>gi|26553502|ref|NP_757436.1| methionyl-tRNA formyltransferase [Mycoplasma penetrans HF-2] >gi|33516869|sp|Q8EX00|FMT_MYCPE Methionyl-tRNA formyltransferase >gi|26453508|dbj|BAC43840.1| methionyl-tRNA formyltransferase [Mycoplasma penetrans HF-2] (318 aa)
Score = 1529, Expect = 5.8e-168, Identities = 318/318 (100%), Positives = 318/318 (100%)
  Q:     1 MGEKRNSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           MGEKRNSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK
  S:     1 MGEKRNSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
>gi|42560985|ref|NP_975436.1| methionyl-tRNA formyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|73919407|sp|Q6MTF8|FMT_MYCMS Methionyl-tRNA formyltransferase >gi|42492482|emb|CAE77078.1| methionyl-tRNA formyltransferase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (317 aa)
Score = 644, Expect = 2.1e-65, Identities = 143/302 (47%), Positives = 208/302 (68%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK--KMKLFKAVSTNSKSNNA-PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKN-ILNGNSEIKI 313
           K+VF GTP+I    L AL+E    ++V V+ QPDKPIGRKK+I+ + VKKLA+E N+K  QPNKI EI ++L +L     +TCAFGQFIP  IL + +   IN H SLLPK RGGAPI +A+ NG+K+TG+ +M+ +KQMDAGD Y    ++I +SD + +LF+KM +L Y +    L  ++N ++  IKQ+E +V+F  NIS ++EKIN+   +++I NLIR LS +P +Y  IN++  K+K  K +  ++++ NA PGTI  I+K+GI++ T D  +L+ E+Q EGK      N  LN  S++KI
  S:     6 KVVFCGTPKIGADVLKALIEMNQVEIVLVISQPDKPIGRKKQIVHTPVKKLALENNLKVVQPNKIGEIYDDLAKLEFDFLITCAFGQFIPTKILKLAKIDSINFHGSLLPKLRGGAPIQYAIKNGDKKTGITIMQMVKQMDAGDYYVQESIDILDSDDSGSLFEKMGHLAYSMCKKYLVDIYNHKFELIKQNEDEVTFCKNISSEEEKINWNNTSLDIFNLIRSLSPSPISYTTINNQRYKIKSSKVIDLDNQNKNAIPGTILGINKQGIVVKTLDKALLILEIQKEGKKMILASNYYLNKLSDLKI 312
>gi|188159350|ref|ZP_02998724.1| methionyl-tRNA formyltransferase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (317 aa)
Score = 644, Expect = 2.5e-65, Identities = 144/302 (47%), Positives = 208/302 (68%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK--KMKLFKAVSTNSKSNNA-PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKN-ILNGNSEIKI 313
           KIVF GTP+I    L AL+E    +VV V+ QPDKPIGRKK+I+++ VKKLA+E N+K  QPNKI EI ++L +L     +TCAFGQFIP  IL + +   IN H SLLPK RGGAPI +A+ NG+K+TG+ +M+ +KQMDAGD Y    ++I +SD + +LF+KM  L Y +    L  ++N ++  IKQ+E +V+F  NIS ++EKIN+   +++I NLIR LS +P +Y  IN++  K+K  K +  ++++ N  PGTI +I+K+GI++ T D  +L+ E+Q EGK      N  LN  S++KI
  S:     6 KIVFCGTPKIGADVLKALIEMNQVEVVLVISQPDKPIGRKKQIVYTPVKKLALENNLKVVQPNKIGEIYDDLAKLEFDFLITCAFGQFIPTKILKLAKIDSINFHGSLLPKLRGGAPIQYAIKNGDKKTGITIMQMVKQMDAGDYYVQESIDILDSDDSGSLFEKMGQLAYSMCKKYLVDIYNHKFELIKQNEDEVTFCKNISSEEEKINWNNTSLDIFNLIRSLSPSPISYTTINNQRYKIKSSKVIDLDNQNKNVMPGTIIDINKQGIVVKTLDKALLILEIQKEGKKMILASNYYLNKLSDLKI 312
>gi|83319576|ref|YP_424492.1| methionyl-tRNA formyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|123740044|sp|Q2SRX1|FMT_MYCCT Methionyl-tRNA formyltransferase >gi|83283462|gb|ABC01394.1| methionyl-tRNA formyltransferase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (317 aa)
Score = 642, Expect = 3.6e-65, Identities = 142/302 (47%), Positives = 210/302 (69%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK--KMKLFKAVSTNSKSNN-APGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKN-ILNGNSEIKI 313
           K+VF GTP+I    L AL+E    +VV V+ QPDKPIGRKK+I+++ VKKLA+E N+K  QPNKI EI ++L +L     +TCAFGQFIP  IL + +   IN H SLLPK RGGAPI +A+ NG+K+TG+ +M+ +KQMDAGD Y    ++I +SD + +LF+KM  L Y +    L  ++N ++  IKQ+E++V+F  NIS ++EKI++   +++I NLIR LS +P +Y  IN +  K+K  K ++ ++++ N APGTI +I+++GI++ T D  +L+ E+Q EGK      N  LN  S++KI
  S:     6 KVVFCGTPKIGADVLKALIEMNEVEVVLVISQPDKPIGRKKQIVYTPVKKLALENNLKVVQPNKIGEIYDDLAKLEFDFLITCAFGQFIPTKILKLAKTDSINFHGSLLPKLRGGAPIQYAIKNGDKKTGITIMQMVKQMDAGDYYVQESIDILDSDDSGSLFEKMGQLAYSMCKKYLVDIYNHKFELIKQNENEVTFCKNISSEEEKIDWNNTSLDIFNLIRSLSPSPISYTTINSQRYKIKSSKIINLDNQNKNVAPGTIIDINRQGIVVKTLDSSLLILEIQKEGKKMILASNYYLNKLSDLKI 312
>gi|163790823|ref|ZP_02185248.1| methionyl-tRNA formyltransferase [Carnobacterium sp. AT7] >gi|159873891|gb|EDP67970.1| methionyl-tRNA formyltransferase [Carnobacterium sp. AT7] (317 aa)
Score = 639, Expect = 1.0e-64, Identities = 128/303 (42%), Positives = 196/303 (64%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG-NSEIKIG 314
           KI+FMGTP  +   L AL++  ++V+AVV QPD+P+GRKK +  S VK  A++  +  FQP KI      + L  L P   VT AFGQF+P  +LS+P++G IN+HASLLPKYRGGAP+H+A++ GEKETGV +M   K+MDAGD+   + + I   D   TLF +++ L  +++++ L K+   +  P+KQDE+KV+F+ NI +++E I++ K A E+   +RG+   P AY  +   ++KL+    T   +  APGTI  I KE I ++  +  +L + EVQ  GK++  V   L+G  +++K+G
  S:     3 KIIFMGTPAFSVPILEALIDSEYEVIAVVSQPDRPVGRKKVLTASPVKAAAVKHGLPIFQPEKISGSPEMDALIALEPDLIVTAAFGQFLPQKLLSVPKYGAINVHASLLPKYRGGAPVHYALMQGEKETGVSIMYMEKKMDAGDILSQKSLEITRDDDVGTLFDRLSLLGKELLMDTLPKLLAGDITPVKQDEAKVTFSPNIKREEEMIDWNKTATEVDFQVRGMRPWPVAYTELEGNRLKLWDVTPTEEVTTAAPGTIIRIEKEAIYLACGNQTVLKINEVQPAGKSKMTVMAFLSGVGNQLKVG 309
>gi|169351107|ref|ZP_02868045.1| hypothetical protein CLOSPI_01886 [Clostridium spiroforme DSM 1552] >gi|169292169|gb|EDS74302.1| hypothetical protein CLOSPI_01886 [Clostridium spiroforme DSM 1552] (317 aa)
Score = 629, Expect = 1.2e-63, Identities = 129/305 (42%), Positives = 201/305 (65%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAV------STNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKI 313
           +N KI+FMGT   ++  L  LLE +++V+AVV QPD+ +GRKK +    VK++A+  +I  +QP KIK+   +L +L P   +T A+GQ IP++IL++P+ GCIN+HASLLPKYRGGAP+H+A+INGE+ TGV +M  +K+MDAG++    +V I   +TT  L+ +++N+   +++  L  + +     I+QDE+ V++A  IS + EKI+F ++A ++ N +RGL+  PGAY    DK +K++         +T    +   GTI  I K+ I + T D   L+ E+QI GK R  VK+ LNGN+  K+
  S:     2 ENVKILFMGTASFSSCVLEKLLETNYNVIAVVTQPDRLVGRKKILTMPEVKEVALNHDIPVYQPQKIKKDYQDLLDLKPDLVITAAYGQMIPEAILNLPKLGCINVHASLLPKYRGGAPVHYAIINGEEVTGVTIMYMVKKMDAGNIISQEEVKIAPDETTGELYDRLSNVGAKLLIETLPSIISKTNDSIEQDENLVTYAPVISHEQEKIDFNQSAKQVYNHVRGLNPWPGAYTVYQDKVVKIWAGSIHNCQNATKHHGHQENGTIVKIFKDAIGVKTGDGIYLITELQIAGKKRMLVKDYLNGNNIFKV 312
>gi|160915159|ref|ZP_02077372.1| hypothetical protein EUBDOL_01167 [Eubacterium dolichum DSM 3991] >gi|158432958|gb|EDP11247.1| hypothetical protein EUBDOL_01167 [Eubacterium dolichum DSM 3991] (314 aa)
Score = 625, Expect = 3.6e-63, Identities = 127/306 (41%), Positives = 186/306 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           K   I+FMGTPEIA   L+ LLE  + +V VV QPDK IGRK+ +    VK+LA+  +I  +QP  IKE   +L EL+    +TCA+GQFIP ++L  P+FG  N+H SLLPK RGGAPIH A++ GE  +GV + R + +MDAG V   +KV I + DT  TL+ K+  +  D++   L K+ N E   ++Q E + +FAYNI+K++E ++FE +   + N IR L   P AY +++ KK+K  KA        +  G I  +  +GI I   +  +L+ E+Q+EGK + + K+  NG  +  IG
  S:     2 KKVNILFMGTPEIAVAMLSRLLEDKYRIVGVVTQPDKKIGRKQLLTMPPVKELALAHDIPVYQPGSIKEEYEQLMELDIDVLITCAYGQFIPKALLEYPKFGSFNVHTSLLPKLRGGAPIHRAIMTGESFSGVSIQRMVAKMDAGAVCAQQKVEITQEDTMGTLYDKLAQVGADLLAKTLPKIINNEACFVEQREEEATFAYNITKEEELVDFECDVQTVYNHIRALIPQPCAYAYVHQKKLKFHKARMIRDNQPHVCGQIEGLIDQGIAIGAMNGYVLIDELQMEGKAKTDAKSFYNGIGKNLIG 307
>gi|20807949|ref|NP_623120.1| methionyl-tRNA formyltransferase [Thermoanaerobacter tengcongensis MB4] >gi|23821557|sp|Q8R9T1|FMT_THETN Methionyl-tRNA formyltransferase >gi|20516519|gb|AAM24724.1| Methionyl-tRNA formyltransferase [Thermoanaerobacter tengcongensis MB4] (309 aa)
Score = 617, Expect = 3.2e-62, Identities = 132/307 (42%), Positives = 193/307 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           +IVFMGTPE A  +L  L E+ +DV+AVV QPDK  GR  ++ FS VK+LA++K +K  QP  +K   E   ELKELNP   V  A+G+ +P+ IL++PE+GCIN+HASLLPKYRG API+WA+INGEKETG+  M   K +D GD+   R + IEE D   TL  K+ NL  +++   L+K+   +  P KQ + + ++A  I+K+   I+++  A  I NLIRGL   PG Y F + K +K++KA       N  PG++   SK+ +++   +  + + E+Q EG  +  ++  L G++ I  G  LK
  S:     2 RIVFMGTPEFAVPSLKRLFEEGYDVLAVVTQPDKQRGRGMKVSFSPVKELALQKGVKVLQPESVKNNPEFLQELKELNPEVIVVAAYGKILPEEILTLPEYGCINVHASLLPKYRGAAPINWAIINGEKETGITTMLMDKGLDTGDMLLKRSIAIEEDDDAQTLHDKLANLGAEVLSETLKKLKEGKLIPEKQKDEEATYAPIITKEMGHIDWKSPACRIRNLIRGLKPWPGCYTFYDGKMLKIWKAEVVEHFGNEPPGSVLK-SKDELIVKCGENALRILEIQQEGSRKMGIREYLIGHN-IPEGTILK 309
>gi|187605822|ref|ZP_02992007.1| methionyl-tRNA formyltransferase [Exiguobacterium sp. AT1b] >gi|187482095|gb|EDU20114.1| methionyl-tRNA formyltransferase [Exiguobacterium sp. AT1b] (356 aa)
Score = 616, Expect = 3.8e-62, Identities = 125/309 (40%), Positives = 188/309 (60%)
  Q:     6 NSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIG 314
           N  K+K+IVFMGTP  A   L  LLE+ ++VV VV QPDKP+GRK+E+  + VK+ A+   I   QP K++    ++ EL P   VT A+GQ +P ++L  P  G IN+HASLLPKYRGGAPIH A+++GE ETGV +M  + ++DAGD+  +  V IEE+DT  +LF K+     D+++  L          + QDE  V+FA NIS++ E+I++  N   I N IRG++  P AY  ++ +++KLF    T       PG +  + ++G +++T  D  I V ++Q  GK R +    + G   +++IG
  S:    38 NPGKDKRIVFMGTPTFAVSVLERLLEEGYNVVGVVSQPDKPVGRKRELKPTPVKECALRHGIPVLQPEKVRTDYADILELKPDLIVTAAYGQIVPTALLEAPPHGAINVHASLLPKYRGGAPIHQAILDGESETGVTIMYMVDKLDAGDMIANTIVPIEETDTVGSLFDKLAVAGSDLLIRTLPAFLEGWIEAVPQDERDVTFAPNISREREQIDWTMNGESIYNHIRGMNPFPTAYSTLDGERVKLFMGEKTTGSGQ--PGEVVRLEEDGFVVATGNDVAIKVTDLQPAGKKRMDGATFMRGAGQKLRIG 346
>gi|50365227|ref|YP_053652.1| methyonyl-tRNA formyltransferase [Mesoplasma florum L1] >gi|73919405|sp|Q6F155|FMT_MESFL Methionyl-tRNA formyltransferase >gi|50363783|gb|AAT75768.1| methyonyl-tRNA formyltransferase [Mesoplasma florum L1] (313 aa)
Score = 615, Expect = 5.2e-62, Identities = 131/303 (43%), Positives = 198/303 (65%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNI-LNGNSEIKIG 314
           K++F GTP+I    L  L E ++ +VV V+ QPD+P+GRKKE+  + VK++A++ N+K  QP KI E   E+ ++     VTCA+GQF+P  IL +P+   IN+H SLLPKYRGGAPI +A+ NG+ +TG+ +M+ +K+MDAGD Y    ++IEE+D T  +F+K+  L   ++  +L K++N E PPI Q+E +V+F+ NIS ++EKIN+   +V + N IR LS  P A+ F  +++ K+ K    N+     PGTI NIS+ GI I TKD  + +  +Q  GK   E  +  LN  S++K+G
  S:     5 KVIFCGTPQIGADILTTLTEMENVEVVLVISQPDRPVGRKKELKPTPVKEIALKNNLKIIQPVKISEAYEEIAQIESDFIVTCAYGQFVPTKILDLPKIDSINVHGSLLPKYRGGAPIQYAIKNGDSKTGISIMKMVKKMDAGDYYIQESIDIEETDDTGIMFEKLAKLGQKMIKENLLKIYNNELPPIAQNEDEVTFSKNISTEEEKINWNDLSVNVWNHIRSLSPWPIAHTFKGEERYKIQKVQILNNNVEAKPGTIVNISENGIDIQTKDGQVQILLIQKPGKKMMEASSYKLNNLSDLKVG 309
>gi|82750820|ref|YP_416561.1| methionyl-tRNA formyltransferase [Staphylococcus aureus RF122] >gi|123727477|sp|Q2YXK0|FMT_STAAB Methionyl-tRNA formyltransferase >gi|82656351|emb|CAI80769.1| methionyl-tRNA formyltransferase [Staphylococcus aureus RF122] (311 aa)
Score = 612, Expect = 1.1e-61, Identities = 123/306 (40%), Positives = 200/306 (65%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP+ +T  L  L+ +  DV+AVV QPD+P+GRK+ +    VKK+A++ ++  +QP K+   E   +L +L+    VT AFGQ +P+S+L++P+ G IN+HASLLPKYRGGAPIH A+I+GE+ETG+ +M  +K++DAG++   + + IEE+D   T+  K++ L  D++   L  +       + QD+++ +FA NI ++DE+I++ K   ++ N IRGLS  P AY  ++D  +K++ A    +   N PGTI   +K+ I+++T D + + +K++Q+ GK R    N L+G   I +G  L
  S:     3 KIIFMGTPDFSTTVLEMLIAEH-DVIAVVTQPDRPVGRKRVMTPPPVKKVAMKYDLPVYQPEKLSGSEELEQLLQLDVDLIVTAAFGQLLPESLLALPKLGAINVHASLLPKYRGGAPIHQAIIDGEQETGITIMYMVKKLDAGNIISQQAIKIEENDNVGTMHDKLSVLGADLLKETLPSIIEGTNESVPQDDTQATFASNIRREDERISWNKPGRQVFNQIRGLSPWPVAYTTMDDTNLKIYDAELVETNKINEPGTIIETTKKAIIVATNDNEAVAIKDMQLAGKKRMLAANYLSGAQNILVGKKL 310
>gi|21282828|ref|NP_645916.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus MW2] >gi|49486055|ref|YP_043276.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus MSSA476] >gi|23821552|sp|Q8NX18|FMT_STAAW Methionyl-tRNA formyltransferase >gi|56748911|sp|Q6G9Z7|FMT_STAAS Methionyl-tRNA formyltransferase >gi|21204267|dbj|BAB94964.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus MW2] >gi|49244498|emb|CAG42927.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus MSSA476] (311 aa)
Score = 612, Expect = 1.3e-61, Identities = 123/306 (40%), Positives = 199/306 (65%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP+ +T  L  L+ +  DV+AVV QPD+P+GRK+ +    VKK+A++ ++  +QP K+   E   +L +L+    VT AFGQ +P+S+L++P+ G IN+HASLLPKYRGGAPIH A+I+GE+ETG+ +M  +K++DAG++   + + IEE+D   T+  K++ L  D++   L  +       + QD+++ +FA NI ++DE+IN+ K   ++ N IRGLS  P AY  ++D  +K++ A    +   N PGTI   +K+ I+++T D + + +K++Q+ GK R    N L+G     +G  L
  S:     3 KIIFMGTPDFSTTVLEMLIAEH-DVIAVVTQPDRPVGRKRVMTPPPVKKVAMKYDLPVYQPEKLSGSEELEQLLQLDVDLIVTAAFGQLLPESLLALPKLGAINVHASLLPKYRGGAPIHQAIIDGEQETGITIMYMVKKLDAGNIISQQAIKIEENDNVGTMHDKLSVLGADLLKETLPSIIEGTNESVPQDDTQATFASNIRREDERINWNKPGRQVFNQIRGLSPWPVAYTTMDDTNLKIYDAELVETNKINEPGTIIETTKKAIIVATNDNEAVAIKDMQLAGKKRMLAANYLSGAQNTLVGKKL 310
>gi|15924206|ref|NP_371740.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|15926799|ref|NP_374332.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus N315] >gi|49483379|ref|YP_040603.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus MRSA252] >gi|148267707|ref|YP_001246650.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|150393765|ref|YP_001316440.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|156979537|ref|YP_001441796.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus Mu3] >gi|166215517|sp|A7X1H4|FMT_STAA1 Methionyl-tRNA formyltransferase >gi|189044554|sp|A5ISA1|FMT_STAA9 Methionyl-tRNA formyltransferase >gi|189044555|sp|A6U135|FMT_STAA2 Methionyl-tRNA formyltransferase >gi|54037121|sp|P99127|FMT_STAAN Methionyl-tRNA formyltransferase >gi|54040769|sp|P64136|FMT_STAAM Methionyl-tRNA formyltransferase >gi|56748922|sp|Q6GHL9|FMT_STAAR Methionyl-tRNA formyltransferase >gi|13701016|dbj|BAB42311.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus N315] >gi|14246986|dbj|BAB57378.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus Mu50] >gi|49241508|emb|CAG40194.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus MRSA252] >gi|147740776|gb|ABQ49074.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus JH9] >gi|149946217|gb|ABR52153.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus JH1] >gi|156721672|dbj|BAF78089.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus Mu3] (311 aa)
Score = 608, Expect = 3.2e-61, Identities = 122/306 (39%), Positives = 199/306 (65%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP+ +T  L  L+ +  DV+AVV QPD+P+GRK+ +    VKK+A++ ++  +QP K+   E   +L +L+    VT AFGQ +P+S+L++P+ G IN+HASLLPKYRGGAPIH A+I+GE+ETG+ +M  +K++DAG++   + + IEE+D   T+  K++ L  D++   L  +       + QD+++ +FA NI ++DE+I++ K   ++ N IRGLS  P AY  ++D  +K++ A    +   N PGTI   +K+ I+++T D + + +K++Q+ GK R    N L+G     +G  L
  S:     3 KIIFMGTPDFSTTVLEMLIAEH-DVIAVVTQPDRPVGRKRVMTPPPVKKVAMKYDLPVYQPEKLSGSEELEQLLQLDVDLIVTAAFGQLLPESLLALPKLGAINVHASLLPKYRGGAPIHQAIIDGEQETGITIMYMVKKLDAGNIISQQAIKIEENDNVGTMHDKLSVLGADLLKETLPSIIEGTNESVPQDDTQATFASNIRREDERISWNKPGRQVFNQIRGLSPWPVAYTTMDDTNLKIYDAELVETNKINEPGTIIETTKKAIIVATNDNEAVAIKDMQLAGKKRMLAANYLSGAQNTLVGKKL 310
>gi|57651785|ref|YP_186091.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|87161486|ref|YP_493806.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus USA300] >gi|88194922|ref|YP_499722.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221338|ref|YP_001332160.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509388|ref|YP_001575047.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168728557|ref|ZP_02760834.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|123003478|sp|Q2FZ68|FMT_STAA8 Methionyl-tRNA formyltransferase >gi|123486229|sp|Q2FHM2|FMT_STAA3 Methionyl-tRNA formyltransferase >gi|172048852|sp|A6QGB6|FMT_STAAE Methionyl-tRNA formyltransferase >gi|189044553|sp|A8Z3Q2|FMT_STAAT Methionyl-tRNA formyltransferase >gi|71152054|sp|Q5HGL6|FMT_STAAC Methionyl-tRNA formyltransferase >gi|57285971|gb|AAW38065.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus COL] >gi|87127460|gb|ABD21974.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202480|gb|ABD30290.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374138|dbj|BAF67398.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368197|gb|ABX29168.1| methionyl-tRNA formyltransferase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (311 aa)
Score = 607, Expect = 4.3e-61, Identities = 122/306 (39%), Positives = 198/306 (64%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP+ +T  L  L+ +  DV+AVV QPD+P+GRK+ +    VKK+A++ ++  +QP K+   E   +L +L+    VT AFGQ +P+S+L++P  G IN+HASLLPKYRGGAPIH A+I+GE+ETG+ +M  +K++DAG++   + + IEE+D   T+  K++ L  D++   L  +       + QD+++ +FA NI ++DE+I++ K   ++ N IRGLS  P AY  ++D  +K++ A    +   N PGTI   +K+ I+++T D + + +K++Q+ GK R    N L+G     +G  L
  S:     3 KIIFMGTPDFSTTVLEMLIAEH-DVIAVVTQPDRPVGRKRVMTPPPVKKVAMKYDLPVYQPEKLSGSEELEQLLQLDVDLIVTAAFGQLLPESLLALPNLGAINVHASLLPKYRGGAPIHQAIIDGEQETGITIMYMVKKLDAGNIISQQAIKIEENDNVGTMHDKLSVLGADLLKETLPSIIEGTNESVPQDDTQATFASNIRREDERISWNKPGRQVFNQIRGLSPWPVAYTTMDDTNLKIYDAELVETNKINEPGTIIETTKKAIIVATNDNEAVAIKDMQLAGKKRMLAANYLSGAQNTLVGKKL 310
>gi|126649675|ref|ZP_01721911.1| methionyl-tRNA formyltransferase [Bacillus sp. B14905] >gi|126593394|gb|EAZ87339.1| methionyl-tRNA formyltransferase [Bacillus sp. B14905] (313 aa)
Score = 607, Expect = 5.0e-61, Identities = 125/306 (40%), Positives = 190/306 (62%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKE---LNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGN-SEIKIGVTLK 318
           I+FMGTP+ +   L  L E+ +D+ AVV QPD+P+GRK+ +    VK  A+E  +   QP K++   NEL++   L P   +T AFGQ +P  +L  P  GCIN+HASLLPKYRGGAPIH A+++GEKETGV +M   +++DAGD+   R + IE+ D T   F+K++ +  D++ + L  + N       QDE++V+FA NIS++ E+I++ K+A  + N +RGL   P AY    D   K++ A+  NSK +  PGT+  I+K+   ++  +   L + +VQ  GK R   +  L G  S+++IG   K
  S:     4 IIFMGTPDFSAPILRMLHEEGYDIKAVVTQPDRPVGRKRVLTPPPVKAAALELGLPIIQPEKLRG-SNELQQILALQPDIVITAAFGQILPKELLDAPALGCINVHASLLPKYRGGAPIHQAIMDGEKETGVTIMYMAEKLDAGDIISQRAIPIEQDDHTGGFFEKLSIVGRDLLKDTLPSIINGTNSRTVQDETQVTFASNISREQERIDWTKDATTLYNQVRGLHPWPVAYTTFEDGNFKVWWAIIGNSKHDTIPGTVVAIAKDHFEVAAGNGTTLALFDVQPAGKKRMTAEEYLRGTGSKLQIGDQFK 313
