.1|AE013636_1 putative transposase [Yersinia pestis KIM] >gi|21957885|gb|AAM84710.1|AE013716_1 putative transposase [Yersinia pestis KIM] >gi|21958142|gb|AAM84944.1|AE013739_10 putative transposase [Yersinia pestis KIM] >gi|21958329|gb|AAM85113.1|AE013757_5 putative transposase [Yersinia pestis KIM] >gi|21958408|gb|AAM85185.1|AE013764_9 putative transposase [Yersinia pestis KIM] >gi|21958547|gb|AAM85311.1|AE013777_10 putative transposase [Yersinia pestis KIM] >gi|21958553|gb|AAM85316.1|AE013778_2 putative transposase [Yersinia pestis KIM] >gi|21958588|gb|AAM85349.1|AE013780_13 putative transposase [Yersinia pestis KIM] >gi|21958707|gb|AAM85456.1|AE013792_4 putative transposase [Yersinia pestis KIM] >gi|21958990|gb|AAM85713.1|AE013818_7 putative transposase [Yersinia pestis KIM] >gi|21959026|gb|AAM85745.1|AE013822_4 putative transposase [Yersinia pestis KIM] >gi|21959054|gb|AAM85771.1|AE013824_13 putative transposase [Yersinia pestis KIM] >gi|21959175|gb|AAM85882.1|AE013834_7 putative transposase [Yersinia pestis KIM] >gi|21959454|gb|AAM86135.1|AE013860_1 putative transposase [Yersinia pestis KIM] >gi|21959482|gb|AAM86161.1|AE013862_6 putative transposase [Yersinia pestis KIM] >gi|21959557|gb|AAM86228.1|AE013870_3 putative transposase [Yersinia pestis KIM] >gi|2996347|gb|AAC13227.1| transposase [Yersinia pestis KIM] >gi|3883062|gb|AAC82722.1| transposase [Yersinia pestis KIM] >gi|5834763|emb|CAB55262.1| putative transposase [Yersinia pestis CO92] >gi|45357363|gb|AAS58757.1| transposase [Yersinia pestis biovar Microtus str. 91001] >gi|45435662|gb|AAS61220.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45435843|gb|AAS61400.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436068|gb|AAS61624.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436375|gb|AAS61930.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436424|gb|AAS61979.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436472|gb|AAS62027.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436484|gb|AAS62039.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436501|gb|AAS62055.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436602|gb|AAS62156.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436656|gb|AAS62210.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436887|gb|AAS62440.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45436920|gb|AAS62473.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437087|gb|AAS62639.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437212|gb|AAS62764.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437390|gb|AAS62941.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437484|gb|AAS63035.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437585|gb|AAS63135.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45438101|gb|AAS63649.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|51587824|emb|CAH19426.1| putative transposase for IS285 insertion element [Yersinia pseudotuberculosis IP 32953] >gi|51588336|emb|CAH19944.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51588409|emb|CAH20017.1| putative transposase-like protein [Yersinia pseudotuberculosis IP 32953] >gi|51589704|emb|CAH21334.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|51590893|emb|CAH22549.1| Putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|52538067|emb|CAG27492.1| putative transposase [Yersinia pestis] >gi|108773902|gb|ABG16421.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108774855|gb|ABG17374.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775086|gb|ABG17605.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775279|gb|ABG17798.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775387|gb|ABG17906.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775416|gb|ABG17935.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775447|gb|ABG17966.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775472|gb|ABG17991.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775543|gb|ABG18062.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775581|gb|ABG18100.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775819|gb|ABG18338.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775849|gb|ABG18368.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108775854|gb|ABG18373.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776205|gb|ABG18724.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776228|gb|ABG18747.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776294|gb|ABG18813.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108776616|gb|ABG19135.1| transposase for the IS285 insertion element [Yersinia pestis Nepal516] >gi|108777871|gb|ABG20389.1| transposase [Yersinia pestis Nepal516] >gi|108778054|gb|ABG12112.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108778699|gb|ABG12757.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108778766|gb|ABG12824.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108778790|gb|ABG12848.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779010|gb|ABG13068.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779279|gb|ABG13337.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779404|gb|ABG13462.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779436|gb|ABG13494.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779461|gb|ABG13519.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779699|gb|ABG13757.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779810|gb|ABG13868.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108779854|gb|ABG13912.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780040|gb|ABG14098.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780209|gb|ABG14267.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780289|gb|ABG14347.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780436|gb|ABG14494.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|108780449|gb|ABG14507.1| transposase for the IS285 insertion element [Yersinia pestis Antiqua] >gi|115345843|emb|CAL18701.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347245|emb|CAL20139.1| transposase [Yersinia pestis CO92] >gi|115347311|emb|CAL20207.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347331|emb|CAL20228.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347336|emb|CAL20234.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347368|emb|CAL20266.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347465|emb|CAL20370.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347709|emb|CAL20624.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347821|emb|CAL20740.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347850|emb|CAL20770.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347881|emb|CAL20802.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115347903|emb|CAL20824.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348147|emb|CAL21075.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348267|emb|CAL21196.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348343|emb|CAL21276.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348466|emb|CAL21402.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348477|emb|CAL21414.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348533|emb|CAL21473.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115348605|emb|CAL21549.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|115349487|emb|CAL22461.1| transposase for the IS285 insertion element [Yersinia pestis CO92] >gi|145209062|gb|ABP38469.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209704|gb|ABP39111.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209933|gb|ABP39340.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209952|gb|ABP39359.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145209957|gb|ABP39364.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210126|gb|ABP39533.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210146|gb|ABP39553.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210195|gb|ABP39602.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210397|gb|ABP39804.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210699|gb|ABP40106.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210804|gb|ABP40211.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145210840|gb|ABP40247.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211022|gb|ABP40429.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211180|gb|ABP40587.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211458|gb|ABP40865.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145211647|gb|ABP41054.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145212054|gb|ABP41461.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|145212923|gb|ABP42329.1| transposase [Yersinia pestis Pestoides F] >gi|145213036|gb|ABP42441.1| transposase [Yersinia pestis Pestoides F] >gi|145213055|gb|ABP42460.1| transposase [Yersinia pestis Pestoides F] >gi|148872467|gb|ABR14956.1| putative transposase [Yersinia pestis CA88-4125] >gi|149289377|gb|EDM39455.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290333|gb|EDM40410.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290693|gb|EDM40768.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290788|gb|EDM40863.1| transposase [Yersinia pestis CA88-4125] >gi|149290854|gb|EDM40929.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290874|gb|EDM40949.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290879|gb|EDM40954.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149290911|gb|EDM40986.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291603|gb|EDM41677.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291670|gb|EDM41744.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291680|gb|EDM41754.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291735|gb|EDM41809.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291863|gb|EDM41937.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149291937|gb|EDM42011.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292057|gb|EDM42131.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292298|gb|EDM42372.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292320|gb|EDM42394.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292351|gb|EDM42425.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292381|gb|EDM42455.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|149292494|gb|EDM42568.1| transposase for the IS285 insertion element [Yersinia pestis CA88-4125] >gi|162350817|gb|ABX84766.1| transposase, IS256 family [Yersinia pestis Angola] >gi|162351033|gb|ABX84981.1| IS285, transposase [Yersinia pestis Angola] >gi|162351070|gb|ABX85018.1| IS285, transposase [Yersinia pestis Angola] >gi|162351135|gb|ABX85083.1| IS285, transposase [Yersinia pestis Angola] >gi|162351557|gb|ABX85505.1| IS285, transposase [Yersinia pestis Angola] >gi|162351785|gb|ABX85733.1| IS285, transposase [Yersinia pestis Angola] >gi|162351868|gb|ABX85816.1| IS285, transposase [Yersinia pestis Angola] >gi|162351888|gb|ABX85836.1| IS285, transposase [Yersinia pestis Angola] >gi|162351960|gb|ABX85908.1| IS285, transposase [Yersinia pestis Angola] >gi|162352288|gb|ABX86236.1| IS285, transposase [Yersinia pestis Angola] >gi|162352410|gb|ABX86358.1| IS285, transposase [Yersinia pestis Angola] >gi|162352599|gb|ABX86547.1| IS285, transposase [Yersinia pestis Angola] >gi|162352719|gb|ABX86667.1| IS285, transposase [Yersinia pestis Angola] >gi|162352720|gb|ABX86668.1| IS285, transposase [Yersinia pestis Angola] >gi|162352755|gb|ABX86703.1| IS285, transposase [Yersinia pestis Angola] >gi|162352765|gb|ABX86713.1| IS285, transposase [Yersinia pestis Angola] >gi|162352821|gb|ABX86769.1| IS285, transposase [Yersinia pestis Angola] >gi|162352837|gb|ABX86785.1| IS285, transposase [Yersinia pestis Angola] >gi|162352964|gb|ABX86912.1| IS285, transposase [Yersinia pestis Angola] >gi|162353104|gb|ABX87052.1| IS285, transposase [Yersinia pestis Angola] >gi|162353110|gb|ABX87058.1| IS285, transposase [Yersinia pestis Angola] >gi|162353289|gb|ABX87237.1| IS285, transposase [Yersinia pestis Angola] >gi|162353343|gb|ABX87291.1| IS285, transposase [Yersinia pestis Angola] >gi|162353382|gb|ABX87330.1| IS285, transposase [Yersinia pestis Angola] >gi|162353459|gb|ABX87407.1| IS285, transposase [Yersinia pestis Angola] >gi|162353547|gb|ABX87495.1| IS285, transposase [Yersinia pestis Angola] >gi|162353568|gb|ABX87516.1| IS285, transposase [Yersinia pestis Angola] >gi|162353743|gb|ABX87691.1| IS285, transposase [Yersinia pestis Angola] >gi|162353802|gb|ABX87750.1| IS285, transposase [Yersinia pestis Angola] >gi|162353836|gb|ABX87784.1| IS285, transposase [Yersinia pestis Angola] >gi|162354133|gb|ABX88081.1| IS285, transposase [Yersinia pestis Angola] >gi|162354166|gb|ABX88114.1| IS285, transposase [Yersinia pestis Angola] >gi|162354468|gb|ABX88416.1| IS285, transposase [Yersinia pestis Angola] >gi|165911912|gb|EDR30557.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165911920|gb|EDR30565.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912153|gb|EDR30792.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912355|gb|EDR30989.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912455|gb|EDR31088.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912476|gb|EDR31108.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912546|gb|EDR31177.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912633|gb|EDR31263.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912681|gb|EDR31310.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912722|gb|EDR31351.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165912826|gb|EDR31453.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913182|gb|EDR31805.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913620|gb|EDR32240.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913622|gb|EDR32242.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913744|gb|EDR32363.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913865|gb|EDR32483.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165913908|gb|EDR32526.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914463|gb|EDR33078.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914882|gb|EDR33494.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914925|gb|EDR33537.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165914957|gb|EDR33569.1| IS285, transposase [Yersinia pestis biovar Orientalis str. IP275] >gi|165920296|gb|EDR37573.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165920322|gb|EDR37599.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165920510|gb|EDR37787.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165920703|gb|EDR37951.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165921180|gb|EDR38404.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165921603|gb|EDR38800.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165921858|gb|EDR39055.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922066|gb|EDR39243.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922149|gb|EDR39326.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922579|gb|EDR39730.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922589|gb|EDR39740.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922733|gb|EDR39884.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922773|gb|EDR39924.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922804|gb|EDR39955.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165922937|gb|EDR40088.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923011|gb|EDR40162.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923413|gb|EDR40545.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923629|gb|EDR40761.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165923764|gb|EDR40896.1| IS285, transposase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165988909|gb|EDR41210.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165989285|gb|EDR41586.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165989384|gb|EDR41685.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165989578|gb|EDR41879.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991381|gb|EDR43682.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991646|gb|EDR43947.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991663|gb|EDR43964.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991811|gb|EDR44112.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991814|gb|EDR44115.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991826|gb|EDR44127.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165991930|gb|EDR44231.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992435|gb|EDR44736.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992610|gb|EDR44911.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992618|gb|EDR44919.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992703|gb|EDR45004.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992798|gb|EDR45099.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992904|gb|EDR45205.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992944|gb|EDR45245.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|165992973|gb|EDR45274.1| IS285, transposase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204334|gb|EDR48814.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166205253|gb|EDR49733.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166205275|gb|EDR49755.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166206192|gb|EDR50672.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207050|gb|EDR51530.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207100|gb|EDR51580.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207336|gb|EDR51816.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207515|gb|EDR51995.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207614|gb|EDR52094.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207636|gb|EDR52116.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207685|gb|EDR52165.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207718|gb|EDR52198.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166207804|gb|EDR52284.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166208144|gb|EDR52624.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166208152|gb|EDR52632.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166208242|gb|EDR52722.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166958442|gb|EDR55463.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166958554|gb|EDR55575.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166958774|gb|EDR55795.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960213|gb|EDR56234.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960223|gb|EDR56244.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960268|gb|EDR56289.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960275|gb|EDR56296.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960335|gb|EDR56356.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960847|gb|EDR56868.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960877|gb|EDR56898.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166960887|gb|EDR56908.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166961223|gb|EDR57244.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166961992|gb|EDR58013.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962047|gb|EDR58068.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962065|gb|EDR58086.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962087|gb|EDR58108.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166962138|gb|EDR58159.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|166963203|gb|EDR59224.1| IS285, transposase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167048217|gb|EDR59625.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167048232|gb|EDR59640.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167048516|gb|EDR59924.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167048904|gb|EDR60312.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049125|gb|EDR60533.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049151|gb|EDR60559.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049624|gb|EDR61032.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049712|gb|EDR61120.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167049730|gb|EDR61138.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050193|gb|EDR61601.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050194|gb|EDR61602.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050216|gb|EDR61624.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050265|gb|EDR61673.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167050940|gb|EDR62348.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051094|gb|EDR62502.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051257|gb|EDR62665.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051673|gb|EDR63081.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167051896|gb|EDR63304.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167053865|gb|EDR63697.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167053980|gb|EDR63808.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167054000|gb|EDR63828.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167054080|gb|EDR63907.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167054441|gb|EDR64253.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167055046|gb|EDR64845.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056122|gb|EDR65900.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056274|gb|EDR66043.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056547|gb|EDR66316.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056653|gb|EDR66422.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056672|gb|EDR66441.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167056705|gb|EDR66468.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167057047|gb|EDR66810.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167057096|gb|EDR66859.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167057259|gb|EDR67005.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749212|gb|ACA66730.1| transposase mutator type [Yersinia pseudotuberculosis YPIII] >gi|186696567|gb|ACC87196.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186697885|gb|ACC88514.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186698127|gb|ACC88756.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186698906|gb|ACC89535.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|186700587|gb|ACC91215.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] (402 aa)
Score = 286, Expect = 3.4e-24, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|17544971|ref|NP_518373.1| ISRSO7-transposase protein [Ralstonia solanacearum GMI1000] >gi|17548699|ref|NP_522039.1| ISRSO7-transposase protein [Ralstonia solanacearum GMI1000] >gi|17427261|emb|CAD13780.1| isrso7-transposase protein [Ralstonia solanacearum] >gi|17430947|emb|CAD17629.1| isrso7-transposase protein [Ralstonia solanacearum] (416 aa)
Score = 286, Expect = 3.5e-24, Identities = 56/154 (36%), Positives = 89/154 (57%)
  Q:    29 KLLEKLG--VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +LLE+ G      E  +     L K+ IE++L  EM+ HLGY          +N  R G   KT+ T+ G + +E+PRD + +FEP L+ KH+R     +  I+ +Y++GM+ REIQ   L+ Y   V  + +S VTD+++ E+  WQ+RPL+ +Y
  S:    18 ELLEQFGNGPMTAEAINAATLALKKALIERALSGEMNHHLGYPPGAAKPATVTNQ-RNGSGAKTVLTEDGPIRIEVPRDRDGSFEPLLIPKHERRFKGFDDKIVAMYARGMTVREIQGFLLEQYATEVSPEFISSVTDEVMAEVTAWQARPLDPMY 172
>gi|45442500|ref|NP_994039.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45437365|gb|AAS62916.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] (402 aa)
Score = 285, Expect = 3.6e-24, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|49658889|emb|CAF28515.1| is285 transposase [Yersinia pseudotuberculosis] (402 aa)
Score = 285, Expect = 4.2e-24, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIIATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|71735175|ref|YP_276608.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71555728|gb|AAZ34939.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 285, Expect = 4.5e-24, Identities = 58/163 (35%), Positives = 94/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+++   G  + E   +      K+ IE++L  E+  HLGY +  +  +E S N R GK+ KT+ T  G L ++IPRD + +F   L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIKQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPKE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFASILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|45443659|ref|NP_995198.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|45438529|gb|AAS64075.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] (402 aa)
Score = 284, Expect = 4.8e-24, Identities = 62/162 (38%), Positives = 101/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQKRQLDALY 160
>gi|162418655|ref|YP_001606994.1| IS285, transposase [Yersinia pestis Angola] >gi|162421331|ref|YP_001607453.1| IS285, transposase [Yersinia pestis Angola] >gi|162351470|gb|ABX85418.1| IS285, transposase [Yersinia pestis Angola] >gi|162354146|gb|ABX88094.1| IS285, transposase [Yersinia pestis Angola] (402 aa)
Score = 284, Expect = 5.2e-24, Identities = 62/162 (38%), Positives = 101/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E   HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAEFTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|83716088|ref|YP_439723.1| transposase mutator family protein [Burkholderia thailandensis E264] >gi|83649913|gb|ABC33977.1| transposase, Mutator family [Burkholderia thailandensis E264] (422 aa)
Score = 284, Expect = 6.0e-24, Identities = 64/165 (38%), Positives = 97/165 (58%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L  E+  HL  E   +  R  + N+R G + KT+ T  G+L ++I RD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLKKQLAERMLAAELSHHLAAET--EQGR--AGNHRNGTSPKTVLTPNGELKLDILRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 178
>gi|158321645|ref|YP_001514152.1| transposase mutator type [Alkaliphilus oremlandii OhILAs] >gi|158141844|gb|ABW20156.1| transposase mutator type [Alkaliphilus oremlandii OhILAs] (405 aa)
Score = 284, Expect = 6.0e-24, Identities = 60/169 (35%), Positives = 106/169 (62%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M+   K    +++    +++  D  + LK++ K  +++ L+ E++  L Y K D+ ++  SN  R G ++K + T++G++ ++IPRD N  FEP +V K++R+++ IE  +I LY++GMSTR+I +   D+YG  V  ++VS++TD ILP I  WQ R L+ IY  + L
  S:     1 MSTLPKEFLREMITSGNLKSAGDLQSDLKDIFKDVLQEMLEAELEVELCYSKGDRENKNTSNR-RNGYSEKKVKTQFGEMSLDIPRDRNGEFEPAVVPKNKRDISGIEEKVISLYARGMSTRDIHEQIKDIYGIEVSAEMVSKITDSILPSIKEWQHRSLDPIYSFVFL 168
>gi|120435365|ref|YP_861051.1| mutator family transposase [Gramella forsetii KT0803] >gi|120435941|ref|YP_861627.1| mutator family transposase [Gramella forsetii KT0803] >gi|117577515|emb|CAL65984.1| mutator family transposase [Gramella forsetii KT0803] >gi|117578091|emb|CAL66560.1| mutator family transposase [Gramella forsetii KT0803] (398 aa)
Score = 283, Expect = 7.8e-24, Identities = 58/165 (35%), Positives = 106/165 (64%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           KKE   +++ L++   ++ +  ++ LKEL K  IEK L+ E+DGHLGY   D++ +  ++N R G  +K + T +G+  +++PRD  ++F P +V K    ++ IE+ I+ LY+KGMS  +I++   ++Y   V    +SR+T+K+  +I+ WQ+RPLE +Y+++
  S:     2 KKEDLFSDEFLKQF--KSGDQLNSFLKELQKRGIEKMLEGELDGHLGY---DKSQKSGNSNTRNGYGQKKVRTSFGESQIQVPRDREASFTPMIVPKRGNMVDGIENVIVSLYAKGMSNSDIEEQIREVYNFEVSTSTISRITEKVTEDIVAWQNRPLEPVYLIV 161
>gi|82779492|ref|YP_405841.1| putative transposase [Shigella dysenteriae Sd197] >gi|81243640|gb|ABB64350.1| putative transposase [Shigella dysenteriae Sd197] (236 aa)
Score = 282, Expect = 8.7e-24, Identities = 62/167 (37%), Positives = 104/167 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           KK K+ A +L++  G++ + D +   + LTK  +E  L+ E+  HLG+EK   N+ +  +N R G + KT+    G++++  PRD  + FEPQL++KHQ  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+V D +  ++  WQ+RPL+ +Y ++ L
  S:     4 KKLKALAAELVK--GLKTEADLNQFSRMLTKLTVETVLNAELTDHLGHEK---NAPKSGSNTRNGYSLKTVLYDDGEIELNTPRDRENIFEPQLIKKHQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVADAVKEQVSEWQNRPLDALYPIVYL 165
>gi|22127688|ref|NP_671111.1| transposase [Yersinia pestis KIM] >gi|108809522|ref|YP_653438.1| putative transposase [Yersinia pestis Antiqua] >gi|108810404|ref|YP_646171.1| transposase [Yersinia pestis Nepal516] >gi|166213676|ref|ZP_02239711.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167402110|ref|ZP_02307587.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167427030|ref|ZP_02318783.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|21960805|gb|AAM87362.1|AE013984_8 putative transposase [Yersinia pestis KIM] >gi|108774052|gb|ABG16571.1| transposase [Yersinia pestis Nepal516] >gi|108781435|gb|ABG15493.1| putative transposase [Yersinia pestis Antiqua] >gi|166205078|gb|EDR49558.1| IS285, transposase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167048485|gb|EDR59893.1| IS285, transposase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167053957|gb|EDR63788.1| IS285, transposase [Yersinia pestis biovar Mediaevalis str. K1973002] (402 aa)
Score = 282, Expect = 8.9e-24, Identities = 57/148 (38%), Positives = 94/148 (63%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:    16 GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|71736031|ref|YP_273698.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556584|gb|AAZ35795.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 280, Expect = 1.4e-23, Identities = 58/163 (35%), Positives = 93/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E + N R GK+ KT+ T  G L ++IPRD + +F   L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERP-EGATNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFASILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71738142|ref|YP_276452.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558695|gb|AAZ37906.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|115265659|dbj|BAF32920.1| ISPsy18 transposase [Pseudomonas syringae pv. phaseolicola] (419 aa)
Score = 280, Expect = 1.4e-23, Identities = 58/163 (35%), Positives = 93/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E + N R GK+ KT+ T  G L ++IPRD + +F   L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERP-EGATNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFASILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|71733937|ref|YP_276385.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71734237|ref|YP_276112.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71735547|ref|YP_276172.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71738037|ref|YP_274115.1| prophage PSPPH02, ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554490|gb|AAZ33701.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554790|gb|AAZ34001.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556100|gb|AAZ35311.1| ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558590|gb|AAZ37801.1| prophage PSPPH02, ISPsy18, transposase [Pseudomonas syringae pv. phaseolicola 1448A] (419 aa)
Score = 280, Expect = 1.4e-23, Identities = 58/163 (35%), Positives = 93/163 (57%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E + N R GK+ KT+ T  G L ++IPRD + +F   L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERP-EGATNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFASILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 175
>gi|22126309|ref|NP_669732.1| transposase [Yersinia pestis KIM] >gi|21959288|gb|AAM85983.1|AE013846_14 putative transposase [Yersinia pestis KIM] (258 aa)
Score = 280, Expect = 1.7e-23, Identities = 56/139 (40%), Positives = 91/139 (65%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEP+L++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+RPL+ +Y ++ L
  S:     2 LTKLTVETALNAELTEHLGHEK---NTPKTGSNTRNGYSSKTLLCDDGEIELSTPRDSENTFEPKLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVTEWQNRPLDALYPIVYL 137
>gi|28373056|ref|NP_783715.1| transposase [Yersinia enterocolitica] >gi|28302123|gb|AAO39032.1| transposase [Yersinia enterocolitica] (400 aa)
Score = 280, Expect = 1.7e-23, Identities = 57/140 (40%), Positives = 83/140 (59%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D +L  L K   E +L  E+D HL        +++   N + G TKKT+ T  G  ++  PRD N +FEPQLV+KHQ  L+D IE  II++++ GMS ++I     D+Y   V    ++ VTDK++PE+  WQ RPLE +Y
  S:    24 DGILTPLIKQLTEAALAAELDSHL--------AQDIEANRKNGSTKKTVKTPTGAFELATPRDRNGSFEPQLVKKHQTTLSDEIERKIIRMFALGMSYKDISQEIEDLYAFSVSSATITAVTDKVIPELKQWQQRPLEAVY 156
>gi|68535456|ref|YP_250161.1| transposase for IS3508a [Corynebacterium jeikeium K411] >gi|68535579|ref|YP_250284.1| transposase for IS3508b [Corynebacterium jeikeium K411] >gi|68536308|ref|YP_251013.1| transposase for IS3508c [Corynebacterium jeikeium K411] >gi|68536339|ref|YP_251044.1| transposase for IS3508d [Corynebacterium jeikeium K411] >gi|68536342|ref|YP_251047.1| transposase for IS3508e [Corynebacterium jeikeium K411] >gi|68536360|ref|YP_251065.1| transposase for IS3508f [Corynebacterium jeikeium K411] >gi|68536672|ref|YP_251377.1| transposase for IS3508g [Corynebacterium jeikeium K411] >gi|68536688|ref|YP_251393.1| transposase for IS3508h [Corynebacterium jeikeium K411] >gi|68536877|ref|YP_251582.1| transposase for IS3508i [Corynebacterium jeikeium K411] >gi|68263055|emb|CAI36543.1| transposase for IS3508a [Corynebacterium jeikeium K411] >gi|68263178|emb|CAI36666.1| transposase for IS3508b [Corynebacterium jeikeium K411] >gi|68263907|emb|CAI37395.1| transposase for IS3508c [Corynebacterium jeikeium K411] >gi|68263938|emb|CAI37426.1| transposase for IS3508d [Corynebacterium jeikeium K411] >gi|68263941|emb|CAI37429.1| transposase for IS3508e [Corynebacterium jeikeium K411] >gi|68263959|emb|CAI37447.1| transposase for IS3508f [Corynebacterium jeikeium K411] >gi|68264271|emb|CAI37759.1| transposase for IS3508g [Corynebacterium jeikeium K411] >gi|68264287|emb|CAI37775.1| transposase for IS3508h [Corynebacterium jeikeium K411] >gi|68264476|emb|CAI37964.1| transposase for IS3508i [Corynebacterium jeikeium K411] (449 aa)
Score = 280, Expect = 1.7e-23, Identities = 54/148 (36%), Positives = 89/148 (60%)
  Q:    40 EDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREF-----SNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +D  +L+K L ++ I   L  EMD HLGY   D+ ++        +N+R G   KT+N+ YG ++V +PRD   TF P++V K  R L +++  I+ LY+ GM+ R+IQ       G  +  D +S +TD +L E++ WQ+R L++ Y ++ L
  S:    40 DDASDLVKGLLQASINAGLQAEMDAHLGYGHSDRKAKAQVEAAQESNHRNGSYTKTVNSGYGAVEVTVPRDRAGTFTPKMVPKGARRLTELDDMIVSLYAGGMTVRDIQHHLATTLGVDMSPDTISTITDAVLDEVMIWQNRQLDEFYPVIFL 192
>gi|150378034|ref|YP_001314629.1| transposase mutator type [Sinorhizobium medicae WSM419] >gi|150032581|gb|ABR64696.1| transposase mutator type [Sinorhizobium medicae WSM419] (400 aa)
Score = 279, Expect = 1.8e-23, Identities = 63/158 (39%), Positives = 96/158 (60%)
  Q:    28 EKLLEKL--GVENKEDF--DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           ++LL++L  G +  E F  D LL +L K+  E+ L+ E+D HL   + +        N R G +KKT+ T   K+ + IPRD   TF+P+L+ ++QR   D +  II +Y++GM+ REIQ    ++YG  V  DL+S VTD +L  +  WQ+RPLE  Y L+
  S:     5 KELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELDDHLDVGRLEGGPA----NRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDFDDKIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYPLV 162
>gi|45439877|ref|NP_991416.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|145601132|ref|YP_001165208.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] >gi|45434732|gb|AAS60293.1| transposase for the IS285 insertion element [Yersinia pestis biovar Microtus str. 91001] >gi|145212828|gb|ABP42235.1| transposase for the IS285 insertion element [Yersinia pestis Pestoides F] (402 aa)
Score = 279, Expect = 2.0e-23, Identities = 61/162 (37%), Positives = 101/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+K M+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKSMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|51594371|ref|YP_068562.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|186893357|ref|YP_001870469.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] >gi|51587653|emb|CAH19252.1| putative transposase [Yersinia pseudotuberculosis IP 32953] >gi|186696383|gb|ACC87012.1| transposase mutator type [Yersinia pseudotuberculosis PB1/+] (395 aa)
Score = 279, Expect = 2.1e-23, Identities = 61/162 (37%), Positives = 101/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+K M+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKSMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|122815847|ref|YP_001004113.1| transposase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|121663721|emb|CAL10090.1| transposase [Yersinia enterocolitica subsp. enterocolitica 8081] (400 aa)
Score = 278, Expect = 2.4e-23, Identities = 57/140 (40%), Positives = 83/140 (59%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D +L  L K   E +L  E+D HL        +++   N + G TKKT+ T  G  ++  PRD N +FEPQLV+KHQ  L+D IE  II++++ GMS ++I     D+Y   V    ++ VTDK++PE+  WQ RPLE +Y
  S:    24 DGILTPLIKQLTEAALAAELDSHL--------AQDIEANRKNGSTKKTVKTPTGAFELATPRDRNGSFEPQLVKKHQTTLSDEIERKIIRMFALGMSYKDISQEIEDLYAFSVSSATITAVTDKVIPELKQWQQRPLEAVY 156
>gi|110600165|ref|ZP_01388392.1| Transposase, mutator type [Geobacter sp. FRC-32] >gi|110549150|gb|EAT62349.1| Transposase, mutator type [Geobacter sp. FRC-32] (241 aa)
Score = 278, Expect = 2.4e-23, Identities = 55/133 (41%), Positives = 81/133 (60%)
  Q:    55 EKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           E+++  EM  HLGYEK   N    S N R G  KKT+   +G L++ +PRD  S+FEP +V K +      +  II +Y++GM+TR+IQ    ++YG  V   LVS+VT  +  EI  WQ+RPL+D+Y ++ L
  S:    37 ERAMQAEMTEHLGYEKHAPNGAN-SGNSRNGSYKKTVKGDFGNLEMTVPRDRQSSFEPIIVPKGESRFTGFDDKIISMYARGMTTRDIQGHLEEIYGVEVSPTLVSQVTQAVTEEITLWQNRPLDDVYPIMYL 168
>gi|83746025|ref|ZP_00943080.1| Transposase [Ralstonia solanacearum UW551] >gi|83727208|gb|EAP74331.1| Transposase [Ralstonia solanacearum UW551] (331 aa)
Score = 278, Expect = 2.8e-23, Identities = 50/134 (37%), Positives = 81/134 (60%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           L K+ IE++L  EM+ HLGY          +N  R G   KT+ T+ G + +E+PRD + +FEP L+ KH+R     +  I+ +Y++GM+ REIQ   L+ Y   V  + +S VT++++ E+  WQ+RPL+ +Y
  S:    40 LKKALIERALGGEMNHHLGYPPGATKPATVTNQ-RNGSGAKTVLTEDGPIRIEVPRDRDGSFEPLLIPKHERRFKGFDDKIVAMYARGMTVREIQGFLLEQYATEVSPEFISSVTNEVMGEVTAWQARPLDPMY 172
>gi|153947942|ref|YP_001399285.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] >gi|153949637|ref|YP_001399016.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] >gi|152959437|gb|ABS46898.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] >gi|152961132|gb|ABS48593.1| IS285, transposase [Yersinia pseudotuberculosis IP 31758] (402 aa)
Score = 278, Expect = 3.0e-23, Identities = 61/162 (37%), Positives = 101/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R   + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNDYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|108811602|ref|YP_647369.1| transposase [Yersinia pestis Nepal516] >gi|108775250|gb|ABG17769.1| transposase [Yersinia pestis Nepal516] (240 aa)
Score = 277, Expect = 3.3e-23, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|38505576|ref|NP_942197.1| transposase [Synechocystis sp. PCC 6803] >gi|38423600|dbj|BAD01811.1| transposase [Synechocystis sp. PCC 6803] (182 aa)
Score = 277, Expect = 3.6e-23, Identities = 59/143 (41%), Positives = 91/143 (63%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           LLK+LTK  IE++L  E+  HL        + E   N R G +KKT+ ++ G++++ IPRD    FEP LV K++R +  ++  I+ LY++GMSTR+I     ++YGA V   ++S VTD +L E+  WQ+RPLE+IY ++ L
  S:    24 LLKQLTKRLIERALAGELSHHL-----KNQAEEEKRNSRNGYSKKTVQSEQGEMELAIPRDRQGKFEPVLVPKNERRIAGLDEKILALYARGMSTRDISPQLEELYGAKVSASMISEVTDAVLEEVKAWQARPLEEIYPIVYL 161
>gi|108811157|ref|YP_646924.1| transposase [Yersinia pestis Nepal516] >gi|108774805|gb|ABG17324.1| transposase [Yersinia pestis Nepal516] (191 aa)
Score = 276, Expect = 4.4e-23, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|32470336|ref|NP_863558.1| hypothetical protein pYVe8081_p53 [Yersinia enterocolitica] >gi|14579394|gb|AAK69271.1|AF336309_66 unknown [Yersinia enterocolitica] (400 aa)
Score = 276, Expect = 5.0e-23, Identities = 57/140 (40%), Positives = 83/140 (59%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D +L  L K   E +L  E+D HL        +++   N + G TKKT+ T  G  ++  PRD N +FEPQLV+KHQ  L+D IE  II++++ GMS ++I     D+Y   V    ++ VTDK++PE+  WQ RPLE +Y
  S:    24 DGILTPLIKQLTEAALAAELDFHL--------AQDIEANRKNGSTKKTVKTPTGAFELATPRDRNGSFEPQLVKKHQTTLSDEIERKIIRMFALGMSYKDISQEIEDLYAFSVSSATITAVTDKVIPELKQWQQRPLEAVY 156
>gi|28373038|ref|NP_783725.1| transposase Tnp [Yersinia enterocolitica] >gi|23630610|gb|AAN37566.1| transposase Tnp [Yersinia enterocolitica] (191 aa)
Score = 275, Expect = 5.4e-23, Identities = 57/140 (40%), Positives = 83/140 (59%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D +L  L K   E +L  E+D HL        +++   N + G TKKT+ T  G  ++  PRD N +FEPQLV+KHQ  L+D IE  II++++ GMS ++I     D+Y   V    ++ VTDK++PE+  WQ RPLE +Y
  S:    24 DGILTPLIKQLTEAALAAELDFHL--------AQDIEANRKNGSTKKTVKTPTGAFELATPRDRNGSFEPQLVKKHQTTLSDEIERKIIRMFALGMSYKDISQEIEDLYAFSVSSATITAVTDKVIPELKQWQQRPLEAVY 156
>gi|120403640|ref|YP_953469.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|120404397|ref|YP_954226.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119956458|gb|ABM13463.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119957215|gb|ABM14220.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] (451 aa)
Score = 275, Expect = 6.1e-23, Identities = 56/143 (39%), Positives = 84/143 (58%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           LL  L K  +E+ L  E+  HLGYEK D   R   N  R G + KT+ T+ G + +++PRD + +F P+LV K QR +  ++  II LY+ GM+ R+IQ       G  V  + +S++ D+I  E+L WQ RPL+ IY ++ L
  S:    50 LLPGLIKLALERGLAAELTDHLGYEKGDPAGRALPNA-RNGSSAKTVQTEAGPVPLDVPRDRDGSFTPRLVPKGQRRIGGLDDMIISLYAGGMTLRDIQFHLASTIGTDVSHETISKIVDEISEEVLVWQRRPLDPIYPVIYL 191
>gi|108812326|ref|YP_648093.1| transposase [Yersinia pestis Nepal516] >gi|108775974|gb|ABG18493.1| transposase [Yersinia pestis Nepal516] (176 aa)
Score = 275, Expect = 6.2e-23, Identities = 62/162 (38%), Positives = 102/162 (62%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 160
>gi|83718803|ref|YP_441062.1| transposase [Burkholderia thailandensis E264] >gi|83652628|gb|ABC36691.1| transposase [Burkholderia thailandensis E264] (639 aa)
Score = 274, Expect = 7.1e-23, Identities = 50/102 (49%), Positives = 72/102 (70%)
  Q:    81 NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           N+R G + KT+ T  G+L ++IPRD  +TFEPQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V  DL+S VTD++L ++  WQ RPLE +Y
  S:   294 NHRNGTSAKTVLTPNGELKLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMY 395
>gi|145593147|ref|YP_001157444.1| transposase, mutator type [Salinispora tropica CNB-440] >gi|145302484|gb|ABP53066.1| transposase, mutator type [Salinispora tropica CNB-440] (478 aa)
Score = 273, Expect = 9.4e-23, Identities = 53/138 (38%), Positives = 83/138 (60%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LL  +T++ +  +LD E+D HL     D+ +     N R G   KT+ T+ G + ++IPRD   +F P++V KH R L+     I+ LY+KG++T EI     D+Y A V ++L+SRVTD +L E+  W+ RPL+ +Y
  S:    54 LLAGITRTVLGSALDAELDAHLDTVGVDEATGR-RTNIRNGHGVKTVQTEVGPVRIQIPRDRAGSFAPRIVSKHARRLDGFNEAILSLYAKGLTTGEISAHLADVYDAEVSRELISRVTDSVLDEMEAWRQRPLDRVY 190
>gi|22125930|ref|NP_669353.1| transposase [Yersinia pestis KIM] >gi|45442241|ref|NP_993780.1| putative transposase for IS285 element [Yersinia pestis biovar Microtus str. 91001] >gi|21958869|gb|AAM85604.1|AE013806_8 putative transposase [Yersinia pestis KIM] >gi|45437105|gb|AAS62657.1| putative transposase for IS285 element [Yersinia pestis biovar Microtus str. 91001] (374 aa)
Score = 272, Expect = 1.2e-22, Identities = 55/134 (41%), Positives = 87/134 (64%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KTL    G++++  PRD  +TFEPQL++K+Q  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     2 LTKLTVETALNAELTEHLGHEK---NTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 132
>gi|148243899|ref|YP_001220138.1| transposase, mutator type [Acidiphilium cryptum JF-5] >gi|146400462|gb|ABQ28996.1| transposase, mutator type [Acidiphilium cryptum JF-5] (407 aa)
Score = 272, Expect = 1.3e-22, Identities = 53/142 (37%), Positives = 83/142 (58%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +L+  L K+  E+ L  EMD HL  E   +NSR        G  +K++ T  GK+++ IPRD   +F+PQL+ K+QR     +  II +Y++GM  REI +   ++YG     +L+S +TD +L E+  WQ RPL+ +Y L+
  S:    31 DLVNALKKALAERVLSAEMDYHLSDEAEAENSR-------NGYGRKSVLTGTGKIEIAIPRDRAGSFDPQLIAKYQRRFPGFDDKIISMYARGMRIREIAEHLREIYGMDASAELISTITDAVLDEVTAWQQRPLDPVYPLV 165
>gi|84687369|ref|ZP_01015248.1| Transposase, mutator family protein [Rhodobacterales bacterium HTCC2654] >gi|84664666|gb|EAQ11151.1| Transposase, mutator family protein [Rhodobacterales bacterium HTCC2654] (404 aa)
Score = 270, Expect = 2.3e-22, Identities = 62/157 (39%), Positives = 90/157 (57%)
  Q:    26 SAEKLLEKL-GVENKEDF---DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           S E L E L G +  ED      L+KEL    +E+ L  E+  HLGYE   +   +   N R G   K +    G++ + +PRD   +FEP+LV+K Q  ++ ++  II LY+ G+S R+IQ    D+YG  V  DL+SRVTD +L E+  WQ R L+ +Y
  S:     4 SNEVLDELLKGCKRPEDLLGDAGLMKELKIRLMERMLGAELTAHLGYEAGAEPPAD-QTNRRNGSATKRVKGSDGEVPLSVPRDREGSFEPELVKKGQTRIDGVDDKIIGLYAAGLSVRDIQAHLEDLYGLRVSPDLISRVTDAVLDEVREWQHRALDRMY 163
>gi|25028052|ref|NP_738106.1| putative transposase [Corynebacterium efficiens YS-314] >gi|23493336|dbj|BAC18306.1| putative transposase [Corynebacterium efficiens YS-314] (390 aa)
Score = 270, Expect = 2.3e-22, Identities = 49/130 (37%), Positives = 80/130 (61%)
  Q:    58 LDVEMDGHLGYEKWDQNSREFSN--NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           ++ EMD HLGY   D++ +  +   N+R G   K +++ YG +DV +PRD N +F P +V K  R L D++  II LY+ GM+ R+IQ   +   G  +  + +S +TD +L E++ WQ+R L+D Y ++ L
  S:     1 MNAEMDAHLGYGHSDRDGKTAAGQGNHRNGYYPKRVDSNYGPIDVAVPRDRNGSFLPTMVPKGSRRLTDVDDMIISLYAGGMTVRDIQHHMITSMGVDISHETISAITDAVLDEVMIWQNRQLDDFYPVIFL 132
>gi|67459464|ref|YP_247088.1| transposase [Rickettsia felis URRWXCal2] >gi|67004997|gb|AAY61923.1| Transposase [Rickettsia felis URRWXCal2] (250 aa)
Score = 269, Expect = 2.6e-22, Identities = 52/124 (41%), Positives = 82/124 (66%)
  Q:    62 MDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+S++TD I+ ++  WQSRPL+ +Y ++
  S:     1 MNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQITDDIIEDVKLWQSRPLDPVYAIV 121
>gi|67458493|ref|YP_246117.1| transposase [Rickettsia felis URRWXCal2] >gi|67459446|ref|YP_247070.1| transposase [Rickettsia felis URRWXCal2] >gi|67459823|ref|YP_247446.1| transposase [Rickettsia felis URRWXCal2] >gi|67004026|gb|AAY60952.1| Transposase [Rickettsia felis URRWXCal2] >gi|67004979|gb|AAY61905.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005356|gb|AAY62281.1| Transposase [Rickettsia felis URRWXCal2] (250 aa)
Score = 269, Expect = 2.7e-22, Identities = 52/124 (41%), Positives = 82/124 (66%)
  Q:    62 MDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           M+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+S++TD I+ ++  WQSRPL+ +Y ++
  S:     1 MNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLISQITDDIIEDVKLWQSRPLDPVYAIV 121
>gi|58582741|ref|YP_201757.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] >gi|58427335|gb|AAW76372.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (356 aa)
Score = 268, Expect = 3.7e-22, Identities = 48/107 (44%), Positives = 71/107 (66%)
  Q:    81 NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           N R GK++KT+ +  G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +  E   WQSRPLE IY ++ L
  S:    12 NVRNGKSRKTVQSALGELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHRLIAQVTDAVQEEARAWQSRPLEAIYPIVWL 118
>gi|116255016|ref|YP_770851.1| putative transposase-like protein [Rhizobium leguminosarum bv. viciae 3841] >gi|115259664|emb|CAK11649.1| putative transposase-like protein [Rhizobium leguminosarum bv. viciae 3841] (382 aa)
Score = 266, Expect = 7.1e-22, Identities = 49/107 (45%), Positives = 70/107 (65%)
  Q:    79 SNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           + N R G  +KT+ T  G L++ IPRD  S+F+PQL+ K+QR     +  I+ +Y++GMSTREI     D+YG  V  DL+S VTD +L E+  WQ+RPLE +Y L+
  S:    35 AGNSRNGYGRKTVLTDSGSLELAIPRDRQSSFDPQLLAKYQRRFPGFDEKIVSMYARGMSTREIAGHVHDLYGIDVSPDLISAVTDAVLDEVAIWQARPLEPVYPLV 141
>gi|24373845|ref|NP_717888.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348249|gb|AAN55332.1|AE015670_10 ISSod4, transposase [Shewanella oneidensis MR-1] (400 aa)
Score = 266, Expect = 7.3e-22, Identities = 57/145 (39%), Positives = 84/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL ++           N + GKT KT+    G  +++ PRD N TFEPQL++K+Q  L D IE  ++ ++S GMS R+I     DMYG  V    VS +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDP--------QANRKNGKTPKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHVEDMYGLNVSNATVSAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|24376341|ref|NP_720449.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24345246|gb|AAN53049.1| ISSod4 transposase, TnpA_ISSod4_50 [Shewanella oneidensis MR-1] (400 aa)
Score = 265, Expect = 7.6e-22, Identities = 57/145 (39%), Positives = 84/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL ++           N + GKT KT+    G  +++ PRD N TFEPQL++K+Q  L D IE  ++ ++S GMS R+I     DMYG  V    VS +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDP--------QPNRKNGKTPKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHVEDMYGLNVSNATVSAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|24371954|ref|NP_715996.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24372612|ref|NP_716654.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373334|ref|NP_717377.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375247|ref|NP_719290.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375743|ref|NP_719786.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375867|ref|NP_719910.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376019|ref|NP_720062.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376055|ref|NP_720098.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24345797|gb|AAN53441.1|AE015483_7 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24346641|gb|AAN54099.1|AE015547_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347584|gb|AAN54821.1|AE015620_13 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350044|gb|AAN56734.1|AE015809_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350684|gb|AAN57230.1|AE015858_11 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350834|gb|AAN57354.1|AE015872_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24351025|gb|AAN57506.1|AE015887_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24351071|gb|AAN57542.1|AE015890_3 ISSod4, transposase [Shewanella oneidensis MR-1] (400 aa)
Score = 265, Expect = 7.6e-22, Identities = 57/145 (39%), Positives = 84/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL ++           N + GKT KT+    G  +++ PRD N TFEPQL++K+Q  L D IE  ++ ++S GMS R+I     DMYG  V    VS +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDP--------QPNRKNGKTPKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHVEDMYGLNVSNATVSAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|124547650|ref|ZP_01706506.1| transposase, mutator type [Shewanella putrefaciens 200] >gi|124509051|gb|EAY53136.1| transposase, mutator type [Shewanella putrefaciens 200] (400 aa)