>gi|149182345|ref|ZP_01860823.1| methionyl-tRNA formyltransferase [Bacillus sp. SG-1] >gi|148849964|gb|EDL64136.1| methionyl-tRNA formyltransferase [Bacillus sp. SG-1] (316 aa)
Score = 603, Expect = 1.2e-60, Identities = 123/296 (41%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG 307
           KIVFMGTP+ +   L  L+E  +D++ VV QPD+P+GRK+ +    VK  A +  I  +QP KI+E E   ++  L P   VT AFGQ +P  +L  P+FGCIN+HASLLP+ RGGAPIH+++I G+K TGV +M  ++++DAGD+  S +V I+E D   TL  K++     ++++ L  + N E  P KQDE KV+FA+NI ++ EKI++ K   EI N +RG+   P AY  +    +K++ +      S  APG I ++ ++GI+++T     I + E+Q  GK R   K+ L G
  S:     3 KIVFMGTPQFSVSVLQNLIENDYDIIGVVTQPDRPVGRKRVMTPPPVKVEAEKHGIPVYQPEKIREKEELEKVLSLQPDLIVTAAFGQILPKELLESPKFGCINVHASLLPELRGGAPIHYSIIQGKKTTGVTIMYMVEKLDAGDMISSVEVEIDERDHVGTLHDKLSEAGAKLLIDTLPALLNGEISPQKQDEGKVTFAWNIKREQEKIDWTKTGEEIYNHVRGMHPWPVAYTLLEGSVLKVWWSEKVEG-SAGAPGEITSVEEDGIVVATGSTTSIKITELQPSGKKRMSAKDYLRG 300
>gi|23098961|ref|NP_692427.1| methionyl-tRNA formyltransferase [Oceanobacillus iheyensis HTE831] >gi|33516868|sp|Q8ER25|FMT_OCEIH Methionyl-tRNA formyltransferase >gi|22777189|dbj|BAC13462.1| methionyl-tRNA formyltransferase [Oceanobacillus iheyensis HTE831] (313 aa)
Score = 601, Expect = 2.0e-60, Identities = 133/307 (43%), Positives = 196/307 (63%)
  Q:    11 KKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLF--KAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           K+IVFMGTP+ A   L  LLE  +D+V VV QPD+P GRKK I    VK+ AI+ ++  FQP K+++   ++ +L P   VT A+GQ +P  IL IP FGCIN+HASLLP+ RGGAPIH+A++ G++ TGV +M   +++DAGD+    +V IE+ D   T+  K++    +++   L  +FN E  P KQDES V+FA NI+++ E+I++ K A EI+N IRGL   P A+     K MK++  + +S +SKS N  G I     +G  +   +  ++ V E+Q  GK R  V++ L G+ + IKIG+ L
  S:     2 KRIVFMGTPDFAVPVLQKLLELKYDIVLVVTQPDRPKGRKKVITPPPVKEEAIKHDLDIFQPEKLRDDYKKITDLKPDLIVTAAYGQILPKEILEIPTFGCINVHASLLPELRGGAPIHYAIMQGKEVTGVTIMYMAEKLDAGDILTQVEVPIEQDDHVGTMHDKLSLAGANLLSETLPSLFNNEITPKKQDESLVTFASNITREQERIDWSKTANEIINQIRGLHPWPVAFTTYEGKVMKIWWGQELSKSSKSGNI-GEIIEKDTDGFYVQCGNNTVVKVSEIQPAGKKRMLVEDYLKGSQDRIKIGIKL 311
>gi|152976232|ref|YP_001375749.1| methionyl-tRNA formyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189044499|sp|A7GRJ6|FMT_BACCN Methionyl-tRNA formyltransferase >gi|152024984|gb|ABS22754.1| methionyl-tRNA formyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] (314 aa)
Score = 600, Expect = 2.7e-60, Identities = 127/306 (41%), Positives = 193/306 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEG-ILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  +DVV VV QPD+P+GRKK +  + VK  A +  I   QP KI+E +   K   L P   VT AFGQ IP  IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQDE KV+FAYNI ++ EKIN+ K   E+ N IRGL+  P AY  +  + +K++      + ++  PGTI  I ++G I+++  +  I + E+Q  GK R      L G ++++IG+ L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYDVVGVVTQPDRPVGRKKVMTPTPVKVEAEKHGIPVLQPLKIREQDEYEKVLALEPDLIVTAAFGQIIPKEILEAPKYGCINVHASLLPELRGGAPIHYAIMQGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLVQGKLEPIKQDEEKVTFAYNIKREQEKINWAKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPTANDAQPGTIVEIQEDGFIVVTGNETGIKITELQPAGKKRMSSSQFLRG-AKLEIGMKL 310
>gi|110004542|emb|CAK98879.1| probable methionyl-trna formyltransferase protein [Spiroplasma citri] (319 aa)
Score = 599, Expect = 3.8e-60, Identities = 130/303 (42%), Positives = 191/303 (63%)
  Q:    12 KIVFMGTPEIATYALNAL--LEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVST-----NSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNIL-NGNSEIKIG 314
           +++FMGTP  AT  L AL  L  + +++ +V QPD+ IGR++ + FS VK+ A+   I  FQP KI ++  EL  L P   VTCA+GQFIP+ IL +    CIN+HASLLPK RGGAPIH A+I GE+ETG+ LM+ IK+MDAG++Y    + I  ++T S+L  ++  L   ++   L  +   +     QD+S+ +FAYNI++D+EK+N+     +IV+ IRGL   P AY  +N+   KL +A  T        ++   GTI +ISK GI +  +D  +L+  +Q EGK   + KN   N +SEI +G
  S:     5 RVIFMGTPIFATAVLKALQKLSPTIEIIGIVTQPDRKIGRQQLVQFSPVKEFALTNQIPVFQPEKINDLYAELVTLQPDVIVTCAYGQFIPERILKLALINCINVHASLLPKLRGGAPIHKAIIYGEQETGITLMQMIKKMDAGEMYVQTTIPISPTETASSLHDRLMVLAGTMIEKHLLDIITGKIKGTPQDDSQATFAYNITRDEEKVNWFLPKQKIVDQIRGLYAWPIAYTTVNNIHYKLHQAAITLEPLAEKDADFVNGTIIDISKLGIKVKVEDGYLLITRLQREGKKATDAKNYYHNASSEIIVG 315
>gi|164687802|ref|ZP_02211830.1| hypothetical protein CLOBAR_01446 [Clostridium bartlettii DSM 16795] >gi|164603077|gb|EDQ96542.1| hypothetical protein CLOBAR_01446 [Clostridium bartlettii DSM 16795] (304 aa)
Score = 599, Expect = 3.9e-60, Identities = 128/303 (42%), Positives = 190/303 (62%)
  Q:    16 MGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           MGTP+IA+  L  L++K +D++ VV QPDK +GR K+I+FS VK++AIE N+  +QP K KE    NE+KELNP   V  A+GQ +    L IP+ GCIN+H SLLPKYRG API+W +INGE++TGV  M   + +D GDV    +  +++  T   L  KM      ++   L+ +   + P   Q+  + ++A  + K+   ++F K A E+ NL+RG++  P AY    DKKMK++K    N KS+  PGTI  + +EGI ++TKD  IL+ E+Q+  K R EVK  + GN+ +++G  L+
  S:     1 MGTPDIASGCLQELIDKKYDIIGVVTQPDKQVGRGKKIVFSPVKQVAIENNLPVYQPIKAKEESFVNEIKELNPDVIVVVAYGQILSKEFLEIPKQGCINVHVSLLPKYRGAAPINWVIINGEEKTGVSTMFMDEGLDTGDVILQSEFALDDEITAGELHDKMTVEGAKVLCETLDLIKEGKAPRTPQNHDEFTYAPIMDKNLGHVDFSKTAREVHNLVRGVNPWPSAYTMYMDKKMKVWKTKVLNEKSSKEPGTILKVDQEGIKVATKDNVILISEIQMPNKKRMEVKEFIKGNT-LEVGNVLQ 304
>gi|57866754|ref|YP_188365.1| methionyl-tRNA formyltransferase [Staphylococcus epidermidis RP62A] >gi|71152055|sp|Q5HPX5|FMT_STAEQ Methionyl-tRNA formyltransferase >gi|57637412|gb|AAW54200.1| methionyl-tRNA formyltransferase [Staphylococcus epidermidis RP62A] (310 aa)
Score = 596, Expect = 9.6e-60, Identities = 129/306 (42%), Positives = 195/306 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP+ +T  L  L+ +  +V+AVV QPD+P+GRKK +    VK++A +  I  +QP K+K+ +  + L  L     VT AFGQ +P+S+L+ P+ G IN+HASLLPKYRGGAPIH A+I+GE+ETG+ +M  +K++DAG++   + + IEE D   T+  K++ L  +++   L  + +     I QD++  +FA NI ++DE+I++  +A  I N IRGLS  P AY  +N+K +KLF A     K  N PGTI   +K  ++I+T   D I + E+Q  GK R +V + L+G  E  +G  L
  S:     3 KIIFMGTPDFSTKVLEMLIAEH-EVIAVVTQPDRPVGRKKVMTPPPVKRVATKHQIPVYQPEKLKDSQELDVLLSLESDLIVTAAFGQLLPESLLNAPKLGAINVHASLLPKYRGGAPIHQAIIDGEEETGITIMYMVKKLDAGNIISQQSIRIEEEDNVGTMHDKLSFLGAELLKKTLPSIIDNTNDSIPQDDALATFASNIRREDERIDWNMSAQAIHNHIRGLSPWPVAYTTMNEKNLKLFSAFIVKGKKGN-PGTIIEATKHELIIATGSDDAIALTEIQPAGKKRMKVTDYLSGVQESLVGKVL 309
>gi|167755670|ref|ZP_02427797.1| hypothetical protein CLORAM_01185 [Clostridium ramosum DSM 1402] >gi|167704609|gb|EDS19188.1| hypothetical protein CLORAM_01185 [Clostridium ramosum DSM 1402] (317 aa)
Score = 595, Expect = 1.3e-59, Identities = 126/301 (41%), Positives = 194/301 (64%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA---VSTNSKSNNA---PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K+ KI+FMGT   +   L  LLE +++VVAVV QPD+ +GRKK +    VK++A+   I  +QP KIKE   E+  L P   +T A+GQ +P+++L+ P+ GCIN+HASLLPKYRGGAP+H+A++ GE+ TGV +M  +K+MDAG++    +V I   +TT  L+++++    +++L  L  V       I QDES V+++  IS + EKI+F K+A+ + N +RG++  PGAY     K +K++     V  N+  ++A    GTI  I K+ I + T +   L+ E+Q+ GK R  VK+ LNGN+
  S:     2 KDAKIIFMGTASFSKQVLEKLLENNYNVVAVVTQPDRFVGRKKVLTMPEVKEVALASGIPVYQPLKIKEEYQEIIALEPDLIITAAYGQIVPEAVLNAPKIGCINVHASLLPKYRGGAPVHYAIMEGEEVTGVTIMYMVKKMDAGNIISQVEVPIGAEETTGELYERLSIAGAELLLETLPSVLAGTNESIAQDESLVTYSPTISHEQEKIDFSKSALRVYNQVRGMNPWPGAYTTYQGKVVKIWAGKIHVCENALKHHAHQENGTIVKIFKDAIGVKTGEGIYLITELQLAGKKRMLVKDYLNGNN 308
>gi|29377579|ref|NP_816733.1| methionyl-tRNA formyltransferase [Enterococcus faecalis V583] >gi|33516854|sp|Q82ZD8|FMT_ENTFA Methionyl-tRNA formyltransferase >gi|29345046|gb|AAO82803.1| methionyl-tRNA formyltransferase [Enterococcus faecalis V583] (313 aa)
Score = 594, Expect = 1.3e-59, Identities = 123/296 (41%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           KIVFMGTP  +   L +L+E  +DV AVV QPD+P+GRKK I  + VK+ A++ N+   QP KI    E+E  + +L P   VT AFGQF+P+ IL  P+ G IN+HASLLPKYRGGAP+H+++I GEKETGV +M  +K+MDAG +   R + I + D   T+F+K++ L  +++L  L K+   E  PI Q E + +F+ NI+++ E+I+++K A  I N +RG+   P A+        K++        + +APGTI   SK+ + I+  +  +L +  +Q  GK +  ++  LNG
  S:     3 KIVFMGTPAFSVPILESLIEAGYDVQAVVTQPDRPVGRKKVITPTPVKEAALKHNLLVLQPEKISGSPEMEKVI-DLAPDLIVTAAFGQFLPEKILKAPKLGAINVHASLLPKYRGGAPVHYSIIEGEKETGVTIMEMVKKMDAGAILSQRAIPITKQDDVGTMFEKLSILGKELLLETLPKLIAGEITPIPQVEEEATFSPNITREQERIDWQKTAEAIDNQVRGMRPWPTAFTTYQGTNWKIWAVTPLTETTTSAPGTIIQRSKKALWIACGEGTVLQIDRLQPAGKGQLTIQEFLNG 301
>gi|167040392|ref|YP_001663377.1| methionyl-tRNA formyltransferase [Thermoanaerobacter sp. X514] >gi|166854632|gb|ABY93041.1| methionyl-tRNA formyltransferase [Thermoanaerobacter sp. X514] (310 aa)
Score = 594, Expect = 1.4e-59, Identities = 128/298 (42%), Positives = 187/298 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNS 309
           KIVFMGTPE A  +L  L E+ +DV AVV QPDK  GR  +  FS VK++A++K ++  QP KIK   E  N L+E+NP A V  A+G+ +P+ IL++P++GCIN+HASLLPKYRG API+WA+INGEKETG+  M   K +D GD+   + + I E D   TL  K++ L  ++++  L+ +      P+KQ E + S++  ++K+   I++ K A EI NLIRG+   PG Y F  DK +K++K        N   GT+  +  +G LI   D D L + E+Q EG  +  ++  L G++
  S:     3 KIVFMGTPEFAVPSLQKLFEEGYDVAAVVTQPDKQKGRGMKFSFSPVKEVALQKGVEILQPEKIKNNPEFLNRLEEINPDAIVVVAYGKILPEEILTLPKYGCINVHASLLPKYRGAAPINWAIINGEKETGITTMLMDKGLDTGDMLIKKSIPILEEDDAETLHDKLSRLGAEVLIETLKGLEKGSLTPVKQREEEASYSPILTKEMGHIDWNKTAEEIRNLIRGMKPWPGCYTFYGDKMLKIWKGEIVEYNGNEENGTV--LKSKGDLIVKCDKDALKIVEIQQEGSKKMGIREYLIGHN 302
>gi|196162752|ref|ZP_03123283.1| methionyl-tRNA formyltransferase [Clostridium difficile QCD-23m63] (309 aa)
Score = 594, Expect = 1.6e-59, Identities = 133/306 (43%), Positives = 192/306 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+IA   L  ++++ ++++ VV QPDKP GR K++  S VK+LAIE NI  +QP K   KE  + +K LNP   V  AFGQ +P  IL IP+FGCIN+H SLLPKYRG API+W +INGE++TGV  M   + +D GD+    +VN++E+ T   L  KM N+  + +   L  +     P   Q+  + S+A  ++K    I+F K+A EI NL+RG++  P AY   ND  MK++K    + KS    GTI ++SK+GI +ST D  +L++E+Q+  K R  V   + GN+ I+ G+ L
  S:     2 KIVFMGTPDIAVPCLQKIIDEKYEILGVVTQPDKPKGRGKKLGMSPVKELAIENNIPVYQPVKARDKEFIDTIKSLNPDVIVVVAFGQILPKGILEIPKFGCINVHVSLLPKYRGAAPINWVIINGEEKTGVTTMYMDEGLDTGDMILKTEVNLDENITAGELHDKMMNIGAETLKETLRLIEEGNAPREVQNHEEFSYAPIMNKSLGNIDFSKSAREIHNLVRGVNPWPSAYTTYNDVIMKVWKTKVLDEKSTKDAGTIIDVSKDGIKVSTIDNVLLIEEIQMPNKKRMLVGEYIKGNT-IETGLVL 308
>gi|191164674|ref|ZP_03026535.1| methionyl-tRNA formyltransferase [Geobacter sp. M21] >gi|190994227|gb|EDV69694.1| methionyl-tRNA formyltransferase [Geobacter sp. M21] (318 aa)
Score = 593, Expect = 1.8e-59, Identities = 121/296 (40%), Positives = 184/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTPE A   L  L+E+   VVAVV QPD+P GR ++ +   VK +A E  I   QP K++  E+  E++ LNP   V  AFGQ +P ++L IP +GCIN+HASLLP+YRG AP++W +INGE ETGV  M     +D GD+   R   I   + T +L  +M+ L  +++   L+++   E  P KQD++   +A  + K+D  I++ ++A  I N +RG++  PGAY F++DK +K+F+ V T S S  APG I ++ ++GI ++     +++ E+Q+EGK R    + L G
  S:     5 RIVFMGTPEFACPTLRTLIERGEKVVAVVTQPDRPKGRGQQTLPPPVKVVAEEHGIPVLQPVKVRLPESIEEIRGLNPDLIVVIAFGQILPKALLDIPRYGCINVHASLLPRYRGAAPLNWCIINGETETGVTTMMMDVGLDTGDMLLKRSTPIGADEDTQSLHDRMSQLGAELLAETLDRLARGELVPEKQDDALTCYAPMMKKEDGVIDWSRDAQAIKNQVRGMTPWPGAYSFLDDKLLKVFR-VQTASGS-GAPGEILSLGRDGIEVACGTGSLVISELQLEGKKRLPAGDFLAG 300
>gi|22536499|ref|NP_687350.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae 2603V/R] >gi|25010378|ref|NP_734773.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae NEM316] >gi|76788249|ref|YP_329038.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae A909] >gi|76797830|ref|ZP_00780095.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae 18RS21] >gi|77404964|ref|ZP_00782065.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae H36B] >gi|77408102|ref|ZP_00784849.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae COH1] >gi|77410632|ref|ZP_00786992.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae CJB111] >gi|77413310|ref|ZP_00789505.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae 515] >gi|123602427|sp|Q3K365|FMT_STRA1 Methionyl-tRNA formyltransferase >gi|54037116|sp|P64138|FMT_STRA5 Methionyl-tRNA formyltransferase >gi|54040770|sp|P64137|FMT_STRA3 Methionyl-tRNA formyltransferase >gi|22533331|gb|AAM99222.1|AE014206_2 methionyl-tRNA formyltransferase [Streptococcus agalactiae 2603V/R] >gi|23094730|emb|CAD45949.1| methionyl tRNA formyltransferase [Streptococcus agalactiae NEM316] >gi|76563306|gb|ABA45890.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae A909] >gi|76586844|gb|EAO63337.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae 18RS21] >gi|77160624|gb|EAO71740.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae 515] >gi|77163347|gb|EAO74298.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae CJB111] >gi|77173286|gb|EAO76408.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae COH1] >gi|77176403|gb|EAO79171.1| methionyl-tRNA formyltransferase [Streptococcus agalactiae H36B] (311 aa)
Score = 591, Expect = 2.9e-59, Identities = 125/296 (42%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  +L +  +DV+AVV QPD+ +GRKKEI  + VK++A+E NI  +QP K+    E+E +L  L     VT AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A+INGEKE GV +M  + +MDAGD+     V I + D   T+F ++  +  D++L+ L    + +  PI Q+E +VSF+ NIS D+E+I++ K++ +I N +RG+   P A+  +   + KL++   T S+   +PG +   +K  + ++T D  I +K VQ  GK R ++K+ LNG
  S:     3 KLLFMGTPDFSATVLKGILADGKYDVLAVVTQPDRAVGRKKEIKMTPVKEVALENNIPVYQPEKLSGSPELE-QLMTLGADGIVTAAFGQFLPTKLLESVGFA-INVHASLLPKYRGGAPIHYAIINGEKEAGVTIMEMVAKMDAGDMVSKASVEITDEDNVGTMFDRLAVVGRDLLLDTLPGYLSGDIKPIPQNEEEVSFSPNISPDEERIDWNKSSRDIFNHVRGMYPWPVAHTLLEGNRFKLYEV--TMSEGKGSPGQVIAKTKNSLTVATGDGAIELKSVQPAGKPRMDIKDFLNG 298
>gi|169827063|ref|YP_001697221.1| methionyl-tRNA formyltransferase [Lysinibacillus sphaericus C3-41] >gi|168991551|gb|ACA39091.1| Methionyl-tRNA formyltransferase [Lysinibacillus sphaericus C3-41] (313 aa)
Score = 590, Expect = 4.0e-59, Identities = 122/306 (39%), Positives = 184/306 (60%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGN-SEIKIGVTLK 318
           I+FMGTP+ +   L  L E+ +D+ AVV QPD+P+GRK+ +    VK  A+E  +   QP K++  E   ++  L P   +T AFGQ +P  +L  P  GCIN+HASLLPKYRGGAPIH A+I+GEKETGV +M   +++DAGD+   R + IE  D T  +F K++ +  D++ + L  + N       QDE++V+FA NIS++ E+I++  +A  + N +RGL   P AY    D   K++ A    SK +  PGT+  I+K+   ++  +   L + +VQ  GK R   +  L G  S+++IG   K
  S:     4 IIFMGTPDFSAPILRMLHEEGYDIKAVVTQPDRPVGRKRILTPPPVKAAALELGLPIIQPEKLRGSEELQQILSLQPDIVITAAFGQILPKELLDAPSLGCINVHASLLPKYRGGAPIHQAIIDGEKETGVTIMYMAEKLDAGDIISQRAIPIELDDHTGRVFDKLSMVGRDLLKDTLPSIINRTNNRTVQDETQVTFASNISREQERIDWTNDATTLYNQVRGLHPWPVAYTTFEDGNFKVWWATIGKSKHDTIPGTVVAIAKDHFEVAAGNGTTLALYDVQPAGKKRMTAEEYLRGTGSKLQIGDQFK 313
>gi|153809824|ref|ZP_01962492.1| hypothetical protein RUMOBE_00205 [Ruminococcus obeum ATCC 29174] >gi|149834002|gb|EDM89082.1| hypothetical protein RUMOBE_00205 [Ruminococcus obeum ATCC 29174] (315 aa)
Score = 589, Expect = 5.0e-59, Identities = 130/307 (42%), Positives = 190/307 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQ-DESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFK-AVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIV+MGTP+ A   L AL++  ++V AVV QPDKP GR K ++ + VK+ A++ +I  +QP K++E E    LK+L P   +  AFGQ IP +IL +P++GC+NIHASLLPKYRG API  AVI+GEKE+GV +M+    +D GD+     V + E +T  +LF K+      +++  +  + +      KQ +ES   +A  ISK    ++F K+AVE+  L+RGL+  P AY F+N K +K++K AV        APGTI  + K GI ++     +++KEVQ+EGK R E    L G  ++  G  LK
  S:     2 KIVYMGTPDFAVPPLAALVQNGYEVTAVVTQPDKPKGRGKTLLPTPVKEEAMKHDIPVYQPLKVREPEFVETLKKLEPDMIIVAAFGQIIPKTILDMPKYGCLNIHASLLPKYRGAAPIQQAVIDGEKESGVTIMQMGVGLDTGDMISQAVVPLAEDETGGSLFDKLAEEGAALLIRTIPSIVDGTAVYTKQPEESPTPYAAMISKKMGLMDFSKSAVELERLVRGLNPWPSAYTFLNGKTLKVWKCAVERAECGKEAPGTIIGVDKSGIHVACGSDTLILKEVQLEGKKRMETDAFLRG-YQVTAGTMLK 311
>gi|69245427|ref|ZP_00603422.1| Methionyl-tRNA formyltransferase [Enterococcus faecium DO] >gi|68195809|gb|EAN10245.1| Methionyl-tRNA formyltransferase [Enterococcus faecium DO] (312 aa)
Score = 589, Expect = 6.2e-59, Identities = 125/297 (42%), Positives = 189/297 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGN 308
           K+VFMGTP  +   L  L+E  +++ AVV QPD+P+GRK+ I  + VK+ A++  I+  QP KI    E+E E+ EL P   VT AFGQF+P+ +L +P+ G IN+HASLLPKYRGGAP+H+A++NGEKETGV +M  IK+MDAG +Y    + I + D   T+F+K++ L   ++L  L  + + +  P+ QDES+ +F+ NI+++ E I++ K A EI N +RG+   P A+      + KL         ++ APGTI    K+ + I+     +L + E+Q  GK +Q V + LNG+
  S:     3 KLVFMGTPAFSVPILEGLIESGYEIQAVVTQPDRPVGRKRVITPTPVKEAALKHGIRVLQPEKISGSPEME-EIIELVPDVIVTAAFGQFLPEKLLQVPKLGAINVHASLLPKYRGGAPVHYAIMNGEKETGVTIMEMIKKMDAGGIYAQESIPITKQDDVGTMFEKLSLLGRKLLLETLPNILDGQ-KPVPQDESEATFSPNITREQEAIDWHKTAEEIDNQVRGMRPWPIAFTTYEGIRWKLLSVEVLAETTDKAPGTIIRKDKKNLWIACGKQTVLAINELQPAGKGKQAVHDFLNGS 301
>gi|145618306|ref|ZP_01774366.1| methionyl-tRNA formyltransferase [Geobacter bemidjiensis Bem] >gi|144945488|gb|EDJ80553.1| methionyl-tRNA formyltransferase [Geobacter bemidjiensis Bem] >gi|197086392|gb|ACH37663.1| methionyl-tRNA formyltransferase [Geobacter bemidjiensis Bem] (318 aa)
Score = 588, Expect = 7.8e-59, Identities = 120/296 (40%), Positives = 184/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTPE A   L  L+E+   VVAVV QPD+P GR ++ +   VK +A +  I   QP K++  E+  E++ LNP   V  AFGQ +P ++L IP++GCIN+HASLLP+YRG AP++W +INGE ETGV  M     +D GD+   R   I   + T +L  +M+ L  +++   L+++   E  P KQD++   +A  + K+D  I++ ++A  I N +RG++  PGAY F++DK +K+F+ V T S S  APG I +  ++GI ++     +++ E+Q+EGK R    + L G
  S:     5 RIVFMGTPEFACPTLRTLIERGEKVVAVVTQPDRPKGRGQQTLPPPVKVVAEQHGIPVLQPVKVRLPESIEEIRGLNPDLIVVIAFGQILPKALLDIPKYGCINVHASLLPRYRGAAPLNWCIINGENETGVTTMMMDVGLDTGDMLLKRSTPIGADEDTQSLHDRMSQLGAELLAETLDRLARGELVPEKQDDALTCYAPMMKKEDGLIDWSRDAQAIKNQVRGMTPWPGAYSFLDDKLLKVFR-VQTASGS-GAPGEILSCGRDGIEVACGTGSLVIAELQLEGKKRLPAGDFLAG 300
>gi|167037731|ref|YP_001665309.1| methionyl-tRNA formyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856565|gb|ABY94973.1| methionyl-tRNA formyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223] (310 aa)
Score = 587, Expect = 8.4e-59, Identities = 127/298 (42%), Positives = 186/298 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNS 309
           KIVFMGTPE A  +L  L E+ +DV AVV QPDK  GR  +  FS VK++A++K ++  QP KIK   E  N L+ +NP A V  A+G+ +P+ IL++P++GCIN+HASLLPKYRG API+WA+INGEKETG+  M   K +D GD+   + + I E D   TL  K++ L  ++++  L+ +      P+KQ E + S++  ++K+   I++ K A EI NLIRG+   PG Y F  DK +K++K        N   GT+  +  +G LI   D D L + E+Q EG  +  ++  L G++
  S:     3 KIVFMGTPEFAVPSLQKLFEEGYDVAAVVTQPDKQKGRGMKFSFSPVKEVALQKGVEILQPEKIKNNPEFLNRLEVINPDAIVVVAYGKILPEEILTLPKYGCINVHASLLPKYRGAAPINWAIINGEKETGITTMLMDKGLDTGDMLIKKSIPILEEDDAETLHDKLSRLGAEVLIETLKGLEKGSLTPVKQREEEASYSPILTKEMGHIDWNKTAEEIRNLIRGMKPWPGCYTFYGDKMLKIWKGEIVEYNGNEENGTV--LKSKGDLIVKCDKDALKIVEIQQEGSKKMGIREYLIGHN 302
>gi|145953039|ref|ZP_01802047.1| hypothetical protein CdifQ_04003016 [Clostridium difficile QCD-32g58] >gi|168694207|ref|ZP_02726484.1| methionyl-tRNA formyltransferase [Clostridium difficile QCD-37x79] >gi|168725298|ref|ZP_02757575.1| methionyl-tRNA formyltransferase [Clostridium difficile QCD-76w55] >gi|168732654|ref|ZP_02764931.1| methionyl-tRNA formyltransferase [Clostridium difficile QCD-97b34] >gi|196159224|ref|ZP_03119785.1| methionyl-tRNA formyltransferase [Clostridium difficile CIP 107932] (309 aa)
Score = 587, Expect = 1.0e-58, Identities = 132/306 (43%), Positives = 192/306 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+IA   L  ++++ ++++ VV QPDKP GR K++  S VK+LAIE NI  +QP K   KE  +++K LNP   V  AFGQ +P  IL IP+ GCIN+H SLLPKYRG API+W +INGE++TGV  M   + +D GD+    +VN++E+ T   L  KM N+  + +   L  +     P   Q+  + S+A  ++K    I+F K+A EI NL+RG++  P AY   ND  MK++K    + KS    GTI ++SK+GI +ST D  +L++E+Q+  K R  V   + GN+ I+ G+ L
  S:     2 KIVFMGTPDIAVPCLQKIIDEKYEILGVVTQPDKPKGRGKKLGMSPVKELAIENNIPVYQPVKARDKEFIDKIKSLNPDVIVVVAFGQILPKEILEIPKLGCINVHVSLLPKYRGAAPINWVIINGEEKTGVTTMYMDEGLDTGDMILKTEVNLDENITAGELHDKMMNIGAETLKETLRLIEEGNAPREVQNHEEFSYAPIMNKSLGNIDFSKSAREIHNLVRGVNPWPSAYTIYNDVIMKVWKTKVLDEKSTKDVGTIIDVSKDGIKVSTIDNVLLIEEIQMPNKKRMLVGEYIKGNT-IETGLVL 308
>gi|126700203|ref|YP_001089100.1| methionyl-tRNA formyltransferase [Clostridium difficile 630] >gi|123363033|sp|Q182S2|FMT_CLOD6 Methionyl-tRNA formyltransferase >gi|115251640|emb|CAJ69473.1| methionyl-tRNA formyltransferase [Clostridium difficile 630] (309 aa)
Score = 586, Expect = 1.3e-58, Identities = 132/306 (43%), Positives = 193/306 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+IA   L  +++++++++ VV QPDKP GR K++  S VK+LAIE NI  +QP K   KE  +++K LNP   V  AFGQ +P  IL IP+ GCIN+H SLLPKYRG API+W +INGE++TGV  M   + +D GD+    +VN++E+ T   L  KM N+  + +   L  +     P   Q+  + S+A  ++K    I+F K+A EI NL+RG++  P AY   ND  MK++K    + KS    GTI ++SK+GI +ST D  +L++E+Q+  K R  V   + GN+ I+ G+ L
  S:     2 KIVFMGTPDIAVPCLQKIIDENYEILGVVTQPDKPKGRGKKLGMSPVKELAIENNIPVYQPVKARDKEFIDKIKSLNPDVIVVVAFGQILPKEILEIPKLGCINVHVSLLPKYRGAAPINWVIINGEEKTGVTTMYMDEGLDTGDMILKTEVNLDENITAGELHDKMMNIGAETLKETLRLIEEGNAPREVQNHEEFSYAPIMNKSLGNIDFSKSAREIHNLVRGVNPWPSAYTTYNDVIMKVWKTKVLDEKSTKDVGTIIDVSKDGIKVSTIDNVLLIEEIQMPNKKRMLVGEYIKGNT-IETGLVL 308
>gi|27467809|ref|NP_764446.1| methionyl-tRNA formyltransferase [Staphylococcus epidermidis ATCC 12228] >gi|33516863|sp|Q8CSW1|FMT_STAES Methionyl-tRNA formyltransferase >gi|27315353|gb|AAO04488.1|AE016746_278 methionyl-tRNA formyltransferase [Staphylococcus epidermidis ATCC 12228] (310 aa)
Score = 585, Expect = 1.5e-58, Identities = 127/306 (41%), Positives = 195/306 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFA--FVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP+ +T  L  L+ +  +V+AVV QPD+P+GRKK +    VK++A +  I  +QP K+K+ +     L+  +   VT AFGQ +P+S+L+ P+ G IN+HASLLPKYRGGAPIH A+I+GE+ETG+ +M  +K++DAG++   + + IEE D   T+  K++ L  +++   L  + +     I QD++  +FA NI ++DE++++  +A  I N IRGLS  P AY  +N+K +KLF A     K  N PGTI   +K  ++I+T   D I + E+Q  GK R +V + L+G  E  +G  L
  S:     3 KIIFMGTPDFSTKILEMLIAEH-EVIAVVTQPDRPVGRKKVMTPPPVKRVATKHQIPVYQPEKLKDSQELESLLSLESDLIVTAAFGQLLPESLLNAPKLGAINVHASLLPKYRGGAPIHQAIIDGEEETGITIMYMVKKLDAGNIISQQSIRIEEEDNVGTMHDKLSFLGAELLKKTLPSIIDNTNDSIPQDDALATFASNIRREDERVDWNMSAQAIHNHIRGLSPWPVAYTTMNEKNLKLFSAFIVKGKKGN-PGTIIETTKHELIIATGSDDAIALTEIQPAGKKRMKVTDYLSGVQESLVGKVL 309
>gi|168716057|ref|ZP_02748334.1| methionyl-tRNA formyltransferase [Clostridium difficile QCD-63q42] >gi|196126730|ref|ZP_03118479.1| methionyl-tRNA formyltransferase [Clostridium difficile ATCC 43255] (309 aa)
Score = 585, Expect = 1.6e-58, Identities = 132/306 (43%), Positives = 192/306 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+IA   L  ++++ ++++ VV QPDKP GR K++  S VK+LAIE NI  +QP K   KE  +++K LNP   V  AFGQ +P  IL IP+ GCIN+H SLLPKYRG API+W +INGE++TGV  M   + +D GD+    +VN++E+ T   L  KM N+  + +   L  +     P   Q+  + S+A  ++K    I+F K+A EI NL+RG++  P AY   ND  MK++K    + KS    GTI ++SK+GI +ST D  +L++E+Q+  K R  V   + GN+ I+ G+ L
  S:     2 KIVFMGTPDIAVPCLQKIIDEKYEILGVVTQPDKPKGRGKKLGMSPVKELAIENNIPVYQPVKARDKEFIDKIKSLNPDVIVVVAFGQILPKEILEIPKLGCINVHVSLLPKYRGAAPINWVIINGEEKTGVTTMYMDEGLDTGDMILKTEVNLDENITAGELHDKMMNIGAETLKETLRLIEEGNAPREVQNHEEFSYAPIMNKSLGNIDFSKSAREIHNLVRGVNPWPSAYTTYNDVIMKVWKTKVLDEKSTKDVGTIIDVSKDGIKVSTIDNVLLIEEIQMPNKKRMLVGEYIKGNT-IETGLVL 308
>gi|73662865|ref|YP_301646.1| methionyl-tRNA formyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|72495380|dbj|BAE18701.1| methionyl-tRNA formyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (312 aa)
Score = 585, Expect = 1.7e-58, Identities = 125/306 (40%), Positives = 195/306 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI---KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K++FMGTP+ +T  L  L+ +  DV+AVV QPD+P+GRK+ +    VK++AI+  +  +QP K+    E+E +L +L     VT AFGQ +P+S+L+ P+ G IN+HASLLPKYRGGAPIH A+++G+ ETG+ +M  +K++DAGD+   + + IE  D   T+  K++ L  +++   L  + N     I Q+ES+ SFA NIS++ EKI++ ++A  I N IRGLS  P AY  ++D  MK++ +     K+   PGTI   +K+ I+++T   D I + ++Q+ GK R    N L+G     +G  L
  S:     5 KVIFMGTPDFSTKVLEMLIAEH-DVIAVVTQPDRPVGRKRVLTPPPVKEVAIKHGLPVYQPEKLAQSSELE-QLIDLEADLIVTAAFGQILPESLLNAPKLGAINVHASLLPKYRGGAPIHQAIMDGQTETGISIMYMVKKLDAGDIISQQAIEIEHQDDVGTMHDKLSFLGAELLKETLPSIINGTNNRITQNESEASFATNISREQEKIDWYQSAEVIYNHIRGLSPWPVAYTVMDDGNMKVYASRIEKGKTGE-PGTIIETTKKAIIVATGSDDAIALTDIQVAGKKRMLTANYLSGVQTSLVGKVL 311
>gi|163762466|ref|ZP_02169531.1| sigma-70 region 2 domain protein [Bacillus selenitireducens MLS10] >gi|160357205|gb|EDP83853.1| sigma-70 region 2 domain protein [Bacillus selenitireducens MLS10] (317 aa)
Score = 584, Expect = 1.9e-58, Identities = 116/296 (39%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI---KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  L E  +DVV VV QPD+P GRKK++    VK  A ++ +  +QP KI   KE E+ L   +    VT A+GQ +P  IL     GCIN+HASLLP+YRGGAPIH AVI+G+ +TG+ +M  ++++DAGD+   R+  I + DTT T+  +++ +  +++L  + ++   E  P +QDE KV+FA NI K+ E+++F ++A  + N IRGL+  P A+  ++ K++KL+ +V     +  APG I  +SK G+ ++  +  I+ + ++Q +GK   +    L G
  S:     2 KVIFMGTPDFSVPVLEGLCESGYDVVMVVTQPDRPKGRKKQLTPPPVKVAAEKRGLSVYQPEKIRDPKEAEHVLAA-DADLLVTAAYGQILPKEILESTRLGCINVHASLLPEYRGGAPIHQAVIDGKNKTGITIMYMVEKLDAGDILTQRETPITDEDTTGTMHDRLSRIGAELLLETIPRLAAGELSPRRQDEEKVTFASNIKKEQERVDFSQSARAVFNHIRGLNPWPVAHTLLDGKRLKLWDSVEVEEHTAAAPGEIVALSKSGVDVACGNRSIIRLTKLQPQGKKPMDAATFLQG 300
>gi|168186791|ref|ZP_02621426.1| methionyl-tRNA formyltransferase [Clostridium botulinum C str. Eklund] >gi|169295199|gb|EDS77332.1| methionyl-tRNA formyltransferase [Clostridium botulinum C str. Eklund] (309 aa)
Score = 584, Expect = 2.2e-58, Identities = 123/298 (41%), Positives = 190/298 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           KIVFMGTPE A  AL +++E +F+V  V  QPD+P GR K++  S VK++A+E NI+ +QP  ++   +   +LK + P   +  A+GQ +P  +L IP++ CIN+HASLLPKYRG AP++WA+INGEK++G   M     +D GD+  +++V+I +  T   L   +     D++++ + K+ + E  PIKQD+SK  +A  + K+   I++ K+  EI NLIRGL+  P AY   NDK MK++K+   N  S   PGT+ ++S EGI ++     +LV+E+Q  GK   +V+  + GNS
  S:     2 KIVFMGTPEFAVPALKSMIE-NFNVEGVFTQPDRPKGRGKKLAMSPVKEVALENNIEVYQPINLRKEPDFIEKLKRIQPDFIIVVAYGQILPKEVLEIPKYACINLHASLLPKYRGAAPLNWAIINGEKKSGNTTMLMDVGLDTGDMLMTQEVDINDDMTAGELHDLLMTQGGDLLVDTINKMVSGEITPIKQDDSKTCYASMLDKEMACIDWNKSVTEIHNLIRGLNPWPVAYTHYNDKVMKIYKSRVLNENSKKTPGTVIDVSSEGIKVACNGGVLLVEEIQFPGKKSLKVEQYIRGNS 301
>gi|171778150|ref|ZP_02919407.1| hypothetical protein STRINF_00243 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283132|gb|EDT48556.1| hypothetical protein STRINF_00243 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (311 aa)
Score = 583, Expect = 2.6e-58, Identities = 122/296 (41%), Positives = 187/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ A   L  LL+ + +DV+AVV QPD+ +GRKKEI  + VK++A+  N+  +QP K+   +   +L  L     VT AFGQF+P  +L   +F  +N+HASLLPKYRGGAPIH+A+ING+KE GV +M  +K+MDAGD+       I + D   T+F+K+  +  D++L  L         P  QDESK +F+ NI+ ++E+I++ K+A E+ N IRGL   P A+  ++ K+ K+++A  + ++    PG I    K+ ++++T D  I +K VQ  GK R  + + LNG
  S:     3 KLIFMGTPDFAATVLEGLLDDANYDVLAVVTQPDRAVGRKKEIKMTPVKEVALAHNLPVYQPEKMSGSDEMAKLMTLGADGIVTAAFGQFLPTKLLDSVDFA-VNVHASLLPKYRGGAPIHYAIINGDKEAGVTIMEMVKKMDAGDMIAKASTPITDEDNVGTMFEKLAVIGRDLLLKTLPDYIAGNIKPELQDESKATFSPNITSEEERIDWNKSAREVFNHIRGLYPWPVAHTLLDGKRFKIYEA--SLAEGQGQPGQIIEKGKKTLVVATGDGAISLKTVQPAGKPRMSIVDFLNG 298
>gi|15615071|ref|NP_243374.1| methionyl-tRNA formyltransferase [Bacillus halodurans C-125] >gi|20138134|sp|Q9K9Y6|FMT_BACHD Methionyl-tRNA formyltransferase >gi|10175128|dbj|BAB06227.1| methionyl-tRNA formyltransferase [Bacillus halodurans C-125] (317 aa)
Score = 583, Expect = 3.1e-58, Identities = 125/306 (40%), Positives = 183/306 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKEL---NPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG-NSEIKIGVTL 317
           KIVFMGTP+ +   L  L+E  + + AVV QPD+P+GRK+ +    VK  A +  I   QP KI++ E EL+ L    P   VT AFGQ +P+++L  P+ GCIN+HASLLPKYRGGAPIH A+I+GEKETG+ +M   +++DAGD+     V I + D   +L  K++     ++   +  +   E   I QD+   +FA NI+++ E+I++ K    I N IRGL   P AY   N K MK++ A   +S    APGT+  + + G L++T D   L V ++Q  GK R   ++ L G  S++ +G  L
  S:     2 KIVFMGTPDFSVPVLRRLIEDGYTIAAVVTQPDRPVGRKRVLTPPPVKVEAEKHQIPVLQPEKIRD-EAELERLFSFEPDLIVTAAFGQILPNALLEYPKHGCINVHASLLPKYRGGAPIHQAIIDGEKETGITIMYMAEKLDAGDILTQVTVPIADDDHVGSLHNKLSEAGAALLAKTIPPLIKGELQSIPQDDQLATFAPNITREKEEIDWRKEGERIYNQIRGLHPWPVAYTLWNGKPMKIWWAEKVSSPKKEAPGTVIALEENGFLVATGDETALKVTDLQPAGKKRMLARDFLRGAGSQLSVGSVL 311
>gi|70726700|ref|YP_253614.1| methionyl-tRNA formyltransferase [Staphylococcus haemolyticus JCSC1435] >gi|68447424|dbj|BAE05008.1| methionyl-tRNA formyltransferase [Staphylococcus haemolyticus JCSC1435] (312 aa)
Score = 581, Expect = 4.7e-58, Identities = 129/310 (41%), Positives = 201/310 (64%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           K  K++FMGTP+ +T  L  L+E+  DV+AVV QPD+P+GRK+ +    VK++A E N+  FQP K+ + +   +L +L P   VT AFGQ +PD +L +P+ G IN+HASLLPKYRGGAPIH A+I+GE +TG+ +M  +K++DAG++   + +NIE++D   T+  K++ L  +++   L  + N     I QD+++ +FA NIS++DE+I++  NA +I N IRGLS  P  Y  ++D  +KL+ A   ++K    PG I   +K+ I+++T   D I + ++Q+ GK R    N L+G  E  +G  LK
  S:     2 KMTKVIFMGTPDFSTKVLEMLIEEH-DVIAVVTQPDRPVGRKRVLTPPPVKRVAEEHNLPVFQPEKLAQSDELAQLLQLEPDLIVTAAFGQLLPDQLLQLPKLGAINVHASLLPKYRGGAPIHQAIIDGEAQTGITIMYMVKKLDAGNIISQKAINIEDNDDVGTMHDKLSVLGANLLKETLPSIVNGTNDSISQDDTQATFASNISREDERIDWTMNAKDIHNHIRGLSPWPVGYTTMDDTNLKLYAAHIVHNKKGQ-PGEIVETTKKAIIVATGSDDAIALTDIQLAGKKRMLASNYLSGVQESLVGKILK 312
>gi|55821414|ref|YP_139856.1| methionyl-tRNA formyltransferase [Streptococcus thermophilus LMG 18311] >gi|55823339|ref|YP_141780.1| methionyl-tRNA formyltransferase [Streptococcus thermophilus CNRZ1066] >gi|73919419|sp|Q5LYX4|FMT_STRT1 Methionyl-tRNA formyltransferase >gi|73919420|sp|Q5M3I7|FMT_STRT2 Methionyl-tRNA formyltransferase >gi|55737399|gb|AAV61041.1| methionyl tRNA formyltransferase [Streptococcus thermophilus LMG 18311] >gi|55739324|gb|AAV62965.1| methionyl-tRNA formyltransferase [Streptococcus thermophilus CNRZ1066] (311 aa)
Score = 580, Expect = 6.1e-58, Identities = 119/296 (40%), Positives = 184/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KI+FMGTP  +   L  LL ++ +D+VAVV QPD+ +GRKKEI  + VK+LA+   +  +QP K+   E   +L  L     VT A+GQF+P  +L   +F  +N+HASLLPKYRGGAPIH+A+ING+ E GV +M  +K+MDAGD+   + + I + D   T+F+K+  L  D++L  L      E  P+ QD S+V+F+ NIS ++E++++ K+  +I N IRG+   P A+  +N K+ K+++      +     G I   +K+ ++++T    I +K VQ EGK R  + + LNG
  S:     3 KIIFMGTPAFSATVLEGLLTDERYDIVAVVTQPDRAVGRKKEIRMTPVKELALAHELPIYQPEKLSGSEEMAQLISLGADGIVTAAYGQFLPSKLLDSMDFA-VNVHASLLPKYRGGAPIHYAIINGDAEAGVTIMEMVKEMDAGDMVSQKALPILDQDNVGTMFEKLAVLGRDLLLETLPAYIAGEIKPVPQDASQVTFSPNISPEEERLDWNKSGRDIFNQIRGMYPWPVAHTLLNGKRFKIYEGDLVEGQGQ--AGHIIEKTKKSLVVATGQGAISLKSVQPEGKPRMAIADFLNG 298
>gi|116873258|ref|YP_850039.1| methionyl-tRNA formyltransferase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123458548|sp|A0AJS8|FMT_LISW6 Methionyl-tRNA formyltransferase >gi|116742136|emb|CAK21260.1| fmt [Listeria welshimeri serovar 6b str. SLCC5334] (312 aa)
Score = 579, Expect = 8.7e-58, Identities = 123/296 (41%), Positives = 187/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTP  +   L  L   ++DV+AVV QPD+P+GRK+ +    VKK A+E  I  FQP K++     NEL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I E+D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ +    I N IRGLS  P AY  + +K  K+++A   ++K    PGTI  + K  + I   D  ++V  V Q  GK + +V + ++G
  S:     3 KIIFMGTPAFSVPILEQL-ASTYDVIAVVTQPDRPVGRKRILTPPPVKKAALELAIPVFQPEKLRTSSELNELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITEADNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIAQDPEKVTFARNISREQEKIDWTQPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYDDTKVEGEPGTI-LMDKTSLKIIAGDGTLIVPTVIQPAGKPKMDVHSFMSG 299
>gi|42519412|ref|NP_965342.1| methionyl-tRNA formyltransferase [Lactobacillus johnsonii NCC 533] >gi|73919399|sp|Q74IM9|FMT_LACJO Methionyl-tRNA formyltransferase >gi|41583700|gb|AAS09308.1| methionyl-tRNA formyltransferase [Lactobacillus johnsonii NCC 533] (314 aa)
Score = 579, Expect = 8.9e-58, Identities = 123/302 (40%), Positives = 185/302 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN-SEIKIG 314
           ++F+GTP   +  L  L+E+ +++ AVV QPDK +GRK+ +  S+VK+ A++ N+  +QP K+   E   EL ++ P   +T A+GQF+P   L   +   +N+H SLLPKYRGGAPI ++V+NG+KETGV +M  +K+MDAGD++  + + I + DT+ TLF K++ L  D++L  L K  +       QDE KV F+ NISKD EKIN    A E  NLIR L+  PGAY  +  K+ K++KA     K++   GT+    K+ ++       + + EVQ  GK +  +K+ LNG  S   IG
  S:     4 VIFLGTPNFGSVVLQGLIEQGYEIKAVVTQPDKRVGRKQVVHQSAVKETALKHNLPVYQPAKLSGSEELAELMKIEPDFIITAAYGQFLPTKFLKSAKVAPVNVHGSLLPKYRGGAPIQYSVLNGDKETGVTIMEMVKKMDAGDIFAQKALPITDEDTSGTLFDKLSILGRDLLLETLPKFIDGTVTRTAQDEDKVVFSPNISKDQEKINLSMTAKEANNLIRALNPDPGAYFMLGGKRFKVWKAKPLTEKTSFPAGTLVTNKKKFVISMADGSQLELLEVQPTGKKKMNIKDYLNGQGSHFTIG 308
>gi|16801003|ref|NP_471271.1| hypothetical protein lin1937 [Listeria innocua Clip11262] >gi|21542049|sp|Q92AI5|FMT_LISIN Methionyl-tRNA formyltransferase >gi|16414438|emb|CAC97167.1| fmt [Listeria innocua] (312 aa)
Score = 577, Expect = 1.3e-57, Identities = 122/296 (41%), Positives = 189/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTP  +   L  L   ++DV+AVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+++L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I E D T T+F K++ L  +++++ L      +   + QD  KV+FA NIS++ EKIN+ K    I N IRGLS  P AY  + +K  K+++A   ++K++  PGTI    K  + I   D  ++V  V Q  GK + ++ + ++G
  S:     3 KIIFMGTPAFSVPVLEQL-ASAYDVIAVVTQPDRPVGRKRILTPPPVKKAALELGIPVYQPEKLRTSSELE-ELISLEADLLVTAAYGQILPNTLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITEEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAVAQDPEKVTFARNISREQEKINWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATFEDTKTSGEPGTILT-DKSTLKIVAGDGTLIVPTVIQPAGKPKMDIHSFMSG 299
>gi|118443626|ref|YP_878317.1| methionyl-tRNA formyltransferase [Clostridium novyi NT] >gi|166214889|sp|A0Q115|FMT_CLONN Methionyl-tRNA formyltransferase >gi|118134082|gb|ABK61126.1| methionyl-tRNA formyltransferase [Clostridium novyi NT] (309 aa)
Score = 576, Expect = 1.6e-57, Identities = 128/307 (41%), Positives = 196/307 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTPE A  +L A++E +F+V  V  QPD+P GR K++  S VK++A+E NI  +QP  ++   E   +LK + P   +  A+GQ +P  +L IP++ CIN+HASLLPKYRG AP++WA+INGEK++G   M     +D GD+  +++V+I +S T   L   +     D++++ + K+ + E  PIKQD+SK  +A  + K    I++ K+A EI NLIRGL+  P AY   +DK MK++K+   N  S   PGT+ N+S +GI ++  +  ++V+E+Q  GK   +V+  + GNS I+I   LK
  S:     2 KIVFMGTPEFAVPSLKAMVE-NFNVEGVFTQPDRPKGRGKKLAMSPVKEVALENNIDVYQPVSLRKEPEFIEKLKNIQPDFIIVVAYGQILPKEVLEIPKYACINLHASLLPKYRGAAPLNWAIINGEKKSGNTTMLMDVGLDTGDMLMTQEVDINDSMTAGELHDILMIQGGDLLVDTINKMVSGEITPIKQDDSKTCYASMLDKKMACIDWSKSASEIHNLIRGLNPWPVAYTHYDDKVMKIYKSHVLNENSKKEPGTVINVSNKGIKVACGEGILVVEEIQFPGKKPLKVEQYIRGNS-IEIESVLK 309
>gi|89098705|ref|ZP_01171587.1| methionyl-tRNA formyltransferase [Bacillus sp. NRRL B-14911] >gi|89086667|gb|EAR65786.1| methionyl-tRNA formyltransferase [Bacillus sp. NRRL B-14911] (318 aa)
Score = 575, Expect = 2.1e-57, Identities = 116/306 (37%), Positives = 190/306 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKE---LNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNG-NSEIKIGVTL 317
           KIVFMGTP+ +   L  L+ + ++V+A V QPD+P+GRK+ +    VK  A+++ I  +QP KI+ ++ EL++   L P   VT AFGQ +P  +L  P++GCIN+HASLLP+ RGGAPIH+++I G+++TG+ +M   +++DAGD+    +V I+E DT  +LF K++     ++   L K+   E  PI Q++ + +FAYNI ++ E++++ K   EI N IRG++  P A+  ++   +KL+ +     K    PGT+  I K+G + +  +   I + E+Q  GK +   +  L G  S + IG  L