Score = 265, Expect = 8.0e-22, Identities = 57/145 (39%), Positives = 84/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL ++           N + GKT KT+    G  +++ PRD N TFEPQL++K+Q  L D IE  ++ ++S GMS R+I     DMYG  V    VS +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDP--------QPNRKNGKTPKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHVEDMYGINVSNATVSAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|24371974|ref|NP_716016.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24372187|ref|NP_716229.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24372850|ref|NP_716892.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373014|ref|NP_717056.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373185|ref|NP_717228.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373440|ref|NP_717483.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373638|ref|NP_717681.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373825|ref|NP_717868.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373869|ref|NP_717912.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373891|ref|NP_717934.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24373939|ref|NP_717982.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374345|ref|NP_718388.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374349|ref|NP_718392.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374567|ref|NP_718610.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374909|ref|NP_718952.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374953|ref|NP_718996.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24374959|ref|NP_719002.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375022|ref|NP_719065.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375026|ref|NP_719069.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375209|ref|NP_719252.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375315|ref|NP_719358.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375347|ref|NP_719390.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375364|ref|NP_719407.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375370|ref|NP_719413.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375432|ref|NP_719475.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375511|ref|NP_719554.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24375651|ref|NP_719694.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376179|ref|NP_720223.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376263|ref|NP_720371.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376307|ref|NP_720415.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24376352|ref|NP_720460.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24345826|gb|AAN53461.1|AE015486_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24346093|gb|AAN53674.1|AE015506_9 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24346955|gb|AAN54337.1|AE015570_11 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347176|gb|AAN54501.1|AE015588_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347403|gb|AAN54672.1|AE015608_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347724|gb|AAN54927.1|AE015631_3 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24347979|gb|AAN55125.1|AE015649_7 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348223|gb|AAN55312.1|AE015668_13 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348283|gb|AAN55356.1|AE015673_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348310|gb|AAN55378.1|AE015675_10 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348374|gb|AAN55426.1|AE015680_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348899|gb|AAN55832.1|AE015720_4 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24348903|gb|AAN55836.1|AE015720_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349166|gb|AAN56054.1|AE015740_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349616|gb|AAN56396.1|AE015776_6 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349671|gb|AAN56440.1|AE015780_11 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349680|gb|AAN56446.1|AE015781_6 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349763|gb|AAN56509.1|AE015788_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349767|gb|AAN56513.1|AE015788_9 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349997|gb|AAN56696.1|AE015805_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350125|gb|AAN56802.1|AE015815_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350165|gb|AAN56834.1|AE015818_10 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350188|gb|AAN56851.1|AE015820_4 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350197|gb|AAN56857.1|AE015821_2 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350276|gb|AAN56919.1|AE015826_4 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350380|gb|AAN56998.1|AE015834_1 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24350565|gb|AAN57138.1|AE015849_5 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24351224|gb|AAN57666.1|AE015902_8 ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24344732|gb|AAN52971.1| ISSod4 transposase, TnpA_ISSod4_46 [Shewanella oneidensis MR-1] >gi|24345199|gb|AAN53015.1| ISSod4 transposase, TnpA_ISSod4_48 [Shewanella oneidensis MR-1] >gi|24345263|gb|AAN53060.1| ISSod4 transposase, TnpA_ISSod4_51 [Shewanella oneidensis MR-1] (400 aa)
Score = 265, Expect = 8.0e-22, Identities = 57/145 (39%), Positives = 84/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL ++           N + GKT KT+    G  +++ PRD N TFEPQL++K+Q  L D IE  ++ ++S GMS R+I     DMYG  V    VS +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDP--------QPNRKNGKTPKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHVEDMYGLNVSNATVSAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|24375104|ref|NP_719147.1| ISSod4, transposase [Shewanella oneidensis MR-1] >gi|24349869|gb|AAN56591.1|AE015797_2 ISSod4, transposase [Shewanella oneidensis MR-1] (400 aa)
Score = 265, Expect = 8.3e-22, Identities = 57/145 (39%), Positives = 84/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL ++           N + GKT KT+    G  +++ PRD N TFEPQL++K+Q  L D IE  ++ ++S GMS R+I     DMYG  V    VS +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDP--------QPNRKNGKTPKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHVEDMYGLNVSNATVSAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|27228690|ref|NP_758733.1| transposase [Erwinia pyrifoliae] >gi|26245284|gb|AAN04528.1| transposase [Erwinia pyrifoliae] (403 aa)
Score = 263, Expect = 1.3e-21, Identities = 59/167 (35%), Positives = 101/167 (60%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREI-QDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  H G+EK   N+ +  +N R G + KT+    G +++  PRD  +T +PQL++K Q  +  ++  I+ LY+KGM+TREI    F +MY A V   L+ +VTD +  ++  WQ+RPL+ +Y ++ L
  S:     4 KKLKALAAELAK--GLKTEADLNAFSRMLTKLTVETALNAELTEHPGHEK---NAPKAGSNTRNGYSSKTVLCDDGDIELSTPRDRENTSQPQLIKKSQTRITQMDSQILSLYAKGMTTREIVAATFXEMYDADVSPTLIXKVTDAVKEQVAEWQTRPLDALYPIVYL 166
>gi|50955731|ref|YP_063019.1| transposase, undefined [Leifsonia xyli subsp. xyli str. CTCB07] >gi|50952213|gb|AAT89914.1| transposase, undefined [Leifsonia xyli subsp. xyli str. CTCB07] (228 aa)
Score = 263, Expect = 1.4e-21, Identities = 50/127 (39%), Positives = 78/127 (61%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEIL 171
           L++ LTKS +E  LD E   HLGY K D       N+    ++K  +    G + +E+PR    +FEP++VRKHQR L  ++  I+ L ++G++T EI  +F ++YGA V KD +SR+TDK+  E++
  S:    51 LMRALTKSVLETVLDEEFAEHLGYGKHDVAGYHTGNSRNGTRSKTVITDAVGPVVIEVPRGREGSFEPKIVRKHQRRLGQVDEIILSLTARGLTTGEISALFAEIYGASVSKDTISRITDKVSEEMI 177
>gi|160871725|ref|ZP_02061857.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872321|ref|ZP_02062453.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872379|ref|ZP_02062511.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872641|ref|ZP_02062773.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872704|ref|ZP_02062836.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872855|ref|ZP_02062987.1| transposase, Mutator family [Rickettsiella grylli] >gi|159120524|gb|EDP45862.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121120|gb|EDP46458.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121178|gb|EDP46516.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121440|gb|EDP46778.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121503|gb|EDP46841.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121654|gb|EDP46992.1| transposase, Mutator family [Rickettsiella grylli] (407 aa)
Score = 262, Expect = 1.7e-21, Identities = 64/154 (41%), Positives = 93/154 (60%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL-LMELDLKLE 196
           D +L  L K  IE SL+ E++ HL  E     + E SN  R GKT K L T+    ++E PRD   TFEPQ+V+K Q  LN+ +++ I+ LY+ GMS   IQD   DMYG  V    +S ++DK++P I  W++RPLE +Y ++ L  M   +++E
  S:    28 DGILTPLIKQIIEASLEGELESHLLSE---SKTPELSNR-RNGKTSKVLKTETESFELETPRDRLGTFEPQMVKKRQTVLNESLDNKILSLYALGMSYEAIQDHLADMYGLEVSAAKISLISDKLMPVITEWRNRPLESVYPIVFLDAMHFKVRIE 179
>gi|91780358|ref|YP_555565.1| putative transposase, mutator type [Burkholderia xenovorans LB400] >gi|91693018|gb|ABE36215.1| Putative transposase, mutator type [Burkholderia xenovorans LB400] (418 aa)
Score = 262, Expect = 2.1e-21, Identities = 58/165 (35%), Positives = 95/165 (57%)
  Q:    18 IMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++A+ +   AE +L + G         L  +L K   E+ L   ++ HL  E    + +  + N+R G + KT+ T  G+L ++IPR+  +T  PQLV K+QR L   + ++I +Y++GMS REIQ   L++YG  V   L+S +TD++L ++  WQ RPLE +Y
  S:    27 LLAQVQGKDAESILGESG---------LAGQLRKQLAERMLAAGLNHHLETE----SEQGKAGNHRNGTSPKTVLTPSGELKLDIPRERQATSGPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPGLISTITDEVLADVEEWQQRPLEAMY 178
>gi|24374871|ref|NP_718914.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24349569|gb|AAN56358.1|AE015773_3 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 262, Expect = 2.1e-21, Identities = 59/145 (40%), Positives = 82/145 (56%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L  E+DGHL   +          N + GKT KT+ +  G  ++  PRD   TFEPQLV+KHQ  L D +E  II L+S G S ++I+    DMYG  V    V+ +TDK+LPE+  W+ R LE +Y ++ L
  S:    25 DGILTPLIKQLTEAALAAELDGHLASTE--------GANRKNGKTTKTVKSPLGNFELNTPRDRAGTFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWL 162
>gi|24375766|ref|NP_719809.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24350711|gb|AAN57253.1|AE015861_5 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 262, Expect = 2.1e-21, Identities = 59/145 (40%), Positives = 82/145 (56%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L  E+DGHL   +          N + GKT KT+ +  G  ++  PRD   TFEPQLV+KHQ  L D +E  II L+S G S ++I+    DMYG  V    V+ +TDK+LPE+  W+ R LE +Y ++ L
  S:    25 DGILTPLIKQLTEAALAAELDGHLASTE--------GANRKNGKTTKTVKSPLGNFELNTPRDRAGTFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWL 162
>gi|16420394|gb|AAL20775.1| putative transposase [Salmonella typhimurium LT2] (285 aa)
Score = 261, Expect = 2.2e-21, Identities = 59/162 (36%), Positives = 98/162 (60%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           KK K+ A +L +  G++ + D ++  + L K  +E  L+ E+  H GYEK   N+ +  +N R G + KT+    G++++  PRD  +TFEPQL++KHQ  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++   Q+R  + +Y
  S:     4 KKLKALAVELAK--GLKTEADLNSFSRMLAKLTVETVLNAELADHPGYEK---NAPKTGSNTRNGYSSKTVLCDDGEIELNTPRDRENTFEPQLLKKHQTRITQMDSQILSLYAKGMTTREIVATFKEMYDANVSPSLISKVTDAVKEQVTERQNRQPDALY 160
>gi|4007787|emb|CAA51375.1| hypothetical protein [Sphingomonas sp.] (185 aa)
Score = 261, Expect = 2.3e-21, Identities = 47/105 (44%), Positives = 69/105 (65%)
  Q:    81 NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           N R G  +KT+ T  GKL +++P D  S+F+PQL+ K+QR     +  I+ +Y++GM+TREI     D+YG  V  DL+S VTD +L E+ TWQ RPL+ +Y L+
  S:    61 NMRNGYGRKTVMTDTGKLAIDVPADRQSSFDPQLIAKYQRRFPGFDDKIVSMYARGMTTREITRHLHDLYGIDVSPDLISTVTDAVLDEVATWQQRPLDPVYPLV 165
>gi|24375974|ref|NP_720017.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24350967|gb|AAN57461.1|AE015881_8 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 260, Expect = 3.2e-21, Identities = 59/145 (40%), Positives = 82/145 (56%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L  E+DGHL   +          N + GKT KT+ +  G  ++  PRD   TFEPQLV+KHQ  L D +E  II L+S G S ++I+    DMYG  V    V+ +TDK+LPE+  W+ R LE +Y ++ L
  S:    25 DGILTPLIKQLTEAALAAELDGHLASTE--------GANRKNGKTTKTVKSPLGNFELNTPRDRAGTFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWL 162
>gi|160871660|ref|ZP_02061792.1| transposase, Mutator family [Rickettsiella grylli] >gi|160871990|ref|ZP_02062122.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872219|ref|ZP_02062351.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872257|ref|ZP_02062389.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872571|ref|ZP_02062703.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872670|ref|ZP_02062802.1| transposase, Mutator family [Rickettsiella grylli] >gi|160872908|ref|ZP_02063040.1| transposase, Mutator family [Rickettsiella grylli] >gi|159120459|gb|EDP45797.1| transposase, Mutator family [Rickettsiella grylli] >gi|159120789|gb|EDP46127.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121018|gb|EDP46356.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121056|gb|EDP46394.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121370|gb|EDP46708.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121469|gb|EDP46807.1| transposase, Mutator family [Rickettsiella grylli] >gi|159121707|gb|EDP47045.1| transposase, Mutator family [Rickettsiella grylli] (406 aa)
Score = 259, Expect = 3.7e-21, Identities = 63/154 (40%), Positives = 90/154 (58%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL-LMELDLKLE 196
           D +L  L K  IE SL+ E+D HL   K    S     N R GKT K L T     ++E PRD   TFEPQ+V+K Q  LN+ +++ I+ LY+ GMS   IQ+   DMYG  V    +S ++DK++P I  W++RPLE +Y ++ L  M   +++E
  S:    28 DGILTPLIKQIIEASLEGEIDAHLSESKATDIS-----NRRNGKTSKLLKTGTESFELETPRDRLGTFEPQMVKKRQTVLNESLDNKILSLYALGMSYEAIQEHLADMYGLEVSAAKISLISDKLMPVITEWRNRPLESVYPIVFLDAMHFKVRIE 178
>gi|83592154|ref|YP_425906.1| transposase [Rhodospirillum rubrum ATCC 11170] >gi|83575068|gb|ABC21619.1| Transposase, mutator type [Rhodospirillum rubrum ATCC 11170] (236 aa)
Score = 259, Expect = 4.1e-21, Identities = 46/107 (42%), Positives = 68/107 (63%)
  Q:    79 SNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           + N R G  +KT+ T  G L +++PRD  S+F+PQ++ K QR     +  I+ +Y++GMSTREI     ++YG  V  DL+S VTD +L EI  WQ RPL+ +Y L+
  S:    11 AGNTRNGYGRKTVMTDTGSLAIDVPRDRQSSFDPQMIAKDQRRFPGFDEKIVSMYARGMSTREITGHLQELYGIDVSPDLISTVTDAVLDEIAAWQQRPLDPVYPLV 117
>gi|24375366|ref|NP_719409.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24350190|gb|AAN56853.1|AE015820_6 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 257, Expect = 7.0e-21, Identities = 59/145 (40%), Positives = 81/145 (55%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L  E+DGHL   +          N + GKT KT+ +  G  ++  PRD   TFEPQLV+KHQ  L D +E  II L+S G S ++I+    DMYG  V    V+ +TDK+LPE+  W+ R LE  Y ++ L
  S:    25 DGILTPLIKQLTEAALAAELDGHLASTE--------GANRKNGKTTKTVKSPLGNFELNTPRDRAGTFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPPYPVIWL 162
>gi|120599436|ref|YP_964010.1| transposase, mutator type [Shewanella sp. W3-18-1] >gi|120559529|gb|ABM25456.1| transposase, mutator type [Shewanella sp. W3-18-1] (216 aa)
Score = 257, Expect = 7.9e-21, Identities = 59/145 (40%), Positives = 82/145 (56%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L  E+DGHL   +          N + GKT KT+ +  G  ++  PRD   TFEPQLV+KHQ  L D +E  II L+S G S ++I+    DMYG  V    V+ +TDK+LPE+  W+ R LE +Y ++ L
  S:    25 DGILTPLIKQLTEAALAAELDGHLASTE--------GANRKNGKTTKTVKSPLGNFELNTPRDRAGTFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWL 162
>gi|24373965|ref|NP_718008.1| ISSod5, transposase [Shewanella oneidensis MR-1] >gi|24348407|gb|AAN55452.1|AE015682_7 ISSod5, transposase [Shewanella oneidensis MR-1] (401 aa)
Score = 255, Expect = 1.1e-20, Identities = 60/145 (41%), Positives = 83/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L  E+D HL        S E +N  + GKT KT+ +  G  ++  PRD   TFEPQLV+KHQ  L D +E  II L+S G S ++I+    DMYG  V    V+ +TDK+LPE+  W+ R LE +Y ++ L
  S:    25 DGILTPLIKQLTEAALAAELDSHL-------TSTEGANR-KNGKTTKTIKSPLGNFELNTPRDRAGTFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWL 162
>gi|91793530|ref|YP_563181.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91715532|gb|ABE55458.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 255, Expect = 1.3e-20, Identities = 53/145 (36%), Positives = 85/145 (58%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL +++          N + GKT KT+    G  ++E PRD N +FEPQL++K+Q  L D I+  ++ ++S GMS R+I     +MYG  V    ++ +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDE--------QPNRKNGKTAKTIKHLSGSFELETPRDRNGSFEPQLIKKNQTTLTDEIDRKVLSMFSMGMSYRDINQHVEEMYGINVSSATINAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|91795065|ref|YP_564716.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91717067|gb|ABE56993.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 255, Expect = 1.3e-20, Identities = 53/145 (36%), Positives = 85/145 (58%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL +++          N + GKT KT+    G  ++E PRD N +FEPQL++K+Q  L D I+  ++ ++S GMS R+I     +MYG  V    ++ +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDE--------QPNRKNGKTAKTIKHLSGSFELETPRDRNGSFEPQLIKKNQTTLTDEIDRKVLSMFSMGMSYRDINQHVEEMYGINVSSATINAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|148653847|ref|YP_001280940.1| transposase, mutator type [Psychrobacter sp. PRwf-1] >gi|148572931|gb|ABQ94990.1| transposase, mutator type [Psychrobacter sp. PRwf-1] (399 aa)
Score = 254, Expect = 1.8e-20, Identities = 53/140 (37%), Positives = 86/140 (61%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLN-DIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D +L  L K   E +L+ E+  HL     +Q+S   ++N R G +KKT+ +  G  ++E PRD N  +EP LV+KHQ  L  +I+  I+ L+S GMS R+I+    ++Y   V +  +S +TD+++P++  WQSRPL+ +Y
  S:    23 DGVLAPLIKQLTEAALNAEIQSHL-----EQSS---TSNRRNGYSKKTVKSAAGSFELETPRDRNGEYEPVLVKKHQTKLTAEIDSRILSLFSHGMSYRDIRHHIAEIYQLEVSEATISSITDELIPQLKAWQSRPLDSVY 155
>gi|91791731|ref|YP_561382.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91713733|gb|ABE53659.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 253, Expect = 2.1e-20, Identities = 53/145 (36%), Positives = 85/145 (58%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ HL +++          N + GKT KT+    G  ++E PRD N +FEPQL++K+Q  L D I+  ++ ++S GMS R+I     +MYG  V    ++ +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDE--------QPNRKNGKTAKTIKHLSGSFELETPRDRNGSFEPQLIKKNQTTLTDEIDRKVLSMFSMGMSYRDINQHVEEMYGINVSSVTINAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|10955377|ref|NP_053089.1| hypothetical protein pB171_027 [Escherichia coli] >gi|190014888|ref|YP_001965400.1| Hypothetical IS protein [Escherichia coli] >gi|1004096|gb|AAB36833.1| transposase [Escherichia coli] >gi|6009403|dbj|BAA84862.1| orf27 [Escherichia coli] >gi|109389609|gb|ABG29528.1| Hypothetical IS protein [Escherichia coli] (150 aa)
Score = 252, Expect = 2.7e-20, Identities = 57/135 (42%), Positives = 84/135 (62%)
  Q:    37 ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEIL 171
           E+   FD LLK+L+   +E +L+ EM  HLGYEK   N      N R G   KT+ T  G L++  PRD + TFEPQLV+K+Q  +  + + I+ LY+KGM+TREI   F ++Y A V   L+S+VTD ++ +++
  S:    21 EDLSQFDRLLKKLS---VEAALNAEMTHHLGYEK---NQSRLGANTRNGYPTKTVITGDGPLELRTPRDRDGTFEPQLVKKNQTRITGMGNQILSLYAKGMATREIAAAFKELYDADVSPALISKVTDAVMEQVV 149
>gi|111219965|ref|YP_710759.1| putative transposase [Frankia alni ACN14a] >gi|111147497|emb|CAJ59148.1| Putative transposase [Frankia alni ACN14a] (176 aa)
Score = 251, Expect = 3.4e-20, Identities = 45/109 (41%), Positives = 76/109 (69%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG 151
           D LL ++TK+ +E++L VEM  HLGYE  D  + + + N R G++ KT++T+ G +++E+PRD N +FEP +V K  R + +++  I+ LYS+GM+TR+I+    ++YG
  S:    46 DGLLNQMTKAVLERALQVEMTDHLGYEVGDP-AGQGTGNSRNGRSTKTVSTRNGPVEIEVPRDRNGSFEPTIVPKRARRIGNLDDTILSLYSRGMTTRDIEAHLREVYG 153
>gi|71734059|ref|YP_276792.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71554612|gb|AAZ33823.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (359 aa)
Score = 251, Expect = 3.8e-20, Identities = 45/106 (42%), Positives = 65/106 (61%)
  Q:    77 EFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:    10 EGSTNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 115
>gi|282485|pir||B43871 probable transposase - Clostridium perfringens (167 aa)
Score = 249, Expect = 5.6e-20, Identities = 59/147 (40%), Positives = 89/147 (60%)
  Q:    36 VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +E  E   N++K L    I++ L+ EM+ +LGY K+D +++  +++ R  + +KT+     K D++IPRD   +FEPQ+ +KHQ     I   I   Y+KGMSTR+I     +MYG  V   L+S +TDKI+P I  WQ +PLE IY
  S:    28 IETAEYAQNVIKSLFGGLIQQILEAEMEEYLGYLKYDYSNKNTTDS-RNWENEKTV-----KFDLDIPRDREGSFEPQIEKKHQTTRKFI---IGGRYAKGMSTRDIATQVNEMYGMDVSPTLISNITDKIIPSIKEWQCKPLESIY 165
>gi|82775609|ref|YP_401956.1| hypothetical protein SDY_0243 [Shigella dysenteriae Sd197] >gi|81239757|gb|ABB60467.1| hypothetical protein SDY_0243 [Shigella dysenteriae Sd197] (163 aa)
Score = 248, Expect = 7.6e-20, Identities = 57/146 (39%), Positives = 92/146 (63%)
  Q:    21 KKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKI 166
           KK K+ A +L +  G++ + D +   + LTK  +E +L+ E+  HLG+EK   N+ +  +N R G + KT+    G++++  PRD  +TFEPQL++KHQ  +  ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +
  S:    17 KKLKALAAELAK--GLKTEADLNQFSRMLTKLTVETALNAELTDHLGHEK---NAPKSGSNTRNGYSSKTVLCDDGEIELNTPRDRENTFEPQLIKKHQTRITQMDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAV 157
>gi|67459848|ref|YP_247471.1| transposase [Rickettsia felis URRWXCal2] >gi|67459893|ref|YP_247515.1| transposase [Rickettsia felis URRWXCal2] >gi|67005381|gb|AAY62306.1| Transposase [Rickettsia felis URRWXCal2] >gi|67005426|gb|AAY62350.1| Transposase [Rickettsia felis URRWXCal2] (168 aa)
Score = 248, Expect = 8.9e-20, Identities = 54/117 (46%), Positives = 77/117 (65%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLV 159
           D LLKELTK  +EK+L  EM+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+FEP LV K QR L+  +  ++ LY+KGMS  +I+    ++YGA V + L+
  S:    49 DGLLKELTKHLVEKALQSEMNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFEPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYGADVSESLI 162
>gi|91793412|ref|YP_563063.1| transposase, mutator type [Shewanella denitrificans OS217] >gi|91715414|gb|ABE55340.1| transposase, mutator type [Shewanella denitrificans OS217] (400 aa)
Score = 247, Expect = 1.0e-19, Identities = 51/145 (35%), Positives = 84/145 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D++L  L K   E +L  E++ H  +++          N + GKT KT+    G  +++ PRD N +FEPQL++K+Q  L D I+  ++ ++S GMS R+I     +MYG  V    ++ +TDK++PE+  WQ RPL+  Y ++ L
  S:    24 DSILGPLIKQLTEAALQAELEQHSAHDE--------QPNRKNGKTAKTIKHPSGSFELDTPRDRNGSFEPQLIKKNQTTLTDEIDRKVLSMFSMGMSYRDINQHVEEMYGINVSSATINAITDKLIPELKAWQQRPLDSHYPIVWL 161
>gi|83943406|ref|ZP_00955865.1| TRm3 transposase [Sulfitobacter sp. EE-36] >gi|83845638|gb|EAP83516.1| TRm3 transposase [Sulfitobacter sp. EE-36] (155 aa)
Score = 243, Expect = 3.2e-19, Identities = 49/126 (38%), Positives = 78/126 (61%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSN--NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEI 170
           +L ELTK+  E++L  EMD HL  E+ D  S   +   N R G ++KT+    GK+ ++IPRD N TF+P L+ K+QR   + +  I+ +Y++GM+TREIQ    ++YG      L+S + D ++ E+
  S:    26 ILAELTKALAERALSTEMDVHLDEERADDASEGQTQPPNRRNGSSQKTVTMDSGKVVLDIPRDRNGTFDPMLIAKYQRRFPEFDRKIVSMYARGMTTREIQGHIEEIYGVEASPSLISAIPDAVMEEV 153
>gi|27228664|ref|NP_758714.1| transposase [Pseudomonas resinovorans] >gi|26106252|dbj|BAC41692.1| transposase [Pseudomonas resinovorans] (416 aa)
Score = 242, Expect = 4.1e-19, Identities = 48/107 (44%), Positives = 64/107 (59%)
  Q:    81 NYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           N R G + KTL   +G+L + IPRD  + FEPQLV K Q      +  II LY++G+S REIQ    +MYG  V   L+S VTD +  E+  WQ RPL+ +Y +L L
  S:    74 NARNGHSDKTLKGDFGELPLAIPRDRQALFEPQLVAKQQTRWTGFDDKIISLYARGLSVREIQGHLEEMYGTEVSPTLISTVTDAVSDEVKLWQGRPLDPLYPILYL 180
>gi|29349845|ref|NP_813348.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29341756|gb|AAO79542.1| transposase [Bacteroides thetaiotaomicron VPI-5482] (404 aa)
Score = 237, Expect = 1.3e-18, Identities = 54/140 (38%), Positives = 80/140 (57%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D     L +S +  +L+ EMD HL  E+    +R      R GK +K + T  G++ V  PRD NS+F+PQ ++K +  L + +   II LY+ G STREI D   +  G  V  D +S +TD++LPEI  W+SR L+ +Y
  S:    28 DGAFAPLLESILNAALEGEMDAHLTEEERQMGNR------RNGKMQKQVQTPLGEVTVSTPRDRNSSFDPQFIKKRETILAEGVADRIIGLYAMGNSTREISDWMEENLGNRVSADTISSITDRVLPEIKAWKSRMLDSVY 162
>gi|111017032|ref|YP_700004.1| transposase mutator family protein [Rhodococcus sp. RHA1] >gi|110816562|gb|ABG91846.1| probable transposase, mutator family protein [Rhodococcus sp. RHA1] (338 aa)
Score = 235, Expect = 2.3e-18, Identities = 39/93 (41%), Positives = 66/93 (70%)
  Q:    93 TKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           T+ G + +++PRD +++F+PQ+V+K QR L  ++  I+ L +KG++T EI   F D+YGA V K+ +S++TDK+L E+  W  RPL+ +Y +L
  S:     3 TEIGPVQIQVPRDTDASFDPQIVKKRQRRLTGVDEIILSLSAKGLTTGEIAAHFDDVYGASVSKETISKITDKVLTEMAEWSVRPLDPVYPVL 95
>gi|14518308|ref|NP_116791.1| putative transposase [Microscilla sp. PRE1] >gi|14484943|gb|AAK62825.1| MS103, putative transposase [Microscilla sp. PRE1] (413 aa)
Score = 235, Expect = 2.5e-18, Identities = 47/121 (38%), Positives = 78/121 (64%)
  Q:    67 GYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G+   DQ  R   N  R GK +KT+ + +G++ ++ P+D +S FEPQ++ K QR L D +E  II +Y  G S R+IQD   +MY   +  +++S +TD+++P++  WQ+RPLE +Y ++ L
  S:    48 GHLSSDQKGRPMGNK-RNGKGQKTVKSSHGEVQIQTPQDRHSNFEPQIIEKRQRILADNLEKQIIAMYGLGNSLRDIQDHIKEMYDTDISTEVLSDITDRVVPKVKEWQNRPLEPVYCIVWL 168
>gi|84621837|ref|YP_449209.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|84365777|dbj|BAE66935.1| IS1113 transposase [Xanthomonas oryzae pv. oryzae MAFF 311018] (331 aa)
Score = 235, Expect = 2.7e-18, Identities = 42/92 (45%), Positives = 62/92 (67%)
  Q:    96 GKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G+L +E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L++++TD +L E   WQSRPLE IY ++ L
  S:     2 GELQIETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQMTDAVLEEARAWQSRPLEAIYPIVWL 93
>gi|58424420|gb|AAW73457.1| putative IS1113 transposase [Xanthomonas oryzae pv. oryzae KACC10331] (339 aa)
Score = 228, Expect = 1.7e-17, Identities = 41/94 (43%), Positives = 60/94 (63%)