  S:     3 KIVFMGTPDFSVPILKQLISEGYNVIAAVTQPDRPVGRKRVLTPPPVKAEAVKQGIPVYQPEKIR-VKEELEKILALEPDLIVTAAFGQILPKELLDYPKYGCINVHASLLPELRGGAPIHYSIIQGKEKTGITIMYMAEKLDAGDILTQAEVKIDEQDTAGSLFDKLSAAGAALLSETLPKLLKGELEPIPQNDEEATFAYNIKREQEQVDWTKTGEEIYNHIRGMNPWPVAFTTLDGSVVKLWSSAKVGLKEKALPGTVVGIEKDGFIAAAGNMTGIKITELQPAGKKKMSGEQFLRGAGSSLSIGTVL 312
>gi|24378966|ref|NP_720921.1| methionyl-tRNA formyltransferase [Streptococcus mutans UA159] >gi|24376855|gb|AAN58227.1|AE014894_4 putative methionyl-tRNA formyltransferase [Streptococcus mutans UA159] (315 aa)
Score = 575, Expect = 2.6e-57, Identities = 120/303 (39%), Positives = 191/303 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIG 314
           K++FMGTP+ +   L  LLE S + V+AVV QPD+ +GRKKEI  + VK+LA+E  +K +QP K+       EL  L     VT AFGQF+P  +++  +F  +N+HASLLPKYRGGAPIH+A+ING+K+ GV +M  +K+MDAGD+       I ++D   T+F+K+  +  D++L  L    + +  P  QD+S+ +F+ NIS  +EKI++ K+A +I N +RG++  P A+  ++ K+ K++     N   N  PG I   +K+ ++++     + +K VQ  GK +  + + LNG   ++K+G
  S:     7 KLIFMGTPDFSATVLKGLLEDSHYHVLAVVTQPDRAVGRKKEIKMTPVKQLALEHGLKVYQPEKLSGSSEMVELMNLGADGIVTAAFGQFLPMILINSVDFA-VNVHASLLPKYRGGAPIHYAIINGDKKAGVTIMEMVKEMDAGDMIAKASTPITDADDVGTMFEKLAIIGRDLLLQTLPGYLSGKIEPQAQDDSQATFSPNISSQEEKIDWSKSARDIFNQVRGMNPWPVAHTLLDGKRFKIYAVEVVNGAGN--PGEIIEKTKKALIVAANQDALSLKLVQPAGKPKMSITDFLNGLGQKLKVG 310
>gi|125718646|ref|YP_001035779.1| methionyl-tRNA formyltransferase [Streptococcus sanguinis SK36] >gi|166215520|sp|A3CPX4|FMT_STRSV Methionyl-tRNA formyltransferase >gi|125498563|gb|ABN45229.1| Methionyl-tRNA formyltransferase, putative [Streptococcus sanguinis SK36] (311 aa)
Score = 574, Expect = 2.8e-57, Identities = 119/296 (40%), Positives = 189/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KI+FMGTP+ +   L  LL+   ++V+AVV QPD+ +GRK+EI  + VK+LA+E  +  +QP K+ +  +  EL  L     VT AFGQF+P  +L   +F  +N+HASLLPKYRGGAPIH+A+ING+++ GV +M  +K+MDAGD+  S+   IEE+D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NIS ++E+I++ K   +I N IRG+   P A+  +  ++ K+++A       +  PG I +ISK+ ++++     + +K VQ  GK +  + + LNG
  S:     3 KIIFMGTPDFSATVLKGLLDSGQYEVLAVVTQPDRAVGRKREIRMTPVKELALEYKLPVYQPEKLAKSSDLEELMNLEADGIVTAAFGQFLPSCLLDSVDFA-VNVHASLLPKYRGGAPIHYALINGDEQAGVTIMEMVKEMDAGDMIASKATPIEETDNVGTLFEKLALIGRDLLLDVLPAYRAGQIIPQPQDPSQVTFSPNISPEEERIDWSKTNRQIFNQIRGMYPWPVAHTLLQGQRFKIYEA--DMMAGSGQPGQILSISKKELVVAAGKGALSLKTVQPAGKPKMAIVDFLNG 298
>gi|33516865|sp|Q8DVK4|FMT_STRMU Methionyl-tRNA formyltransferase (311 aa)
Score = 573, Expect = 4.1e-57, Identities = 120/303 (39%), Positives = 191/303 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIG 314
           K++FMGTP+ +   L  LLE S + V+AVV QPD+ +GRKKEI  + VK+LA+E  +K +QP K+       EL  L     VT AFGQF+P  +++  +F  +N+HASLLPKYRGGAPIH+A+ING+K+ GV +M  +K+MDAGD+       I ++D   T+F+K+  +  D++L  L    + +  P  QD+S+ +F+ NIS  +EKI++ K+A +I N +RG++  P A+  ++ K+ K++     N   N  PG I   +K+ ++++     + +K VQ  GK +  + + LNG   ++K+G
  S:     3 KLIFMGTPDFSATVLKGLLEDSHYHVLAVVTQPDRAVGRKKEIKMTPVKQLALEHGLKVYQPEKLSGSSEMVELMNLGADGIVTAAFGQFLPMILINSVDFA-VNVHASLLPKYRGGAPIHYAIINGDKKAGVTIMEMVKEMDAGDMIAKASTPITDADDVGTMFEKLAIIGRDLLLQTLPGYLSGKIEPQAQDDSQATFSPNISSQEEKIDWSKSARDIFNQVRGMNPWPVAHTLLDGKRFKIYAVEVVNGAGN--PGEIIEKTKKALIVAANQDALSLKLVQPAGKPKMSITDFLNGLGQKLKVG 306
>gi|46908055|ref|YP_014444.1| methionyl-tRNA formyltransferase [Listeria monocytogenes str. 4b F2365] >gi|67460685|sp|Q71YJ3|FMT_LISMF Methionyl-tRNA formyltransferase >gi|46881325|gb|AAT04621.1| methionyl-tRNA formyltransferase [Listeria monocytogenes str. 4b F2365] (312 aa)
Score = 573, Expect = 4.2e-57, Identities = 124/296 (41%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K+++A    +K +  PG I    K  + I   D  ++V  V Q  GK + +V + + G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEETKEDGEPGAI-LADKTTLKIVAGDGTLIVPTVIQPAGKPKMDVHSFMTG 299
>gi|168266234|ref|ZP_02688199.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL J2-071] (312 aa)
Score = 572, Expect = 5.2e-57, Identities = 123/296 (41%), Positives = 187/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K+++A    +K +  PG I    K  + I   D  ++V  V Q  GK + ++ + ++G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEETKGSGEPGAI-LADKTTLKIVAGDGTLIVPTVIQPAGKPKMDIHSFMSG 299
>gi|167941786|ref|ZP_02528861.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 8] >gi|167942055|ref|ZP_02529130.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 8] >gi|167959893|ref|ZP_02546962.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|167972905|ref|ZP_02555182.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|167973767|ref|ZP_02556044.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|167975764|ref|ZP_02558041.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|167987952|ref|ZP_02569623.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|168338247|ref|ZP_02694862.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 10] >gi|168362883|ref|ZP_02696057.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|168808470|ref|ZP_02829529.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 2] >gi|195867792|ref|ZP_03079792.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903067|gb|EDT49356.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209275|gb|EDU06318.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188019097|gb|EDU57137.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998082|gb|EDU67179.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659762|gb|EDX53142.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660489|gb|EDX53746.1| methionyl-tRNA formyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (305 aa)
Score = 572, Expect = 5.9e-57, Identities = 125/297 (42%), Positives = 182/297 (61%)
  Q:    13 IVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           ++F GTPEIA   L  L      +++ VV QPD    RKK +++S VK+  ++ +IK FQP KIKEIE E++ L P   +TCAFGQFI   I+ IP++  +N+HASLLPK RGGAPIH+A++NG+ +TG+ LM TIK+MDAG++   R + I E  TT  L  ++ NL   ++     ++   +   I+QDE+ VSFAYNI K+   I+F K A  +   +  + + P A    ND  +K+ +   TN KS   PGTI  ISK  I +ST+DF++ +  +Q+  K     K +LNG +
  S:     5 VMFFGTPEIAKIVLETLFNMPEVNLIGVVSQPDSHFDRKKNVVYSPVKQFCLDHDIKLFQPQKIKEIEEEIRSLAPDIIITCAFGQFINQGIIDIPKYKIVNVHASLLPKLRGGAPIHYAILNGDLQTGITLMHTIKKMDAGNILFQRSLAINEQTTTKILTLELANLGALMIKEHFLELVKSDLVGIQQDENDVSFAYNIQKNQNIIDFNKPAFFVNRFVNAMYDKPIAIMEYNDVLIKVHQIKITNQKSTQKPGTI-AISKHQIFVSTQDFNVELLLIQLPNKKPLAPKALLNGKN 301
>gi|153202820|ref|ZP_01944258.1| methionyl-tRNA formyltransferase [Listeria monocytogenes HPB2262] >gi|133734890|gb|EBA36588.1| methionyl-tRNA formyltransferase [Listeria monocytogenes HPB2262] (312 aa)
Score = 571, Expect = 6.3e-57, Identities = 124/296 (41%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K+++A    +K    PG I    K  + I   D  ++V  V Q  GK + +V + + G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEETKEGGEPGAI-LADKTTLKIVAGDGTLIVPTVIQPAGKPKMDVHSFMTG 299
>gi|47096544|ref|ZP_00234134.1| methionyl-tRNA formyltransferase [Listeria monocytogenes str. 1/2a F6854] >gi|153179860|ref|ZP_01933033.1| methionyl-tRNA formyltransferase [Listeria monocytogenes F6900] >gi|153183314|ref|ZP_01934174.1| methionyl-tRNA formyltransferase [Listeria monocytogenes J0161] >gi|153191331|ref|ZP_01938551.1| methionyl-tRNA formyltransferase [Listeria monocytogenes J2818] >gi|47015076|gb|EAL06019.1| methionyl-tRNA formyltransferase [Listeria monocytogenes str. 1/2a F6854] >gi|126943605|gb|EBA21322.1| methionyl-tRNA formyltransferase [Listeria monocytogenes J0161] >gi|127765110|gb|EBA25460.1| methionyl-tRNA formyltransferase [Listeria monocytogenes J2818] >gi|133732504|gb|EBA34202.1| methionyl-tRNA formyltransferase [Listeria monocytogenes F6900] (312 aa)
Score = 571, Expect = 7.5e-57, Identities = 124/296 (41%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGIL-ISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   R++ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K+++A   ++K    PG I  ++ + IL I   D  ++V  V Q  GK + +V + ++G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQREIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEDTKEGGEPGAI--LADKTILKIVAGDGTLIVPTVIQPAGKPKMDVHSFMSG 299
>gi|172057935|ref|YP_001814395.1| methionyl-tRNA formyltransferase [Exiguobacterium sibiricum 255-15] >gi|171990456|gb|ACB61378.1| methionyl-tRNA formyltransferase [Exiguobacterium sibiricum 255-15] (461 aa)
Score = 570, Expect = 8.2e-57, Identities = 114/296 (38%), Positives = 182/296 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG 307
           ++VFMGTPE A   L  +++  ++VV VV QPDKP+GRK+EI  + VK++A+  +I   QP KI+E    L +L P   +T A+GQ +P ++L  P++G IN+HASLLPKYRGGAPIH A+I+GE ETGV +M  + ++DAGD+     V IEE DT  T+F K++     +++  L ++      P  Q E  V+F+ NIS++ E+++F ++  E+ N IRG++  P AY  +   ++K++ A     +   + G I  +  +G +++T  D  + + +VQ  GK R +    + G
  S:   152 RVVFMGTPEFAANTLREVIDAGYNVVGVVSQPDKPVGRKREIKPTPVKEVALAHDIPVLQPAKIREDYQGLLDLKPDLIITAAYGQIVPMAVLEAPQYGAINVHASLLPKYRGGAPIHQAIIDGETETGVTIMYMVDKLDAGDMLSKIIVPIEERDTVGTMFDKLSAAGAKLLIETLPQLIAGTSTPEAQREEDVTFSPNISRERERLDFSRSGEELYNQIRGMNPFPSAYTLLGSDRLKVYFAEKVPGRG--SAGEIIALEADGPVVATGSDTALKLVDVQPAGKKRMDGATFMRG 446
>gi|39995241|ref|NP_951192.1| methionyl-tRNA formyltransferase [Geobacter sulfurreducens PCA] >gi|73919395|sp|Q74GW4|FMT_GEOSL Methionyl-tRNA formyltransferase >gi|39982003|gb|AAR33465.1| methionyl-tRNA formyltransferase [Geobacter sulfurreducens PCA] (317 aa)
Score = 570, Expect = 9.7e-57, Identities = 112/296 (37%), Positives = 175/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+FMGTPE A   L  L+E+  +V+AVV QPD+P GR ++++   VK LA E +I   QP K++  E  +E++ L P   V  AFGQ +P S+L IP+ GCINIHASLLP+YRG AP++W +INGE ETG+  M     +D GD+   R + I   +   +L  +++ L  + +   L+ +   +    KQD+S   +A  + K+D  +++ +  V++ N +RG +  PGAY F++ K +KL++           PG I  + +EGIL+      IL++E+Q+EG+ R      L G
  S:     5 RIIFMGTPEFACPTLRKLIERGEEVIAVVTQPDRPKGRGQKLVPPPVKALAQEHDIPVLQPLKVRTPESVDEIRRLAPDLIVVVAFGQILPQSLLDIPKHGCINIHASLLPRYRGAAPLNWCLINGETETGITTMMMDAGLDTGDMLVKRAIPIGPDEDAQSLHDRLSQLGAETIDETLDLLLAGKLVREKQDDSLTCYAPMLKKEDGLVDWTREPVQVKNQVRGFTPWPGAYTFLDGKTLKLYRVAVAGETGE--PGEILRVGREGILVGCGSGSILIQELQLEGRKRLPTAEFLAG 300
>gi|167404757|ref|ZP_02309535.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL J2-003] (312 aa)
Score = 569, Expect = 1.2e-56, Identities = 124/296 (41%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGIL-ISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I Q+  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K+++A   ++K    PG I  ++ + IL I   D  ++V  V Q  GK + +V + ++G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQNPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEDTKEGGEPGAI--LADKTILKIVAGDGTLIVPTVIQPAGKPKMDVHSFMSG 299
>gi|118726734|ref|ZP_01575353.1| methionyl-tRNA formyltransferase [Clostridium cellulolyticum H10] >gi|118663900|gb|EAV70542.1| methionyl-tRNA formyltransferase [Clostridium cellulolyticum H10] (312 aa)
Score = 569, Expect = 1.2e-56, Identities = 118/297 (39%), Positives = 181/297 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           KI+FMGTPE A  +L  L+ + ++V+AVV QPDKP GR K++    VK+ A+E  IK  QP KIK  E   +++EL P   +T A+G+ I   +L +P  GCIN+H SLLP YRG APIHW++INGEK TG+  M T   +D GD+   R++ I    T   L  +M  L  +++ + L  + N       QD++  S+A  I+K+   I++ K   ++ NL+RG +  PGA+ FIN+ KM+++K   V   +   + PG I ++  +GIL+   D  I++KE+Q +   R +V++ + GN
  S:     2 KIIFMGTPEFAVPSLEMLINEGYNVIAVVTQPDKPKGRGKKLAAPPVKEFALEHGIKVLQPAKIKTPEFVEQIRELGPDLLITAAYGKIISKDMLDVPPLGCINVHGSLLPAYRGAAPIHWSIINGEKVTGITTMFTDVGLDTGDMLLKRELEISSDMTAGELHDEMAILGAEVLKDTLIHLKNGTLVRSPQDDALSSYAPIITKEVGLIDWNKTVQQVHNLVRGTNPWPGAFTFINESKMRVWKTCIVDFGNSQEHCPGEIVSVDDKGILVKCCDGYIMIKELQFDSSKRMKVRDYIRGN 302
>gi|163941604|ref|YP_001646488.1| methionyl-tRNA formyltransferase [Bacillus weihenstephanensis KBAB4] >gi|163863801|gb|ABY44860.1| methionyl-tRNA formyltransferase [Bacillus weihenstephanensis KBAB4] (314 aa)
Score = 568, Expect = 1.4e-56, Identities = 120/306 (39%), Positives = 189/306 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  +DVV VV QPD+P+GRKK +  + VK  A +  I   QP KI+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ E++V+FAYNI ++ E I++ K   E+ N IRGL+  P AY  +  + +K++     +      PGTI  + ++G +++T  +  + + E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYDVVGVVTQPDRPVGRKKVLTPTPVKVEAEKHGIPVVQPLKIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQSEAEVTFAYNIKREQEIIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVIKVWWGEKVSITEKAEPGTIVALEEDGFVVATGNETGVKITELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|116628136|ref|YP_820755.1| methionyl-tRNA formyltransferase [Streptococcus thermophilus LMD-9] >gi|116101413|gb|ABJ66559.1| methionyl-tRNA formyltransferase [Streptococcus thermophilus LMD-9] (305 aa)
Score = 568, Expect = 1.4e-56, Identities = 116/292 (39%), Positives = 181/292 (61%)
  Q:    16 MGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           MGTP  +   L  LL ++ +D+VAVV QPD+ +GRKKEI  + VK+LA+   +  +QP K+   E   +L  L     VT A+GQF+P  +L   +F  +N+HASLLPKYRGGAPIH+A+ING+ E GV +M  +K+MDAGD+   + + I + D   T+F+K+  L  D++L  L      E  P+ QD S+V+F+ NIS ++E++++ K+  +I N IRG+   P A+  +N K+ K+++      +     G I   +K+ ++++T    I +K VQ+EGK R  + + LNG
  S:     1 MGTPAFSATVLEGLLTDEHYDIVAVVTQPDRAVGRKKEIRMTPVKELALAHELPIYQPEKLSGSEEMAQLISLGADGIVTAAYGQFLPSKLLDSMDFA-VNVHASLLPKYRGGAPIHYAIINGDAEAGVTIMEMVKEMDAGDMVSQKALPILDQDNVGTMFEKLAVLGRDLLLETLPAYIAGEIKPVPQDASQVTFSPNISPEEERLDWNKSGRDIFNQIRGMYPWPVAHTLLNGKRFKIYEGDLVEGQGQ--AGHIIEKTKKSLVVATGQGAISLKSVQLEGKPRMAIADFLNG 292
>gi|116629418|ref|YP_814590.1| methionyl-tRNA formyltransferase [Lactobacillus gasseri ATCC 33323] >gi|122273644|sp|Q044H0|FMT_LACGA Methionyl-tRNA formyltransferase >gi|116095000|gb|ABJ60152.1| methionyl-tRNA formyltransferase [Lactobacillus gasseri ATCC 33323] (314 aa)
Score = 568, Expect = 1.6e-56, Identities = 117/295 (39%), Positives = 184/295 (62%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++F+GTP   +  L  L+++ +DV AVV QPDK +GRK+ +  S+VK+ A++ N+  +QP K+   +   EL ++ P   VT A+GQF+P   L   +   +N+H SLLPKYRGGAPI ++V+NG+KETGV +M  +K+MDAGD++  + + IE+ DT+ TLF K++ L  D++L  L K  +       Q+E KV F+ NISK+ E+I     A +  NLIR L+  PGAY  ++ K+ K++KA     K++   GT+    K+ ++      ++ + EVQ  GK +  +K+ LNG
  S:     4 VIFLGTPNFGSVVLQGLIDQGYDVKAVVTQPDKRVGRKQVVHQSAVKQTALKHNLPVYQPAKLSGSDELAELMKIEPDFIVTAAYGQFLPTKFLKSAKIAPVNVHGSLLPKYRGGAPIQYSVLNGDKETGVTIMEMVKKMDAGDIFSQKALPIEDDDTSGTLFDKLSILGRDLLLETLPKFIDGTVTRTPQNEDKVVFSPNISKEQEQIKLTMTAEQANNLIRALNPDPGAYVMLDGKRFKIWKAKPLAEKTSFPAGTLVTNKKKFVISMAGGSELELLEVQPTGKKKMNIKDYLNG 300
>gi|121533702|ref|ZP_01665529.1| methionyl-tRNA formyltransferase [Thermosinus carboxydivorans Nor1] >gi|121307693|gb|EAX48608.1| methionyl-tRNA formyltransferase [Thermosinus carboxydivorans Nor1] (313 aa)
Score = 567, Expect = 1.8e-56, Identities = 112/289 (38%), Positives = 175/289 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA-PGTINNISKEGILISTKDFDILVKEVQIEGKNRQE 300
           +++FMGTP+ A   L  LL    D+VAVV QPD+P GR + +  S VK+ AI + +   QP KIK+    N + +L P   V  AFGQ +P  +L +P  GCIN+HASLLP+YRG APIHWA+INGE +TGV  M     MD GD+    +  I   +TT  L  ++  +  ++++  LE +     P I QD S  S+A  +++D E++++ ++A+E+ NL+RGL+  PGAY   + K +K+++    +  + +  PGT+ ++   G++++T    I + EVQ E K R +
  S:     5 RVIFMGTPDFAVPTLEKLLAAKHDIVAVVTQPDRPKGRGQRMAASPVKEFAISQGLPVLQPEKIKDPVFINHMLQLRPDVIVVVAFGQILPQGLLDLPPLGCINVHASLLPRYRGAAPIHWAIINGETKTGVTTMWMDIGMDTGDMILKAETPIGPDETTGELHDRLKWMGAELLVRSLELLMAGNAPRIPQDNSAASYAPLLTRDIEQVDWRRSALEVHNLVRGLNPWPGAYTTHSGKTLKIWRTRIIDGHAGSVPPGTVVDVRHHGVVVATGRGLIQLTEVQPESKKRMQ 296
>gi|47569493|ref|ZP_00240173.1| methionyl-tRNA formyltransferase [Bacillus cereus G9241] >gi|166984842|ref|ZP_02256164.1| methionyl-tRNA formyltransferase [Bacillus cereus AH187] >gi|168162138|ref|ZP_02597371.1| methionyl-tRNA formyltransferase [Bacillus cereus H3081.97] >gi|47553822|gb|EAL12193.1| methionyl-tRNA formyltransferase [Bacillus cereus G9241] (314 aa)
Score = 567, Expect = 2.0e-56, Identities = 120/306 (39%), Positives = 189/306 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  +DV+ VV QPD+P+GRKK +  + VK  A +  I   QP +I+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ+E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++         +   GTI  I ++G +++T  +  + V E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYDVIGVVTQPDRPVGRKKVLTPTPVKVEAEKHGIPVLQPLRIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQNEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPVTKSAEAGTIVAIEEDGFVVATGNETGVKVTELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|16803863|ref|NP_465348.1| hypothetical protein lmo1823 [Listeria monocytogenes EGD-e] >gi|153196332|ref|ZP_01940702.1| methionyl-tRNA formyltransferase [Listeria monocytogenes 10403S] >gi|21542043|sp|Q8Y676|FMT_LISMO Methionyl-tRNA formyltransferase >gi|16411277|emb|CAC99901.1| fmt [Listeria monocytogenes] >gi|127633793|gb|EBA23185.1| methionyl-tRNA formyltransferase [Listeria monocytogenes 10403S] (312 aa)
Score = 567, Expect = 2.2e-56, Identities = 123/296 (41%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +     QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K+++A   ++K    PG I    K  + I   D  ++V  V Q  GK + +V + + G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSILGAELLMDTLPDFLAGKITATPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEDTKEGGEPGAI-LADKTTLKIVAGDGTLIVPTVIQPAGKPKMDVHSFMTG 299
>gi|171326144|ref|ZP_02914634.1| methionyl-tRNA formyltransferase [Geobacillus sp. WCH70] >gi|171087888|gb|EDT34249.1| methionyl-tRNA formyltransferase [Geobacillus sp. WCH70] (318 aa)
Score = 566, Expect = 2.4e-56, Identities = 120/306 (39%), Positives = 184/306 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  +++ AVV QPDKP GRK+E+    VK  A +  I   QP KI+E E   ++    P   VT AFGQ +P ++L  P++GCIN+HASLLP+ RGGAPIH+A++ G+ +TGV +M  ++++DAGD+    +V I E+DT  TL  K++     ++   + ++   +  PIKQD+ K ++AYNI ++ EKI++ K   +I N IRGL   P AY        K++      +     PGTI +I ++GI+++T  +  I + E+Q  GK R      L G  + + IG+ L
  S:     3 KVVFMGTPDFSVPILKQLIEDGYNIAAVVTQPDKPKGRKRELTPPPVKVEAEKHGIPVLQPTKIREKEQYEQVLAFKPDLIVTAAFGQILPKALLDAPKYGCINVHASLLPELRGGAPIHYAILQGKTKTGVTIMYMVEKLDAGDILTQVEVPITETDTVGTLHDKLSIAGAKLLSETIPQLVAGKLTPIKQDDEKATYAYNIKREQEKIDWTKPGEDIYNHIRGLHPWPVAYTTFAGNVWKVWWGEKVPAPKKAEPGTIIDIVQDGIVVATGNETAIKITELQPAGKKRMNAAQFLRGAGAHLTIGMKL 312
>gi|167768545|ref|ZP_02440598.1| hypothetical protein CLOSS21_03104 [Clostridium sp. SS2/1] >gi|167710069|gb|EDS20648.1| hypothetical protein CLOSS21_03104 [Clostridium sp. SS2/1] (309 aa)
Score = 566, Expect = 2.4e-56, Identities = 125/296 (42%), Positives = 194/296 (65%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K VFMGTPE A   L AL++   +V+AVV QPDK  GR K++ F  VK+ A+E +I  +QP + ++ E   ELK LNP   V  A+GQ +P+SIL+IP++GCIN+H SLLPKYRG API WAV++GE++TG+  M   K +D GD+    +V +++ +T  +L  K+  L  D++L  L+K+ +      KQ++ +  +A  +SKD  +I+F K+A EI  LIRG++  P AY  ++ K MK+++A   +++S   PGTI  ++K+ I+++T   D+ + E+Q+ GK R +V+  L G
  S:     2 KAVFMGTPEFAVPTLQALIDHH-EVLAVVTQPDKQRGRGKKMQFPPVKEKAVEYDIPVYQPQRARDEEFIEELKNLNPDVIVVVAYGQILPESILNIPKYGCINVHGSLLPKYRGAAPIQWAVLDGEEKTGITTMYMEKGLDTGDMIDKAEVVLDKKETAGSLHDKLMVLGADLLLETLKKLEDGTAVREKQNDEESCYAKMLSKDMGQIDFTKSAREIECLIRGMNPWPSAYTSLDGKTMKVWEADVLDAQSKEEPGTIVEVNKKEIIVATGSNDLALHEIQLAGKKRMQVQAFLLG 298
>gi|78224530|ref|YP_386277.1| methionyl-tRNA formyltransferase [Geobacter metallireducens GS-15] >gi|123729163|sp|Q39QC2|FMT_GEOMG Methionyl-tRNA formyltransferase >gi|78195785|gb|ABB33552.1| methionyl-tRNA formyltransferase [Geobacter metallireducens GS-15] (311 aa)
Score = 566, Expect = 2.5e-56, Identities = 113/295 (38%), Positives = 181/295 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           I+FMGTP+ A   L  L+E+  DV+AVV QPD+P GR ++++   VK +A E  I   QP K++  E+  +++ELNP   V  AFGQ +P S+L IP  GCINIHASLLP+YRG API+W +INGE ETG+  M+    +D GD+   R ++I   +   +L  +++ L  + +   L+++        KQD++   +A  + K+D  I++++   +I NL+RG +  PGAY  ++ K +KL+K VS  ++    PG I  + K+GI++      + ++E+Q+EG+ R   ++ L G
  S:     6 IIFMGTPDFACPTLTRLIERGEDVIAVVTQPDRPKGRGQKLVPPPVKVIAEEHGIPVLQPQKVRAPEVVAQIRELNPDLIVVVAFGQILPQSLLEIPRHGCINIHASLLPRYRGAAPINWCLINGETETGITTMQMDAGLDTGDMLVKRSISIGPDEDAQSLHDRLSLLGAETIDETLDRLQVGTLTREKQDDALTCYAPMLKKEDGLIDWKQEPQQIKNLVRGFTPWPGAYTTLDGKTLKLYK-VSVATECGK-PGDIMAVGKDGIIVGCGSGSLRIEELQLEGRKRLSAQDFLAG 300
>gi|49478422|ref|YP_037927.1| methionyl-tRNA formyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|73919375|sp|Q6HEU9|FMT_BACHK Methionyl-tRNA formyltransferase >gi|49329978|gb|AAT60624.1| methionyl-tRNA formyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] (314 aa)
Score = 566, Expect = 2.6e-56, Identities = 119/306 (38%), Positives = 190/306 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  +DV+ VV QPD+P+GRKK +  + VK  A + +I   QP +I+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ+E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++         +   GTI  I ++G +++T  +  + + E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYDVIGVVTQPDRPVGRKKVLTPTPVKVEAEKHDIPVLQPLRIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQNEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPVTKSAEAGTIVAIEEDGFVVATGNETGVKITELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|167015002|ref|ZP_02277535.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL J1-194] (312 aa)
Score = 566, Expect = 2.7e-56, Identities = 124/296 (41%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK AIE  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L   + G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K+++A    +K +  PG I    K  + I   D  ++V  V Q  GK + +V + + G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAAIELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESTKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEETKEDGEPGAI-LADKTTLKIVAGDGTLIVPTVIQPAGKPKMDVHSFMTG 299
>gi|28378316|ref|NP_785208.1| methionyl-tRNA formyltransferase [Lactobacillus plantarum WCFS1] >gi|33516859|sp|Q88WL3|FMT_LACPL Methionyl-tRNA formyltransferase >gi|28271151|emb|CAD64056.1| methionyl-tRNA formyltransferase [Lactobacillus plantarum WCFS1] (317 aa)
Score = 566, Expect = 2.8e-56, Identities = 118/298 (39%), Positives = 187/298 (62%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKIN-FEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVS-TNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSE 310
           IVFMGTP  A   L +L+++ + V+ VV QPD+ +GRK  +  S VK++A+  +I  FQP KI    E++ ++ +L P   VT AFGQF+P  +L   + G +N+H SLLPKYRGGAP+ +++INGE ETG+ ++  +K+MDAGD+   R + IE++D T T+F K++ +  D++L  L K+   E   + QDES+V+FA NI  + E ++ F K AVEI N +RG+   P AY  ++ K+ K +      +     APG +   +K  ++I+  D   I + ++Q  GK +  + + LNG ++
  S:     4 IVFMGTPAFAAPILESLIKEQYQVLGVVTQPDRKVGRKHVLTASPVKEVAVAHDIPVFQPEKISGSPEMQ-QIIDLQPDLIVTAAFGQFLPTKLLKAAKIGAVNVHGSLLPKYRGGAPVQYSIINGESETGITIIYMVKKMDAGDMLAQRAIPIEKNDDTGTMFDKLSLVGRDLLLETLPKLIAGEITAVPQDESQVTFAPNIQPEQEVLDFFTKTAVEIDNQVRGMRPAPIAYAVLDGKRTKFWDVTPLADEVVTQAPGQVVRKTKHELVIAAADHTAIAINQLQPAGKPKMTITDYLNGAAD 306
>gi|134299561|ref|YP_001113057.1| methionyl-tRNA formyltransferase [Desulfotomaculum reducens MI-1] >gi|172044290|sp|A4J579|FMT_DESRM Methionyl-tRNA formyltransferase >gi|134052261|gb|ABO50232.1| methionyl-tRNA formyltransferase [Desulfotomaculum reducens MI-1] (317 aa)
Score = 565, Expect = 3.3e-56, Identities = 120/296 (40%), Positives = 177/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPN--KIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA-PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTP+ A  +L AL++    VVAVV QPDKP GR +++    VK LA E  I   QP   KI E +  ++EL P   V  A+G+ +P  IL +P  GCIN+HASLLP YRG APIHWA+INGE+ETGV  M   K MD GD+     V+I  SDT   +  K+ +    +++  +  +     P I Q+    ++A  + K+ E I+++ +A +I N +RG++  PG Y   ++K +K+++      ++ +A PGT+  +S  GIL+ T    IL+KE+Q++G  R EV   L G
  S:     2 RIVFMGTPDFAATSLKALIDAGQQVVAVVTQPDKPKGRGRQVQPPPVKVLANEYKIPVLQPTSIKINEFQQTIEELKPECIVVVAYGKILPTEILELPPKGCINVHASLLPYYRGSAPIHWAIINGEEETGVTTMFMDKGMDTGDMILKSSVSIGPSDTVGAIHDKLASDGAKLLIETIHLLEEDCAPRIPQNHKLATYAPMLRKEHELIHWDLSAKDIHNHVRGMNPWPGTYTIWDNKILKIWQTTIPAHQNIDADPGTVLEVSPSGILVQTAGGQILIKELQLQGSRRMEVTEFLRG 300
>gi|30263869|ref|NP_846246.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. Ames] >gi|47529296|ref|YP_020645.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49186716|ref|YP_029968.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. Sterne] >gi|52141620|ref|YP_085207.1| methionyl-tRNA formyltransferase [Bacillus cereus E33L] >gi|65321193|ref|ZP_00394152.1| COG0223: Methionyl-tRNA formyltransferase [Bacillus anthracis str. A2012] >gi|118479088|ref|YP_896239.1| methionyl-tRNA formyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|165872274|ref|ZP_02216911.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0488] >gi|166995424|ref|ZP_02261884.1| methionyl-tRNA formyltransferase [Bacillus cereus AH820] >gi|167636422|ref|ZP_02394721.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0442] >gi|167641157|ref|ZP_02399412.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0193] >gi|170688854|ref|ZP_02880057.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0465] >gi|170708783|ref|ZP_02899219.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0389] >gi|177654886|ref|ZP_02936603.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0174] >gi|190565782|ref|ZP_03018701.1| methionyl-tRNA formyltransferase [Bacillus anthracis Tsiankovskii-I] >gi|196038628|ref|ZP_03105936.1| methionyl-tRNA formyltransferase [Bacillus cereus NVH0597-99] >gi|196047442|ref|ZP_03114654.1| methionyl-tRNA formyltransferase [Bacillus cereus 03BB108] >gi|81686553|sp|Q636G0|FMT_BACCZ Methionyl-tRNA formyltransferase >gi|166214873|sp|A0RHN9|FMT_BACAH Methionyl-tRNA formyltransferase >gi|33516850|sp|Q81WH2|FMT_BACAN Methionyl-tRNA formyltransferase >gi|30258513|gb|AAP27732.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. Ames] >gi|47504444|gb|AAT33120.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49180643|gb|AAT56019.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. Sterne] >gi|51975089|gb|AAU16639.1| methionyl-tRNA formyltransferase [Bacillus cereus E33L] >gi|118418313|gb|ABK86732.1| methionyl-tRNA formyltransferase [Bacillus thuringiensis str. Al Hakam] >gi|164711950|gb|EDR17490.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0488] >gi|167510937|gb|EDR86328.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0193] >gi|167528164|gb|EDR90951.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0442] >gi|170126268|gb|EDS95159.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0389] >gi|170667209|gb|EDT17969.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0465] >gi|172080397|gb|EDT65484.1| methionyl-tRNA formyltransferase [Bacillus anthracis str. A0174] >gi|190562701|gb|EDV16667.1| methionyl-tRNA formyltransferase [Bacillus anthracis Tsiankovskii-I] >gi|196021750|gb|EDX60445.1| methionyl-tRNA formyltransferase [Bacillus cereus 03BB108] >gi|196030351|gb|EDX68950.1| methionyl-tRNA formyltransferase [Bacillus cereus NVH0597-99] (314 aa)
Score = 565, Expect = 3.3e-56, Identities = 119/306 (38%), Positives = 189/306 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  +DV+ VV QPD+P+GRKK +  + VK  A +  I   QP +I+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ+E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++         +   GTI  I ++G +++T  +  + + E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYDVIGVVTQPDRPVGRKKVLTPTPVKVEAEKHGIPVLQPLRIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQNEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPVTKSAEAGTIVAIEEDGFVVATGNETGVKITELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|52080176|ref|YP_078967.1| methionyl-tRNA formyltransferase Fmt [Bacillus licheniformis ATCC 14580] >gi|52785553|ref|YP_091382.1| hypothetical protein BLi01794 [Bacillus licheniformis ATCC 14580] >gi|73919376|sp|Q65JS5|FMT_BACLD Methionyl-tRNA formyltransferase >gi|52003387|gb|AAU23329.1| methionyl-tRNA formyltransferase Fmt [Bacillus licheniformis ATCC 14580] >gi|52348055|gb|AAU40689.1| Fmt [Bacillus licheniformis DSM 13] (316 aa)
Score = 564, Expect = 4.9e-56, Identities = 112/296 (37%), Positives = 184/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTP+ +   L  L++  ++VV VV QPD+P GRKK +    VK+ A+ + I   QP K++E    +++  L P   VT AFGQ +P  +L  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TGV +M  ++++DAGD+    +V+IEE+D   TL  K++     ++   + ++ +    P KQDE K ++A NI ++ E I++ K    + N +RGL+  P AY  +N + +K++ A    +     PG I  + K+GI+++T  D  + + EVQ  GK R + ++ + G
  S:     3 RIVFMGTPDFSVPVLGTLIDDGYEVVGVVTQPDRPKGRKKVMTPPPVKEEALRRGIPVLQPEKVREEAETDKILALEPDLIVTAAFGQILPKKLLDYPKYGCINVHASLLPELRGGAPIHYAILEGKEKTGVTIMYMVEKLDAGDMLAKVEVDIEETDNVGTLHDKLSKAGAALLSETVPRIIDGSVTPEKQDEQKATYAPNIKREQELIDWSKPGEVLYNQVRGLNPWPVAYTVLNGQTLKVWAAKKCQALKQAEPGEIVTVEKDGIVVATGNDTALKLTEVQPAGKKRMKAEDFVRG 301
>gi|71904041|ref|YP_280844.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS6180] >gi|123747759|sp|Q48S21|FMT_STRPM Methionyl-tRNA formyltransferase >gi|71803136|gb|AAX72489.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS6180] (311 aa)
Score = 564, Expect = 5.0e-56, Identities = 115/296 (38%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL+  +++++ VV QPD+ +GRKK+I  + VK+LA+E  I  +QP K+   +   E+ EL     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+KE GV +M  IK+MDAGD+       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++  +  E+ N IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+     + +  VQ  GK +  + + LNG
  S:     3 KLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDIKVTPVKQLALEHGISIYQPEKLSGSQELIEIMELGADGIITAAFGQFLPTILLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEQEKLDWTMSDQEVFNHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVIVKTKKSLVIAAGQGALSLLVVQPAGKPKMAIADFLNG 298
>gi|154685989|ref|YP_001421150.1| hypothetical protein RBAM_015560 [Bacillus amyloliquefaciens FZB42] >gi|166214872|sp|A7Z4J3|FMT_BACA2 Methionyl-tRNA formyltransferase >gi|154351840|gb|ABS73919.1| Fmt [Bacillus amyloliquefaciens FZB42] (317 aa)
Score = 562, Expect = 7.4e-56, Identities = 120/298 (40%), Positives = 187/298 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNS 309
           +IVFMGTP+ +   L  L+E  ++VV VV QPD+P GRKK +    VK  A    I   QP K++   EIE  L  L P   VT AFGQ +P  +L  P++GCIN+HASLLP+ RGGAPIH++++ G+K+TGV +M  ++++DAGD+    +V I+E+D   TL  K++     ++   +  V +    PIKQDESK ++A NI ++ E+I++ K   EI N IRGL+  P AY  +N + MK++ +    +K+  APGT+    + GI++++ +   +L+ E+Q  GK R + ++ + G +
  S:     3 RIVFMGTPDFSVPVLRTLIEDGYEVVGVVTQPDRPKGRKKIMTPPPVKAEAERHGIPVLQPEKVRLEEEIEKVL-SLKPDLIVTAAFGQILPKQLLDGPKYGCINVHASLLPELRGGAPIHYSILQGKKKTGVTIMYMVEKLDAGDMISKIEVEIDETDNVGTLHDKLSIAGAKLLSETVPNVISGNIKPIKQDESKATYAPNIKREQERIDWAKPGEEIYNQIRGLNPWPVAYTTLNGQNMKVWASEKVAAKTEAAPGTVIRTEQNGIVVASGNSTALLITELQPAGKKRMKGEDFVRGKN 303
>gi|153175055|ref|ZP_01930450.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL N3-165] >gi|133729508|gb|EBA31206.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL N3-165] (312 aa)
Score = 561, Expect = 8.9e-56, Identities = 122/296 (41%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +     QD  KV+FA NIS++ EKI+++K    I N IRGLS  P AY  + +K  K+++A    +K    PG I    K  + I   D  ++V  V Q  GK + ++ + ++G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSILGAELLMDTLPDFLAGKITATPQDPEKVTFARNISREQEKIDWKKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEETKEGGEPGAI-LADKTTLKIVAGDGTLIVPIVIQPAGKPKMDIHSFMSG 299
>gi|50914730|ref|YP_060702.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS10394] >gi|68051960|sp|Q5XAP4|FMT_STRP6 Methionyl-tRNA formyltransferase >gi|50903804|gb|AAT87519.1| Methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS10394] (311 aa)
Score = 560, Expect = 1.3e-55, Identities = 116/296 (39%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL+  +++++ VV QPD+ +GRKK+I  + VK+LA+E  I  +QP K+   +   E+  L     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+KE GV +M  IK+MDAGDV       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++  +  E+ N IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+T    + +  VQ  GK +  + + LNG
  S:     3 KLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDIKVTPVKQLALEHGISIYQPEKLSGSQELIEITGLGADGIITAAFGQFLPTLLLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDVVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEQEKLDWTMSNQEVFNHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVIVKTKKSLVIATGQGALSLIVVQPAGKPKMSIIDFLNG 298
>gi|75762656|ref|ZP_00742498.1| Methionyl-tRNA formyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] >gi|168139834|ref|ZP_02583063.1| methionyl-tRNA formyltransferase [Bacillus cereus G9842] >gi|74489855|gb|EAO53229.1| Methionyl-tRNA formyltransferase [Bacillus thuringiensis serovar israelensis ATCC 35646] (314 aa)
Score = 560, Expect = 1.3e-55, Identities = 120/306 (39%), Positives = 188/306 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  ++VV VV QPD+P+GRKK +  + VK  A +  I   QP KI+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ+E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++             GTI  I ++G +++T  +  + + E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYEVVGVVTQPDRPVGRKKVLTPTPVKVEAEKHGIPVLQPLKIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQNEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPVTEPAEAGTIVAIEEDGFVVATSNETGVKITELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|169189509|ref|ZP_02849508.1| methionyl-tRNA formyltransferase [Paenibacillus sp. JDR-2] >gi|169003699|gb|EDS50564.1| methionyl-tRNA formyltransferase [Paenibacillus sp. JDR-2] (316 aa)
Score = 560, Expect = 1.4e-55, Identities = 116/296 (39%), Positives = 177/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNN---APGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTPE A  +L  L+E+ +DVVA V QPD+P GRK+ +    +K+ A+   +   QP +++  E    + EL P   VT A+GQ +P ++L IP  GCIN+H SLLP+YRGGAPI  ++INGE  TGV +M   + +D GD+    +V I + DT+ TLF+K++    +++   L  +   E     QD    ++A N++++DE+I++ K A  I N +RGLS   GA+ ++N +  K++     + K+ N   APGT+   S  GI + T D  + + EVQ  GK    V + L G
  S:     2 RIVFMGTPEFAVPSLRLLIEQGYDVVAAVSQPDRPKGRKRVLTPPPLKEAALAFGLPVLQPERMRSAEAVAAIAELQPDLIVTAAYGQILPKALLDIPRLGCINVHGSLLPRYRGGAPIQRSIINGETVTGVTIMYMAEGLDTGDMISKIEVPITDEDTSGTLFEKLSAAGAELLGRTLPALLAGELQAEPQDNELATYAPNLTREDERIDWSKPARSIFNQVRGLSPMAGAFTYLNGEVFKVWACAKPDGKAGNESAAPGTVVAASTSGIDVQTGDGLLRLLEVQPSGKRVMTVADWLPG 302
>gi|168136896|ref|ZP_02580125.1| methionyl-tRNA formyltransferase [Bacillus cereus B4264] (314 aa)
Score = 558, Expect = 1.9e-55, Identities = 120/306 (39%), Positives = 188/306 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  ++VV VV QPD+P+GRKK +  + VK  A +  I   QP KI+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ+E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++             GTI  I ++G +++T  +  + + E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYEVVGVVTQPDRPVGRKKVLTPTPVKVEAEKHGIPVLQPLKIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQNEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPITEPAEAGTIVAIEEDGFVVATSNETGVKITELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|15895000|ref|NP_348349.1| methionyl-tRNA formyltransferase [Clostridium acetobutylicum ATCC 824] >gi|18266727|sp|O05101|FMT_CLOAB Methionyl-tRNA formyltransferase >gi|15024689|gb|AAK79689.1|AE007681_10 Methionyl-tRNA formyltransferase [Clostridium acetobutylicum ATCC 824] (310 aa)