  Q:    94 KYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           ++     E PRD   TF PQLV+K Q  L  +E  I+ LY++GM+TR+I+   +D+YG  +   L+++VTD +L E   WQSRPLE IY ++ L
  S:     8 RWASCRCETPRDRAGTFAPQLVKKRQVRLAGMEEKILALYARGMTTRDIESALVDVYGVEISHGLIAQVTDAVLEEARAWQSRPLEAIYPIVWL 101
>gi|71725225|ref|YP_272225.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|55978473|gb|AAV68723.1| unknown [Pseudomonas syringae pv. phaseolicola] >gi|71558815|gb|AAZ38025.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (168 aa)
Score = 226, Expect = 3.2e-17, Identities = 50/143 (34%), Positives = 80/143 (55%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRV 162
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y++GM+ REI+    + YG  V  D +S V
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMYARGMTVREIRAFLSEQYGTDVSHDFISSV 155
>gi|29345690|ref|NP_809193.1| transposase for insertion sequence element ISRM3 [Bacteroides thetaiotaomicron VPI-5482] >gi|29347406|ref|NP_810909.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29348172|ref|NP_811675.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29337583|gb|AAO75387.1| transposase for insertion sequence element ISRM3 [Bacteroides thetaiotaomicron VPI-5482] >gi|29339306|gb|AAO77103.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29340075|gb|AAO77869.1| transposase [Bacteroides thetaiotaomicron VPI-5482] (405 aa)
Score = 224, Expect = 5.3e-17, Identities = 49/145 (33%), Positives = 81/145 (55%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D     L K F+E +LD EM  HL       +S     N R G+  K + T  G++D+  P+D +S+F P++++K +  L D +   II LY  G+S R+I     +MY   +  + +S + ++I+P++  WQSRPLE +Y ++ L
  S:    29 DGAFGPLLKEFLEAALDGEMSSHL------DDSERLKGNKRNGRGSKRVKTMAGEIDIVTPQDRHSSFSPEILKKRETILADNMSSKIISLYGMGLSLRDISSHIEEMYDVEISHNTLSEIIERIVPKVKEWQSRPLESMYTIVWL 168
>gi|67458441|ref|YP_246065.1| transposase [Rickettsia felis URRWXCal2] >gi|67003974|gb|AAY60900.1| Transposase [Rickettsia felis URRWXCal2] (193 aa)
Score = 223, Expect = 5.7e-17, Identities = 54/138 (39%), Positives = 87/138 (63%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDF------DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDK 156
           M +K+ ++ E+ ++ L + N  D       D LLKE+TK  +E++L  EM+ HLGY K++Q+    + N R G   K L TK G +++E+PRD NS+F P LV K QR L+  +  ++ LY+KGMS  +I+    ++Y +  D+
  S:    20 MTQKQNAAMEQAIDLL-INNDTDVSILFREDGLLKEITKRLVERALQSEMNNHLGYSKYNQSD---AQNSRNGYNTKNLITKNGAVEIEVPRDRNSSFAPSLVAKRQRRLDGFDDKVLSLYAKGMSLSDIKLQLQELYVSYKDR 159
>gi|160873087|ref|YP_001557092.1| transposase mutator type [Shewanella baltica OS195] >gi|160877500|ref|YP_001556816.1| transposase mutator type [Shewanella baltica OS195] >gi|160858609|gb|ABX51832.1| transposase mutator type [Shewanella baltica OS195] >gi|160863022|gb|ABX51556.1| transposase mutator type [Shewanella baltica OS195] (400 aa)
Score = 223, Expect = 5.9e-17, Identities = 50/145 (34%), Positives = 86/145 (59%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNL-NDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L+ E++ HL  +  DQ +R      + GK  K + +  G  ++E PRD   +FEPQLV+K+Q  L +D+E  I+ +++ GMS R+++    +MY   + +  +S VTD++LP++  W+ R L+ IY ++ L
  S:    24 DGILTPLIKQLTEAALNAELEQHLAND--DQPNR------KNGKASKKIKSMAGNFELETPRDRAGSFEPQLVKKNQTRLTDDLERKILSMFALGMSYRDMRAHVQEMYDMDISEATISSVTDQLLPKLKEWRQRQLDAIYPIVWL 161
>gi|82524466|ref|YP_406061.1| putative transposase [Shigella dysenteriae Sd197] >gi|81243864|gb|ABB64573.1| putative transposase [Shigella dysenteriae Sd197] (192 aa)
Score = 223, Expect = 7.1e-17, Identities = 38/90 (42%), Positives = 66/90 (73%)
  Q:    98 LDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +++  PRD + +FEPQLV+K+Q  +  +++ ++ LY++GM+TREI  VF +MY A V   L+S+VTD ++ +++ WQ+RPL+ IY ++ L
  S:     1 MELRTPRDRDGSFEPQLVKKNQTRITGMDNQLLALYARGMTTREITSVFKEMYDADVSPALISKVTDAVIDQVVEWQNRPLDAIYPIVYL 90
>gi|42520146|ref|NP_966061.1| IS256 family transposase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|42409883|gb|AAS13995.1| transposase, IS256 family [Wolbachia endosymbiont of Drosophila melanogaster] (410 aa)
Score = 222, Expect = 7.6e-17, Identities = 48/140 (34%), Positives = 78/140 (55%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLN-DIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           D  L    K  +E SL+ E++ H+       +++   NN R G+  KTL T  G  ++  PRD    FEPQ+V+K Q +L+ ++E  ++  Y+ GM  R+I     ++Y   +    +S +TDK+LP I  W+SRPL+ +Y
  S:    34 DGALTPFIKRLLEASLEGEIESHM-------SAKSEENNRRNGRNAKTLRTSAGSFELLTPRDREGNFEPQIVKKRQTSLHPELEAKVLSTYASGMGYRDIASHVEEIYDHKISAAEISSITDKLLPIINEWRSRPLQSVY 167
>gi|3647286|emb|CAA11690.1| transposase [Lactococcus lactis subsp. cremoris] >gi|3647291|emb|CAA11694.1| transposase [Lactococcus lactis subsp. cremoris] >gi|3647296|emb|CAA11698.1| transposase [Lactococcus lactis subsp. cremoris] >gi|3647299|emb|CAA11700.1| transposase [Lactococcus lactis subsp. cremoris] (201 aa)
Score = 221, Expect = 1.1e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|22536628|ref|NP_687479.1| IS256 family transposase [Streptococcus agalactiae 2603V/R] >gi|76797756|ref|ZP_00780023.1| transposase, Mutator family [Streptococcus agalactiae 18RS21] >gi|22533466|gb|AAM99351.1|AE014212_10 transposase, IS256 family [Streptococcus agalactiae 2603V/R] >gi|76586904|gb|EAO63395.1| transposase, Mutator family [Streptococcus agalactiae 18RS21] (391 aa)
Score = 221, Expect = 1.1e-16, Identities = 50/149 (33%), Positives = 76/149 (51%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L VE+   LGYE +D+     + N R G   +   TKYG +++ IPRD N  F P L+  + R  N +E  +IKLY  G++TREI D+   MYG       VS ++      + ++  R LE  Y +L L
  S:    15 KQDIDEFFRSSLETAMNDLLQVELSAFLGYEPYDKAGYN-TGNSRNGAYTRRFETKYGVVNLLIPRDRNGEFSPALIPSYGRRDNHLEEMVIKLYRTGVTTREISDIIERMYGHHYSPATVSNISKATQENVASFHERSLEANYTVLYL 162
>gi|118578583|ref|YP_899833.1| transposase mutator family protein [Pelobacter propionicus DSM 2379] >gi|118501293|gb|ABK97775.1| transposase, mutator family [Pelobacter propionicus DSM 2379] (146 aa)
Score = 218, Expect = 2.4e-16, Identities = 47/120 (39%), Positives = 70/120 (58%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRV 162
           + LLK+LTK  +E+++  E+  HLGYEK     +  S N R G  KKT+   +G LD+  PRD NSTFEP ++ K +      +  II +Y++GM+TR+IQ    ++YG  V      R+
  S:    25 NGLLKQLTKRLLERAMQTELTEHLGYEKHAPTGKN-SGNSRNGGYKKTITGDFGNLDITTPRDRNSTFEPVILPKGETRFTGFDDKIISMYARGMTTRDIQGHLQEIYGIDVSPTTTVRL 143
>gi|116627700|ref|YP_820319.1| transposase [Streptococcus thermophilus LMD-9] >gi|22416337|emb|CAC87148.1| transposase [Streptococcus thermophilus] >gi|116100977|gb|ABJ66123.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 217, Expect = 3.0e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRYDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|15384307|gb|AAK96240.1|AF406971_5 transposase [Enterococcus hirae] (391 aa)
Score = 217, Expect = 3.4e-16, Identities = 49/153 (32%), Positives = 85/153 (55%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
            +  K+D D + +   +  I + L  E+   LGYE++        NN R G  +++ +TKYG+L++ IPRD N  FE   +  + R+ +++E  +I+LY+KG++T EI ++  +MYGA   K  VS +T  +  ++  +Q R L   Y  + L
  S:    11 ALAQKQDLDEVFRHHLEIAINQLLQTELAEFLGYERYSYAGINTGNN-RNGSYERSFDTKYGQLNLTIPRDRNGRFENHTLPAYGRHSDNLETTVIQLYTKGITTAEIAELIENMYGAHYSKATVSNMTKAVNEQVQAFQQRRLASQYAAIFL 162
>gi|3063936|emb|CAA04878.1| ISRm3 homologue [Rhizobium leguminosarum] (164 aa)
Score = 216, Expect = 3.7e-16, Identities = 52/143 (36%), Positives = 78/143 (54%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQL-VRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           D LL +L K+  E+ L+ ++D HL  E+ +        N R G +KKT+ T   K+ + IPR       P+      +R   D +  II +Y++GM+ REIQ    ++YG  V  DL+S VTD +L  +  WQ+RPLE  Y L+
  S:    11 DGLLDDLKKALSERILNADVDDHLDVERLEGGPA----NRRNGSSKKTVLTGTSKMTLTIPRRSGGYLRPKADTPDIKRRFPDFDDKIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVEEWQNRPLELCYPLV 150
>gi|126090286|ref|YP_001041741.1| transposase, mutator type [Shewanella baltica OS155] >gi|125999917|gb|ABN63986.1| transposase, mutator type [Shewanella baltica OS155] (389 aa)
Score = 216, Expect = 4.5e-16, Identities = 55/145 (37%), Positives = 76/145 (52%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D +L  L K   E +L  E+DGHL   +          N + GKT KT+ +  G             FEPQLV+KHQ  L D +E  II L+S G S ++I+    DMYG  V    V+ +TDK+LPE+  W+ R LE +Y ++ L
  S:    25 DGILTPLIKQLTEAALAAELDGHLASTE--------GANRKNGKTTKTVKSPIG------------NFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWL 150
>gi|125623419|ref|YP_001031902.1| transposase for insertion sequence element IS905B [Lactococcus lactis subsp. cremoris MG1363] >gi|124492227|emb|CAL97156.1| transposase for insertion sequence element IS905B [Lactococcus lactis subsp. cremoris MG1363] (391 aa)
Score = 215, Expect = 5.1e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|116512071|ref|YP_809287.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116512087|ref|YP_809303.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107725|gb|ABJ72865.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107741|gb|ABJ72881.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 215, Expect = 5.5e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|116511320|ref|YP_808536.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511444|ref|YP_808660.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511474|ref|YP_808690.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116512995|ref|YP_811902.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116513120|ref|YP_812027.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116106974|gb|ABJ72114.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107098|gb|ABJ72238.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107128|gb|ABJ72268.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116108649|gb|ABJ73789.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116108774|gb|ABJ73914.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 215, Expect = 5.7e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|15673186|ref|NP_267360.1| transposase of IS905 [Lactococcus lactis subsp. lactis Il1403] >gi|125622944|ref|YP_001031427.1| transposase for insertion sequence element IS905A [Lactococcus lactis subsp. cremoris MG1363] >gi|125623973|ref|YP_001032456.1| transposase for insertion sequence element IS905F [Lactococcus lactis subsp. cremoris MG1363] >gi|125624139|ref|YP_001032622.1| transposase for insertion sequence element IS905H [Lactococcus lactis subsp. cremoris MG1363] >gi|125624143|ref|YP_001032626.1| transposase for insertion sequence element IS905I [Lactococcus lactis subsp. cremoris MG1363] >gi|125625249|ref|YP_001033732.1| transposase for insertion sequence element IS905N [Lactococcus lactis subsp. cremoris MG1363] >gi|549109|sp|P35881|TRA5_LACLA Transposase for insertion sequence element IS905 >gi|12724173|gb|AAK05302.1|AE006353_1 transposase of IS905 [Lactococcus lactis subsp. lactis Il1403] >gi|437389|gb|AAA25167.1| transposase >gi|124491752|emb|CAL96671.1| transposase for insertion sequence element IS905A [Lactococcus lactis subsp. cremoris MG1363] >gi|124492781|emb|CAL97736.1| transposase for insertion sequence element IS905F [Lactococcus lactis subsp. cremoris MG1363] >gi|124492947|emb|CAL97910.1| transposase for insertion sequence element IS905H [Lactococcus lactis subsp. cremoris MG1363] >gi|124492951|emb|CAL97914.1| transposase for insertion sequence element IS905I [Lactococcus lactis subsp. cremoris MG1363] >gi|124494057|emb|CAL99057.1| transposase for insertion sequence element IS905N [Lactococcus lactis subsp. cremoris MG1363] (391 aa)
Score = 215, Expect = 5.8e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|116511735|ref|YP_808951.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107389|gb|ABJ72529.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 215, Expect = 5.9e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|549104|sp|P35880|TRA1_LACHE Transposase for insertion sequence element IS1201 >gi|425467|gb|AAA25249.1| transposase >gi|745531|prf||2016315A transposase (369 aa)
Score = 214, Expect = 6.4e-16, Identities = 43/150 (28%), Positives = 89/150 (59%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           N++  ++LL++  +  +   L+ E+   LGY  + ++    + N R G   + ++T++GK+++++PRD N  F    +  ++++ + +E+ IIKLYSKG++TREI D+   MYG+      VS ++ +++P++  +  R L D +  + L
  S:    14 NQDKINDLLRKELQQAVNDLLEAELTAFLGYNPYARDGWN-TGNSRNGAYFRKVDTQFGKIEIQVPRDRNGLFHQHTLPDYKQHSDVLENMIIKLYSKGVTTREIADLIEKMYGSHYSPAQVSNISKQMIPKVEAYHKRKLSDKFFCVYL 162
>gi|168712685|ref|ZP_02744962.1| putative transposase within CP-933O [Escherichia coli O157:H7 str. EC4045] >gi|168721830|ref|ZP_02754107.1| putative transposase within CP-933O [Escherichia coli O157:H7 str. EC4206] >gi|168739136|ref|ZP_02771413.1| putative transposase within CP-933O [Escherichia coli O157:H7 str. EC4115] >gi|168751516|ref|ZP_02776538.1| TnpA [Escherichia coli O157:H7 str. EC4113] >gi|168758048|ref|ZP_02783055.1| TnpA [Escherichia coli O157:H7 str. EC4401] >gi|168764921|ref|ZP_02789928.1| TnpA [Escherichia coli O157:H7 str. EC4501] >gi|168771755|ref|ZP_02796762.1| TnpA [Escherichia coli O157:H7 str. EC4486] >gi|168774151|ref|ZP_02799158.1| TnpA [Escherichia coli O157:H7 str. EC4196] >gi|168781592|ref|ZP_02806599.1| TnpA [Escherichia coli O157:H7 str. EC4076] >gi|168796437|ref|ZP_02821444.1| putative transposase within CP-933O [Escherichia coli O157:H7 str. EC4042] >gi|168802181|ref|ZP_02827188.1| TnpA [Escherichia coli O157:H7 str. EC508] >gi|195940378|ref|ZP_03085760.1| hypothetical protein EscherichcoliO157_28945 [Escherichia coli O157:H7 str. EC4024] >gi|13361691|dbj|BAB35648.1| putative transposase [Escherichia coli O157:H7 str. Sakai] >gi|187770164|gb|EDU34008.1| TnpA [Escherichia coli O157:H7 str. EC4196] >gi|188014437|gb|EDU52559.1| TnpA [Escherichia coli O157:H7 str. EC4113] >gi|189000889|gb|EDU69875.1| TnpA [Escherichia coli O157:H7 str. EC4076] >gi|189355094|gb|EDU73513.1| TnpA [Escherichia coli O157:H7 str. EC4401] >gi|189359559|gb|EDU77978.1| TnpA [Escherichia coli O157:H7 str. EC4486] >gi|189365166|gb|EDU83582.1| TnpA [Escherichia coli O157:H7 str. EC4501] >gi|189375784|gb|EDU94200.1| TnpA [Escherichia coli O157:H7 str. EC508] (140 aa)
Score = 214, Expect = 7.0e-16, Identities = 52/134 (38%), Positives = 84/134 (62%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGV 154
           K+ ++ A +L + L   E+   FD LLK+++   +E +L+ EM  HLGY   D+N  +   N R G + KT+ T  G L++  PRD + +FEPQLV+K+Q  +  +++ I+ LY+KG++TREI   F ++Y A V
  S:     4 KQLQALANELAKNLKTPEDLSQFDRLLKKIS---VEAALNAEMSHHLGY---DKNQPKPGANSRNGYSTKTVITGDGHLELRTPRDRDGSFEPQLVKKNQTRITGMDNQILSLYAKGLTTREIAAAFKELYDADV 132
>gi|405804|emb|CAA50683.1| transposase [Streptococcus thermophilus] >gi|15485431|emb|CAC67525.1| putative transposase [Streptococcus thermophilus] (391 aa)
Score = 213, Expect = 8.4e-16, Identities = 49/149 (32%), Positives = 75/149 (50%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI+D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREIRDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|111017487|ref|YP_700459.1| transposase [Rhodococcus sp. RHA1] >gi|110817017|gb|ABG92301.1| transposase [Rhodococcus sp. RHA1] (151 aa)
Score = 213, Expect = 8.6e-16, Identities = 34/92 (36%), Positives = 64/92 (69%)
  Q:    93 TKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYIL 184
           T+ G +++++PRD +++F+PQ+V++ QR L  ++  I+ L SKG++T EI   F D++GA V ++ + ++TDK+L E+  W  RPL+ +  +
  S:     3 TEIGPVEIQVPRDTDASFDPQIVKERQRRLTGVDEIILSLSSKGLTTGEIVAHFDDVFGASVSRETIGKITDKVLAEMAEWSLRPLDPVIFI 94
>gi|33321489|gb|AAQ06499.1| transposase [Lactobacillus crispatus] >gi|48926948|gb|AAT47511.1| transposase [Lactobacillus crispatus] (408 aa)
Score = 213, Expect = 9.4e-16, Identities = 44/150 (29%), Positives = 87/150 (57%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           N +  ++LL++  +  +   L+ E+   LGY+ + +N    + N R G   + ++T++G ++V++PRD N  F    +  ++++ + +E  IIKLYSKG++TREI D+   MYG+      VS ++ +++P++  +  R L D +  + L
  S:    30 NPDKINDLLRKELQQAVNNLLEAELTAFLGYDPYARNGWN-TGNSRNGAYFRKVDTQFGPIEVQVPRDRNGQFHQHTLPDYKQHSDILESMIIKLYSKGVTTREIADLIEKMYGSHYSPAQVSNISKQMIPKVEAYHKRKLSDKFFCVYL 178
>gi|14389012|gb|AAK61894.1|AF373595_2 transposase [Streptococcus thermophilus] (391 aa)
Score = 213, Expect = 9.9e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|22218130|gb|AAM94581.1|AF448502_2 transposase [Streptococcus thermophilus] (391 aa)
Score = 213, Expect = 9.9e-16, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|116627245|ref|YP_819864.1| transposase [Streptococcus thermophilus LMD-9] >gi|116100522|gb|ABJ65668.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 213, Expect = 1.0e-15, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|15801519|ref|NP_287536.1| putative transposase within CP-933O [Escherichia coli O157:H7 EDL933] >gi|12515024|gb|AAG56148.1|AE005345_10 putative transposase within CP-933O [Escherichia coli O157:H7 EDL933] (140 aa)
Score = 212, Expect = 1.2e-15, Identities = 47/118 (39%), Positives = 75/118 (63%)
  Q:    37 ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGV 154
           E+   FD LLK+++   +E +L+ EM  HLGY   D+N  +   N R G + KT+ T  G L++  PRD + +FEP+LV+K+Q  +  +++ I+ LY+KG++TREI   F ++Y A V
  S:    21 EDLSQFDRLLKKIS---VEAALNAEMSHHLGY---DKNQPKPGANSRNGYSTKTVITGDGHLELRTPRDRDGSFEPZLVKKNQTRITGMDNQILSLYAKGLTTREIAAAFKELYDADV 132
>gi|24636989|gb|AAN63505.1|AF410175_2 transposase [Streptococcus thermophilus] (391 aa)
Score = 212, Expect = 1.2e-15, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|116511796|ref|YP_809012.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511821|ref|YP_809037.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107450|gb|ABJ72590.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107475|gb|ABJ72615.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 211, Expect = 1.4e-15, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFIPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|55820896|ref|YP_139338.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55736881|gb|AAV60523.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 211, Expect = 1.4e-15, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    26 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRYDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKVTQENVATFHERSLEANYSVLFL 173
>gi|55822804|ref|YP_141245.1| IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738789|gb|AAV62430.1| IS1191, transposase, IS256 family [Streptococcus thermophilus CNRZ1066] (402 aa)
Score = 211, Expect = 1.5e-15, Identities = 49/149 (32%), Positives = 75/149 (50%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+ S   S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI+D+   MYG       +S ++      +  +  R LE  Y +L L
  S:    26 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLSYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREIRDIIERMYGHHYSPATISNISKATQENVAAFHERSLEANYSVLFL 173
>gi|55820420|ref|YP_138862.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55736405|gb|AAV60047.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 210, Expect = 1.9e-15, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    26 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 173
>gi|55821914|ref|YP_140356.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55737899|gb|AAV61541.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 210, Expect = 1.9e-15, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    26 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 173
>gi|51247021|ref|YP_066904.1| transposase (partial length) [Desulfotalea psychrophila LSv54] >gi|50878058|emb|CAG37914.1| probable transposase (partial length) [Desulfotalea psychrophila LSv54] (285 aa)
Score = 209, Expect = 2.7e-15, Identities = 44/92 (47%), Positives = 59/92 (64%)
  Q:    96 GKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           G  D++ PRD + +F PQL++KHQ  L+D +E  II LY  GMS R+I     DMYG  V    +S VTDKIL  +  WQ+RPLE +Y ++ L
  S:     3 GNFDLKTPRDRDGSFTPQLIKKHQTTLSDALEQKIIALYGLGMSYRDISSHIEDMYGLEVSTGTLSTVTDKILHTVKEWQARPLERVYPIVWL 95
>gi|115354051|emb|CAL48350.1| transposase [Lactobacillus amylovorus] (295 aa)
Score = 209, Expect = 2.8e-15, Identities = 43/150 (28%), Positives = 87/150 (57%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           N +  ++LL++  +  +   L+ E+   LGY+ + ++    + N R G   + ++T++G ++V++PRD N  F    +  ++++ + +E  IIKLYSKG++TREI D+   MYG+      VS ++ +++P++  +  R L D +  + L
  S:    14 NPDKINDLLRKELQQAVNNLLEAELTAFLGYDPYARSGWN-TGNSRNGAYFRKVDTQFGPIEVQVPRDRNGQFHQHTLPDYKQHSDILESMIIKLYSKGVTTREIADLIEKMYGSHYSPAQVSNISKQMIPKVEAYHKRKLSDKFFCVYL 162
>gi|55823022|ref|YP_141463.1| IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55739007|gb|AAV62648.1| IS1191, transposase, IS256 family [Streptococcus thermophilus CNRZ1066] (402 aa)
Score = 208, Expect = 3.5e-15, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    26 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGYHYSPATISNISKATQENVSTFHERSLEANYSVLFL 173
>gi|116511350|ref|YP_808566.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107004|gb|ABJ72144.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 207, Expect = 4.0e-15, Identities = 48/149 (32%), Positives = 73/149 (48%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MY        +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRGDDHLEEMVIKLYQTGVTTREISDIIERMYCHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|69246069|ref|ZP_00603796.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195441|gb|EAN09887.1| Transposase, mutator type [Enterococcus faecium DO] (389 aa)
Score = 207, Expect = 4.0e-15, Identities = 48/145 (33%), Positives = 77/145 (53%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           NK D D L ++  +  I   L  E+   L YEK+D+N    S N R G   +T  T+YG+L++ IPRD N  F  Q +  ++R  + +E  II+L+ KG++  EI  +   MYG       +S ++  +  ++L ++ R LE  Y
  S:    14 NKGDLDELFQDHLERAINSLLQAELTAFLDYEKYDRNGFN-SGNSRNGNYSRTFKTEYGELNLTIPRDRNGEFSQQTLPAYKRTNDSLETTIIQLFQKGITMAEISKLIEKMYGHHYTPQTISNMSKLVAEDVLAFKERTLEANY 157
>gi|55820887|ref|YP_139329.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55736872|gb|AAV60514.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (402 aa)
Score = 207, Expect = 4.2e-15, Identities = 48/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI+D+   MYG       +S ++      +  +  R LE  Y +L L
  S:    26 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREIRDIIERMYGHHYSPATISNISKATQENVAAFHERSLEANYSVLFL 173
>gi|116627694|ref|YP_820313.1| transposase [Streptococcus thermophilus LMD-9] >gi|116100971|gb|ABJ66117.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 207, Expect = 4.7e-15, Identities = 48/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI+D+   MYG       +S ++      +  +  R LE  Y +L L
  S:    15 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREIRDIIERMYGHHYSPATISNISKATQENVAAFHERSLEANYSVLFL 162
>gi|116510946|ref|YP_808162.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116511903|ref|YP_809119.1| transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116106600|gb|ABJ71740.1| Transposase [Lactococcus lactis subsp. cremoris SK11] >gi|116107557|gb|ABJ72697.1| Transposase [Lactococcus lactis subsp. cremoris SK11] (391 aa)
Score = 207, Expect = 5.0e-15, Identities = 48/149 (32%), Positives = 73/149 (48%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MY        +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKVGYN-SGNSRNGSYSRQFETKYGTVQLSIPRDRNGNFSPALLPAYGRGDDHLEEMVIKLYQTGVTTREISDIIERMYCHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|116627696|ref|YP_820315.1| transposase [Streptococcus thermophilus LMD-9] >gi|116100973|gb|ABJ66119.1| Transposase [Streptococcus thermophilus LMD-9] (391 aa)
Score = 207, Expect = 5.1e-15, Identities = 48/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI+D+   MYG       +S ++      +  +  R LE  Y +L L
  S:    15 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREIRDIIERMYGHHYSPATISNISKATQENVAAFHERSLEANYSVLFL 162
>gi|24637415|gb|AAN63693.1|AF454495_20 tnp-IS1191 [Streptococcus thermophilus] (391 aa)
Score = 206, Expect = 6.1e-15, Identities = 48/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R L+  Y +L L
  S:    15 KQDSDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLKANYSVLFL 162
>gi|24637504|gb|AAN63774.1|AF454500_16 transposase [Streptococcus thermophilus] (391 aa)
Score = 205, Expect = 7.6e-15, Identities = 48/149 (32%), Positives = 73/149 (48%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++ REI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDIDEFFRTSLETAMNDLLQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVRLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTIREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 162
>gi|55822807|ref|YP_141248.1| truncated IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738792|gb|AAV62433.1| IS1191, transposase, IS256 family, truncated [Streptococcus thermophilus CNRZ1066] (179 aa)
Score = 204, Expect = 1.1e-14, Identities = 48/149 (32%), Positives = 73/149 (48%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   +  +   L  E+   LGYE +++     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    26 KQDSDEFFRTSLEIAMNDLLQAELSAFLGYEPYNKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGYHYSPATISNISKATQENVATFHERSLEANYSVLFL 173
>gi|55821065|ref|YP_139507.1| IS1191 transposase [Streptococcus thermophilus LMG 18311] >gi|55737050|gb|AAV60692.1| IS1191, transposase, IS256 family [Streptococcus thermophilus LMG 18311] (362 aa)
Score = 200, Expect = 2.9e-14, Identities = 46/130 (35%), Positives = 66/130 (50%)
  Q:    58 LDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           L  E+   LGYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:     5 LQAELSAFLGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 133
>gi|20385127|gb|AAM21176.1|AF329367_2 transposase [Enterococcus faecalis] >gi|20385135|gb|AAM21184.1|AF329367_12 transposase [Enterococcus faecalis] >gi|21693315|gb|AAM75262.1|AF454824_57 EF0057 [Enterococcus faecalis] >gi|30058666|gb|AAK67275.1| transposase [Enterococcus faecalis] (392 aa)
Score = 200, Expect = 3.1e-14, Identities = 49/140 (35%), Positives = 81/140 (57%)