Score = 558, Expect = 2.1e-55, Identities = 129/307 (42%), Positives = 185/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTPE +  +L  L+E ++DV AV+ QPDKP GR K++  S VK++A++ NI  FQP K+K   E+ N+LKE+ P   V  AFGQ +   +L IP++ CIN+HASLLP YRG API+WA+INGE +TG   M   + +D GD+    +V+I+   T   L   + N   D+++  +++       P KQ E +  +A  +SKD  KIN+   +  I NLIRGL+  P AY   NDK MK+ +A   ++     PG I N+   GI +++ D  IL+ ++Q  GK    V   + GN+ I  GV LK
  S:     3 KIVFMGTPEFSVPSLEKLIE-NYDVRAVLTQPDKPKGRGKKLAMSEVKEVAVKNNIPVFQPVKLKNDIEVINKLKEIAPDFIVVVAFGQILSKEVLDIPKYACINLHASLLPNYRGAAPINWAIINGETKTGNTTMIMAEGLDTGDMLLKDEVDIKRDMTAGELHDILMNRGADLLVKTIDEFSKGNIKPEKQGEPETDYAAMLSKDTGKINWNDKSERIYNLIRGLNPWPLAYSSYNDKVMKIHEAKILDAAPEGEPGLITNVDNNGIEVNSSDGKILITKIQFPGKKSMNVGEYIRGNN-IDKGVILK 310
>gi|16078636|ref|NP_389455.1| methionyl-tRNA formyltransferase [Bacillus subtilis subsp. subtilis str. 168] >gi|6166189|sp|P94463|FMT_BACSU Methionyl-tRNA formyltransferase >gi|2337802|emb|CAA74263.1| putative Fmt protein [Bacillus subtilis] >gi|2633945|emb|CAB13446.1| methionyl-tRNA formyltransferase [Bacillus subtilis subsp. subtilis str. 168] (317 aa)
Score = 557, Expect = 2.5e-55, Identities = 115/296 (38%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTP+ +   L  L+E  ++VV VV QPD+P GRKK +    VK+ A+   I   QP K++   EIE  L  L P   VT AFGQ +P  +L  P++GCIN+HASLLP+ RGGAPIH++++ G+K+TG+ +M  ++++DAGD+    +V+IEE+D   TL  K++     ++   +  V      P KQDE K ++A NI ++ E +++ +   E+ N IRGL+  P AY  +N + +K++ +    + +   PGT+  + KEGI+++T  +  +L+ E+Q  GK R + ++ + G
  S:     3 RIVFMGTPDFSVPVLRTLIEDGYEVVGVVTQPDRPKGRKKVLTPPPVKEEALRHGIPVLQPEKVRLTEEIEKVLA-LKPDLIVTAAFGQILPKELLDSPKYGCINVHASLLPELRGGAPIHYSILQGKKKTGITIMYMVEKLDAGDMISKVEVDIEETDNVGTLHDKLSVAGAKLLSETVPNVIAGSISPEKQDEEKATYAPNIKREQELLDWSRTGEELYNQIRGLNPWPVAYTTLNGQNLKIWASKKIAAPTTAEPGTVVAVEKEGIIVATGNETALLLTELQPAGKKRMKGEDFVRG 301
>gi|15903622|ref|NP_359172.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae R6] >gi|116515769|ref|YP_816998.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae D39] >gi|148997790|ref|ZP_01825354.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP11-BS70] >gi|168575073|ref|ZP_02721036.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae MLV-016] >gi|182684678|ref|YP_001836425.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CGSP14] >gi|122278156|sp|Q04J40|FMT_STRP2 Methionyl-tRNA formyltransferase >gi|33516864|sp|Q8DNR7|FMT_STRR6 Methionyl-tRNA formyltransferase >gi|15459246|gb|AAL00383.1| Methionyl-tRNA formyltransferase [Streptococcus pneumoniae R6] >gi|116076345|gb|ABJ54065.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae D39] >gi|147756289|gb|EDK63331.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP11-BS70] >gi|182630012|gb|ACB90960.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CGSP14] >gi|183578831|gb|EDT99359.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae MLV-016] (311 aa)
Score = 557, Expect = 2.6e-55, Identities = 114/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+N+ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKSEEEKLNWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|30021954|ref|NP_833585.1| methionyl-tRNA formyltransferase [Bacillus cereus ATCC 14579] >gi|33516849|sp|Q819U1|FMT_BACCR Methionyl-tRNA formyltransferase >gi|29897510|gb|AAP10786.1| Methionyl-tRNA formyltransferase [Bacillus cereus ATCC 14579] (314 aa)
Score = 557, Expect = 2.6e-55, Identities = 120/306 (39%), Positives = 187/306 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+     L  L+E  ++VV VV QPD+P+GRKK +  + VK  A +  I   QP KI+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ+E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++             GTI  I ++G +++T  +  + + E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFTVPVLRRLIEDGYEVVGVVTQPDRPVGRKKVLTPTPVKVEAEKHGIPVLQPLKIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQNEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPITEPAEAGTIVAIEEDGFVVATSNETGVKITELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|94988963|ref|YP_597064.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS9429] >gi|94992856|ref|YP_600955.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS2096] >gi|139473324|ref|YP_001128039.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes str. Manfredo] >gi|123080380|sp|Q1JKP9|FMT_STRPC Methionyl-tRNA formyltransferase >gi|123382271|sp|Q1JAJ7|FMT_STRPB Methionyl-tRNA formyltransferase >gi|166215518|sp|A2RD70|FMT_STRPG Methionyl-tRNA formyltransferase >gi|94542471|gb|ABF32520.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS9429] >gi|94546364|gb|ABF36411.1| Methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS2096] >gi|134271570|emb|CAM29795.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes str. Manfredo] (311 aa)
Score = 557, Expect = 2.8e-55, Identities = 115/296 (38%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL+  +++++ VV QPD+ +GRKK+I  + VK+LA+E  I  +QP K+   +   E+  L     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+KE GV +M  IK+MDAGD+       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++  +  E+ N IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+T    + +  VQ  GK +  + + LNG
  S:     3 KLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDIKVTPVKQLALEHGISIYQPEKLSGSQELIEIMGLGADGIITAAFGQFLPTLLLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEQEKLDWTMSNQEVFNHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVIVKTKKSLVIATGQGALSLIVVQPAGKPKMSIIDFLNG 298
>gi|154485070|ref|ZP_02027518.1| hypothetical protein EUBVEN_02793 [Eubacterium ventriosum ATCC 27560] >gi|149734023|gb|EDM50142.1| hypothetical protein EUBVEN_02793 [Eubacterium ventriosum ATCC 27560] (308 aa)
Score = 557, Expect = 2.8e-55, Identities = 124/296 (41%), Positives = 179/296 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KIVFMGTP+ +  AL  L  K   VVAV+ Q D+P GR  ++ ++ VK+ A+E NI  +QP K+K  E  + L+E+NP   V  AFGQ +   IL +P++GCIN+HASLLPKYRG API WAVI+GE+ETGV  M   + +D GDV  +  + ++E +T  +LF K+      +++  L K+ N       QD+ K S+A  I+K+  +I+F K AV I  LIRGL+  P AY  ++ K MK++ A          PG I  I+K  I ++T +  + + E+Q+ GK R  +   LNG
  S:     2 KIVFMGTPDFSVPALEEL-AKVHQVVAVITQQDRPKGRGHKMQYTPVKEKALELNIPVYQPEKVKNPEFVDILREINPDVIVVIAFGQILSKEILDLPKYGCINVHASLLPKYRGAAPIQWAVIDGEEETGVTTMYMAEGLDTGDVIDTAVIKLDEKETGGSLFDKLAIEGGKLIVETLSKLENGTATRTPQDDEKSSYAGKITKELGQIDFTKPAVTIERLIRGLNPWPSAYTTLDGKAMKVWDATVEEGNVTEQPGEIVEIAKHYIKVATGENYLKINEIQLAGKKRMPMDAFLNG 298
>gi|15675504|ref|NP_269678.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes M1 GAS] >gi|71911151|ref|YP_282701.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS5005] >gi|21542055|sp|Q99YM7|FMT_STRP1 Methionyl-tRNA formyltransferase >gi|13622701|gb|AAK34399.1| putative methionyl tRNA formyltransferase [Streptococcus pyogenes M1 GAS] >gi|71853933|gb|AAZ51956.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS5005] (311 aa)
Score = 557, Expect = 2.8e-55, Identities = 115/296 (38%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL+  +++++ VV QPD+ +GRKK+I  + VK+LA+E  I  +QP K+   +   E+  L     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+KE GV +M  IK+MDAGD+       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++  +  E+ N IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+T    + +  VQ  GK +  + + LNG
  S:     3 KLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDIKVTPVKQLALEHGISIYQPEKLSGSQELIEIMGLGADGIITAAFGQFLPTILLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEHEKLDWTMSNQEVFNHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVVVKTKKSLVIATGQGALSLIVVQPAGKPKMSIIDFLNG 298
>gi|167939579|ref|ZP_02526654.1| methionyl-tRNA formyltransferase [Bacillus cereus AH1134] (314 aa)
Score = 556, Expect = 3.5e-55, Identities = 120/306 (39%), Positives = 188/306 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K+VFMGTP+ +   L  L+E  ++VV VV QPD+P+GRKK +  + VK  A +  I   QP KI+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ+E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++             GTI  I ++G +++T  +  + + E+Q  GK R      L G ++ +IG  L
  S:     3 KVVFMGTPDFSVPVLRRLIEDGYEVVGVVTQPDRPVGRKKVLTPTPVKVEAEKHGIPVLQPLKIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDILTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQNEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPIIEPAEAGTIVAIEEDGFVVATSNETGVKITELQPSGKKRMSCSQFLRG-TKPEIGTKL 310
>gi|149020817|ref|ZP_01835346.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP23-BS72] >gi|147930458|gb|EDK81441.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP23-BS72] (311 aa)
Score = 556, Expect = 3.8e-55, Identities = 114/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E EL +L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEME-ELMKLGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|157151389|ref|YP_001449913.1| methionyl-tRNA formyltransferase [Streptococcus gordonii str. Challis substr. CH1] >gi|189044552|sp|A8AVV3|FMT_STRGC Methionyl-tRNA formyltransferase >gi|157076183|gb|ABV10866.1| methionyl-tRNA formyltransferase [Streptococcus gordonii str. Challis substr. CH1] (311 aa)
Score = 556, Expect = 4.0e-55, Identities = 115/296 (38%), Positives = 187/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LLE   ++V+AVV QPD+ +GRKKEI  + VK++A+   +  +QP K+    E+E  +  L     VT AFGQF+P  +L+   F  +N+HASLLPK+RGGAPIH+A+I G+KETGV +M T+K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L    + +  P  QD S+V+F+ NI  ++E++++     ++ N IRG++  P A+     ++ K+++A   + +    PG I  I K  +L++T +  +++K VQ  GK +  + + LNG
  S:     3 KLIFMGTPDFSATVLKGLLESDQYEVLAVVTQPDRAVGRKKEIRITPVKEVALSYGLPIYQPEKLSGSPEME-AIMNLGADGIVTVAFGQFLPSKLLARMNF-VVNVHASLLPKHRGGAPIHYALIQGDKETGVTIMETVKEMDAGDMISRRSIPITDEDNVGTLFEKLAIVGRDLLLDTLPAYLSGDIQPEAQDPSQVTFSPNIRPEEERLDWNMTNRQLFNQIRGMNPWPVAHTLWQGERFKIYEAELADGEGQ--PGEILEIGKRQLLVATGEGALVLKTVQPAGKPKMTISDFLNG 298
>gi|13358026|ref|NP_078300.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|170762040|ref|YP_001752548.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189044551|sp|B1AJA4|FMT_UREP2 Methionyl-tRNA formyltransferase >gi|21542064|sp|Q9PQ27|FMT_UREPA Methionyl-tRNA formyltransferase >gi|11356979|pir||H82888 methionyl-tRNA formyltransferase UU463 [imported] - Ureaplasma urealyticum >gi|6899456|gb|AAF30875.1|AE002142_9 methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827617|gb|ACA32879.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] (305 aa)
Score = 556, Expect = 4.2e-55, Identities = 132/298 (44%), Positives = 184/298 (61%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K++F GTPEIA   L  L      D++AVV QPD    RKK +I+S VK+  ++ NIK FQP KIKEIE E++ L P   +TCAFGQFI   I+ IP++  +NIHASLLPK RGGAPIH+A++NGE +TG+ LM TIK+MDAG++   R + I +  TT +L  ++ NL   ++     ++       I+QDE+ VSFAYNI KD   INF++ A  I   +  + + P A    N   +K+++   TN KS   PGTI  I K  + +ST+DFDI +  +Q+  K     K +LNG +
  S:     4 KVMFFGTPEIAKIVLETLFNMHEVDLIAVVSQPDAHFDRKKNVIYSPVKQFCLDHNIKLFQPEKIKEIEEEIRILGPDIIITCAFGQFINQGIIDIPKYKIVNIHASLLPKLRGGAPIHYAILNGELKTGITLMHTIKKMDAGNILFQRSLEINDCTTTKSLTLELANLSALMIKEHFLELVKPNLVGIQQDENSVSFAYNIQKDQNIINFDQPAFFINRFVNAMYDKPIAIMQYNGVSIKVYQVKITNQKSCQKPGTI-MIFKNQLFVSTQDFDIELLLIQLPNKKPLSPKVLLNGKN 301
>gi|148994054|ref|ZP_01823410.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP9-BS68] >gi|168488546|ref|ZP_02712745.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP195] >gi|194398296|ref|YP_002038346.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae G54] >gi|147927521|gb|EDK78549.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP9-BS68] >gi|183572799|gb|EDT93327.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP195] >gi|194357963|gb|ACF56411.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae G54] (311 aa)
Score = 555, Expect = 4.6e-55, Identities = 114/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E EL +L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEME-ELMKLGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSICKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|125973087|ref|YP_001036997.1| methionyl-tRNA formyltransferase [Clostridium thermocellum ATCC 27405] >gi|166214890|sp|A3DCX5|FMT_CLOTH Methionyl-tRNA formyltransferase >gi|125713312|gb|ABN51804.1| methionyl-tRNA formyltransferase [Clostridium thermocellum ATCC 27405] (311 aa)
Score = 555, Expect = 4.7e-55, Identities = 114/297 (38%), Positives = 179/297 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLF-KAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           +IVFMGTPE A  +L  L+ + ++V AVV QPDKP GR K+     VK+ AI+ NI+  QP+K+K  E  + ++EL P   VT A+G+ +P  +L IP +GC+N+H SLLPKYRG API+WA+INGEK TG+  M T   MD GD+    ++ I +  T   L  K+  L  +++   L+K+ +     I Q   + ++A  + K    IN+ K+A ++ NL+RG +  P A+ +   +KMK++  +V      N  PGTI  + K+G++++     +++KEVQ +   R  V+  + G+
  S:     2 RIVFMGTPEFAIPSLEMLVRERYEVAAVVTQPDKPKGRGKKTAMPPVKEFAIKNNIEVLQPSKVKTPEFVSTIRELRPDLLVTAAYGKILPQEVLDIPPYGCVNVHGSLLPKYRGAAPINWAIINGEKVTGITTMYTDAGMDTGDMLLKAEIEISDDMTAGELHDKLACLGAEVLRETLKKIEDSTLQRIPQPHEQATYAPMLDKTVGCINWSKSARDVHNLVRGTNPWPVAFTYYKGQKMKVWVTSVLDEENHNFTPGTILKVGKDGLVVACGVGKVVIKEVQFDSSRRMTVEEYICGH 301
>gi|1772500|emb|CAA71350.1| Met-tRNAi formyl transferase [Bacillus subtilis] (317 aa)
Score = 555, Expect = 5.4e-55, Identities = 120/296 (40%), Positives = 188/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA-PGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTP+ +   L  L+E  ++VV VV QPD+P GRKK +    VK+ A+   I   QP K++   EIE  L  L P   VT AFGQ +P  +L  P++GCIN+HASLLP+ RGGAPIH++++ G+K+TG+ +M  ++++DAGD+    +V+IEE+D   TL  K++     ++   +  V      P KQDE K ++A NI ++ E +++ +   E+ N IRGL+  P AY  +N +K++    V  NS +NN+ PGT+  + KEGI+++T  +  +L+ E+Q  GK R + ++ + G
  S:     3 RIVFMGTPDFSVPVLRTLIEDGYEVVGVVTQPDRPKGRKKVLTPPPVKEEALRHGIPVLQPEKVRLTEEIEKVLA-LKPDLIVTAAFGQILPKELLDSPKYGCINVHASLLPELRGGAPIHYSILQGKKKTGITIMYMVEKLDAGDMISKVEVDIEETDNVGTLHDKLSVAGAKLLSETVPNVIAGSISPEKQDEEKATYAPNIKREQELLDWSRTGEELYNQIRGLNPWPVAYTTLNGQKLENM-GVEKNSGTNNSEPGTVVAVEKEGIIVATGNETALLLTELQPGGKKRMKGEDFVRG 301
>gi|167971523|ref|ZP_02553800.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|171920326|ref|ZP_02690479.3| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|171902746|gb|EDT49035.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|186701124|gb|EDU19406.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] (305 aa)
Score = 554, Expect = 5.8e-55, Identities = 131/298 (43%), Positives = 184/298 (61%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K++F GTPEIA   L  L      D++AVV QPD    RKK +++S VK+  ++ NIK FQP KIKEIE E++ L P   +TCAFGQFI   I+ IP++  +NIHASLLPK RGGAPIH+A++NGE +TG+ LM TIK+MDAG++   R + I +  TT +L  ++ NL   ++     ++       I+QDE+ VSFAYNI KD   INF++ A  I   +  + + P A    N   +K+++   TN KS   PGTI  I K  + +ST+DFDI +  +Q+  K     K +LNG +
  S:     4 KVMFFGTPEIAKIVLETLFNMHEVDLIAVVSQPDAHFDRKKNVVYSPVKQFCLDHNIKLFQPEKIKEIEEEIRILGPDIIITCAFGQFINQGIIDIPKYKIVNIHASLLPKLRGGAPIHYAILNGELKTGITLMHTIKKMDAGNILFQRSLEINDCTTTKSLTLELANLSALMIKEHFLELVKPNLVGIQQDENSVSFAYNIQKDQNIINFDQPAFFINRFVNAMYDKPIAIMQYNGVSIKVYQVKITNQKSCQKPGTI-VIFKNQLFVSTQDFDIELLLIQLPNKKPLSPKVLLNGRN 301
>gi|168281662|ref|ZP_02689329.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|182675873|gb|EDT87778.1| methionyl-tRNA formyltransferase [Ureaplasma parvum serovar 14 str. ATCC 33697] (305 aa)
Score = 554, Expect = 6.4e-55, Identities = 131/298 (43%), Positives = 184/298 (61%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K++F GTPEIA   L  L      D++AVV QPD    RKK +I+S VK+  ++ NIK FQP KIKEIE E++ L P   +TCAFGQFI   I+ IP++  +NIHASLLPK RGGAPIH+A++NGE +TG+ LM TIK+MDAG++   R + I +  TT +L  ++ NL   ++     ++       ++QDE+ VSFAYNI KD   INF++ A  I   +  + + P A    N   +K+++   TN KS   PGTI  I K  + +ST+DFDI +  +Q+  K     K +LNG +
  S:     4 KVMFFGTPEIAKIVLETLFNMHEVDLIAVVSQPDAHFDRKKNVIYSPVKQFCLDHNIKLFQPEKIKEIEEEIRILGPDIIITCAFGQFINQGIIDIPKYKIVNIHASLLPKLRGGAPIHYAILNGELKTGITLMHTIKKMDAGNILFQRSLEINDCTTTKSLTLELANLSALMIKEHFLELVKPNLVGVQQDENSVSFAYNIQKDQNIINFDQPAFFINRFVNAMYDKPIAIMQYNGVSIKVYQVKITNQKSCQKPGTI-MIFKNQLFVSTQDFDIELLLIQLPNKKPLSPKVLLNGKN 301
>gi|81428304|ref|YP_395304.1| methionyl-tRNA formyltransferase [Lactobacillus sakei subsp. sakei 23K] >gi|123755855|sp|Q38XT6|FMT_LACSS Methionyl-tRNA formyltransferase >gi|78609946|emb|CAI54993.1| Methionyl-tRNA formyltransferase [Lactobacillus sakei subsp. sakei 23K] (318 aa)
Score = 554, Expect = 6.6e-55, Identities = 111/295 (37%), Positives = 183/295 (62%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKE---LNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           IVFMGTP+ +   L AL+   + ++AVV QPD+ +GRK+ +  + VK+ A+  ++  FQP K+     EL +   L P   VT A+GQF+P  +L   +   IN+H SLLPKYRGGAPI +AV+NG+ E G+ +M   K+MDAGD+     + IE +D T +LF K++ +  D++L  L  +     P   QDE +V+FAYNI+K+ E+++  + A +++N IR L   PGA+  +N ++ K+++A    + ++ A G +  ++K+   ++  +  +L + E+Q  GK +  V++ LNG
  S:     4 IVFMGTPQFSVPILEALVANDYQILAVVTQPDRKVGRKQVLQQTPVKEAAVRLDLPVFQPEKLSG-SPELADVIALQPDLIVTAAYGQFLPTKLLEAAKIAAINVHGSLLPKYRGGAPIQYAVLNGDSEIGITIMHMAKKMDAGDMIEQASIPIEATDDTGSLFDKLSYVGRDLLLKTLPGIIAQTAPRTPQDEVQVTFAYNITKEQEQLDINQPAEQLLNQIRALRPQPGAWLAVNGQRTKIWQATVAETTTDQAAGVVVALNKKDFELAAGNGTVLKITEIQPAGKAKMPVQSYLNG 301
>gi|149006596|ref|ZP_01830295.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP18-BS74] >gi|147761894|gb|EDK68857.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP18-BS74] (311 aa)