  Q:    46 LKELTKSFIEKSLDV----EMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           L EL +S +EK+++     E+   L YEK+D+     S N R G   +++ T+YG+L +EIPRD N  F+ Q +  ++R  + +E  II L+ KG++  EI D+   MYG       +S +T  +  E+  ++SR L D Y+ +
  S:    18 LNELFRSHLEKAINTLLRTELTAFLDYEKYDRTGFN-SGNSRNGSYFRSIKTEYGELTLEIPRDRNGEFKQQTLPAYKRTNDTLETTIIHLFEKGVTMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKSRALNDKYVAI 160
>gi|29375002|ref|NP_814155.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29375204|ref|NP_814357.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29376681|ref|NP_815835.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29376693|ref|NP_815847.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29377271|ref|NP_816425.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|69244269|ref|ZP_00602737.1| Transposase, mutator type [Enterococcus faecium DO] >gi|69244966|ref|ZP_00603156.1| Transposase, mutator type [Enterococcus faecium DO] >gi|29342461|gb|AAO80226.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29342663|gb|AAO80428.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29344145|gb|AAO81905.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29344157|gb|AAO81917.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|29344737|gb|AAO82495.1| ISEf1, transposase [Enterococcus faecalis V583] >gi|68196132|gb|EAN10563.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68196455|gb|EAN10882.1| Transposase, mutator type [Enterococcus faecium DO] >gi|117979178|gb|ABK59940.1| transposase [Enterococcus faecalis] (392 aa)
Score = 200, Expect = 3.1e-14, Identities = 49/140 (35%), Positives = 81/140 (57%)
  Q:    46 LKELTKSFIEKSLDV----EMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           L EL +S +EK+++     E+   L YEK+D+     S N R G   +++ T+YG+L +EIPRD N  F+ Q +  ++R  + +E  II L+ KG++  EI D+   MYG       +S +T  +  E+  ++SR L D Y+ +
  S:    18 LNELFRSHLEKAINTLLRTELTAFLDYEKYDRTGFN-SGNSRNGSYFRSIKTEYGELTLEIPRDRNGEFKQQTLPAYKRTNDTLETTIIHLFEKGVTMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKSRALNDKYVAI 160
>gi|121633864|ref|YP_976102.1| IS256 family transposase [Enterococcus faecium] >gi|124112030|ref|YP_001019059.1| IS256 family transposase [Enterococcus faecium] >gi|121490923|emb|CAL36559.1| transposase, IS256 family [Enterococcus faecium] >gi|124012132|emb|CAL90965.1| putative transposase, IS256 family [Enterococcus faecium] (396 aa)
Score = 199, Expect = 3.5e-14, Identities = 46/145 (31%), Positives = 76/145 (52%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           NK D + L +   +  +   L  E+   L YEK+D+     + N R G   +T+ T+YG+L ++IPRD N  F+ Q V  ++R  + +E  +I L+ KG++  EI D+   MYG       +S +T     E+ +++ R L D Y
  S:    14 NKGDLNELFRVHLEKAVNTLLKTELTAFLDYEKYDRIGFN-TGNSRNGSYDRTVKTEYGELHLQIPRDRNGEFKQQTVPAYRRTNDTLEETVIHLFRKGITMSEIADLIEKMYGHHYTPQTMSNMTKSFTEEVTSFKERELHDRY 157
>gi|55822813|ref|YP_141254.1| IS1191 transposase [Streptococcus thermophilus CNRZ1066] >gi|55738798|gb|AAV62439.1| IS1191, transposase, IS256 family [Streptococcus thermophilus CNRZ1066] (392 aa)
Score = 198, Expect = 4.6e-14, Identities = 49/149 (32%), Positives = 74/149 (49%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHL-GYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           K+D D   +   ++ +   L  E+   L GYE +D+     S N R G   +   TKYG + + IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG       +S ++      + T+  R LE  Y +L L
  S:    15 KQDSDEFFRTSLETAMNDLLQAELSAFLVGYEPYDKLGYN-SGNSRNGSYARKFETKYGTVQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLYQTGVTTREISDIIERMYGHHYSPATISNISKATQENVATFHERSLEANYSVLFL 163
>gi|29376403|ref|NP_815557.1| IS256 family transposase [Enterococcus faecalis V583] >gi|29343866|gb|AAO81627.1| transposase, IS256 family [Enterococcus faecalis V583] (396 aa)
Score = 198, Expect = 4.6e-14, Identities = 46/145 (31%), Positives = 75/145 (51%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           NK D + L +   +  +   L  E+   L YEK+D+     + N R G   +T+ T+YG+L ++IPRD N  F+ Q V  ++R  + +E  +I L+ KG++  EI D+   MYG       +S +T     E+  ++ R L D Y
  S:    14 NKGDLNELFRVHLEKAVNTLLKTELTAFLDYEKYDRIGFN-TGNSRNGSYDRTVKTEYGELHLQIPRDRNGEFKQQTVPAYRRTNDTLEETVIHLFRKGITMSEIADLIEKMYGHHYTPQTMSNITKSFTEEVTAFKGRELHDRY 157
>gi|69246180|ref|ZP_00603849.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195388|gb|EAN09836.1| Transposase, mutator type [Enterococcus faecium DO] (392 aa)
Score = 198, Expect = 4.6e-14, Identities = 46/148 (31%), Positives = 80/148 (54%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           NK D + L +   +  +   L  E+   L YEK+D+     + N R G   +T+ T+YG+L ++IPRD N  F+ Q V  ++R  + +E  +I L+ KG++  EI D+  +MYG       +S++T  +  E+  ++ R L D Y+ +
  S:    14 NKGDLNELFRVHLEKAVNTLLKTELTAFLDYEKYDRIGFN-TGNSRNGSYDRTVKTEYGELHLQIPRDRNGEFKQQTVPAYRRTNDTLEETVIHLFRKGITMSEIADLIEEMYGYHYTPQTMSKMTKVLTEEVNAFKVRTLNDKYVAI 160
>gi|69244961|ref|ZP_00603151.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68196127|gb|EAN10558.1| Transposase, mutator type [Enterococcus faecium DO] (193 aa)
Score = 197, Expect = 6.5e-14, Identities = 49/140 (35%), Positives = 81/140 (57%)
  Q:    46 LKELTKSFIEKSLDV----EMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           L EL +S +EK+++     E+   L YEK+D+     S N R G   +++ T+YG+L +EIPRD N  F+ Q +  ++R  + +E  II L+ KG++  EI D+   MYG       +S +T  +  E+  ++SR L D Y+ +
  S:    18 LNELFRSHLEKAINTLLRTELTAFLDYEKYDRTGFN-SGNSRNGSYFRSIKTEYGELTLEIPRDRNGEFKQQTLPAYKRTNDTLETTIIHLFEKGVTMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKSRALNDKYVAI 160
>gi|15923405|ref|NP_370939.1| transposase [Staphylococcus aureus subsp. aureus Mu50] >gi|156978743|ref|YP_001441002.1| transposase [Staphylococcus aureus subsp. aureus Mu3] >gi|14246183|dbj|BAB56577.1| transposase [Staphylococcus aureus subsp. aureus Mu50] >gi|156720878|dbj|BAF77295.1| transposase [Staphylococcus aureus subsp. aureus Mu3] (396 aa)
Score = 196, Expect = 8.0e-14, Identities = 46/145 (31%), Positives = 74/145 (51%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           NK D + L +   +  +   L  E+   L YEK+D+     + N R G   +T+ T+YG+L ++IPRD N  F+ Q V  ++R  + +E  +I L+ KG++  EI D+   MYG       +S +T     E+  +  R L D Y
  S:    14 NKGDLNELFRVHLEKAVNTLLKTELTAFLDYEKYDRIGFN-TGNSRNGSYDRTVKTEYGELHLQIPRDRNGEFKQQTVPAYRRTNDTLEETVIHLFRKGITMSEIADLIEKMYGHYYTPQTMSNITKSFTEEVTAFNGRELHDRY 157
>gi|56962597|ref|YP_174323.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56962935|ref|YP_174662.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56962977|ref|YP_174704.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56965034|ref|YP_176765.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56908835|dbj|BAD63362.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56909174|dbj|BAD63701.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56909216|dbj|BAD63743.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56909412|dbj|BAD63939.1| IS256 family transposase [Bacillus clausii KSM-K16] >gi|56911277|dbj|BAD65804.1| IS256 family transposase [Bacillus clausii KSM-K16] (394 aa)
Score = 195, Expect = 1.2e-13, Identities = 45/149 (30%), Positives = 79/149 (53%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           KED   + +   ++ +   L  E+   L YEK+D+     S N R G   +TL+T++G L + IPRD N  F  Q +  ++R+ + +E  +I +Y KG++T EI D+   MYG       +S +T  +  ++  +++R L   Y+ + L
  S:    15 KEDLKEVFRTHLENAVNTLLATELTAFLDYEKYDRGGFG-SGNSRNGTYPRTLHTEFGDLHLSIPRDRNGEFHQQTISPYKRSNDTLESFVIHMYQKGVTTGEITDLLERMYGHHYTPQTISNMTKTMEKQVEAFKARTLAKRYVCVYL 162
>gi|61387415|gb|AAX45363.1| transposase [Enterococcus faecium] (392 aa)
Score = 194, Expect = 1.4e-13, Identities = 46/148 (31%), Positives = 78/148 (52%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           NK D + L +   +  +   L  E+   L YEK+D+     + N R G   +T+ T+YG+L ++IPRD N  F+ Q V  ++R  + +E  +I L+ KG++  EI D+   MYG       +S +T  +  E+  ++ R L D Y+ +
  S:    14 NKGDLNELFRVHLEKAVNTLLKTELTAFLDYEKYDRIGFN-TGNSRNGSYDRTVKTEYGELHLQIPRDRNGEFKQQTVPAYRRTNDTLEETVIHLFRKGITMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKVRTLNDKYVAI 160
>gi|56418880|ref|YP_146198.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] >gi|196249630|ref|ZP_03148327.1| transposase mutator type [Geobacillus sp. G11MC16] >gi|56378722|dbj|BAD74630.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] >gi|196210924|gb|EDY05686.1| transposase mutator type [Geobacillus sp. G11MC16] (389 aa)
Score = 193, Expect = 1.8e-13, Identities = 46/147 (31%), Positives = 83/147 (56%)
  Q:    41 DFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLD-VEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D+ N L+   + F+++ L++ M   +  + + +  +  + N R G  ++ L+T+YG+++ + +PRD N  F+ QL   +QR+   +E  II++Y  GMSTREI      + G+      +SR+TD +  +I  W +RPL   Y +L L
  S:    10 DWANQLENAIRQFVKEKLELIMREEI--KNFLEIEQAGTPNMRNGYYQRNLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWLEEAIIRMYQSGMSTREIGKFIERILGSTYSPATISRITDVVKEDIEKWHARPLHQRYSVLYL 155
>gi|69246059|ref|ZP_00603786.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195431|gb|EAN09877.1| Transposase, mutator type [Enterococcus faecium DO] (185 aa)
Score = 193, Expect = 2.0e-13, Identities = 46/151 (30%), Positives = 80/151 (52%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSLL 188
           NK D + L +   +  +   L  E+   L YEK+D+     + N R G   +T+ T+YG+L ++IPRD N  F+ Q V  ++R  + +E  +I L+ KG++  EI D+   MYG       +S +T  +  E+  ++ R L D Y+ + ++
  S:    14 NKGDLNGLFRVHLEKAVNTLLKTELTAFLDYEKYDRIGFN-TGNSRNGSYDRTVKTEYGELHLQIPRDRNGEFKQQTVPAYRRTNDTLEETVIHLFRKGITMSEIADLIEKMYGHHYTPQTMSNMTKVLTEEVNAFKVRTLNDKYVAIFMI 163
>gi|28275212|ref|NP_783469.1| transposase [Shewanella oneidensis MR-1] (154 aa)
Score = 191, Expect = 3.7e-13, Identities = 45/119 (37%), Positives = 66/119 (55%)
  Q:    43 DNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSR 161
           D++L  L K   E +L  E++ HL ++           N + GKT KT+    G  +++ PRD N TFEPQL++K+Q  L D IE  ++ ++S GMS R+I     DMYG  V K L  +
  S:    24 DSILGPLIKQLTEAALQAELEQHLAHDP--------QPNRKNGKTPKTIKHPSGNFELDAPRDRNGTFEPQLIKKNQTTLTDEIERKVLSMFSIGMSYRDINQHVEDMYGLNVSKCLTQQ 135
>gi|15706280|emb|CAC69998.1| putative transposase [Lactobacillus delbrueckii] >gi|21530790|emb|CAD33970.1| putative transposase [Lactobacillus delbrueckii subsp. lactis] (392 aa)
Score = 190, Expect = 4.4e-13, Identities = 41/150 (27%), Positives = 80/150 (53%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           NKE FD  ++   +  +++ L+ E+   LGY+ + +     S N R G   + + T++G + V++PRD    F    +  + ++   +E  +I+LYS G++TREI D+   MYG+      VS ++ ++  ++ ++  R L D +  + L
  S:    14 NKEKFDEFMRTQLEEGLDQLLESELTAFLGYDPYAREGWN-SGNSRNGSYFRQVKTQFGPIKVQVPRDRKGEFHQHTLPAYGQHTVPLESTVIQLYSHGVTTREISDLIEKMYGSYYSAGTVSNISKQVASQVESYHQRQLSDKFFCVYL 162
>gi|56419412|ref|YP_146730.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] >gi|56379254|dbj|BAD75162.1| transposase of IS654-like element [Geobacillus kaustophilus HTA426] (389 aa)
Score = 190, Expect = 4.5e-13, Identities = 46/147 (31%), Positives = 82/147 (55%)
  Q:    41 DFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLD-VEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           D+ N L+   + F+++ L++ M   +  + + +  +  + N R G  ++ L+T+YG+++ + +PRD N  F+ QL   +QR+   +E  II++Y  GMSTREI      + G+      +SR+TD    +I  W +RPL   Y +L L
  S:    10 DWANQLENAIRQFVKEKLELIMREEI--KNFLEIEQAGTPNMRNGYYQRNLDTQYGRIEGLLVPRDRNGEFQTQLFAPYQRHTGWLEEAIIRMYQSGMSTREIGKFIERILGSTYSPATISRITDVAKEDIEKWHARPLHQRYSVLYL 155
>gi|159901543|ref|YP_001547789.1| transposase and inactivated derivatives [Herpetosiphon aurantiacus ATCC 23779] >gi|159894582|gb|ABX07661.1| transposase and inactivated derivatives [Herpetosiphon aurantiacus ATCC 23779] (102 aa)
Score = 187, Expect = 9.3e-13, Identities = 41/100 (41%), Positives = 58/100 (57%)
  Q:    54 IEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVF--LDMYGAG 153
           +E+ LD E+  HLGYE +    R  S N R G   + L T  G   +++PRD NSTF+P L+  +Q + N++E  II LY KG+S  +IQ     L + G G
  S:     1 MEQMLDAELTAHLGYEPYAPEGRN-SGNTRDGSRPRRLRTSAGDHTIQVPRDRNSTFQPALLDPYQTSTNELEEKIIALYFKGVSACDIQQTLHELTLLGKG 101
>gi|13447735|gb|AAK26734.1|AF200363_42 putative transposase [Escherichia coli] >gi|18034539|gb|AAL57561.1|AF453441_45 putative transposase [Escherichia coli] >gi|57434402|emb|CAI43819.1| putative transposase [Escherichia coli] (131 aa)
Score = 187, Expect = 1.0e-12, Identities = 42/107 (39%), Positives = 68/107 (63%)
  Q:    37 ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQ 143
           E+   FD LLK+++   +E +L+ EM  HLGY   D+N  +   N R G + KT+ T  G L++  PRD + +FEPQLV+K+Q  +  +++ I+ LY+KG++T  +Q
  S:    21 EDLSQFDRLLKKIS---VEAALNAEMSHHLGY---DKNQPKPGANSRNGYSTKTVITGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMDNQILSLYAKGLTTVSVQ 121
>gi|88706785|ref|ZP_01104486.1| Transposase, mutator type [gamma proteobacterium KT 71] >gi|88706807|ref|ZP_01104508.1| Transposase, mutator type [gamma proteobacterium KT 71] >gi|88698966|gb|EAQ96084.1| Transposase, mutator type [Congregibacter litoralis KT71] >gi|88698988|gb|EAQ96106.1| Transposase, mutator type [Congregibacter litoralis KT71] (403 aa)
Score = 186, Expect = 1.2e-12, Identities = 42/158 (26%), Positives = 87/158 (55%)
  Q:    25 SSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSL----DVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +S  K L K+   N     + L EL +  +E++L    D E D   G ++++++        R G  ++T ++K G++ +++P+    TFE  ++ +++R    IE  ++++Y  G+S R ++D+   ++G  V    VS++  K+   I TW++RP++  Y
  S:     4 NSETKDLGKVVQINDARIQDHLGELVRGTVEETLNAMLDAEADAMCGAQRYERSPDRVDT--RAGHYERTFHSKAGEVKLKMPKLRKQTFETAIIERYKRRETSIEEALMEMYLAGVSVRRVEDITEALWGTRVSSGTVSKLNKKVYKHIETWRNRPIQGEY 163
>gi|88704552|ref|ZP_01102265.1| Transposase, mutator type [gamma proteobacterium KT 71] >gi|88700873|gb|EAQ97979.1| Transposase, mutator type [Congregibacter litoralis KT71] (296 aa)
Score = 186, Expect = 1.2e-12, Identities = 42/158 (26%), Positives = 87/158 (55%)
  Q:    25 SSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSL----DVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +S  K L K+   N     + L EL +  +E++L    D E D   G ++++++        R G  ++T ++K G++ +++P+    TFE  ++ +++R    IE  ++++Y  G+S R ++D+   ++G  V    VS++  K+   I TW++RP++  Y
  S:     4 NSETKDLGKVVQINDARIQDHLGELVRGTVEETLNAMLDAEADAMCGAQRYERSPDRVDT--RAGHYERTFHSKAGEVKLKMPKLRKQTFETAIIERYKRRETSIEEALMEMYLAGVSVRRVEDITEALWGTRVSSGTVSKLNKKVYKHIETWRNRPIQGEY 163
>gi|69246054|ref|ZP_00603781.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68195426|gb|EAN09872.1| Transposase, mutator type [Enterococcus faecium DO] (389 aa)
Score = 186, Expect = 1.3e-12, Identities = 46/145 (31%), Positives = 75/145 (51%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           NK D D+L +   +  I   L  E+   L YEK+D+     S N R G   ++  T+YG+L++ IPRD N  F  Q +  ++R  + +E  II+L  KG++  EI D+   MYG       +S ++  +  ++  ++ R LE  Y
  S:    14 NKGDLDDLFRRHLELAINALLQAELTVFLDYEKYDRAGFN-SGNSRNGNYSRSFKTEYGELNLVIPRDRNGDFSQQTLPAYKRTNDSLETTIIQLVQKGITMSEISDLIEKMYGHYYKPQTISNMSKIVSEDVSAFKERTLEAKY 157
>gi|15612874|ref|NP_241177.1| transposase (04) [Bacillus halodurans C-125] >gi|15612919|ref|NP_241222.1| transposase (04) [Bacillus halodurans C-125] >gi|15612950|ref|NP_241253.1| transposase (04) [Bacillus halodurans C-125] >gi|15613478|ref|NP_241781.1| transposase (04) [Bacillus halodurans C-125] >gi|15614656|ref|NP_242959.1| transposase (04) [Bacillus halodurans C-125] >gi|15615527|ref|NP_243831.1| transposase (04) [Bacillus halodurans C-125] >gi|15616020|ref|NP_244325.1| transposase (04) [Bacillus halodurans C-125] >gi|15616226|ref|NP_244531.1| transposase (04) [Bacillus halodurans C-125] >gi|10172924|dbj|BAB04030.1| transposase (04) [Bacillus halodurans C-125] >gi|10172969|dbj|BAB04075.1| transposase (04) [Bacillus halodurans C-125] >gi|10173000|dbj|BAB04106.1| transposase (04) [Bacillus halodurans C-125] >gi|10173530|dbj|BAB04634.1| transposase (04) [Bacillus halodurans C-125] >gi|10174712|dbj|BAB05812.1| transposase (04) [Bacillus halodurans C-125] >gi|10175587|dbj|BAB06684.1| transposase (04) [Bacillus halodurans C-125] >gi|10176081|dbj|BAB07177.1| transposase (04) [Bacillus halodurans C-125] >gi|10176288|dbj|BAB07383.1| transposase (04) [Bacillus halodurans C-125] >gi|47076567|dbj|BAD18191.1| transposase of IS654 [Bacillus halodurans] >gi|47076569|dbj|BAD18192.1| transposase of IS654 [Bacillus halodurans] >gi|47076573|dbj|BAD18194.1| transposase of IS654 [Bacillus halodurans] >gi|47076575|dbj|BAD18195.1| transposase of IS654 [Bacillus halodurans] (390 aa)
Score = 185, Expect = 1.8e-12, Identities = 45/149 (30%), Positives = 78/149 (52%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLD-VEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +  F+N L  + + F+++ L+  M   +  E +  +      N + G   + L+T+YG+L+ + +PRD  + F+ +L   +QR    +   II +Y KG+STREI      + G       +S+VTD +  +I  WQ RPL+  Y +L L
  S:     7 QSTFENQLDSMVREFVKEKLETIMKEEM--ESFFTHEHPELKNQKNGFYTRQLDTRYGRLENLRVPRDRQNAFQTELFSPYQRREEWLGEAIITMYQKGVSTREIGHFIEKILGHSYSASTISQVTDVVTEDITQWQQRPLKKRYSVLYL 154
>gi|47076695|dbj|BAD18260.1| transposase of IS654 [Bacillus alcalophilus] (390 aa)
Score = 184, Expect = 1.8e-12, Identities = 45/149 (30%), Positives = 78/149 (52%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLD-VEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +  F+N L  + + F+++ L+  M   +  E +  +      N + G   + L+T+YG+L+ + +PRD  + F+ +L   +QR    +   II +Y KG+STREI      + G       +S+VTD +  +I  WQ RPL+  Y +L L
  S:     7 QSTFENQLDSMVREFVKEKLETIMKEEM--ESFFTHEHPELKNQKNGFYTRQLDTRYGRLENLRVPRDRQNAFQTELFSPYQRREEWLGEAIITMYQKGVSTREIGHFIEKILGHSYSASAISQVTDVVTEDITQWQQRPLKKRYSVLYL 154
>gi|94988024|ref|YP_596125.1| transposase [Streptococcus pyogenes MGAS9429] >gi|94991910|ref|YP_600009.1| transposase [Streptococcus pyogenes MGAS2096] >gi|94541532|gb|ABF31581.1| transposase [Streptococcus pyogenes MGAS9429] >gi|94545418|gb|ABF35465.1| Transposase [Streptococcus pyogenes MGAS2096] (193 aa)
Score = 184, Expect = 1.9e-12, Identities = 40/113 (35%), Positives = 61/113 (53%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG 151
           K+D D   +   +  +   L VE+   LGYE +++     + N R G   +   TKYG +++ IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG
  S:    40 KQDIDEFFRSSLEIAMNDLLQVELSAFLGYEPYEKEGYN-TGNSRNGTYSRQFETKYGLVNLIIPRDRNGEFSPVLLPSYARRDDHLEEMVIKLYQTGVTTREISDIIERMYG 151
>gi|93005757|ref|YP_580194.1| transposase mutator family protein [Psychrobacter cryohalolentis K5] >gi|93005786|ref|YP_580223.1| transposase mutator family protein [Psychrobacter cryohalolentis K5] >gi|92393435|gb|ABE74710.1| transposase, mutator family [Psychrobacter cryohalolentis K5] >gi|92393464|gb|ABE74739.1| transposase, mutator family [Psychrobacter cryohalolentis K5] (129 aa)
Score = 184, Expect = 1.9e-12, Identities = 38/100 (38%), Positives = 61/100 (61%)
  Q:    40 EDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMST 139
           +D  +  K+L +SFI+ +L+ EM+ HLGY K ++  +    N R G TKKT+ +  G+L++  PRD +  FEP LVRKHQ  ++ ++  II  Y   + +
  S:    22 DDIKDFQKQLMQSFIDTALEAEMEDHLGYPKHEKADKP---NKRNGHTKKTVRSDTGELEISTPRDRDGAFEPTLVRKHQTRISGLDDKIIFHYRHSLPS 118
>gi|71903048|ref|YP_279851.1| transposase [Streptococcus pyogenes MGAS6180] >gi|71802143|gb|AAX71496.1| transposase [Streptococcus pyogenes MGAS6180] (193 aa)
Score = 184, Expect = 2.1e-12, Identities = 40/113 (35%), Positives = 61/113 (53%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG 151
           K+D D   +   +  +   L VE+   LGYE +++     + N R G   +   TKYG +++ IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG
  S:    40 KQDIDEFFRSSLEIAMNDLLQVELSAFLGYEPYEKEGYN-TGNSRNGTYSRQFETKYGLVNLIIPRDRNGEFSPVLLPSYARRDDHLEEMVIKLYQTGVTTREISDIIERMYG 151
>gi|47076577|dbj|BAD18196.1| transposase of IS654 [Bacillus halodurans] (390 aa)
Score = 184, Expect = 2.3e-12, Identities = 45/149 (30%), Positives = 78/149 (52%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLD-VEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +  F+N L  + + F+++ L+  M   +  E +  +      N + G   + L+T+YG+L+ + +PRD  + F+ +L   +QR    +   II +Y KG+STREI      + G       +S+VTD +  +I  WQ RPL+  Y +L L
  S:     7 QSTFENQLDSMVREFVKEELETIMKEEM--ESFFTHEHPELKNQKNGFYTRQLDTRYGQLENLRVPRDRQNAFQTELFSPYQRREEWLGEAIITMYQKGVSTREIGHFIEKILGHSYSASTISQVTDVVTEDITQWQQRPLKKRYSVLYL 154
>gi|47076563|dbj|BAD18189.1| transposase of IS654 [Bacillus halodurans] (390 aa)
Score = 183, Expect = 3.1e-12, Identities = 45/149 (30%), Positives = 78/149 (52%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLD-VEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +  F+N L  + + F+++ L+  M   +  E +  +      N + G   + L+T+YG+L+ + +PRD  + F+ +L   +QR    +   II +Y KG+STREI      + G       +S+VTD +  +I  WQ RPL+  Y +L L
  S:     7 QSTFENQLDPMVREFVKEKLETIMKEEV--ESFFTHEHPELKNQKNGFYTRQLDTRYGRLENLRVPRDRQNAFQTELFSPYQRREEWLGEAIITMYQKGVSTREIGHFIEKILGHSYSASTISQVTDVVTEDITQWQQRPLKKRYSVLYL 154
>gi|193065738|ref|ZP_03046802.1| TnpA [Escherichia coli E22] >gi|194428947|ref|ZP_03061480.1| TnpA [Escherichia coli B171] >gi|5881828|emb|CAB55630.1| putative transposase [Escherichia coli] >gi|192926607|gb|EDV81237.1| TnpA [Escherichia coli E22] >gi|194413000|gb|EDX29289.1| TnpA [Escherichia coli B171] >gi|195183310|dbj|BAG66849.1| putative transposase [Escherichia coli O111:H-] (131 aa)
Score = 182, Expect = 3.7e-12, Identities = 45/123 (36%), Positives = 76/123 (61%)
  Q:    21 KKEKSSAEKLLEKLGV-ENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQ 143
           K+ ++ A +L + L   E+   FD LLK+++   +E +L+ EM  HLGY   D+N  +   N R G + KT+    G L++  PRD + +FEPQLV+K+Q  +  +++ I+ LY+KG++T  +Q
  S:     4 KQLQALANELAKNLKTPEDLSQFDRLLKKIS---VEAALNAEMSHHLGY---DKNQPKPGANSRNGYSTKTVIIGDGPLELRTPRDRDGSFEPQLVKKNQTRITGMDNQILSLYAKGLTTVSVQ 121
>gi|71910210|ref|YP_281760.1| transposase [Streptococcus pyogenes MGAS5005] >gi|71852992|gb|AAZ51015.1| transposase [Streptococcus pyogenes MGAS5005] (140 aa)
Score = 180, Expect = 5.6e-12, Identities = 40/113 (35%), Positives = 61/113 (53%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG 151
           K+D D   +   +  +   L VE+   LGYE +++     + N R G   +   TKYG +++ IPRD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG
  S:    15 KQDIDEFFRSSLEIAMNDLLQVELSAFLGYEPYEKEGYN-TGNSRNGTYSRQFETKYGLVNLIIPRDRNGEFSPVLLPSYARREDHLEEIVIKLYQTGVTTREISDIIKRMYG 126
>gi|116514780|ref|YP_813686.1| transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116094095|gb|ABJ59248.1| Transposase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (389 aa)
Score = 180, Expect = 6.4e-12, Identities = 39/150 (26%), Positives = 76/150 (50%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           NKE FD  ++   +  +++ L+ E+   LGY+ + +     S N R G   + + T++G + V++PRD    F    +  + +  + +E  +I+ YS G++ REI D+   MYG+      VS ++ +   ++  +  R L D +  + L
  S:    14 NKEKFDEFMRTQLEEGLDQLLESELTAFLGYDPYAREGWN-SGNSRNGSYFRQVKTQFGPIKVQVPRDRKGEFHQHTLPAYGQRTDTLESTVIQFYSHGVTPREITDLIEKMYGSYYSAGTVSNISKQFASQVENYHQRQLSDKFFCVYL 162
>gi|157827045|ref|YP_001496109.1| transposase [Rickettsia bellii OSU 85-389] >gi|157802349|gb|ABV79072.1| Transposase and inactivated derivative [Rickettsia bellii OSU 85-389] (319 aa)
Score = 178, Expect = 9.8e-12, Identities = 34/84 (40%), Positives = 54/84 (64%)
  Q:   102 IPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +PRD  + F P LV K    +  I+  I+  Y+KGMS  +I+    ++YGA V + L+SRVTD ++ E+ +WQ+RPLE +Y ++
  S:     1 MPRDRKADFTPILVPKRVSRIEGIDDKILSFYAKGMSLSDIKLQLEELYGAEVSESLISRVTDNVMDEVRSWQNRPLESVYAIV 84
>gi|37522131|ref|NP_925508.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|35213131|dbj|BAC90503.1| gll2562 [Gloeobacter violaceus PCC 7421] (117 aa)
Score = 178, Expect = 1.1e-11, Identities = 38/79 (48%), Positives = 57/79 (72%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRK-HQRNLN 123
           LLK+LTK+ IE++L+ EM+ HLGY+K +   +  + N R GK++KTL  + G +++ IPRD N+ FEP +VRK H R +N
  S:    29 LLKQLTKAVIERALEAEMETHLGYKKHEAAGKG-TGNSRNGKSQKTLQAECGPVELHIPRDRNAEFEPVVVRKGHTRWIN 107
>gi|56808808|ref|ZP_00366522.1| COG3328: Transposase and inactivated derivatives [Streptococcus pyogenes M49 591] (140 aa)
Score = 176, Expect = 1.6e-11, Identities = 39/113 (34%), Positives = 61/113 (53%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG 151
           K+D D   +   +  +   L VE+   LGYE +++     + N R G   +   TKYG +++ IPRD N  F P L+  + R  + +E  +IKLY  G++TREI ++   MYG
  S:    15 KQDIDEFFRSSLEIAMNDLLQVELSAFLGYEPYEKEGYN-TGNSRNGTYSRQFETKYGLVNLIIPRDRNGEFSPVLLPSYARREDHLEEIVIKLYQTGVTTREISNIIERMYG 126
>gi|37520088|ref|NP_923465.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|37523760|ref|NP_927137.1| putative transposase [Gloeobacter violaceus PCC 7421] >gi|35211080|dbj|BAC88460.1| gll0519 [Gloeobacter violaceus PCC 7421] >gi|35214765|dbj|BAC92132.1| glr4191 [Gloeobacter violaceus PCC 7421] (133 aa)
Score = 176, Expect = 1.9e-11, Identities = 38/79 (48%), Positives = 57/79 (72%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRK-HQRNLN 123
           LLK+LTK+ IE++L+ EM+ HLGY+K +   +  + N R GK++KTL  + G +++ IPRD N+ FEP +VRK H R +N
  S:    45 LLKQLTKAVIERALEAEMETHLGYKKHEAAGKG-TGNSRNGKSQKTLQAECGPVELHIPRDRNAEFEPVVVRKGHTRWIN 123
>gi|15966733|ref|NP_387086.1| partial transposase for insertion sequence element ISRM5 [Sinorhizobium meliloti 1021] >gi|15076005|emb|CAC47559.1| Partial transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (358 aa)
Score = 174, Expect = 3.1e-11, Identities = 41/169 (24%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R LE+ +  L L
  S:     1 MTKTEGKTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLIL 163
>gi|94989906|ref|YP_598006.1| transposase [Streptococcus pyogenes MGAS10270] >gi|94543414|gb|ABF33462.1| Transposase [Streptococcus pyogenes MGAS10270] (140 aa)
Score = 173, Expect = 3.7e-11, Identities = 39/113 (34%), Positives = 60/113 (53%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG 151
           K+D D   +   +  +   L VE+   LGYE +++     + N R G   +   TKYG +++ I RD N  F P L+  + R  + +E  +IKLY  G++TREI D+   MYG
  S:    15 KQDIDEFFRPYLEIAMNDLLQVELSAFLGYEPYEKEGYN-TGNSRNGTYSRQFETKYGLVNLIISRDRNGEFSPVLLPSYARREDHLEEIVIKLYQTGVTTREISDIIKRMYG 126
>gi|76810378|ref|YP_333179.1| transposase [Burkholderia pseudomallei 1710b] >gi|76579831|gb|ABA49306.1| transposase [Burkholderia pseudomallei 1710b] (190 aa)