Score = 554, Expect = 6.7e-55, Identities = 114/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E EL +L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEME-ELMKLGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMIFRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEDQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|192813102|ref|ZP_03041767.1| methionyl-tRNA formyltransferase [Geobacillus sp. Y412MC10] >gi|192798023|gb|EDV74538.1| methionyl-tRNA formyltransferase [Geobacillus sp. Y412MC10] (313 aa)
Score = 553, Expect = 7.6e-55, Identities = 111/297 (37%), Positives = 174/297 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNS----KSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           IVFMGTP  A  +L  L+ + + + AVV QPD+P GRKK +  + VK+ A+   I   QP +++  E   EL E  P   VT A+GQ +P S+L +P  GC+N+H SLLP YRGGAPI  ++INGE  TG+ LM   + +D GD+    +V IE+ DT  T+F+K++    +++  +L ++         QD+SK ++A N+++DDEKI++ + + EI + IRGL    G +   N +  K++ A   +S      +  PGT+  + + GI++ T D  + +  VQ  GK   +    + G S
  S:     3 IVFMGTPAFAVPSLEMLIAEGYTIAAVVTQPDRPQGRKKVLTPTPVKEAALRHGIPVLQPQRLRNPEAVAELAEYKPDLIVTAAYGQILPKSVLDMPALGCLNVHGSLLPAYRGGAPIQRSIINGEPVTGITLMYMAEGLDTGDMIARTEVPIEDDDTAGTMFEKLSQAGAELLRRELPRLVKGRVEAEPQDDSKATYAPNLTRDDEKIDWSRTSREIYDQIRGLVPYSGGFTLWNGEVFKVWAAAKPDSAQKPSGDAQPGTVLELHETGIVVKTGDGTLTLLTVQPSGKKAMDAAQFVRGTS 305
>gi|51244599|ref|YP_064483.1| methionyl-tRNA formyltransferase [Desulfotalea psychrophila LSv54] >gi|73919388|sp|Q6AQ97|FMT_DESPS Methionyl-tRNA formyltransferase >gi|50875636|emb|CAG35476.1| probable methionyl-tRNA formyltransferase [Desulfotalea psychrophila LSv54] (323 aa)
Score = 553, Expect = 7.8e-55, Identities = 120/299 (40%), Positives = 174/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTS-TLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K+ +I+FMGTP+ A+  L ALL     VVAVV QPD+P GR K++    VK +A E  +   QP K++  E    L    P   V  A+G+ +P  IL +   GCIN+H SLLPKYRG API WAVI G+ E GV  M+  + MD GD+   RK+ I   D T+ TLF K+  L    +L  +E +         QD ++ + A  +SK+D  I++ + A E+ +LIRG+   P A+CF+  K+++LF    +  K++  PG +    ++G+LI+T    +LVKE+Q EGK R  V+  L G
  S:    11 KSLRIIFMGTPDFASSNLRALLAGPDQVVAVVTQPDRPKGRGKKLTSPPVKVIAEEAGLPVLQPTKVRTDEFLEALAAYAPDLIVVTAYGRILPKPILDLAPLGCINVHGSLLPKYRGAAPIQWAVIQGDDEVGVTTMQMDEGMDTGDILL-RKIIIPSPDETAGTLFDKLAELGTSALLETIEGLKKGTIRAEAQDHAQATEAPMLSKNDGLIDWSRTATELESLIRGMDPWPSAFCFLEGKRLRLFMPEVSYQKTDAQPGAVLRAGRDGLLIATGKNCLLVKEIQPEGKKRMTVEAFLCG 311
>gi|15901567|ref|NP_346171.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae TIGR4] >gi|148984179|ref|ZP_01817474.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP3-BS71] >gi|168493645|ref|ZP_02717788.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC3059-06] >gi|169833515|ref|YP_001695110.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|21542051|sp|Q97PA6|FMT_STRPN Methionyl-tRNA formyltransferase >gi|14973230|gb|AAK75811.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae TIGR4] >gi|147923468|gb|EDK74581.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP3-BS71] >gi|168996017|gb|ACA36629.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae Hungary19A-6] >gi|183576365|gb|EDT96893.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC3059-06] (311 aa)
Score = 553, Expect = 7.9e-55, Identities = 113/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|160939812|ref|ZP_02087159.1| hypothetical protein CLOBOL_04703 [Clostridium bolteae ATCC BAA-613] >gi|158437246|gb|EDP15011.1| hypothetical protein CLOBOL_04703 [Clostridium bolteae ATCC BAA-613] (328 aa)
Score = 553, Expect = 8.2e-55, Identities = 120/296 (40%), Positives = 177/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--------------VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTP+ +  AL AL+E    V+AVV QPDKP GR KE+  + VK  A+E  I  +QP K++E      LK L   A+V  AFGQ +P ++L +P++GCINIHASLLPKYRG API W VI+GE+ETG+  M     +D GD+     + IEE +T  +L  K++    D++L+ L+K+         Q +    +A  ++K    I++ + AV I  LIRGL+  P AY   N K +K++ A                  +++  APGT+    K G+++ T    + ++E+Q+EGK R +    L G
  S:     2 RIVFMGTPDFSVPALKALVEAGHQVIAVVTQPDKPKGRGKEVQMTPVKIQAMEYGIPVYQPAKVREASFVEVLKGLEADAYVVIAFGQILPKAVLELPKYGCINIHASLLPKYRGAAPIQWCVIDGERETGITTMMMDVGLDTGDMLEKAVIPIEEKETGGSLHDKLSMAGGDLILSTLKKLEEGTLVRTPQTDEGTCYAKMLTKSLGDIDWNQGAVSIERLIRGLNPWPSAYTMWNGKTIKIWAADVIAGREAAEFLSESGVPAETGTAPGTVVCSDKRGLVVCTGGGLLSIRELQMEGKKRMDTPAFLRG 313
>gi|168483274|ref|ZP_02708226.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC1873-00] >gi|172043227|gb|EDT51273.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC1873-00] (311 aa)
Score = 553, Expect = 9.4e-55, Identities = 113/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSICKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|195978661|ref|YP_002123905.1| methionyl-tRNA formyltransferase Fmt [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975366|gb|ACG62892.1| methionyl-tRNA formyltransferase Fmt [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (305 aa)
Score = 552, Expect = 9.7e-55, Identities = 110/292 (37%), Positives = 185/292 (63%)
  Q:    16 MGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           MGTP+ +   L  LLE  ++D++AVV QPD+ +GRKK+I  + VKKLA+   +  FQP K+   +   ++  L     VT AFGQF+P  +L    F  +N+HASLLPKYRGGAPIH+A+ING+KE GV +M  +K+MDAGD+  S  + I ++D   T+F K+  L  D++L  L    + +  P+ QD S+ +F+ N+S ++E++++ K A E+ N IRG++  P A+  ++ ++ K+++A    ++ + + G I + +K+ ++++  +  + +  VQ  GK +  + + LNG
  S:     1 MGTPQFSATVLQGLLENPAYDILAVVTQPDRAVGRKKDITMTPVKKLALAHQLPVFQPEKLSGSQELADIMALGADGIVTAAFGQFLPTVLLDSVTFA-VNVHASLLPKYRGGAPIHYAIINGDKEAGVTIMEMVKEMDAGDMISSASLPILDTDNVGTMFDKLAILGRDLLLKTLPDYLSGDLKPVPQDHSQATFSPNLSAEEERLDWSKPAREVFNHIRGMNPWPVAHTLLDGQRFKIYEA--ELAEGSGSAGQIISKTKKALVVAAGEGALSLTLVQPAGKPKMPIVDFLNG 292
>gi|19746553|ref|NP_607689.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS8232] >gi|94994843|ref|YP_602941.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS10750] >gi|123257533|sp|Q1J5I9|FMT_STRPF Methionyl-tRNA formyltransferase >gi|23821553|sp|Q8P003|FMT_STRP8 Methionyl-tRNA formyltransferase >gi|19748765|gb|AAL98188.1| putative methionyl tRNA formyltransferase [Streptococcus pyogenes MGAS8232] >gi|94548351|gb|ABF38397.1| Methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS10750] (311 aa)
Score = 552, Expect = 9.7e-55, Identities = 114/296 (38%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL+  +++++ VV QPD+ +GRKK+I  + VK+LA+E  I  +QP K+   +   E+  L     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+KE GV +M  IK+MDAGD+       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++  +  E+ + IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+T    + +  VQ  GK +  + + LNG
  S:     3 KLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDIKVTPVKQLALEHGISIYQPEKLSGSQELIEIMGLGADGIITAAFGQFLPTLLLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEQEKLDWTMSNQEVFSHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVIVKTKKSLVIATGQGALSLIVVQPAGKPKMSIIDFLNG 298
>gi|21910908|ref|NP_665176.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS315] >gi|28895402|ref|NP_801752.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes SSI-1] >gi|25452943|sp|Q8K6E8|FMT_STRP3 Methionyl-tRNA formyltransferase >gi|21905114|gb|AAM79979.1| putative methionyl tRNA formyltransferase [Streptococcus pyogenes MGAS315] >gi|28810648|dbj|BAC63585.1| putative methionyl tRNA formyltransferase [Streptococcus pyogenes SSI-1] (311 aa)
Score = 552, Expect = 1.0e-54, Identities = 115/296 (38%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL+  +++++ VV QPD+ +GRKK+I  + VK+LA+E  I  +QP K+   +   E+  L     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+KE GV +M  IK+MDAGD+       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++     E+ N IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+T    + +  VQ  GK +  + + LNG
  S:     3 KLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDIKVTPVKQLALEHGISIYQPEKLSGSQELIEIMGLGADGIITAAFGQFLPTILLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEQEKLDWTMFNQEVFNHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVIVKTKKSLVIATGQGALSLIVVQPAGKPKMSIIDFLNG 298
>gi|147678125|ref|YP_001212340.1| methionyl-tRNA formyltransferase [Pelotomaculum thermopropionicum SI] >gi|189044570|sp|A5D1B9|FMT_PELTS Methionyl-tRNA formyltransferase >gi|146274222|dbj|BAF59971.1| methionyl-tRNA formyltransferase [Pelotomaculum thermopropionicum SI] (313 aa)
Score = 552, Expect = 1.1e-54, Identities = 120/296 (40%), Positives = 176/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFK-AVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++VFMGTP+ A  +L AL+E   DV+AVV QPD+P GR ++     VK+ A   NI  FQP KIK+ +    LK+L+P      A+G+ IP  IL+IP++GCIN+HASLLPKYRG APIHWAVINGEKETG+  M   + +D GD+     V I E DT  T+   +  L   +++  LE V     P + Q +   S+A  +  +DE I +++ A +I N IRG++  PGA  + + K +K+++ AV     +   PG + +  +  I++ T    I V E+Q++G  R    + L G
  S:     2 RVVFMGTPDFAVPSLKALVEAGHDVLAVVTQPDRPRGRGRKETPPPVKQAAHALNIPVFQPLKIKDADFTALLKKLSPQVIAVVAYGRIIPPDILTIPKYGCINVHASLLPKYRGAAPIHWAVINGEKETGITTMFMDEGLDTGDMILQEAVAITEEDTAGTVHDALAVLGARLLVQTLELVGQGMAPRVPQ-QGIPSYAPPLKTEDELIRWDRTARDIFNQIRGMNPWPGARTYFSGKVLKIWRAAVVEEEGAALKPGQVMSAGRNAIVVGTGRGRIAVTELQLQGARRLSAGDFLRG 299
>gi|168491382|ref|ZP_02715525.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC0288-04] >gi|183574132|gb|EDT94660.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC0288-04] (311 aa)
Score = 552, Expect = 1.1e-54, Identities = 113/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPELQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|158320461|ref|YP_001512968.1| methionyl-tRNA formyltransferase [Alkaliphilus oremlandii OhILAs] >gi|166988361|sp|A8MH85|FMT_ALKOO Methionyl-tRNA formyltransferase >gi|158140660|gb|ABW18972.1| methionyl-tRNA formyltransferase [Alkaliphilus oremlandii OhILAs] (310 aa)
Score = 550, Expect = 1.7e-54, Identities = 113/298 (37%), Positives = 182/298 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           KI++MGTPE A   L  L++   ++V V  QPDKP GR +++  + VK+ A+  NI  FQP+ +++  + NE++ L P   V  A+GQ +P +IL +P+ GCIN+HASLLPKYRG  PI+W +INGEK+TG+  M     +D GD+    +V I   +T   L  ++ +L   ++   +  + N E   I Q+ S+ ++A  ++KD  KI++ ++A+EI NLIRG    P A+ F   + MK++K+    S+    PG I ++ K+ IL++T    + ++E+Q  GK R  V++ L GN+
  S:     2 KIIYMGTPEFAVPCLEMLIDSGHEIVGVFTQPDKPSGRGQKMNRTPVKEKALAHNIPVFQPHTLRDTNVMNEIENLKPDLIVVVAYGQILPKAILELPKHGCINVHASLLPKYRGAGPINWVIINGEKKTGITTMYMDVGLDKGDMILKEEVEIGAEETAGELHDRLMHLGAQVLRKTIGLIENNEITAIPQNHSESTYAPILTKDLGKIDWSQSAIEIKNLIRGTIPWPTAFTFYEGQVMKIWKSTVIESELQEVPGKIIDVKKDCILVATGQNILSIEEIQFSGKKRMGVRDYLVGNA 301
>gi|148989396|ref|ZP_01820764.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP6-BS73] >gi|147925146|gb|EDK76226.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP6-BS73] (311 aa)
Score = 550, Expect = 2.0e-54, Identities = 113/296 (38%), Positives = 189/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI   +EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGCDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPKEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|168486404|ref|ZP_02710912.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC1087-00] >gi|183570545|gb|EDT91073.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae CDC1087-00] (311 aa)
Score = 549, Expect = 2.2e-54, Identities = 113/296 (38%), Positives = 189/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E EL +L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D    LF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEME-ELIKLGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGALFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|47093060|ref|ZP_00230838.1| methionyl-tRNA formyltransferase [Listeria monocytogenes str. 4b H7858] >gi|47018561|gb|EAL09316.1| methionyl-tRNA formyltransferase [Listeria monocytogenes str. 4b H7858] (316 aa)
Score = 549, Expect = 2.2e-54, Identities = 124/296 (41%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLF----KAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L A L  ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K++    +     +K +  PG I    K  + I   D  ++V  V Q  GK + +V + + G
  S:     3 KIIFMGTPEFSVPVL-AQLASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEETYEETKEDGEPGAI-LADKTTLKIVAGDGTLIVPTVIQPAGKPKMDVHSFMTG 303
>gi|146318080|ref|YP_001197792.1| methionyl-tRNA formyltransferase [Streptococcus suis 05ZYH33] >gi|146320259|ref|YP_001199970.1| methionyl-tRNA formyltransferase [Streptococcus suis 98HAH33] >gi|166215519|sp|A4VZN1|FMT_STRS2 Methionyl-tRNA formyltransferase >gi|166215521|sp|A4VTF3|FMT_STRSY Methionyl-tRNA formyltransferase >gi|145688886|gb|ABP89392.1| Methionyl-tRNA formyltransferase [Streptococcus suis 05ZYH33] >gi|145691065|gb|ABP91570.1| Methionyl-tRNA formyltransferase [Streptococcus suis 98HAH33] (312 aa)
Score = 549, Expect = 2.3e-54, Identities = 116/303 (38%), Positives = 191/303 (63%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIG 314
           K++FMGTP  +   L  LL + +++++AVV QPD+ +GRKK I  + VK++A+E N+  +QP K+   +  +EL  L     VT AFGQF+P  +L+  +F  +N+HASLLPKYRGGAPIH+A+ING++  GV +M  +K+MDAGD+  S  + IEESD   TLF+K+  +  D++L  L      +  P+ Q+  +V+F+ NI  ++E +++ K A ++ N IRG+   P A+ +   ++ K+ +AV   ++   + G +   SK+ ++I+T    + +K VQ  GK +  + + LNG   +I +G
  S:     3 KLIFMGTPAFSATVLRGLLADGNYNILAVVTQPDRAVGRKKVIQMTPVKEVALEYNLPVYQPEKLSGSQEMDELMNLGADGIVTAAFGQFLPTKLLNSVDFA-VNVHASLLPKYRGGAPIHYALINGDERAGVTIMEMVKEMDAGDMISSDSIAIEESDNVGTLFEKLAVVGRDLLLQTLPAYIAGDLKPVAQNPEQVTFSPNIQPEEEVLDWNKTARQLFNQIRGMYPWPVAHTYWQGERFKIQEAVE--AEGEGSVGRVIARSKKELIIATGQGALSLKTVQPAGKPKMTIADFLNGAGRDIAVG 306
>gi|15858852|gb|AAK13241.1| formyltransferase Fmt [Streptococcus pneumoniae] (311 aa)
Score = 549, Expect = 2.7e-54, Identities = 113/296 (38%), Positives = 189/296 (63%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI   +EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGCDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPKEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSICKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 298
>gi|94990963|ref|YP_599063.1| methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS10270] >gi|122986995|sp|Q1JFP0|FMT_STRPD Methionyl-tRNA formyltransferase >gi|94544471|gb|ABF34519.1| Methionyl-tRNA formyltransferase [Streptococcus pyogenes MGAS10270] (311 aa)
Score = 548, Expect = 3.4e-54, Identities = 115/296 (38%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL+  +++++ VV QPD+ IGRKK I  + VK+LA+E  I  +QP K+   +   E+  L     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+K+ GV +M  IK+MDAGD+       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++  +  E+ N IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+T    + +  VQ  GK +  + + LNG
  S:     3 KLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAIGRKKVIKVTPVKQLALEHGISIYQPEKLSGSQELIEIMGLGADGIITAAFGQFLPTILLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKKAGVTIMEMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEQEKLDWTMSNQEVFNHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVIVKTKKSLVIATGQGALSLIVVQPAGKPKMSIIDFLNG 298
>gi|118587054|ref|ZP_01544484.1| methionyl-tRNA formyltransferase [Oenococcus oeni ATCC BAA-1163] >gi|118432464|gb|EAV39200.1| methionyl-tRNA formyltransferase [Oenococcus oeni ATCC BAA-1163] (316 aa)
Score = 547, Expect = 3.7e-54, Identities = 123/298 (41%), Positives = 187/298 (62%)
  Q:    13 IVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINF-EKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKD-FDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++F GT + +   L  L+ +  F+V+AVV QPD+P+GRKK +  + +K+LA+E  I  FQP K+   E  + L  +     VT AFGQF+P  +L   +   IN+HASLLPKYRG API+WA+ING+KETGV +M  +K+MDAGD+   +K+ IEE+D   +LF+K+  +  D++L  + K+ + +  PI+QDE K++ A  I     +++F  + A +IV+LIRGLS  PGA   I D+K+K+FKA           G+I   SK  + I+  D   + ++E+Q  GK   +V + LNG  +
  S:     5 VIFFGTSDFSRAVLQGLIADDDFEVIAVVSQPDRPVGRKKLLQPTKIKQLALEYRIPIFQPEKLSRSEEMDRLISMQADFLVTAAFGQFVPSKLLKSAKIASINVHASLLPKYRGAAPINWALINGDKETGVSIMYMVKEMDAGDIISVKKMPIEENDNAGSLFEKLAVVGRDLLLKTMPKMVSGDISPIQQDEEKITLAPKIDYKLTELDFYHQKAEKIVDLIRGLSPKPGASLQIADEKIKVFKA--KIGPCQGEVGSIAIKSKHDLAITAADGRTVFLQEIQPIGKKIMDVSSFLNGAGQ 305
>gi|153167667|ref|ZP_01927771.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL N1-017] >gi|133726766|gb|EBA28464.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL N1-017] (316 aa)
Score = 546, Expect = 5.0e-54, Identities = 123/296 (41%), Positives = 185/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLF----KAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEV-QIEGKNRQEVKNILNG 307
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K    I N IRGLS  P AY  + +K  K++    +     +K +  PG I    K  + I   D  ++V  V Q  GK + +V + + G
  S:     3 KIIFMGTPEFSVPVLTQL-ASTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALEADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTKPGRTIFNQIRGLSPWPVAYTTLEEKPFKIWEATYEETYEETKEDGEPGAI-LADKTTLKIVAGDGTLIVPTVIQPAGKPKMDVHSFMTG 303
>gi|116333603|ref|YP_795130.1| methionyl-tRNA formyltransferase [Lactobacillus brevis ATCC 367] >gi|122269710|sp|Q03RS3|FMT_LACBA Methionyl-tRNA formyltransferase >gi|116098950|gb|ABJ64099.1| methionyl-tRNA formyltransferase [Lactobacillus brevis ATCC 367] (314 aa)
Score = 546, Expect = 5.1e-54, Identities = 113/298 (37%), Positives = 184/298 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNSE 310
           ++FMGTP+ +   L++L++  +DV+AVV QPD+ +GRK  +  S VK++A+  +I+  QP KI       +  EL P   VT AFGQF+P  +L   +   +N+HASLLPKYRGGAP+H+A++NG+ ETGV +M   K+MDAG V   R + I + D   T+F K+++L  D++L  L K+   E  P+ QDES+VSF+  I  ++E+++   +A  I   +R L   P A+ ++N  + KL+     + K++  PG + +  K  + I+T +  +L + E+Q  GK +  + + LNG ++