Score = 173, Expect = 3.8e-11, Identities = 41/115 (35%), Positives = 63/115 (54%)
  Q:    29 KLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQ 143
           +L+++L  G   +   D  L  L K+  E++   E+  HLG EK +      S N+R G ++K + T    LDVEI RD   T +P L+ + +R     +  II +Y++GMS REIQ
  S:    22 ELIKQLVPGTPERATIDEQLAALKKAIFERAPGGELTHHLGDEKGEAKPAG-STNHRNGTSRKRVATDDDLLDVEIARDREGTLDPVLIARSERRFTGFDDKIIAMYARGMSVREIQ 137
>gi|27377274|ref|NP_768803.1| putative transposase [Bradyrhizobium japonicum USDA 110] >gi|27350417|dbj|BAC47428.1| bll2163 [Bradyrhizobium japonicum USDA 110] (401 aa)
Score = 173, Expect = 3.9e-11, Identities = 36/134 (26%), Positives = 77/134 (57%)
  Q:    46 LKELTKSFIEKSL----DVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           L E+ +  +E++L    + E D   G  +++++      + R G  ++TL TK G +++++P+    TFE  ++ +++R  + +E  +I++Y  G+S R ++D+   ++G  V    VS +  KI  +I  W++R +E
  S:    22 LGEMVRGTVEETLNAMLEAEADQLCGAGRYERSPAR--QDTRAGSYERTLQTKAGDVNLKVPKLRRQTFETAIIERYRRRESSVEEALIEMYLAGISVRRVEDITEALWGTRVSPSTVSNLNKKIYAKIEAWRNRRIE 157
>gi|13357965|ref|NP_078239.1| integrase-recombinase protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170761890|ref|YP_001752487.1| integrase-recombinase protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|183508433|ref|ZP_02957977.1| integrase-recombinase protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701623|ref|ZP_02971328.1| integrase-recombinase protein [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|11356974|pir||H82893 integrase-recombinase protein UU404 [imported] - Ureaplasma urealyticum >gi|6899391|gb|AAF30814.1|AE002138_1 integrase-recombinase protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827467|gb|ACA32729.1| integrase-recombinase protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|182675841|gb|EDT87746.1| integrase-recombinase protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186700855|gb|EDU19137.1| integrase-recombinase protein [Ureaplasma parvum serovar 6 str. ATCC 27818] (268 aa)
Score = 173, Expect = 4.0e-11, Identities = 44/146 (30%), Positives = 81/146 (55%)
  Q:    28 EKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTW 173
           EKL++K    +K   D+ +   T++F+E  L +EM  HL YE++++     S NYR G +KK L     K+ + IPRD N  FE +++ K+Q +++  E+ ++ L    +   E + +  D+Y    DK +V ++ ++I  +I  +
  S:    11 EKLVKKYKYLHKPILDDYISTFTRTFLEYILTIEMKYHLNYERFERYLSSNSKNYRNGFSKKQLYMNDLKVSINIPRDRNGAFESKIISKYQVDISHFEYRLLSLGINNLQLNEYEKILEDIYNIYNDK-MVDKLCNEIALKIFDY 155
>gi|69243904|ref|ZP_00602482.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68196630|gb|EAN11055.1| ISEf1, transposase [Enterococcus faecium DO] (136 aa)
Score = 173, Expect = 4.0e-11, Identities = 41/106 (38%), Positives = 65/106 (61%)
  Q:    46 LKELTKSFIEKSLDV----EMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG 151
           L EL +S +EK+++     E+   L YEK+D+     S N R G   +++ T+YG+L +EIPRD N  F+ Q +  ++R  + +E  II L+ KG++  EI D+   MYG
  S:    18 LNELFRSHLEKAINTLLRTELTAFLDYEKYDRTGFN-SGNSRNGSYFRSIKTEYGELTLEIPRDRNGEFKQQTLPAYKRTNDTLETTIIHLFEKGVTMSEIADLIEKMYG 126
>gi|15963918|ref|NP_384271.1| partial transposase for insertion sequence element ISRM5 [Sinorhizobium meliloti 1021] >gi|15073093|emb|CAC41552.1| Partial transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (316 aa)
Score = 173, Expect = 4.1e-11, Identities = 41/169 (24%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R LE+ +  L L
  S:     1 MTKTEGKTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLIL 163
>gi|115360191|ref|YP_777329.1| transposase mutator family protein [Burkholderia ambifaria AMMD] >gi|115285479|gb|ABI90995.1| transposase, mutator family [Burkholderia ambifaria AMMD] (136 aa)
Score = 173, Expect = 4.3e-11, Identities = 39/107 (36%), Positives = 59/107 (55%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTRE 141
           G  ++   +  L  + K+  E++L  E+  HLGYEK +        N+R G ++K + T    LDVEIPRD   TF+P L+ K +R     +  II +Y++GMS RE
  S:    30 GTLDRATINEQLAAVKKAIFERALGGELTHHLGYEKGEAKPGG-RTNHRNGTSRKRVATDDDLLDVEIPRDREGTFDPVLIAKGERRFTGFDDRIIAMYARGMSVRE 135
>gi|16262989|ref|NP_435782.1| TRm5 transposase [Sinorhizobium meliloti 1021] >gi|14523640|gb|AAK65194.1| TRm5 transposase [Sinorhizobium meliloti 1021] (410 aa)
Score = 172, Expect = 5.6e-11, Identities = 41/169 (24%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R LE+ +  L L
  S:     1 MTKTEGKTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLIL 163
>gi|51892267|ref|YP_074958.1| transposase [Symbiobacterium thermophilum IAM 14863] >gi|51855956|dbj|BAD40114.1| transposase [Symbiobacterium thermophilum IAM 14863] (407 aa)
Score = 171, Expect = 7.0e-11, Identities = 40/155 (25%), Positives = 86/155 (55%)
  Q:    28 EKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           E+LL K GV+   DFD  L+E  +   +  +++E+   +G +++++++    + YR G  ++  +T+ G +D++IP+    ++ P  +   +R    +   +++ Y  G+STR++ D+   +   GV K  VSR+  ++   +  +++RPLE  Y
  S:     9 EELLRKTGVD---DFD-FLREGLRVLAQGLMELEVSQRIGADRYERSAER--STYRNGYRERQWDTRVGTIDLQIPKLRKGSYMPSFLEPRRRAEKALVAVVLEAYVNGVSTRKVDDLVQALGMTGVSKSQVSRLCAELDEVVQAFRNRPLESRY 157
>gi|87310266|ref|ZP_01092397.1| putative transposase [Blastopirellula marina DSM 3645] >gi|87287015|gb|EAQ78918.1| putative transposase [Blastopirellula marina DSM 3645] (422 aa)
Score = 170, Expect = 8.0e-11, Identities = 41/157 (26%), Positives = 85/157 (54%)
  Q:    23 EKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSL----DVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           E  + E++ + + ++  E     L EL +S +E++L    D E D     ++++++     +  R G   + L TK G++ +++PR  +   E Q++ +++R    +E  ++++Y  G+S R ++D+   ++G  V    VS +  KI   I  W++RPLE
  S:    22 EDRTGEEIRDAIKIDG-EAVRGHLDELVRSTVEETLNQMLDAEADQICKAKRYERSPDRVDS--RAGSYSRKLQTKAGEVSLKVPRLRSLPLETQIIERYKRREASVEEALVEMYLAGVSVRRVEDITEALWGTRVSSSTVSELNQKIYERIDVWRNRPLE 179
>gi|49146144|ref|YP_025582.1| transposase for the insertion element IS2606 (fragment) [Mycobacterium ulcerans Agy99] >gi|42414778|emb|CAE46871.1| probable transposase for the insertion element IS2606 (fragment) [Mycobacterium ulcerans Agy99] (173 aa)
Score = 170, Expect = 8.5e-11, Identities = 32/82 (39%), Positives = 51/82 (62%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIE 126
           LLK +TK+ IE +LD E+  HLGY++ D+      N+    ++K  L    G +++++PRD   TFEP++V K QR L D++
  S:    59 LLKAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGFIEIDVPRDRAGTFEPKIVEKRQRRLTDVD 140
>gi|91205729|ref|YP_538084.1| transposase [Rickettsia bellii RML369-C] >gi|91069273|gb|ABE04995.1| Transposase and inactivated derivative [Rickettsia bellii RML369-C] (287 aa)
Score = 170, Expect = 9.0e-11, Identities = 33/84 (39%), Positives = 53/84 (63%)
  Q:   102 IPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
           +PRD  + F P LV K    +  I+  I+  Y+KGMS  +I+    ++Y A V + L+SRVTD ++ E+ +WQ+RPLE +Y ++
  S:     1 MPRDRKADFTPILVPKRVSRIEGIDDKILSFYAKGMSLSDIKLQLEELYRAEVSESLISRVTDNVMDEVRSWQNRPLESVYAIV 84
>gi|124516652|gb|EAY58160.1| transposase [Leptospirillum sp. Group II UBA] (398 aa)
Score = 170, Expect = 9.6e-11, Identities = 43/149 (28%), Positives = 79/149 (53%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +ED D L+KEL +  ++  L+ EM   LG    ++        YR G  +++  T+ GK+++ +PRD +  F  +L  ++QR+   +   + ++Y +G+STR I+ V  ++ G G     VS +   +   +  + SRPLE+ +  L L
  S:    19 QEDRD-LMKELVREALQSFLEAEMTEFLGASSGERTDER--KGYRAGYYRRSWITRVGKVELAVPRDRSGQFSTELFDRYQRSEKALFSVLAEMYVQGVSTRRIKTVTEELCGHGFSASTVSAINKTLDATLTRFASRPLEEAFPYLIL 164
>gi|15965977|ref|NP_386330.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15966161|ref|NP_386514.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15966519|ref|NP_386872.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|2501306|sp|Q52873|TRA5_RHIME Transposase for insertion sequence element ISRM5 >gi|533461|gb|AAA81001.1| transposase [Sinorhizobium meliloti] >gi|15075247|emb|CAC46803.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] >gi|15075431|emb|CAC46987.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] >gi|15075790|emb|CAC47345.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (398 aa)
Score = 169, Expect = 1.1e-10, Identities = 41/169 (24%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R LE+ +  L L
  S:     1 MTKTEGKTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLIL 163
>gi|46190959|ref|ZP_00120748.2| COG3328: Transposase and inactivated derivatives [Bifidobacterium longum DJO10A] >gi|189440684|ref|YP_001955765.1| Transposase [Bifidobacterium longum DJO10A] >gi|189440817|ref|YP_001955898.1| Transposase [Bifidobacterium longum DJO10A] >gi|189429119|gb|ACD99267.1| Transposase [Bifidobacterium longum DJO10A] >gi|189429252|gb|ACD99400.1| Transposase [Bifidobacterium longum DJO10A] (394 aa)
Score = 169, Expect = 1.1e-10, Identities = 37/144 (25%), Positives = 74/144 (51%)
  Q:    42 FDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILL 185
            D ++++  +  +   LD E D   G  +++++       YR G  ++ L  K GK+ +++P+   + FE  ++ +++R    +E  +I +Y  G+STR++ DV   ++G  +    +S    K+  +I  W+ RPLE  Y  L
  S:    17 LDRMVRKSVEETLNAMLDAEADEITGAARYERSGER--KAYRAGHYERDLTVKAGKMSLKVPKLKGAVFESAVIERYRRREESVEEALIDMYLAGVSTRQVDDVSQLLWGDRMPSQTLSDKLKKVYADIDEWRGRPLEQDYPYL 158
>gi|15965466|ref|NP_385819.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15074647|emb|CAC46292.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (398 aa)
Score = 169, Expect = 1.2e-10, Identities = 41/169 (24%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R LE+ +  L L
  S:     1 MTKTEGKTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLIL 163
>gi|28894871|ref|NP_799478.1| putative transposase [Bacillus megaterium] >gi|28848570|gb|AAO52770.1| putative transposase [Bacillus megaterium] (393 aa)
Score = 169, Expect = 1.3e-10, Identities = 40/140 (28%), Positives = 76/140 (54%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           KE+   + +   ++ +   L  E+   L YEK+D+     + N R G  ++TL+T++G+L + IPRD N  F+ Q V  ++R+ + +E  +I ++ KG++T EI  +   MYG       +S +T  +  ++  ++ R L
  S:    15 KENVTEIFRSHLENAVNTLLASELTAFLDYEKYDRIGFN-TGNSRNGSYERTLHTEFGELHLVIPRDRNGDFKQQTVAPYKRSNDTLEAFVIHMFQKGVTTAEIAHLMERMYGHHYTPQTISNMTKVMSEQVEAFRDRTL 153
>gi|15965305|ref|NP_385658.1| transposase ISRM3 [Sinorhizobium meliloti 1021] >gi|15074485|emb|CAC46131.1| Transposase for insertion sequence element ISRm5 [Sinorhizobium meliloti 1021] (398 aa)
Score = 169, Expect = 1.3e-10, Identities = 41/169 (24%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R LE+ +  L L
  S:     1 MTKTEGRTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLEEPFAYLIL 163
>gi|124515138|gb|EAY56649.1| transposase [Leptospirillum sp. Group II UBA] (161 aa)
Score = 168, Expect = 1.4e-10, Identities = 38/139 (27%), Positives = 80/139 (57%)
  Q:    46 LKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYIL 184
           LK+L +S + + L+V+M  HLG ++ ++   E    YR G  ++TL T+ G L + +P+  + +F   L +++QR+   +  +++++  +G+STR++ ++  ++ G    K  VS+++  +   I  W++R L   Y L
  S:    24 LKKLVESVLNQVLEVQMTEHLGADRHERT--EERAGYRNGIRERTLTTRVGTLILRVPQTRDGSFSTDLFKRYQRSEQALVLSMMEMVVQGVSTRKLANITEELCGTRFSKSTVSQLSTGLSARIQAWKNRKLSGPYPL 160
>gi|48675369|dbj|BAD22831.1| hypothetical protein [Bacillus sp. JF8] (420 aa)
Score = 168, Expect = 1.4e-10, Identities = 41/162 (25%), Positives = 81/162 (50%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           MA+ + +   +LL +L + N  D    + +L +S + + L  +    LG E +++   E    YR G     L T+ G + + +PR  N  F  +L  ++QR+   +   ++++   G+STR++  +  ++ G    K  VS +  ++ P +  W +RPL+D
  S:     1 MAQYQITLDSQLLHQLFLSNAHDAG--VAKLLESVLNQVLQAQATEQLGAEPYERT--EERQGYRNGTYPHQLTTRVGTITLRVPRIRNGKFSTELFARYQRSEQALVLALMEMVVNGVSTRKVAQITEELCGTEFSKSTVSELCKRLDPVVTAWNNRPLDD 158
>gi|87310248|ref|ZP_01092379.1| putative transposase [Blastopirellula marina DSM 3645] >gi|87286997|gb|EAQ78900.1| putative transposase [Blastopirellula marina DSM 3645] (422 aa)
Score = 167, Expect = 2.0e-10, Identities = 40/157 (25%), Positives = 86/157 (54%)
  Q:    23 EKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSL----DVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           E  + E++ + + ++  E     L EL +S +E++L    D E D     ++++++     +  R G   + L TK G++ +++P+  +   E Q++ +++R  + +E  ++++Y  G+S R ++D+   ++G  V    VS +  KI   I  W++RPLE
  S:    22 EDRTGEEIRDAIKIDG-EAVRGHLDELVRSTVEETLNQMLDAEADQICKAKRYERSPDRVDS--RAGSYSRKLQTKAGEVSLKVPQLRSLPLETQIIERYKRRESSVEEALVEMYLAGVSVRRVEDITEALWGTRVSSSTVSELNQKIYERIDVWRNRPLE 179
>gi|194571462|ref|YP_002106462.1| putative exported protein [Burkholderia pseudomallei 406e] >gi|157807933|gb|EDO85103.1| putative exported protein [Burkholderia pseudomallei 406e] (154 aa)
Score = 167, Expect = 2.1e-10, Identities = 39/109 (35%), Positives = 57/109 (52%)
  Q:    35 GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQ 143
           G   +   D  L  L K+  E++   E+  HLG EK +      S N+R G ++K + T    LDVEI RD   T +P L+ + +R     +  II +Y++GMS REIQ
  S:    30 GTPERATIDEQLAALKKAIFERAPGGELTHHLGDEKGEAKPAG-STNHRNGTSRKRVATDDDLLDVEIARDREGTLDPVLIARGERRFTGFDDKIIAMYARGMSVREIQ 137
>gi|76880813|gb|ABA55983.1| ISRm5 transposase [Sinorhizobium meliloti] (398 aa)
Score = 166, Expect = 2.3e-10, Identities = 40/169 (23%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R L++ +  L L
  S:     1 MTKTEGKTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLQEPFAYLIL 163
>gi|189425317|ref|YP_001952494.1| transposase mutator type [Geobacter lovleyi SZ] >gi|189426496|ref|YP_001953673.1| transposase mutator type [Geobacter lovleyi SZ] >gi|189421576|gb|ACD95974.1| transposase mutator type [Geobacter lovleyi SZ] >gi|189422755|gb|ACD97153.1| transposase mutator type [Geobacter lovleyi SZ] (405 aa)
Score = 166, Expect = 2.5e-10, Identities = 38/141 (26%), Positives = 79/141 (56%)
  Q:    38 NKEDFDNLLKELTKSFIEKSL----DVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           N+    + L E+ ++ +E +L    D E D     EK+ ++  +   + R G  ++ L TK G++++ IP+    TFE  ++ +++R    +E ++I++Y  G+S R I+D+   ++G  V    +S +  K+  +I  W++RP+
  S:    15 NESAVRDHLGEMVRNTVEDTLNSMLDSEADRLCNAEKYQRH--DARTDTRAGHYQRKLMTKAGEVNLNIPKLRRQTFETAIIERYRRREASVEESLIEMYLAGVSVRRIEDITETLWGTKVSPGTISNLNKKVYAKIEEWRNRPI 157
>gi|549115|sp|P35879|TRA_CORDI Probable transposase for insertion sequence element (343 aa)
Score = 166, Expect = 2.5e-10, Identities = 30/86 (34%), Positives = 51/86 (59%)
  Q:   102 IPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +PRD   TF P+++ K  R L +++  II LY+ GM+ R+IQ          +  D +S +TD +L E++ WQ+R L++ Y ++ L
  S:     1 MPRDRAGTFTPRMLPKGTRRLTELDDMIISLYAGGMTVRDIQHHLATTLSMDMSPDTISTITDAVLEEVMIWQNRQLDEFYPVIFL 86
>gi|16263808|ref|NP_436600.1| ISRm5 transposase protein [Sinorhizobium meliloti 1021] >gi|15139932|emb|CAC48460.1| probable ISRm5 transposase protein [Sinorhizobium meliloti 1021] (398 aa)
Score = 165, Expect = 3.0e-10, Identities = 40/169 (23%), Positives = 88/169 (52%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M K E  +A   ++ + + N +     L+E+ ++ +++ L+ EMD  LG  K ++        YR G   +TL T+ GKL++ +P+D +  F  +L  ++QR+   +   + ++Y +G+STR+++ +  ++ G       +S +  ++   +  +  R L++ +  L L
  S:     1 MTKTEGRTASAAVKDILLSNPDG----LREVIRTVMQEVLEAEMDEALGAAKGERTPERLG--YRSGHYGRTLITRVGKLELRVPQDRSGHFSTELFERYQRSERALVATLAEMYVQGVSTRKVKAITEELCGHAFSASSISAINKRLDESLKAFAERSLQEPFAYLIL 163
>gi|89097363|ref|ZP_01170253.1| transposase of IS654-like element [Bacillus sp. NRRL B-14911] >gi|89088186|gb|EAR67297.1| transposase of IS654-like element [Bacillus sp. NRRL B-14911] (250 aa)
Score = 165, Expect = 3.5e-10, Identities = 42/147 (28%), Positives = 76/147 (51%)
  Q:    41 DFDNLLK----ELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKL-DVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           DF N+LK    +L K   E  L  E+   L      +N      N R G   +TL+T YG++ D+ +PRD    F  Q+   ++R +  ++  +++LY  G+  R++  +   + G       +S +T  ++ +++ WQ+RPL++ Y  L L
  S:    10 DFANILKLSMQDLLKEKAENILREEIKNVL------ENEPVGEENSRNGYYSRTLDTIYGRIEDLAVPRDRKGDFTTQMFEPYKRRMVAVDELVVQLYQHGVGVRQVGLIMKSLLGEQYSPGTISNITSAVMEDVIEWQNRPLKERYCALFL 155
>gi|118727680|ref|ZP_01576273.1| transposase, mutator type [Clostridium cellulolyticum H10] >gi|118662954|gb|EAV69622.1| transposase, mutator type [Clostridium cellulolyticum H10] (398 aa)
Score = 164, Expect = 3.9e-10, Identities = 35/142 (24%), Positives = 72/142 (50%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           KE+  NL++   +  +   LD E +      K+++        YR G   ++L T  G++ + +P+     FE  ++ +++R  + +E  +I++Y  G+S R ++D+   ++G  V    +S +  K    I  W++RPL+D
  S:    14 KEELKNLVRSSVEETLNNLLDKEAEDLTNAAKYERTQER--QGYRSGHYTRSLQTTSGEVTLRVPKLKGVPFETAIIERYRRRESSVEEALIEMYLAGVSVRRVEDITEALWGTKVSPGTISELNKKAYVHIENWRNRPLQD 153
>gi|118726974|ref|ZP_01575587.1| transposase, mutator type [Clostridium cellulolyticum H10] >gi|118663614|gb|EAV70262.1| transposase, mutator type [Clostridium cellulolyticum H10] (398 aa)
Score = 164, Expect = 4.0e-10, Identities = 35/142 (24%), Positives = 72/142 (50%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           KE+  NL++   +  +   LD E +      K+++        YR G   ++L T  G++ + +P+     FE  ++ +++R  + +E  +I++Y  G+S R ++D+   ++G  V    +S +  K    I  W++RPL+D
  S:    14 KEELKNLVRSSVEETLNNLLDKEAEDLTNAAKYERTQER--QGYRSGHYTRSLQTTSGEVTLRVPKLKGVPFETAIIERYRRRESSVEEALIEMYLAGVSVRRVEDITEALWGTKVSPGTISELNKKAYVHIENWRNRPLQD 153
>gi|27881402|gb|AAN06002.1| transposase TpnA2 [Clostridium cellulolyticum] (398 aa)
Score = 164, Expect = 4.2e-10, Identities = 35/142 (24%), Positives = 72/142 (50%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           KE+  NL++   +  +   LD E +      K+++        YR G   ++L T  G++ + +P+     FE  ++ +++R  + +E  +I++Y  G+S R ++D+   ++G  V    +S +  K    I  W++RPL+D
  S:    14 KEELKNLVRSSVEETLNHLLDKEAEDLTNAAKYERTQER--QGYRSGHYTRSLQTTSGEVTLRVPKLKGVPFETAIIERYRRRESSVEEALIEMYLAGVSVRRVEDITEALWGTKVSPGTISELNKKAYVHIENWRNRPLQD 153
>gi|189424558|ref|YP_001951735.1| transposase mutator type [Geobacter lovleyi SZ] >gi|189420817|gb|ACD95215.1| transposase mutator type [Geobacter lovleyi SZ] (380 aa)
Score = 164, Expect = 4.3e-10, Identities = 34/134 (25%), Positives = 71/134 (52%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           +++   +  +   LD E D     EK+ ++        R G  ++ L TK G++++ IP+    TFE  ++ +++R    +E ++I++Y  G+S R I+D+   ++G  V    +S +  K+  +I  W++RP+
  S:     1 MVRNTVEDTLNSMLDSEADRLCNAEKYQRHDARIDT--RAGHYQRKLMTKAGEVNLNIPKLRRQTFETAIIERYRRREASVEESLIEMYLAGVSVRRIEDITETLWGTKVSPGTISNLNKKVYAKIEEWRNRPI 132
>gi|69247434|ref|ZP_00604347.1| Transposase, mutator type [Enterococcus faecium DO] >gi|68194836|gb|EAN09310.1| Transposase, mutator type [Enterococcus faecium DO] (396 aa)
Score = 164, Expect = 4.7e-10, Identities = 49/150 (32%), Positives = 80/150 (53%)
  Q:    38 NKEDFDNLLKELTKSFIEKSLD----VEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           N   F+  + EL +S +EKSL+     E+   L YE + + + E   N R G  ++  +TKYG + + IPRD    F   L+ K++R     E  I+ L+ +GMS  EI  +   + GA   K  +S +TDK L  + ++++R L   Y ++ L
  S:    18 NLPAFEQAVTELFRSELEKSLNEILAYELTDFLDYEPYARTNNE---NSRNGSYQRKFDTKYGTITLNIPRDRMGEFFTSLLPKYRRRDLFTETTILDLFEEGMSHSEICSMIQKLCGARYSKQTISNITDKALECVDSFKNRILNKEYAVVYL 168
>gi|71737636|ref|YP_272469.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71558189|gb|AAZ37400.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (130 aa)
Score = 163, Expect = 6.0e-10, Identities = 39/114 (34%), Positives = 63/114 (55%)
  Q:    20 AKKEKSSAEKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLY 133
           A++  S  ++L+E+   G  + E   +      K+ IE++L  E+  HLGY +  +   E S N R GK+ KT+ T  G L ++IPRD + +F P L+ KH+R     +  II +Y
  S:    12 ARELPSIPQELIEQFVKGPMSAEAIQDASMAFKKALIERALGAELGHHLGYPQGAERPEE-STNQRNGKSSKTVLTDDGPLRLDIPRDRDGSFAPILIPKHERRFTGFDDKIIAMY 126
>gi|51893427|ref|YP_076118.1| transposase [Symbiobacterium thermophilum IAM 14863] >gi|51857116|dbj|BAD41274.1| transposase [Symbiobacterium thermophilum IAM 14863] (421 aa)
Score = 162, Expect = 7.4e-10, Identities = 39/155 (25%), Positives = 86/155 (55%)
  Q:    28 EKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           E+LL K GV++ +     L+E  +   +  +++E+   +G E+++++S    +NYR G  ++  +T+ G +D++IP+    ++ P  +   +R    +   + + Y +G+STR++ ++   +   GV K  VSR+  ++   +  +++RPLE  Y
  S:    23 EELLRKSGVDDVD----FLREGVRVLAQGLMELEVSQQIGAERYERSSER--SNYRNGYRERQWDTRVGTIDLQIPKLRKGSYMPSWLEPRRRAEKALVAVVQEAYIQGVSTRKVDELVQALGMTGVSKSQVSRLCAELDEVVEAFRNRPLEGRY 171
>gi|89101136|ref|ZP_01173970.1| transposase of IS654-like element [Bacillus sp. NRRL B-14911] >gi|89084137|gb|EAR63304.1| transposase of IS654-like element [Bacillus sp. NRRL B-14911] (269 aa)
Score = 162, Expect = 7.7e-10, Identities = 42/147 (28%), Positives = 76/147 (51%)
  Q:    41 DFDNLLK----ELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKL-DVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           DF N+LK    +L K   E  L  E+   L      +N      N R G   +TL+T YG++ D+ +PRD    F  Q+   ++R +  ++  +++LY  G+  R++  +   + G       +S +T  ++ +++ WQ+RPL++ Y  L L
  S:    10 DFANILKLSMQDLLKEKAENILREEIKNVL------ENEPVGEENSRNGYYSRTLDTIYGRIEDLAVPRDRKGDFTTQMFEPYKRRMVAVDELVVQLYQHGVGVRQVGLIMKSLLGEQYSPGTISNITSAVMEDVIEWQNRPLKERYCALFL 155
>gi|118726721|ref|ZP_01575340.1| transposase, mutator type [Clostridium cellulolyticum H10] >gi|118663887|gb|EAV70529.1| transposase, mutator type [Clostridium cellulolyticum H10] (168 aa)
Score = 162, Expect = 8.0e-10, Identities = 35/142 (24%), Positives = 72/142 (50%)
  Q:    39 KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           KE+  NL++   +  +   LD E +      K+++        YR G   ++L T  G++ + +P+     FE  ++ +++R  + +E  +I++Y  G+S R ++D+   ++G  V    +S +  K    I  W++RPL+D
  S:    14 KEELKNLVRSSVEETLNNLLDKEAEDLTNAAKYERTQER--QGYRSGHYTRSLQTTSGEVTLRVPKLKGVPFETAIIERYRRRESSVEEALIEMYLAGVSVRRVEDITEALWGTKVSPGTISELNKKAYVHIENWRNRPLQD 153
>gi|124515597|gb|EAY57107.1| transposase [Leptospirillum sp. Group II UBA] (241 aa)
Score = 161, Expect = 8.9e-10, Identities = 33/137 (24%), Positives = 77/137 (56%)
  Q:    46 LKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LK+  +S + + L+ +M  HLG ++ ++   E    YR G  ++TL T+ G + + +P+  + +F   L +++QR+   +  +++++  +G+STR++ ++  ++ G    K  VS+++  +   +  W++R L   Y
  S:    33 LKKRVESVLNQVLEAQMTEHLGADRHERT--EERAGYRNGVRERTLTTRVGTVILRVPQTRDGSFSTDLFKRYQRSEQALVLSMMEMVVQGVSTRKVANITEELCGTRFSKSTVSQLSTGLSARVQAWKNRKLSSPY 167
>gi|124514500|gb|EAY56013.1| transposase [Leptospirillum sp. Group II UBA] (405 aa)
Score = 160, Expect = 1.3e-09, Identities = 34/137 (24%), Positives = 78/137 (56%)
  Q:    46 LKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           LK+L +S + + L+ +M  HLG ++ ++   E    YR G  ++TL T+ G + + +P+  + +F   L +++QR+   +  +++++  +G+STR++ ++  ++ G    K  VS+++  +   +  W++R L   Y
  S:    24 LKKLVESVLNQVLEAQMTEHLGADRHERT--EERAGYRNGVRERTLTTRVGTVILRVPQTRDGSFSTDLFKRYQRSEQALVLSMMEMVVQGVSTRKVANITEELCGTRFSKSTVSQLSTGLSARVQAWKNRKLSSPY 158
>gi|124516040|gb|EAY57549.1| transposase [Leptospirillum sp. Group II UBA] (164 aa)
Score = 160, Expect = 1.4e-09, Identities = 37/142 (26%), Positives = 76/142 (53%)
  Q:    46 LKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           +K+L +S + + L+ +M  HLG ++ +++S      YR G  ++ L T+ G L + +P+  +  F   L R++QR+   +   ++++  +G+STR++  +  ++ GA   K  VS +   +   +  W++R L   Y  L L
  S:     1 MKKLVESVLNQVLEAQMVDHLGADRHERSSDR--TGYRNGYRERQLTTRVGTLILRVPQTRDGNFSTDLFRRYQRSEQALVLALMEMVVQGVSTRKVTHITEELCGAQFSKSTVSSLATGLSARVNHWRNRRLNGPYPFLLL 140
>gi|89095967|ref|ZP_01168861.1| transposase of IS654-like element [Bacillus sp. NRRL B-14911] >gi|89089713|gb|EAR68820.1| transposase of IS654-like element [Bacillus sp. NRRL B-14911] (190 aa)
Score = 160, Expect = 1.4e-09, Identities = 42/147 (28%), Positives = 76/147 (51%)
  Q:    41 DFDNLLK----ELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKL-DVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           DF N+LK    +L K   E  L  E+   L      +N      N R G   +TL+T YG++ D+ +PRD    F  Q+   ++R +  ++  +++LY  G+  R++  +   + G       +S +T  ++ +++ WQ+RPL++ Y  L L
  S:    10 DFANILKLSMQDLLKEKAENILREEIKNVL------ENEPVGEENSRNGYYSRTLDTIYGRIEDLAVPRDRKGDFTTQMFEPYKRRMVAVDELVVQLYQHGVGVRQVGLIMKSLLGEQYSPGTISNITSAVMEDVIEWQNRPLKERYCALFL 155
>gi|21673706|ref|NP_661771.1| transposase [Chlorobium tepidum TLS] >gi|21646828|gb|AAM72113.1| transposase, internal deletion [Chlorobium tepidum TLS] (168 aa)
Score = 159, Expect = 1.6e-09, Identities = 31/88 (35%), Positives = 50/88 (56%)
  Q:    79 SNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKI 166
           ++N R G   KT+     +  +  PRD N +FEPQL+ K Q      +  I+ + ++GMS R++Q + L++Y   V + L+S VTD I
  S:    31 TSNSRNGHGSKTIIVDNDQFTIRSPRDRNGSFEPQLIPKRQTRFKGFDEKILAMDARGMSVRDMQAMLLELYQVEVSEALISSVTDAI 118
>gi|26250984|ref|NP_757024.1| transposase [Escherichia coli CFT073] >gi|26111416|gb|AAN83598.1|AE016771_109 Putative Transposase within prophage [Escherichia coli CFT073] (260 aa)
Score = 154, Expect = 5.6e-09, Identities = 30/68 (44%), Positives = 45/68 (66%)
  Q:   115 VRKHQRNLND-IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++KHQ  L+D +E  II+L++ GMS ++I     D+Y   V    +S VTDK++PE+  WQ RPLE +Y
  S:     1 MKKHQTTLSDELERKIIRLFALGMSYQDISREIEDLYAFSVSTTTISAVTDKVIPELKQWQQRPLEKVY 69
>gi|69249076|ref|ZP_00604860.1| ISEf1, transposase [Enterococcus faecium DO] >gi|68194280|gb|EAN08797.1| ISEf1, transposase [Enterococcus faecium DO] (125 aa)
Score = 153, Expect = 7.7e-09, Identities = 38/100 (38%), Positives = 62/100 (62%)
  Q:    46 LKELTKSFIEKSLDV----EMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDV 145
           L EL +S +EK+++     E+   L YEK+D+     S N R G   +++ T+YG+L +EIPRD N  F+ Q +  ++R  + +E  II L+ KG++  EI D+
  S:    18 LNELFRSHLEKAINTLLRTELTAFLDYEKYDRTGFN-SGNSRNGSYFRSIKTEYGELTLEIPRDRNGEFKQQTLPAYKRTNDTLETTIIHLFEKGVTMSEIADL 120
>gi|46199734|ref|YP_005401.1| transposase [Thermus thermophilus HB27] >gi|46197360|gb|AAS81774.1| transposase [Thermus thermophilus HB27] (385 aa)
Score = 152, Expect = 1.1e-08, Identities = 35/146 (23%), Positives = 74/146 (50%)
  Q:    42 FDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
            D +++E  K  +E  +++E +  L   +W           + G  ++ L TK+G + + +PR+ +  F   L   ++R + D+E   + +Y+ G+STR++ +V   + G       +SR+ + +LP +  ++ RPL+  Y  + L
  S:    11 LDAVVREAVKQALETVMELEREVFLA--EW--------GGKKNGYYERGLVTKHGPVRLRVPRERDGRFHTALFAPYRRRMEDLEAFALAMYAAGISTRKVGEVLGYLLGGTYSASTISRIAEGVLPRLEAFRKRPLKPRYAFVYL 146
>gi|172064614|ref|YP_001812264.1| transposase mutator type [Burkholderia ambifaria MC40-6] >gi|171998099|gb|ACB69015.1| transposase mutator type [Burkholderia ambifaria MC40-6] (295 aa)
Score = 151, Expect = 1.4e-08, Identities = 25/51 (49%), Positives = 36/51 (70%)
  Q:   132 LYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +Y++GMS REIQ    + YG  V  D +S VTD+++ E L+WQ+RPLE +Y
  S:     1 MYARGMSVREIQGFLAEHYGTEVSPDFISSVTDEVMDEALSWQNRPLEPMY 51
>gi|157827046|ref|YP_001496110.1| transposase [Rickettsia bellii OSU 85-389] >gi|157802350|gb|ABV79073.1| Transposase and inactivated derivative [Rickettsia bellii OSU 85-389] (110 aa)
Score = 151, Expect = 1.5e-08, Identities = 36/103 (34%), Positives = 58/103 (56%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYG-KLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFL 147
           + ++L K  +E+ L+ ++D  LGY +  +  +   NN R G T+KT+    G K+ +E+P D    FEP+L+ K  R     E  +I LY++GM+  EIQ   L
  S:     1 MFQQLKKRLVERILESKLDKELGYSRHSKVPK-IDNNRRNGITEKTIIDDSGQKITIEVPHDREGEFEPKLIPKGVRRFAGFEDTVISLYARGMTISEIQSTVL 103
>gi|147677723|ref|YP_001211938.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|147677802|ref|YP_001212017.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|147677898|ref|YP_001212113.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|147678692|ref|YP_001212907.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146273820|dbj|BAF59569.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146273899|dbj|BAF59648.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146273995|dbj|BAF59744.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] >gi|146274789|dbj|BAF60538.1| transposase and inactivated derivatives [Pelotomaculum thermopropionicum SI] (409 aa)
Score = 150, Expect = 1.7e-08, Identities = 45/177 (25%), Positives = 90/177 (50%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLG---YEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSLLMELDLKL 195
           MA+ + +  ++LL +L + N +D  + +  L +S + + L  +    L    YE+ D+        YR G     L T+ G + + +PR  N  F  ++  ++QR+   +   ++++   G+STR+I  +  ++ GA   K  VS +  K+ P +++W +R L ++     L+  L LK+
  S:     1 MAQYQITVNQELLHQLFLSNNKD--SGIAALLESVLNQILQAQATEQLQAGPYERTDER-----KGYRNGTYPHQLTTRVGTITLRVPRFRNGQFSTEMFARYQRSEQALVLTLMEMVINGVSTRKISQITEELCGAEFSKSTVSDLCKKLDPLVISWNNRDLREMRYPFILVDALVLKV 173
>gi|91205727|ref|YP_538082.1| transposase [Rickettsia bellii RML369-C] >gi|91069271|gb|ABE04993.1| Transposase and inactivated derivative [Rickettsia bellii RML369-C] (115 aa)
Score = 150, Expect = 1.7e-08, Identities = 37/113 (32%), Positives = 61/113 (53%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYG-KLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKD 157
           + ++L K  +E+ L+ ++D  LGY +  +  +   NN R G T+KT+    G K+ +E+P D    FEP+L+ K  R     E  +I LY++GM+  EIQ   L +    +  D
  S:     1 MFQQLKKRLVERILESKLDKELGYSRHSKVPK-IDNNRRNGITEKTIIDDSGQKITIEVPHDREGEFEPKLIPKGVRRFAGFEDTVISLYARGMTISEIQSTVLRVKSKNIKFD 113
>gi|87123117|ref|ZP_01078968.1| probable transposase [Synechococcus sp. RS9917] >gi|86168837|gb|EAQ70093.1| probable transposase [Synechococcus sp. RS9917] (230 aa)
Score = 148, Expect = 3.5e-08, Identities = 35/135 (25%), Positives = 77/135 (57%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG--AGVDKDLVSRVTDKILPEILTWQSRPLE 179
           L+ EL +  +++ +++E+   LG E+++++       +R G   + L T+ G +D++IP+  + +F P ++   +R    +   +++ Y  G+STR++ D  +   G  +G+ K  VSR+  +I  ++  + +RPLE
  S:    23 LIPELVRHGLQQLIELEVAAVLGAERYERSEERLG--HRNGYRPRVLTTQVGDIDLQIPKLRSGSFLPSILEPRRRVDQALYAVVMEAYVAGVSTRKV-DALVAALGSQSGISKSQVSRICAEIDLQVQAFLNRPLE 156
>gi|1617569|gb|AAB57888.1| putative transposase [Rhodococcus opacus] (418 aa)
Score = 146, Expect = 5.3e-08, Identities = 38/138 (27%), Positives = 74/138 (53%)
  Q:    41 DFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           D  ++  EL ++ ++  +D E    LG  ++++   E    YR G   KT+ T  G ++++IP+  + +F P L+ + +R    +   I++ Y  G+STR + D+   +  G+G+ K  VSR+  ++  EI  ++ R L
  S:    19 DSASVFAELIRAGMQALIDAEATEALGAGRYER--AEGRTTYRNGSRAKTVATTSGDVELKIPKLRSGSFFPSLLERRRRIDRALHAVIMEAYVHGVSTRNVDDLVGALGVGSGISKSEVSRICGQLDTEIGRFRDRTL 155
>gi|55978384|ref|YP_145440.1| transposase-like protein [Thermus thermophilus HB8] >gi|55773557|dbj|BAD71997.1| transposase-like protein [Thermus thermophilus HB8] (186 aa)
Score = 146, Expect = 6.1e-08, Identities = 27/98 (27%), Positives = 55/98 (56%)
  Q:    83 RKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           R G   + L T +G++D+++PRD  S + P  ++ + R L D+    + LY+ G+S R+  ++   + G     + +S +TD++L     +++RPL +
  S:    55 RNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPE 152
>gi|75992401|dbj|BAE45067.1| transposase [Terrabacter sp. DBF63] (138 aa)
Score = 145, Expect = 7.7e-08, Identities = 36/137 (26%), Positives = 70/137 (51%)
  Q:    46 LKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++ L  S ++  +D E   H+G  K ++ +   +   R G  +K + T  G + V+IP+    +F P L+   +R    +   I + Y  G+STR++ D+   +   +G+ K  VSR+   +  E+  W++RPL+  +
  S:     1 MRRLLGSALQMLVDAEATEHIGAAKHERTTARTTQ--RNGTREKLVATTAGDVTVKIPKTRTGSFFPSLLAPRRRVDKALHAVICEAYVHGVSTRKVDDLVAALGIESGISKSEVSRICATLDEEVGAWRNRPLDHTW 136
>gi|49146145|ref|YP_025583.1| transposase for the insertion element IS2606 (fragment) [Mycobacterium ulcerans Agy99] >gi|42414779|emb|CAE46872.1| probable transposase for the insertion element IS2606 (fragment) [Mycobacterium ulcerans Agy99] (302 aa)
Score = 144, Expect = 8.4e-08, Identities = 25/54 (46%), Positives = 37/54 (68%)
  Q:   129 IIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++ LY++G++T EI   F  +Y A V KD VSR+TD +L E+  W +RPLE +Y
  S:     1 MLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVY 54
>gi|55978415|ref|YP_145471.1| transposase [Thermus thermophilus HB8] >gi|55980203|ref|YP_143500.1| transposase [Thermus thermophilus HB8] >gi|55980987|ref|YP_144284.1| transposase [Thermus thermophilus HB8] >gi|55771616|dbj|BAD70057.1| transposase [Thermus thermophilus HB8] >gi|55772400|dbj|BAD70841.1| transposase [Thermus thermophilus HB8] >gi|55773588|dbj|BAD72028.1| transposase [Thermus thermophilus HB8] (406 aa)
Score = 144, Expect = 1.0e-07, Identities = 27/98 (27%), Positives = 55/98 (56%)
  Q:    83 RKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           R G   + L T +G++D+++PRD  S + P  ++ + R L D+    + LY+ G+S R+  ++   + G     + +S +TD++L     +++RPL +
  S:    55 RNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPE 152
>gi|55978267|ref|YP_145323.1| transposase [Thermus thermophilus HB8] >gi|55978312|ref|YP_145368.1| transposase [Thermus thermophilus HB8] >gi|55981238|ref|YP_144535.1| transposase [Thermus thermophilus HB8] >gi|55981836|ref|YP_145133.1| transposase [Thermus thermophilus HB8] >gi|27807845|dbj|BAC55317.1| transposase [Thermus aquaticus] >gi|55772651|dbj|BAD71092.1| transposase [Thermus thermophilus HB8] >gi|55773249|dbj|BAD71690.1| transposase [Thermus thermophilus HB8] >gi|55773440|dbj|BAD71880.1| transposase [Thermus thermophilus HB8] >gi|55773485|dbj|BAD71925.1| transposase [Thermus thermophilus HB8] (406 aa)
Score = 143, Expect = 1.2e-07, Identities = 27/98 (27%), Positives = 55/98 (56%)
  Q:    83 RKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           R G   + L T +G++D+++PRD  S + P  ++ + R L D+    + LY+ G+S R+  ++   + G     + +S +TD++L     +++RPL +
  S:    55 RNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPE 152
>gi|121534623|ref|ZP_01666445.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] >gi|121534958|ref|ZP_01666776.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] >gi|121306371|gb|EAX47295.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] >gi|121306875|gb|EAX47795.1| transposase, mutator type [Thermosinus carboxydivorans Nor1] (408 aa)
Score = 143, Expect = 1.3e-07, Identities = 37/162 (22%), Positives = 81/162 (50%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKED--FDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           MA+ + +   K+L +L + N +D    + L+E+    ++     ++     YE+ D+        YR G     L T+ G + +++PR  +  F  ++  ++QR+   +   ++++   G+STR++  +  ++ G+   K  VS +  ++ P +  W  RPL+D
  S:     1 MAQYQINIDSKILHQLFLSNAKDAAMASFLEEVLNQILQAQATEQLRAER-YERTDER-----QGYRNGVYPHRLTTRVGTITLKVPRFRDGKFSTEMFARYQRSEQALVLTLMEMVVNGVSTRKVAQITEELCGSEFSKSTVSDLCKRLDPIVHAWNERPLKD 158
>gi|119855365|ref|YP_935968.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|119698082|gb|ABL95153.1| transposase, mutator type [Mycobacterium sp. KMS] (391 aa)
Score = 143, Expect = 1.3e-07, Identities = 39/149 (26%), Positives = 75/149 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           LL +L      D   +  EL ++ +++ ++ E    +G  ++ +   +    +R G   KT++T  G ++V+IP+    +F P L+ + +R    +   I++ Y  G+STR + D+   M    GV K  VSR+   +  EI  +++R L
  S:     8 LLAQLDALKSADVGAVFAELIRAGLQQLIEAEATAAIGAGRYQRT--DGRTVHRNGHRPKTVSTTSGDVEVQIPKLRAGSFFPSLLERRRRIDKALHAVIMEAYVHGVSTRSVDDLVFAMGVETGVSKSEVSRICAGLDKEIEAFRTRSL 155
>gi|108802536|ref|YP_642732.1| transposase, mutator type [Mycobacterium sp. MCS] >gi|108772955|gb|ABG11676.1| transposase, mutator type [Mycobacterium sp. MCS] (400 aa)
Score = 143, Expect = 1.3e-07, Identities = 39/149 (26%), Positives = 75/149 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           LL +L      D   +  EL ++ +++ ++ E    +G  ++ +   +    +R G   KT++T  G ++V+IP+    +F P L+ + +R    +   I++ Y  G+STR + D+   M    GV K  VSR+   +  EI  +++R L
  S:    17 LLAQLDALKSADVGAVFAELIRAGLQQLIEAEATAAIGAGRYQRT--DGRTVHRNGHRPKTVSTTSGDVEVQIPKLRAGSFFPSLLERRRRIDKALHAVIMEAYVHGVSTRSVDDLVFAMGVETGVSKSEVSRICAGLDKEIEAFRTRSL 164
>gi|77407137|ref|ZP_00784131.1| transposase, Mutator family [Streptococcus agalactiae H36B] >gi|77174256|gb|EAO77131.1| transposase, Mutator family [Streptococcus agalactiae H36B] (317 aa)
Score = 142, Expect = 1.5e-07, Identities = 31/86 (36%), Positives = 45/86 (52%)
  Q:   102 IPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           IP+D N  F P L+  + R  N +E  +IKLY  G++TREI D+   MYG       VS ++      + ++  R LE  Y +L L
  S:     3 IPKDRNGEFSPALIPSYGRRDNHLEEMVIKLYRTGVTTREISDIIERMYGHHYSPATVSNISKATQENVASFHERSLEANYTVLYL 88
>gi|118462450|ref|YP_881015.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118462631|ref|YP_880739.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118462842|ref|YP_880700.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118463271|ref|YP_879755.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118463770|ref|YP_881359.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464090|ref|YP_879335.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464364|ref|YP_882746.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464387|ref|YP_881077.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464695|ref|YP_884233.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464879|ref|YP_881819.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118464930|ref|YP_881029.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118465312|ref|YP_884221.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118465445|ref|YP_881193.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118465990|ref|YP_881208.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466223|ref|YP_881439.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466328|ref|YP_880480.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466335|ref|YP_884158.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466405|ref|YP_881711.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466443|ref|YP_882097.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466468|ref|YP_883151.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466824|ref|YP_879616.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118467300|ref|YP_884149.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118163737|gb|ABK64634.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118163918|gb|ABK64815.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164129|gb|ABK65026.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164558|gb|ABK65455.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165057|gb|ABK65954.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165377|gb|ABK66274.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165651|gb|ABK66548.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165674|gb|ABK66571.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118165982|gb|ABK66879.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166166|gb|ABK67063.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166217|gb|ABK67114.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166599|gb|ABK67496.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166732|gb|ABK67629.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167277|gb|ABK68174.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167510|gb|ABK68407.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167615|gb|ABK68512.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167622|gb|ABK68519.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167692|gb|ABK68589.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167730|gb|ABK68627.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167755|gb|ABK68652.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118168111|gb|ABK69008.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118168587|gb|ABK69484.1| transposase, Mutator family protein [Mycobacterium avium 104] (424 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    22 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 171
>gi|118463244|ref|YP_884159.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164531|gb|ABK65428.1| transposase, Mutator family protein [Mycobacterium avium 104] (348 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    22 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 171
>gi|118464816|ref|YP_881566.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166103|gb|ABK67000.1| transposase, Mutator family protein [Mycobacterium avium 104] (424 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    22 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 171
>gi|118463153|ref|YP_882159.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164440|gb|ABK65337.1| transposase, Mutator family protein [Mycobacterium avium 104] (314 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    22 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 171
>gi|118466508|ref|YP_879333.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167795|gb|ABK68692.1| transposase, Mutator family protein [Mycobacterium avium 104] (424 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    22 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 171
>gi|118463020|ref|YP_883280.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118467020|ref|YP_882014.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164307|gb|ABK65204.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118168307|gb|ABK69204.1| transposase, Mutator family protein [Mycobacterium avium 104] (423 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    21 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 170
>gi|118465276|ref|YP_881433.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166563|gb|ABK67460.1| transposase, Mutator family protein [Mycobacterium avium 104] (270 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    22 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 171
>gi|118463467|ref|YP_882714.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|5524319|gb|AAD44212.1|AF143772_15 transposase [Mycobacterium avium] >gi|600522|gb|AAA69904.1| transposase [Mycobacterium avium] >gi|118164754|gb|ABK65651.1| transposase, Mutator family protein [Mycobacterium avium 104] (410 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 73/151 (48%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +F P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:     8 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 157
>gi|118463251|ref|YP_880483.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118164538|gb|ABK65435.1| transposase, Mutator family protein [Mycobacterium avium 104] (420 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:    22 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASR--TNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 171
>gi|118465227|ref|YP_881290.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118466425|ref|YP_883455.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118166514|gb|ABK67411.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167712|gb|ABK68609.1| transposase, Mutator family protein [Mycobacterium avium 104] (425 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:    22 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASR--TNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 171
>gi|41406202|ref|NP_959038.1| hypothetical protein MAP0104 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41406947|ref|NP_959783.1| hypothetical protein MAP0849c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41409857|ref|NP_962693.1| hypothetical protein MAP3759c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41394550|gb|AAS02421.1| hypothetical protein MAP_0104 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41395297|gb|AAS03166.1| hypothetical protein MAP_0849c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41398689|gb|AAS06309.1| hypothetical protein MAP_3759c [Mycobacterium avium subsp. paratuberculosis K-10] (411 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:     8 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASR--TNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 157
>gi|564032|gb|AAB59984.1| transposase [Mycobacterium avium] (411 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:     8 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASR--TNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 157
>gi|4210755|emb|CAA11710.1| transposase [Mycobacterium avium subsp. paratuberculosis] (395 aa)
Score = 142, Expect = 1.6e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:     8 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASR--TNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 157
>gi|41406126|ref|NP_958962.1| hypothetical protein MAP0028c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41407248|ref|NP_960084.1| hypothetical protein MAP1150c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41408248|ref|NP_961084.1| hypothetical protein MAP2150 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41408372|ref|NP_961208.1| hypothetical protein MAP2274 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41394474|gb|AAS02345.1| hypothetical protein MAP_0028c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41395600|gb|AAS03467.1| hypothetical protein MAP_1150c [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41396603|gb|AAS04467.1| hypothetical protein MAP_2150 [Mycobacterium avium subsp. paratuberculosis K-10] >gi|41396728|gb|AAS04591.1| hypothetical protein MAP_2274 [Mycobacterium avium subsp. paratuberculosis K-10] (411 aa)
Score = 142, Expect = 1.7e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:     8 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASRI--NQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 157
>gi|12407059|emb|CAC24846.1| putative transposase [Mycobacterium avium subsp. paratuberculosis] (395 aa)
Score = 142, Expect = 1.7e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:     8 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASRI--NQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 157
>gi|85706534|ref|ZP_01037627.1| transposase [Roseovarius sp. 217] >gi|85668946|gb|EAQ23814.1| transposase [Roseovarius sp. 217] (287 aa)
Score = 142, Expect = 1.7e-07, Identities = 43/169 (25%), Positives = 80/169 (47%)
  Q:    19 MAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQN-SREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M  KE +  E +++   V  K D  + L+EL +   ++ +D+E+    G    +++  RE   N+R G   +  +T+ G + + IP+    ++ P  +   +     +   I + Y  G+STR + D+   M   G  K  VSR+ + I   +  + +RPLE  +  L L
  S:     1 MTTKESTMTETMIDLPSVIAKSDDADFLRELIQDAAQRLMDIEVAAVCGAGHGERSPDRE---NHRNGYRPRQWDTRAGTIGLNIPKLRKGSYFPTFLEPRRTAEKALMAVIQEAYIHGISTRAVDDLVRAMGLTGTSKSQVSRLCEVIDERVQAFLNRPLEGDWPFLWL 167
>gi|4210728|emb|CAA11709.1| transposase [Mycobacterium avium subsp. paratuberculosis] (395 aa)
Score = 141, Expect = 2.2e-07, Identities = 39/151 (25%), Positives = 77/151 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG-AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D  + +K+  ++  +  +D E+   +G    ++++     N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+   +   AG+ K  VSR+   +  E+  ++ RPL +
  S:     8 LLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHERSASR--XNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAFRDRPLSE 157
>gi|170736164|ref|YP_001777424.1| transposase, mutator type [Burkholderia cenocepacia MC0-3] >gi|169818352|gb|ACA92934.1| transposase, mutator type [Burkholderia cenocepacia MC0-3] (136 aa)
Score = 141, Expect = 2.2e-07, Identities = 33/93 (35%), Positives = 56/93 (60%)
  Q:    28 EKLLEKL--GVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQR 120
           ++LL++L  G     +  +L+ E  K+ IE+++  EM+ HLGY +  Q+      N R G + KT+ T +G +  E+ RD + +FEP L+ KH+R
  S:    27 KELLDQLVKGPMTPAEVQDLMLEFKKAVIERAMGAEMNLHLGYPQ-GQSKPHGQANGRNGASGKTVITDHGPVRAEVSRDRDDSFEPILIPKHER 120
>gi|114762430|ref|ZP_01441888.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114545048|gb|EAU48052.1| Transposase, mutator type [Roseovarius sp. HTCC2601] (400 aa)
Score = 140, Expect = 2.3e-07, Identities = 38/144 (26%), Positives = 70/144 (48%)
  Q:    36 VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           VE   D D LL+E+     E+ +++E+    G +  ++ S   +   R G   +   T+ G +++ IPR    ++ P  +   +     +   I + Y  G+STR + D+   M G GV K  VSR+ ++I   +  + +RP+E
  S:    12 VEKSADAD-LLREMIGFAAERLMELEVGAKTGADYGEKTSERLAQ--RNGYRDRDWQTRAGSVELRIPRLRTGSYFPSFLEPRRSVEKALTAVIQEAYVHGVSTRSMDDLVQAMGGTGVSKSQVSRLCEEIDERVDAFLTRPIE 152
>gi|114762631|ref|ZP_01442075.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114762945|ref|ZP_01442375.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114764350|ref|ZP_01443576.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114764560|ref|ZP_01443764.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114764958|ref|ZP_01444131.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114766709|ref|ZP_01445648.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114767132|ref|ZP_01446012.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114540694|gb|EAU43762.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114541099|gb|EAU44154.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114542670|gb|EAU45694.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114542936|gb|EAU45956.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114543104|gb|EAU46122.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114544269|gb|EAU47277.1| Transposase, mutator type [Roseovarius sp. HTCC2601] >gi|114544886|gb|EAU47891.1| Transposase, mutator type [Roseovarius sp. HTCC2601] (400 aa)
Score = 140, Expect = 2.4e-07, Identities = 38/144 (26%), Positives = 70/144 (48%)
  Q:    36 VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           VE   D D LL+E+     E+ +++E+    G +  ++ S   +   R G   +   T+ G +++ IPR    ++ P  +   +     +   I + Y  G+STR + D+   M G GV K  VSR+ ++I   +  + +RP+E
  S:    12 VEKSADAD-LLREMIGFAAERLMELEVGAKTGADYGEKTSERLAQ--RNGYRDRDWQTRAGSVELRIPRLRTGSYFPSFLEPRRSVEKALTAVIQEAYVHGVSTRSMDDLVQAMGGTGVSKSQVSRLCEEIDERVDAFLTRPIE 152
>gi|119855141|ref|YP_935746.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|145225955|ref|YP_001136609.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] >gi|119697859|gb|ABL94931.1| transposase, mutator type [Mycobacterium sp. KMS] >gi|145218418|gb|ABP47821.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] (411 aa)
Score = 140, Expect = 2.5e-07, Identities = 39/149 (26%), Positives = 75/149 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           LL +L      D   +  EL ++ +++ ++ E    +G  ++ +   E    +R G   KT++T  G ++V+IP+    +F P L+ + +R    +   I++ Y  G+STR + D+   M    G+ K  VSR+   +  EI  +++R L
  S:     8 LLAQLDALKSADASAVFAELIRAGLQQLIEAEATAAIGAGRYQRT--EGRAVHRNGHRPKTVSTTSGDIEVQIPKLRVGSFFPSLLERRRRIDKALHAVIMEAYVHGVSTRSVDDLVAAMGVETGISKSEVSRICAGLDKEIEAFRTRSL 155
>gi|145221275|ref|YP_001131953.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] >gi|145223778|ref|YP_001134456.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] >gi|145213761|gb|ABP43165.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] >gi|145216264|gb|ABP45668.1| transposase, mutator type [Mycobacterium gilvum PYR-GCK] (411 aa)
Score = 140, Expect = 2.6e-07, Identities = 39/149 (26%), Positives = 75/149 (50%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           LL +L      D   +  EL ++ +++ ++ E    +G  ++ +        +R G   KT++T  G ++V+IP+    +F P L+ + +R    +   I++ Y  G+STR + D+   M   +GV K  VSR+   +  EI  +++R L
  S:     8 LLAQLDALRSADAGAVFAELIRAGLQQLIEAEATAAIGAGRYQRTDGRMV--HRNGHRPKTVSTTSGDIEVQIPKLRAGSFFPSLLERRRRIDKALHAVIMEAYVHGVSTRSVDDLVAAMGVESGVSKSEVSRICAGLDIEIEAFRTRSL 155
>gi|118468209|ref|YP_888434.1| transposase, Mutator family protein [Mycobacterium smegmatis str. MC2 155] >gi|118169496|gb|ABK70392.1| transposase, Mutator family protein [Mycobacterium smegmatis str. MC2 155] (391 aa)
Score = 139, Expect = 3.1e-07, Identities = 39/149 (26%), Positives = 76/149 (51%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           LL +L      D   +  EL ++ ++  ++ E    +G  ++ +     +  +R G   KT++T  G ++V+IP+    +F P L+ + +R    +   I++ Y  G+STR + D+   +  G+GV K  VSR+   +  EI  +++R L
  S:     8 LLAQLDALKSADAGAVFAELIRAGLQALIEAEATEVIGAGRYQRTDGRAT--HRNGHRPKTVSTTAGDVEVQIPKLRAGSFFPSLLERRRRIDRALHAVIMEAYVHGVSTRSVDDLVAALGVGSGVSKSEVSRICAGLDKEIDAFRTRSL 155
>gi|30387229|ref|NP_848205.1| transposase [Corynebacterium jeikeium] >gi|68535124|ref|YP_249829.1| transposase for IS3506a [Corynebacterium jeikeium K411] >gi|68535157|ref|YP_249862.1| transposase for IS3506b [Corynebacterium jeikeium K411] >gi|68535218|ref|YP_249923.1| transposase for IS3506c [Corynebacterium jeikeium K411] >gi|68535402|ref|YP_250107.1| transposase for IS3506d [Corynebacterium jeikeium K411] >gi|68535530|ref|YP_250235.1| transposase for IS3506e [Corynebacterium jeikeium K411] >gi|68535603|ref|YP_250308.1| transposase for IS3506f [Corynebacterium jeikeium K411] >gi|68535705|ref|YP_250410.1| transposase for IS3506g [Corynebacterium jeikeium K411] >gi|68536665|ref|YP_251370.1| transposase for IS3506h [Corynebacterium jeikeium K411] >gi|68536875|ref|YP_251580.1| transposase for IS3506i [Corynebacterium jeikeium K411] >gi|68537039|ref|YP_251744.1| transposase for IS3506j [Corynebacterium jeikeium K411] >gi|68537135|ref|YP_251840.1| transposase for IS3506k [Corynebacterium jeikeium K411] >gi|30349493|gb|AAP22019.1| transposase [Corynebacterium jeikeium] >gi|68262723|emb|CAI36211.1| transposase for IS3506a [Corynebacterium jeikeium K411] >gi|68262756|emb|CAI36244.1| transposase for IS3506b [Corynebacterium jeikeium K411] >gi|68262817|emb|CAI36305.1| transposase for IS3506c [Corynebacterium jeikeium K411] >gi|68263001|emb|CAI36489.1| transposase for IS3506d [Corynebacterium jeikeium K411] >gi|68263129|emb|CAI36617.1| transposase for IS3506e [Corynebacterium jeikeium K411] >gi|68263202|emb|CAI36690.1| transposase for IS3506f [Corynebacterium jeikeium K411] >gi|68263304|emb|CAI36792.1| transposase for IS3506g [Corynebacterium jeikeium K411] >gi|68264264|emb|CAI37752.1| transposase for IS3506h [Corynebacterium jeikeium K411] >gi|68264474|emb|CAI37962.1| transposase for IS3506i [Corynebacterium jeikeium K411] >gi|68264638|emb|CAI38126.1| transposase for IS3506j [Corynebacterium jeikeium K411] >gi|68264734|emb|CAI38222.1| transposase for IS3506k [Corynebacterium jeikeium K411] (412 aa)
Score = 138, Expect = 4.1e-07, Identities = 35/136 (25%), Positives = 72/136 (52%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQ-LVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           +L++++ + FI + L  + D   G E    ++     N+R G   + L+T+ G +DV +P+  +  F P  L+ +  R    +   I   Y KG+STR + D+   +  + + K  VSR+++++   +  +++RPL+
  S:    24 DLMRQMLQGFINQILSAQADTVCGAEYGVVSTERV--NHRNGYRHRDLDTRVGTIDVAVPKLRHGAFFPDWLLERRSRAERALSTVIATCYLKGVSTRRMNDLVATLGISSMSKSQVSRMSEELDDMVADFKNRPLD 158
>gi|161522756|ref|YP_001585685.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161523369|ref|YP_001578381.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161524341|ref|YP_001579353.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161524983|ref|YP_001579995.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161525450|ref|YP_001580462.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161525453|ref|YP_001580465.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|161525783|ref|YP_001580795.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189348394|ref|YP_001941590.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189349496|ref|YP_001945124.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189349812|ref|YP_001945440.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189349814|ref|YP_001945442.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189350273|ref|YP_001945901.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189350904|ref|YP_001946532.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189351858|ref|YP_001947486.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|140831|sp|P24575|TRA6_BURCE Transposase for insertion sequence element IS406 >gi|208687|gb|AAA25037.1| ORF1 [Burkholderia cepacia] >gi|160340798|gb|ABX13884.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160341770|gb|ABX14856.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160342412|gb|ABX15498.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160342879|gb|ABX15965.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160342882|gb|ABX15968.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160343212|gb|ABX16298.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|160346309|gb|ABX19393.1| transposase mutator type [Burkholderia multivorans ATCC 17616] >gi|189333518|dbj|BAG42588.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189333834|dbj|BAG42904.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189333836|dbj|BAG42906.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189334295|dbj|BAG43365.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189334926|dbj|BAG43996.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189335880|dbj|BAG44950.1| IS406 transposase [Burkholderia multivorans ATCC 17616] >gi|189338532|dbj|BAG47600.1| IS406 transposase [Burkholderia multivorans ATCC 17616] (388 aa)
Score = 137, Expect = 5.2e-07, Identities = 38/143 (26%), Positives = 69/143 (48%)
  Q:    48 ELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGA--GVDKDLVSRVTDKILPEILTWQSRPL-EDIYILLSLLME 190
           E  +  + ++  +E    LG   +++   E   +Y  G   KT+ T++G+L  ++P+  +S F P  + K  R    +   + ++Y +G+STR + DV   + G    +    VSR   K+   +  W+ RPL E  Y+ L    E
  S:    27 EALRILVNEAAKIERSAFLGARPYERT--ETRRDYANGFKPKTVLTRHGELTFQVPQVRSSDFYPSALEKGTRTDQAVNLALAEMYVQGVSTRRVIDVLQRLLGPEISLSSAQVSRAAAKLDEGLRAWRERPLGETPYLFLDARYE 170
>gi|87301444|ref|ZP_01084284.1| putative transposase [Synechococcus sp. WH 5701] >gi|87283661|gb|EAQ75615.1| putative transposase [Synechococcus sp. WH 5701] (424 aa)
Score = 137, Expect = 5.7e-07, Identities = 36/136 (26%), Positives = 74/136 (54%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYG--AGVDKDLVSRVTDKILPEILTWQSRPLED 180
           L+ EL +  +++ +++E    LG +  +++       YR G   ++L T+ G +D+ IP+    +F P ++   +R    +   I++ Y  G+STR++ D  +   G  +G+ K  VSR+  +I  ++  + SRPL++
  S:    23 LIPELARHGLQQLIELEAAAVLGADLHERSEERLG--YRNGYRSRSLTTQVGDIDLLIPKLRAGSFLPSILEPRRRVDQALYAVIMEAYIGGVSTRKL-DALVGALGSQSGISKSQVSRICQEIDQQVQAFLSRPLQE 157
>gi|15610567|ref|NP_217948.1| hypothetical protein Rv3431c [Mycobacterium tuberculosis H37Rv] >gi|15843026|ref|NP_338063.1| IS1535 transposase [Mycobacterium tuberculosis CDC1551] >gi|31794608|ref|NP_857101.1| transposase [Mycobacterium bovis AF2122/97] >gi|121639352|ref|YP_979576.1| putative transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|148663296|ref|YP_001284819.1| putative transposase [Mycobacterium tuberculosis H37Ra] >gi|148824641|ref|YP_001289395.1| transposase [Mycobacterium tuberculosis F11] >gi|167968677|ref|ZP_02550954.1| transposase [Mycobacterium tuberculosis H37Ra] >gi|2104352|emb|CAB08680.1| POSSIBLE TRANSPOSASE (FRAGMENT) [Mycobacterium tuberculosis H37Rv] >gi|13883368|gb|AAK47877.1| IS1535, transposase [Mycobacterium tuberculosis CDC1551] >gi|31620205|emb|CAD95648.1| POSSIBLE TRANSPOSASE [Mycobacterium bovis AF2122/97] >gi|121495000|emb|CAL73486.1| Possible transposase [Mycobacterium bovis BCG str. Pasteur 1173P2] >gi|134151549|gb|EBA43594.1| transposase [Mycobacterium tuberculosis str. Haarlem] >gi|148507448|gb|ABQ75257.1| putative transposase [Mycobacterium tuberculosis H37Ra] >gi|148723168|gb|ABR07793.1| transposase [Mycobacterium tuberculosis F11] (281 aa)
Score = 137, Expect = 6.1e-07, Identities = 36/134 (26%), Positives = 71/134 (52%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           +  EL ++ ++  ++ E    +G  +++++       +R G   KT++T  G ++V+IP+    +F P L+ + +R    +   I++ Y  G+STR + D+   M   AGV K  VSR+   +  EI  +++R L
  S:     1 MFAELIRAGLQALIEAEATEAIGAGRYERSDGRIV--HRNGHRPKTVSTTAGDIEVQIPKLRAGSFFPSLLERRRRIDKALHAVIMEAYVHGVSTRSVDDLVAAMGVQAGVSKSEVSRICAGLDTEIEAFRTRSL 133
>gi|71736120|ref|YP_277145.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] >gi|71556673|gb|AAZ35884.1| ISPsy18, transposase, truncated [Pseudomonas syringae pv. phaseolicola 1448A] (295 aa)
Score = 137, Expect = 6.2e-07, Identities = 22/51 (43%), Positives = 33/51 (64%)
  Q:   132 LYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +Y++GM+ REI+    + YG  V  D +S VTD ++ E+  WQ RPLE +Y
  S:     1 MYARGMTVREIRAFLSEQYGTDVSHDFISSVTDAVMEEVGAWQQRPLEPMY 51
>gi|194563807|ref|YP_002098830.1| Transposase [Burkholderia dolosa AUO158] >gi|124895431|gb|EAY69311.1| Transposase [Burkholderia dolosa AUO158] (290 aa)
Score = 136, Expect = 7.0e-07, Identities = 24/46 (52%), Positives = 31/46 (67%)
  Q:   137 MSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           MS REIQ    + YG  V  D +S VTD+++ E L+WQSRPLE +Y
  S:     1 MSVREIQAFLAESYGTEVSPDFISSVTDEVMAEALSWQSRPLETMY 46
>gi|1240078|gb|AAB68957.1| putative transposase [Methylobacterium sp.] >gi|1279560|emb|CAA65720.1| transposase IS1354 [Methylobacterium dichloromethanicum] (421 aa)
Score = 136, Expect = 7.8e-07, Identities = 38/139 (27%), Positives = 72/139 (51%)
  Q:    42 FDNLLKEL---TKSFIEKSLDVEMDGHLGYEKWDQN------SREFSNNYRKGKTKKTLNTKYGKLDVEIPR-------DVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           FD +  E+   ++ FIE+ +  E+D  L   ++ ++      +R     +R G   ++L   +G +++ +PR        + + ++ Q +R +QR     +  I   Y  G +TR ++     ++G  V KD VSR   K+  +   W SR L D
  S:    26 FDPIEAEVRARSRQFIEELIRGELDDALARPRYGRSQMASNEARAGVTGHRHGSRTRSLTGTFGPIEIAVPRARLTTSEGMTTEWKSQALRAYQRRTLAADALIASSYLAGTNTRRVRRALAALFGGTVGKDTVSRTWRKVKSDWDAWNSRSLAD 180
>gi|108807932|ref|YP_651848.1| putative transposase [Yersinia pestis Antiqua] >gi|108812064|ref|YP_647831.1| transposase [Yersinia pestis Nepal516] >gi|108775712|gb|ABG18231.1| transposase [Yersinia pestis Nepal516] >gi|108779845|gb|ABG13903.1| putative transposase [Yersinia pestis Antiqua] (300 aa)
Score = 136, Expect = 7.9e-07, Identities = 25/58 (43%), Positives = 39/58 (67%)
  Q:   125 IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           ++  I+ LY+KGM+TREI   F +MY A V   L+S+VTD +  ++  WQ+R L+ +Y
  S:     1 MDSQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALY 58
>gi|118587167|ref|ZP_01544596.1| transposase [Oenococcus oeni ATCC BAA-1163] >gi|118432446|gb|EAV39183.1| transposase [Oenococcus oeni ATCC BAA-1163] (293 aa)
Score = 135, Expect = 9.3e-07, Identities = 39/166 (23%), Positives = 86/166 (51%)
  Q:    17 FIMAKKEKSSAEKLLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHL---GYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           FIM K E +  +  L++L + ++   D  ++ +    +++ L  E    +    YE+ D+ +     N R+G   + L T+ G L++ +P+  +  F  QL +++QR+    +  ++++  +G+STR++ ++   + G    K  VS + + +  ++L +  RPL   Y
  S:     7 FIMPKVELNLEDDELKELLLGDR---DKAMQSIMTKILDEILKSEATEQIKAKAYERSDERT-----NSRQGYRVRQLTTRVGSLELHVPKLRHGNFSTQLFKRYQRSEQAFDLALMEMVIQGVSTRKVAEITKKLCGTTFSKSTVSALCNNLDDQVLDFNRRPLTQKY 167
>gi|119026385|ref|YP_910230.1| putative transposase [Bifidobacterium adolescentis ATCC 15703] >gi|118765969|dbj|BAF40148.1| putative transposase [Bifidobacterium adolescentis ATCC 15703] (260 aa)
Score = 135, Expect = 9.4e-07, Identities = 24/89 (26%), Positives = 50/89 (56%)
  Q:    91 LNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           +  K GKL++ +P+    TF  Q++ +++R    ++  ++ +Y  G+STR + D+   ++G  +    +S    ++  EI  W++RPLE
  S:     1 MTAKAGKLNLRVPKLKGETFRSQVIERYRRREESVKGALMGMYMAGVSTRRVDDISQLLWGERMPSQTLSDKLKRVYGEIDKWRTRPLE 89
>gi|194542086|ref|YP_002077117.1| hypothetical protein TBCG_03370 [Mycobacterium tuberculosis C] >gi|124599556|gb|EAY58660.1| hypothetical protein TBCG_03370 [Mycobacterium tuberculosis C] (281 aa)
Score = 135, Expect = 1.1e-06, Identities = 36/134 (26%), Positives = 71/134 (52%)
  Q:    45 LLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           +  EL ++ ++  ++ E    +G  +++++       +R G   KT++T  G ++V+IP+    +F P L+ + +R    +   I++ Y  G+STR + D+   M   AGV K  VSR+   +  EI  +++R L
  S:     1 MFAELIRAGLQALIEAEATEAIGAGRYERSDGGIV--HRNGHRPKTVSTTAGDIEVQIPKLRAGSFFPSLLERRRRIDKALHAVIMEAYVHGVSTRSVDDLVAAMGVQAGVSKSEVSRICAGLDTEIEAFRTRSL 133
>gi|87308611|ref|ZP_01090751.1| putative transposase [Blastopirellula marina DSM 3645] >gi|87288703|gb|EAQ80597.1| putative transposase [Blastopirellula marina DSM 3645] (208 aa)
Score = 134, Expect = 1.4e-06, Identities = 31/154 (20%), Positives = 78/154 (50%)
  Q:    23 EKSSAEKLLEKLGVEN---KEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSR 176
           E  + E++ + + ++    +   D L++   +  + K LD E D     +++++ +    +  R G   + L TK G++ +++PR  +   E Q++ +++R  + +E  ++++Y  G+S R ++D+   ++G        +RV+       + W +R
  S:    22 EDRTGEEIRDAIKIDGEAVRGHLDELVRSTVEETLNKMLDAEADQICNAKRYERTADRVDS--RAGSYSRKLQTKAGEVSLKVPRLRSLPLETQIIERYKRRESSVEEALVEMYLAGVSVRRVEDITEALWG--------TRVSSSTWNAPIFWSTR 168
>gi|29345434|ref|NP_808937.1| transposase [Bacteroides thetaiotaomicron VPI-5482] >gi|29337326|gb|AAO75131.1| transposase [Bacteroides thetaiotaomicron VPI-5482] (178 aa)
Score = 134, Expect = 1.4e-06, Identities = 27/58 (46%), Positives = 37/58 (63%)
  Q:   125 IEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIY 182
           +   II LYS G STREI D   +  G  V  + +S +TD++LPEI  W+SR L+D+Y
  S:     5 VADRIIGLYSLGNSTREISDWLKENLGNRVSDETISSITDRVLPEIKVWRSRILDDVY 62
>gi|90417208|ref|ZP_01225135.1| putative transposase [marine gamma proteobacterium HTCC2207] >gi|90330984|gb|EAS46245.1| putative transposase [marine gamma proteobacterium HTCC2207] (152 aa)
Score = 133, Expect = 1.6e-06, Identities = 22/51 (43%), Positives = 37/51 (72%)
  Q:   137 MSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           M+TREI + F +MYGA +   L+S+VT  ++ +++ WQSRPL+ +Y ++ L
  S:     1 MTTREIVETFKEMYGADISPTLISKVTSAVIEQVVEWQSRPLDAVYPIVYL 51
>gi|118465883|ref|YP_880710.1| transposase, Mutator family protein [Mycobacterium avium 104] >gi|118167170|gb|ABK68067.1| transposase, Mutator family protein [Mycobacterium avium 104] (424 aa)
Score = 133, Expect = 1.8e-06, Identities = 38/151 (25%), Positives = 72/151 (47%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDM-YGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           LLE L      D    + +  ++  +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+    +  P L+ + +R    +   +++ Y  G STR++ D+   +    G+ K  VSR+   +  E+  ++ RPL D
  S:    22 LLEVLDALRTADAGERITQAAETIYQALIDAELTAFIGASPHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSCFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVSRICKDLDTEVAAFRDRPLGD 171
>gi|124548403|ref|ZP_01707079.1| transposase, mutator family [Shewanella putrefaciens 200] >gi|124508463|gb|EAY52558.1| transposase, mutator family [Shewanella putrefaciens 200] (77 aa)
Score = 133, Expect = 1.9e-06, Identities = 27/74 (36%), Positives = 49/74 (66%)
  Q:    49 LTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNL 122
           +TK   E++L+ EM+ HLGY K D   +   N+   GK++K++ T +G ++++  RD N +FEP+L++K ++ L
  S:     1 MTKKLAERALEAEMEQHLGYAKHDAAGKNTGNSL-NGKSRKSVRTIHGDIELDPLRDRNGSFEPKLIKKGEKQL 73
>gi|9246956|gb|AAF86222.1| transposase [Enterococcus faecium] (271 aa)
Score = 133, Expect = 1.9e-06, Identities = 30/107 (28%), Positives = 60/107 (56%)
  Q:    72 DQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           D    E   + R G  ++   T+ G L++++PR  +  F P +  ++QRN   +  +++++Y  G+STR++  +  ++ G  V K  VS +T+++ P +  WQ+R L
  S:    50 DYERSESRQSQRNGYYERDFTTRVGTLELKVPRTRDGEFSPTVFERYQRNEKALLASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLDPMVNEWQNRSL 156
>gi|7023947|dbj|BAA92140.1| transposase [Enterococcus faecium] (403 aa)
Score = 133, Expect = 1.9e-06, Identities = 30/107 (28%), Positives = 60/107 (56%)
  Q:    72 DQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           D    E   + R G  ++   T+ G L++++PR  +  F P +  ++QRN   +  +++++Y  G+STR++  +  ++ G  V K  VS +T+++ P +  WQ+R L
  S:    63 DYERSESRQSQRNGYYERDFTTRVGTLELKVPRTRDGEFSPTVFERYQRNEKALLASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLDPMVNEWQNRSL 169
>gi|4704654|gb|AAD28195.1|AF114715_1 putative transposase [Enterococcus faecium] (390 aa)
Score = 132, Expect = 2.0e-06, Identities = 30/107 (28%), Positives = 60/107 (56%)
  Q:    72 DQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPL 178
           D    E   + R G  ++   T+ G L++++PR  +  F P +  ++QRN   +  +++++Y  G+STR++  +  ++ G  V K  VS +T+++ P +  WQ+R L
  S:    50 DYERSESRQSQRNGYYERDFTTRVGTLELKVPRTRDGEFSPTVFERYQRNEKALLASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLDPMVNEWQNRSL 156
>gi|29374776|ref|NP_813928.1| IS256, transposase [Enterococcus faecalis V583] >gi|29375152|ref|NP_814305.1| IS256, transposase [Enterococcus faecalis V583] >gi|29376695|ref|NP_815849.1| IS256, transposase [Enterococcus faecalis V583] >gi|29377117|ref|NP_816271.1| IS256, transposase [Enterococcus faecalis V583] >gi|29377556|ref|NP_816710.1| IS256, transposase [Enterococcus faecalis V583] >gi|29377663|ref|NP_816817.1| IS256, transposase [Enterococcus faecalis V583] >gi|29377854|ref|NP_816982.1| IS256, transposase [Enterococcus faecalis V583] >gi|29377857|ref|NP_816985.1| IS256, transposase [Enterococcus faecalis V583] >gi|29377879|ref|NP_817006.1| IS256, transposase [Enterococcus faecalis V583] >gi|29377944|ref|NP_817070.1| IS256, transposase [Enterococcus faecalis V583] >gi|57865374|ref|YP_189567.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|57866844|ref|YP_188494.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|57867185|ref|YP_188832.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|57867486|ref|YP_189149.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|57867489|ref|YP_189152.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|70725340|ref|YP_252254.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726006|ref|YP_252920.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726009|ref|YP_252923.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726092|ref|YP_253006.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726101|ref|YP_253015.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726497|ref|YP_253411.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726611|ref|YP_253525.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726614|ref|YP_253528.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70726907|ref|YP_253821.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70727034|ref|YP_253948.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70727266|ref|YP_254182.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70727572|ref|YP_254488.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70727574|ref|YP_254490.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70727576|ref|YP_254492.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|135949|sp|P19775|TRA6_STAAU Transposase for insertion sequence element IS256 in transposon Tn4001 >gi|33301699|sp|P59787|TRA6_ENTFA Transposase for insertion sequence element IS256 in transposon Tn4001 >gi|152947|gb|AAA88546.1| transposase >gi|13383310|dbj|BAB39487.1| IS256 transposase [Staphylococcus epidermidis] >gi|13383312|dbj|BAB39489.1| IS256 transposase [Staphylococcus epidermidis] >gi|19702227|emb|CAC95135.1| IS256 transposase [Staphylococcus aureus] >gi|23262701|gb|AAL05909.1| transposase [Cloning vector mini-Tn4001tet] >gi|24636600|dbj|BAC22941.1| IS256 transposase [Staphylococcus aureus] >gi|29342234|gb|AAO80000.1| IS256, transposase [Enterococcus faecalis V583] >gi|29342611|gb|AAO80376.1| IS256, transposase [Enterococcus faecalis V583] >gi|29344159|gb|AAO81919.1| IS256, transposase [Enterococcus faecalis V583] >gi|29344583|gb|AAO82341.1| IS256, transposase [Enterococcus faecalis V583] >gi|29345023|gb|AAO82780.1| IS256, transposase [Enterococcus faecalis V583] >gi|29345131|gb|AAO82887.1| IS256, transposase [Enterococcus faecalis V583] >gi|29345306|gb|AAO83053.1| IS256, transposase [Enterococcus faecalis V583] >gi|29345309|gb|AAO83056.1| IS256, transposase [Enterococcus faecalis V583] >gi|29345331|gb|AAO83077.1| IS256, transposase [Enterococcus faecalis V583] >gi|29345396|gb|AAO83141.1| IS256, transposase [Enterococcus faecalis V583] >gi|29539376|dbj|BAC67572.1| transposase for insertion sequence element IS256 in transposon Tn4001 [Staphylococcus aureus] >gi|29539378|dbj|BAC67574.1| transposase for insertion sequence element IS256 in transposon Tn4001 [Staphylococcus aureus] >gi|33330906|gb|AAQ10698.1| putative transposase [Staphylococcus aureus] >gi|57636032|gb|AAW52820.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|57637502|gb|AAW54290.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|57637843|gb|AAW54631.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|57638144|gb|AAW54932.1| IS256-like transposase [Staphylococcus epidermidis RP62A phage SP-beta] >gi|57638147|gb|AAW54935.1| IS256-like transposase [Staphylococcus epidermidis RP62A] >gi|68446064|dbj|BAE03648.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68446730|dbj|BAE04314.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68446733|dbj|BAE04317.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68446816|dbj|BAE04400.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68446825|dbj|BAE04409.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68447221|dbj|BAE04805.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68447335|dbj|BAE04919.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68447338|dbj|BAE04922.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68447631|dbj|BAE05215.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68447758|dbj|BAE05342.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68447992|dbj|BAE05576.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68448298|dbj|BAE05882.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68448300|dbj|BAE05884.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|68448302|dbj|BAE05886.1| transposase for IS256 [Staphylococcus haemolyticus JCSC1435] >gi|70568202|dbj|BAE06299.1| transposase for insertion sequence element IS256 [Staphylococcus aureus] >gi|84993525|dbj|BAE75927.1| putative transposase [Staphylococcus aureus] >gi|84993528|dbj|BAE75930.1| putative transposase [Staphylococcus aureus] >gi|113927249|emb|CAL22893.1| IS256 transposase [Staphylococcus aureus] (390 aa)
Score = 131, Expect = 2.6e-06, Identities = 29/104 (27%), Positives = 61/104 (58%)
  Q:    77 EFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           E   + R G  +++  T+ G L++++PR  +  F P +  ++QRN   +  +++++Y  G+STR++  +  ++ G  V K  VS +T+++ P +  WQ+R L +
  S:    55 ENRQSQRNGYYERSFTTRVGTLELKVPRTRDGHFSPTVFERYQRNEKALMASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSE 158
>gi|113927252|emb|CAL22896.1| IS256 transposase [Staphylococcus aureus] (390 aa)
Score = 131, Expect = 2.6e-06, Identities = 29/104 (27%), Positives = 61/104 (58%)
  Q:    77 EFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLED 180
           E   + R G  +++  T+ G L++++PR  +  F P +  ++QRN   +  +++++Y  G+STR++  +  ++ G  V K  VS +T+++ P +  WQ+R L +
  S:    55 ENRQSQRNGYYERSFTTRVGTLELKVPRTRDGHFSPTVFERYQRNEKALMASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSE 158
>gi|32470482|ref|NP_863167.1| transposase [Enterococcus faecium] >gi|32470490|ref|NP_863175.1| transposase [Enterococcus faecium] >gi|69243945|ref|ZP_00602523.1| Transposase, mutator type [Enterococcus faecium DO] >gi|1244504|gb|AAC44460.1| putative transposase [Enterococcus faecalis] >gi|28849343|gb|AAO52850.1| transposase [Enterococcus faecium] >gi|28849351|gb|AAO52858.1| transposase [Enterococcus faecium] >gi|68196671|gb|EAN11096.1| Transposase, mutator type [Enterococcus faecium DO] (395 aa)
Score = 131, Expect = 2.9e-06, Identities = 35/138 (25%), Positives = 70/138 (50%)
  Q:    42 FDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREI-QDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           F+ L++E    +I+ +          YE+ ++   +     R G   ++  T+ G L++ +PR  +  F P +  ++QR+   +   +I++   G+STR++ + V L   GA V K  VS +  ++ P +  W++R LE
  S:    34 FNQLMEEQRNQYIQAN---------AYERSEERQSQ-----RNGYYDRSFTTRIGTLELHVPRTRDGKFSPTIFERYQRSEKALIAAMIEMVISGVSTRKVTKTVELLTDGATVSKSFVSNLMKQLDPFVFEWRNRSLE 158
>gi|29569842|gb|AAO84921.1| putative transposase [Paracoccus solventivorans] (398 aa)
Score = 131, Expect = 3.0e-06, Identities = 42/152 (27%), Positives = 73/152 (48%)
  Q:    36 VENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNS-REFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLEDIYILLSL 187
           VE K D D L++E+     E+ ++ E++   G  K  +   RE     R G   +  +T+ G++ +EIP+    ++ P  +   +     +   I + Y  G+STR + D+   M   G+ K  VSR+  +I   +  + SRPLE  +  L L
  S:    12 VEKKADGD-LVREMLAFAAERIMETEVEARTGAAKGARTPMREVQ---RNGYRDRDWDTRAGRIALEIPKLRRGSYFPSFLEPRRTAEKALVAVIQEAYVHGISTRAVDDLVKAMGAGGMSKSQVSRLCAEIDERVNAFLSRPLEGAWPYLWL 160
>gi|190015976|ref|YP_001965184.1| putative transposase [Rhodococcus sp. NS1] >gi|114796816|gb|ABI79409.1| putative transposase [Rhodococcus sp. NS1] (417 aa)
Score = 131, Expect = 3.1e-06, Identities = 36/136 (26%), Positives = 70/136 (51%)
  Q:    44 NLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQ-LVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGAGVDKDLVSRVTDKILPEILTWQSRPLE 179
           +L++EL ++ I   L  E D   G E W + S E  N  R G  ++ L+T+ G +DV +P+  + T+ P+ L+ + +R    +   +   Y  G+STR +  +   +    + K  VSR+ + +  ++  ++ R L+
  S:    23 DLMRELLQTMINALLSAEADAVCGAE-WGRQSTERVNQ-RNGYRRRPLDTRVGTIDVAVPKLRSGTYFPEWLLERRKRAEAALITVVADCYLAGVSTRRMDKLVKTLGINALSKSQVSRMAEDLDEQVAAFRQRRLD 157
>gi|120401571|ref|YP_951400.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|120401598|ref|YP_951427.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|120401601|ref|YP_951430.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119954389|gb|ABM11394.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119954416|gb|ABM11421.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] >gi|119954419|gb|ABM11424.1| transposase, mutator type [Mycobacterium vanbaalenii PYR-1] (410 aa)
Score = 131, Expect = 3.2e-06, Identities = 40/149 (26%), Positives = 74/149 (49%)
  Q:    30 LLEKLGVENKEDFDNLLKELTKSFIEKSLDVEMDGHLGYEKWDQNSREFSNNYRKGKTKKTLNTKYGKLDVEIPRDVNSTFEPQLVRKHQRNLNDIEHNIIKLYSKGMSTREIQDVFLDMYGA--GVDKDLVSRVTDKILPEILTWQSRPL 178
           LLE L      D    + +  +   +  +D E+   +G    ++   E  +N R G   +TL+T  G L++ IP+  + +F P L+ + +R    +   +++ Y  G STR++ D+ +   GA  G+ K  VSR+   +  E+  ++ RPL
  S:     8 LLEVLDALRTADAGERITQACEIVYQALIDAELTAKIGAALHERT--ETRSNQRNGSRPRTLSTVAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDL-VKALGADSGISKSEVSRICKDLDTEVGAFRDRPL 155