  S:     4 VIFMGTPQFSAPILSSLIDNGYDVLAVVTQPDRRVGRKHVLTASPVKQVAVAHDIEVLQPEKISGSSEMARAIELAPDLIVTAAFGQFLPTKLLKAAKVAAVNVHASLLPKYRGGAPVHYAIMNGDSETGVSIMFMEKKMDAGAVLAQRAIPITDQDDVGTMFAKLSDLGRDLLLETLPKLLAGELTPVPQDESQVSFSPTIKPEEERVDINLSARMIDCKVRALRPFPTAHIYLNGVRTKLWHVTVLDQKTDLQPGAVVSRDKHHLAIATGEQGVLSLDELQPAGKPKLSITDYLNGTTD 304
>gi|81096260|ref|ZP_00874608.1| Methionyl-tRNA formyltransferase [Streptococcus suis 89/1591] >gi|80977747|gb|EAP41282.1| Methionyl-tRNA formyltransferase [Streptococcus suis 89/1591] (312 aa)
Score = 546, Expect = 5.6e-54, Identities = 116/303 (38%), Positives = 191/303 (63%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIG 314
           K++FMGTP  +   L  LL + +++++AVV QPD+ +GRKK I  + VK++A+E N+  +QP K+   +  +EL  L     VT AFGQF+P  +L+  +F  +N+HASLLPKYRGGAPIH+A+ING++  GV +M  +K+MDAGD+  S  + IEESD   TLF+K+  +  D++L  L      +  P+ Q+  +V+F+ NI  ++E ++++K+A ++ N IRG+   P A+ +   ++ K+ +AV    +     G +   SK+ ++I+T    + +K VQ  GK +  + + LNG   +I +G
  S:     3 KLIFMGTPAFSATVLRGLLADGNYNILAVVTQPDRAVGRKKVIQMTPVKEVALEYNLPVYQPEKLSGSQEMDELMNLGADGIVTAAFGQFLPTELLNSVDFA-VNVHASLLPKYRGGAPIHYALINGDERAGVTIMEMVKEMDAGDMISSDSIAIEESDNVGTLFEKLAVVGRDLLLQALPAYIAGDLKPVAQNPEQVTFSPNIQPEEEVLDWKKSARQLFNQIRGMYPWPVAHTYWQGERFKIQEAVEVEVEG--PVGRVITRSKKELIIATGQGALSLKTVQPAGKPKMTIADFLNGAGRDIAVG 306
>gi|160880623|ref|YP_001559591.1| methionyl-tRNA formyltransferase [Clostridium phytofermentans ISDg] >gi|160429289|gb|ABX42852.1| methionyl-tRNA formyltransferase [Clostridium phytofermentans ISDg] (319 aa)
Score = 545, Expect = 6.5e-54, Identities = 118/296 (39%), Positives = 177/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTN------SKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K V+MGTPEIA   L  LL    +++ VV QPDKP GR KE+ F  VK++A++  I  +QP ++KE E   +LK L P   +  AFGQ +   IL +P FGCIN+HASLLPKYRG API W ++NGE++TGV +M+     D GD+   ++++I + +T  +L  K+  +  D +L  +E + N      KQD+S  ++   +SK+  KI+F K+A  I  +IRGL+  P AY +   K +KL+ A  ++             G+I  ++KE I + T D  + + E+Q+EGK +      L G
  S:     2 KAVYMGTPEIAATILETLLSSDIEIIGVVTQPDKPKGRGKEMAFPPVKEVALKHQIPVYQPRRVKEPEFVEQLKALAPDIILVAAFGQILSKDILELPPFGCINVHASLLPKYRGSAPIQWVILNGEEKTGVTIMKMDVGCDTGDMILKKEIDITKEETGGSLHDKLAVIGGDALLEGIELIKNGTATYTKQDDSNSTYIKMLSKEMGKIDFSKDADSIERMIRGLNPWPSAYTYYKGKTLKLWSAEVSHDPDIIKDAEEAEFGSIVRVTKEAIFVKTGDKLLKINELQLEGKKKMLAGEFLRG 305
>gi|167760431|ref|ZP_02432558.1| hypothetical protein CLOSCI_02805 [Clostridium scindens ATCC 35704] >gi|167661930|gb|EDS06060.1| hypothetical protein CLOSCI_02805 [Clostridium scindens ATCC 35704] (312 aa)
Score = 545, Expect = 6.9e-54, Identities = 117/296 (39%), Positives = 171/296 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTPE +   L AL E   +VV  V QPDKP GR   + +  VK++A+E  I  FQP KI+  E   EL++      V  AFGQ +P  IL +  +GC+N+HASLLPKYRG API WAVINGEK TGV  M+  + +D GD+    +V ++E +T  +L  K+      + +  L+ + +      KQ ES   +A  ++K+   I++ ++A+ I  L+RGL+  P AY   N K MK+++A     ++  APGTI  I K+G L+      + + E+QI GK R +    L G
  S:     2 KVIFMGTPEFSVGTLKALAEAGHEVVLAVTQPDKPKGRGGRMQYPPVKEMALEYGIPVFQPKKIRAPECVEELRKYEADIMVVIAFGQILPKEILEMTPYGCVNVHASLLPKYRGAAPIQWAVINGEKVTGVTTMQMDEGLDTGDMLLKEEVILDEEETGGSLHDKLAEAGARLCVRTLKALEDGSAVREKQGESPTEYARMLTKELGSIDWTQDALSIERLVRGLNPWPSAYTDWNGKVMKIWEAKVMEGETGKAPGTIVKIEKDGFLVQAGAGLLKILELQIPGKKRMKADAFLRG 299
>gi|163815236|ref|ZP_02206613.1| hypothetical protein COPEUT_01396 [Coprococcus eutactus ATCC 27759] >gi|158449431|gb|EDP26426.1| hypothetical protein COPEUT_01396 [Coprococcus eutactus ATCC 27759] (308 aa)
Score = 545, Expect = 7.8e-54, Identities = 120/297 (40%), Positives = 174/297 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           +I++MGTP+ A  AL +L++   +VVA   QPDKP GR K +  + VK  A E  I  +QP K++E EN  ++K+  P A V  A+GQ +P+SIL+IP +GCINIHASLLPKYRG API  A+I+GE +TGV  M   K +D GD+     V+I   DT  TL  K+      ++L+ L+K+ N       Q++ +  +A  +SKD   I+F K A EI  L+RGL   P A+  I  K +K++ A  T++     PG I  ++K+   I   +  + +K +Q EGK   +    L GN
  S:     2 RIIYMGTPDFAVNALVSLVDAGHEVVACYTQPDKPKGRSKALQPTPVKVKAFEYGIPVYQPVKLREAENVEKIKQYAPDAIVVAAYGQILPESILNIPAYGCINIHASLLPKYRGAAPIERAIIDGESKTGVTTMYMAKGLDTGDIIEQSVVSIMSDDTGETLTDKLAKTGAKLILSTLDKLENGTAERTVQNDDESCYAAMLSKDMGDIDFTKPADEIERLVRGLQPWPCAFTRIKGKSVKIYGACVTDAPEGTEPGQITGVTKKSFAIVCGEGALQIKRLQPEGKKPMDAAAFLAGN 300
>gi|168334697|ref|ZP_02692833.1| methionyl-tRNA formyltransferase [Epulopiscium sp. 'N.t. morphotype B'] (310 aa)
Score = 545, Expect = 8.0e-54, Identities = 129/306 (42%), Positives = 177/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI---KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNS-KSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+ A  AL  L+E+   +  V+ QPDKP GR K+   S VK  A   ++   QP ++   KEI   LK++ P   V  AFGQ +P +IL IP  GC+NIH SLLPKYRG API WA+INGE  TGV +M   K +D GD+   ++++I   DT  T+F K+ NL    +   L  + N      KQ+ S  S A  I K+  K+NF  +A EI NLIRG+S +P AY     +K+K+  A       +    GTI N+ K+GIL+ T    +L+ E+Q+  K R  V   + GN +I++G  L
  S:     2 KIVFMGTPDFAVPALEMLIEQGHQISLVITQPDKPRGRGKKESVSPVKAAAQMHHLAIAQPERLRKNKEILELLKDIAPDLIVVVAFGQILPATILKIPTLGCVNIHGSLLPKYRGAAPIQWALINGETTTGVTIMYMDKGLDTGDMLYKKEISITPDDTAGTMFDKLKNLGALALKEALPLIENGGAQREKQNNSFSSSAPKIEKEMGKLNFNMSATEIENLIRGMSPSPSAYIEYKGEKIKVHAAKEAPEFAATEDAGTILNVDKQGILVKTAKGLLLITEIQVPNKKRMLVSEYIKGN-QIELGYKL 310
>gi|56807938|ref|ZP_00365758.1| COG0223: Methionyl-tRNA formyltransferase [Streptococcus pyogenes M49 591] (305 aa)
Score = 543, Expect = 1.3e-53, Identities = 113/292 (38%), Positives = 182/292 (62%)
  Q:    16 MGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           MGTP+ +   L  LL+  +++++ VV QPD+ +GRKK+I  + VK+LA+E  I  +QP K+   +   E+  L     +T AFGQF+P  +L    F  IN+HASLLPKYRGGAPIH+A++NG+KE GV +M  IK+MDAGD+       I E+D   TLF+K+  +  D++L+ L    + E  PI QD S+ +F+ NIS + EK+++  +  E+ N IRG++  P A+ F+  +++K+++A    ++    PG +   +K+ ++I+T    + +  VQ  GK +  + + LNG
  S:     1 MGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDIKVTPVKQLALEHGISIYQPEKLSGSQELIEIMGLGADGIITAAFGQFLPTILLDSVSFA-INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDMVAKASTPILETDNVGTLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEHEKLDWTMSNQEVFNHIRGMNPWPVAHTFLEGQRLKIYEA--QLAEGEGLPGQVIVKTKKSLVIATGQGALSLIVVQPAGKPKMSIIDFLNG 292
>gi|153815687|ref|ZP_01968355.1| hypothetical protein RUMTOR_01923 [Ruminococcus torques ATCC 27756] >gi|145846928|gb|EDK23846.1| hypothetical protein RUMTOR_01923 [Ruminococcus torques ATCC 27756] (330 aa)
Score = 542, Expect = 1.6e-53, Identities = 117/296 (39%), Positives = 177/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAV-------------------STNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+FMGTP+ +   L AL+E   DV   V QPDKP GR KE+ F+ VK+ A++  I  +QP ++++ E   EL++ N    V  AFGQ +P  IL +  +GCIN+HASLLPKYRG API WA+I GE  TGV  M+  + +D GD+    ++ I E +T  +L  K+      + +  L  + N      KQ ES  ++A  ++KD   I++ K+AV+I  L+RGL+  P AY   + K MK++KA+                   +  +  N  PGT+ +++K+   I T D  + + EVQ+ GK R +  + L G
  S:     2 RIIFMGTPDFSVGTLEALVEAGHDVCLAVTQPDKPKGRGKEMQFTPVKEAAVKHGILVYQPKRVRDPECVEELRKYNADVMVVVAFGQILPKEILEMTPYGCINVHASLLPKYRGAAPIQWAIIEGESVTGVTTMQMDEGLDTGDMILKTEIPIAEDETGESLHDKLAEAGAALCVKTLHAIENKTAVFEKQPESPTAYAKMLTKDLGNIDWAKSAVQIERLVRGLNSWPSAYTHRDGKVMKIWKALAKPQEECAEQTELGSEEHTAQKTGKNAMPGTVVSVAKDSFCIQTGDGVLRILEVQMPGKKRMDTGSFLRG 318
>gi|56964083|ref|YP_175814.1| methionyl-tRNA formyltransferase [Bacillus clausii KSM-K16] >gi|73919377|sp|Q5WFK7|FMT_BACSK Methionyl-tRNA formyltransferase >gi|56910326|dbj|BAD64853.1| methionyl-tRNA formyltransferase [Bacillus clausii KSM-K16] (312 aa)
Score = 540, Expect = 2.4e-53, Identities = 113/306 (36%), Positives = 178/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP  +   L  L++ +  V+AVV QPD+P+GRK+ +  S VK+ A +  I   QP KI+E   ++    P   VT A+GQ +P ++L  P +GCIN+HASLLPKYRGGAPIH A+I+GEK+TG+ +M   +++DAG V   + V I + D   T+  K++ +  D++   +  +       + QDE K +FA NI ++ E ++++K A  + N +RG+   P AY  +N  ++K+++A     +    PG I   +K+GI ++  +  IL +  VQ  GK       +L G    ++G  L
  S:     2 KIVFMGTPAFSVPILKRLID-THTVLAVVTQPDRPVGRKRLLTPSPVKEEAQKHGIPVLQPEKIREQHEDILAFAPELIVTAAYGQIVPKAVLDAPPYGCINVHASLLPKYRGGAPIHQAIIDGEKQTGISIMYMAEKLDAGAVLSQQAVAITDEDDVQTMHDKLSAVGADLLEKTIVALEQGTIEAVAQDEDKATFAPNIKREQEVLDWQKPARALFNQVRGMRPWPVAYTLVNGNRLKVWEAKEIAGEHECEPGEILATTKQGIDVACGNGTILRLTVVQPAGKKAVLANQLLQGAHPFQVGKRL 307
>gi|148262894|ref|YP_001229600.1| methionyl-tRNA formyltransferase [Geobacter uraniireducens Rf4] >gi|189044512|sp|A5GBL0|FMT_GEOUR Methionyl-tRNA formyltransferase >gi|146396394|gb|ABQ25027.1| methionyl-tRNA formyltransferase [Geobacter uraniireducens Rf4] (313 aa)
Score = 540, Expect = 2.4e-53, Identities = 106/296 (35%), Positives = 176/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+FMGTPE A   L  LL++  DV+AV+ QPD+P GR ++ +   VK LA    I   QP K++  E+   ++ L P   V  AFGQ +P S+L IP++GCIN+HASLLP++RG AP++W +INGE ETGV  M     +D GD+   R   I+  + T +L  +++ +  + +   L+ +   +    KQD++   +A  + K+D  I++ K    I NL+RG++  PGA+ F++ K +K+++  +   +    PG++    +EG+ ++     I+++E+Q+EGK R    + L G
  S:     5 RIIFMGTPEFACPTLQKLLDRGEDVIAVITQPDRPKGRGQQTLPPPVKVLAERHGIPVMQPLKVRVPEVVESIRSLAPDLIVVVAFGQILPKSLLDIPKYGCINVHASLLPRWRGAAPLNWCIINGETETGVTTMMMDVGLDTGDMLVKRSTPIDPDENTQSLHDRLSVVGAEALAETLDLLTAGKLVREKQDDALTCYAPMLKKEDGLIDWSKEPQTIKNLVRGMTPWPGAFSFLDGKMLKIYRVGTAGGEG--TPGSVIRAGREGLEVACSGGSIVIEELQLEGKKRLHAGDFLAG 300
>gi|196253548|ref|ZP_03152171.1| methionyl-tRNA formyltransferase [Clostridium thermocellum DSM 4150] >gi|196197046|gb|EDX91920.1| methionyl-tRNA formyltransferase [Clostridium thermocellum DSM 4150] (306 aa)
Score = 540, Expect = 2.7e-53, Identities = 110/293 (37%), Positives = 177/293 (60%)
  Q:    16 MGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNN-APGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           MGTPE A  +L  L+ + ++V AVV QPDKP GR K+     VK+ AI+ NI+  QP+K+K  E  + ++EL P   VT A+G+ +P  +L IP +GC+N+H SLLPKYRG API+WA+INGEK TG+  M T   MD GD+    ++ I +  T   L  K+  L  +++   L+K+ +     I Q   + ++A  + K    IN+ K+A ++ NL+RG +  P A+ +   +KMK++     + +++N  PGTI  + K+G++++     +++KEVQ +   R  V+  + G+
  S:     1 MGTPEFAIPSLEMLVREGYEVAAVVTQPDKPKGRGKKTAMPPVKEFAIKNNIEVLQPSKVKTPEFVSTIRELRPDLLVTAAYGKILPQEVLDIPPYGCVNVHGSLLPKYRGAAPINWAIINGEKVTGITTMYTDAGMDTGDMLLKAEIEISDDMTAGELHDKLACLGAEVLRETLKKIEDSTLQRIPQPHEQATYAPMLDKTVGCINWSKSARDVHNLVRGTNPWPVAFTYYKGQKMKVWMTSVLDEENHNFTPGTILKVGKDGLVVACGVGKVVIKEVQFDSSRRMTVEEYICGH 296
>gi|58337595|ref|YP_194180.1| methionyl-tRNA formyltransferase FMT [Lactobacillus acidophilus NCFM] >gi|73919398|sp|Q5FJH5|FMT_LACAC Methionyl-tRNA formyltransferase >gi|58254912|gb|AAV43149.1| methionyl-tRNA formyltransferase FMT [Lactobacillus acidophilus NCFM] (314 aa)
Score = 540, Expect = 3.0e-53, Identities = 119/295 (40%), Positives = 180/295 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           ++FMGTPE +   L  L+E  +++ AVV QPDK +GRK++I  +  K  A + ++   QP K+   E  N+L +++    VT A+GQF+P   L       +N+H SLLPKYRGGAPI +++ING+KETG+ +M  +K+MDAGD+Y    + IE  D   TLF K++ L  D++L  L  + +       QD  KV F+ NI+K+ E+++ +  A +  N+IR L+  PGAY  IN ++ K+++A V+++S S  A   + N  K    IS  D  +L + EVQ  GK R  +KN LNG
  S:     4 VIFMGTPEFSVPVLEGLIEAGYEIRAVVTQPDKKVGRKQKIAKTPAKIAAEKHDLPVLQPVKLSGSEEMNQLIDMHADLIVTAAYGQFLPTKFLKSVNIAAVNVHGSLLPKYRGGAPIQYSLINGDKETGITIMEMVKKMDAGDIYAQEAIKIEPEDNAGTLFSKLSILGRDLLLKTLPSIIDGSVKKTPQDPDKVVFSPNITKEQERLSIDMTAEQANNMIRALNPDPGAYLMINGQRFKVWEAEVASDSSSLEAGTVVAN--KGRFAISFADNTVLNLLEVQPSGKKRMNIKNFLNG 300
>gi|116492596|ref|YP_804331.1| methionyl-tRNA formyltransferase [Pediococcus pentosaceus ATCC 25745] >gi|122265940|sp|Q03FY3|FMT_PEDPA Methionyl-tRNA formyltransferase >gi|116102746|gb|ABJ67889.1| methionyl-tRNA formyltransferase [Pediococcus pentosaceus ATCC 25745] (320 aa)
Score = 539, Expect = 3.5e-53, Identities = 119/300 (39%), Positives = 196/300 (65%)
  Q:    11 KKIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNSE 310
           K I+FMGTPE +   L +L+ E ++DV+ VV QPD+ +GRK  +  S VKK+A++ +IK +QP K+       EL  LN    VT AFGQF+P S+++  + G +N+HASLLPKYRGGAP+H+A++NG+KETGV ++  +K+MDAG++  + K+ I + D   T+F+K++ L  D++L+ L ++      P+KQDE +VSF+ NIS ++E+I+    A  +   +RGL   P AY  +  K+ K++K    +  ++  PG + + +K  +L++T +  ++ ++E+Q  GK +  + + LNG  E
  S:     2 KSIIFMGTPEFSAPILQSLIDEPNYDVIGVVTQPDRKVGRKHVLTPSPVKKVAVKNDIKVYQPEKLSGSAELTELIALNADLIVTAAFGQFLPMSLINSVKIGAVNVHASLLPKYRGGAPVHYAIMNGDKETGVTIIYMVKKMDAGEMLATAKIPITDQDDVGTMFEKLSLLGRDLLLDTLPQLIEGNVQPVKQDEEQVSFSPNISPEEEEIDINLPARLVDAKVRGLRPFPVAYFMMEGKRTKIWKTKVIDQTTDLKPGQVVSKTKHELLVATGEHGVISIEELQPAGKQKMTITDYLNGVGE 305
>gi|116490834|ref|YP_810378.1| methionyl-tRNA formyltransferase [Oenococcus oeni PSU-1] >gi|116091559|gb|ABJ56713.1| methionyl-tRNA formyltransferase [Oenococcus oeni PSU-1] (316 aa)
Score = 539, Expect = 3.5e-53, Identities = 121/298 (40%), Positives = 187/298 (62%)
  Q:    13 IVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINF-EKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKD-FDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++F GT + +   L  L+ +  F+V+AVV QPD+P+GRKK +  + +K+LA+E  I  FQP K+   E  + L  +     VT AFGQF+P  +L   +   IN+HASLLPKYRG API+WA+ING+KETGV +M  +K+MDAGD+   +K+ I+E+D   +LF+K+  +  D++L  + K+ + +  PI+QDE K++ A  I     +++F  + A +IV+LIRGLS  PGA   I D+K+K+FKA           G+I   SK  + I+  D   + ++++Q  GK   +V + LNG  +
  S:     5 VIFFGTSDFSRAVLQGLIADDDFEVIAVVSQPDRPVGRKKLLQPTKIKQLALEYRIPIFQPEKLSRSEEMDRLISMQADFLVTAAFGQFVPSKLLKSAKIASINVHASLLPKYRGAAPINWALINGDKETGVSIMYMVKEMDAGDIISVKKMPIKENDNAGSLFEKLAVVGRDLLLKTMPKMVSGDISPIQQDEEKITLAPKIDYKLTELDFYHQKAEKIVDLIRGLSPKPGASLQIADEKIKVFKA--KIGPCQGEVGSIAIKSKHDLAITAADGRTVFLQKIQPIGKKIMDVSSFLNGAGQ 305
>gi|160933493|ref|ZP_02080881.1| hypothetical protein CLOLEP_02339 [Clostridium leptum DSM 753] >gi|156867370|gb|EDO60742.1| hypothetical protein CLOLEP_02339 [Clostridium leptum DSM 753] (306 aa)
Score = 538, Expect = 4.1e-53, Identities = 118/297 (39%), Positives = 172/297 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKD-FDILVKEVQIEGKNRQEVKNILNGN 308
           +IVFMGTP+ A   L  LLE    V  V  QPDKP GRK  +    VK+LA+EK +  +QP K+++ E    L+EL P   V  A+G+ +P  IL++P  GC+N+H SLLPKYRG API W+VINGEKETGV  M   + +D GD+     V I E++T   LF ++  +   ++L  LE +      P KQ++ + ++A  + K+   +N+ K++ E+ NLIRGL+  P AY  +  KK+KLF   S+ S +    G I  +S    L+   D   + + +VQ+EGK R        G+
  S:     2 RIVFMGTPDFAVPCLAGLLEAGHQVCGVFTQPDKPKGRKMVLTPPPVKELALEKGLPVYQPAKMRDGEALGILQELRPELIVVVAYGKILPKEILTLPPKGCVNVHGSLLPKYRGAAPIQWSVINGEKETGVTTMLMDEGLDTGDMLLRETVKIGENETAGELFDRLAPIGAQLLLKTLEGLEQGSIAPQKQNDQESTYASMLDKNLSAVNWNKSSREVHNLIRGLTPWPTAYTVLEGKKLKLFG--SSVSAAKGGAGEI--VSLNPFLVGCGDGVCVRIDQVQLEGKKRMGAAEFFRGH 297
>gi|149002038|ref|ZP_01826992.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP14-BS69] >gi|147759847|gb|EDK66837.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP14-BS69] (312 aa)
Score = 538, Expect = 4.7e-53, Identities = 113/296 (38%), Positives = 190/296 (64%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFE-KNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K++FMGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI   +EK++++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 KLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGCDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPKEEKLDWKNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 299
>gi|111657688|ref|ZP_01408416.1| hypothetical protein SpneT_02001122 [Streptococcus pneumoniae TIGR4] (305 aa)
Score = 538, Expect = 4.9e-53, Identities = 111/292 (38%), Positives = 186/292 (63%)
  Q:    16 MGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           MGTP+ +   L  LL +  ++++AVV QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     1 MGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 292
>gi|90961591|ref|YP_535507.1| methionyl-tRNA formyltransferase [Lactobacillus salivarius UCC118] >gi|122993077|sp|Q1WUB1|FMT_LACS1 Methionyl-tRNA formyltransferase >gi|90820785|gb|ABD99424.1| Methionyl-tRNA formyltransferase [Lactobacillus salivarius UCC118] (318 aa)
Score = 535, Expect = 9.9e-53, Identities = 120/302 (39%), Positives = 189/302 (62%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIN--DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNSE-IKIG 314
           IVFMGTP  A   L  ++E  ++V+AVV QPD+P+GRK+ +  S VK++A++  IK FQP K+   +   E+ +L P   VT A+GQF+P  ++   +   IN+H SLLPKYRGGAP+ ++++NG+ +TGV ++  +K+MDAGD+    ++ IE +D T T+F+KM+ L  D++L  L K+ +     +KQDE+KV F+ NI  ++E ++    A EI    R L   PGAY F N   K+ KL+       K+  APG + N+ K  + +S  +  +  + E+Q  GK + ++ + LNG  + +KIG
  S:     4 IVFMGTPAFAAPILEGIIENGYNVLAVVTQPDRPVGRKRVLHASPVKEVALKYGIKVFQPVKLSGSDEMQEIIDLQPDLIVTAAYGQFLPTKLIESVKIAAINVHGSLLPKYRGGAPVQYSIMNGDDKTGVTIIYMVKKMDAGDMLAQAELKIESTDDTGTIFEKMSILGRDVLLETLPKIISGNVEAVKQDENKVVFSPNIKPEEEILHLNLEAKEIDWKTRALRPAPGAY-FKNFKGKRTKLWSIKPLEEKTEFAPGYVVNVDKHELKVSAYNGTVYSIIELQPAGKQKMDITSYLNGVGQGLKIG 310
>gi|126645658|ref|ZP_01718202.1| methionyl-tRNA formyltransferase [Algoriphagus sp. PR1] >gi|126579069|gb|EAZ83233.1| methionyl-tRNA formyltransferase [Algoriphagus sp. PR1] (300 aa)
Score = 534, Expect = 1.2e-52, Identities = 118/292 (40%), Positives = 177/292 (60%)
  Q:    16 MGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESK-VSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           MGTPE A  AL  L+   +DV+AV+  PDKP GR +++IFS VK+ A++ +IK  QP  +K  + + ELK L     +  AF + +P+S+ S+P  G  N+HASLLP YRG API+WA+INGEKETGV       ++D G +    KV+I E D   +++ K+     ++VL  +E +   E  P+ QDE+K +  A  I K+  KI++  +AV+I NL+RGLS  P A+  ++DK  K+FK   +  KS  +PG   +  K  +   T D  + + E+Q+EGK R  +++ L G
  S:     1 MGTPEFAVPALENLVNHGWDVIAVITAPDKPKGRGQKMIFSPVKEAALKHDIKVLQPTNLKSPDFQEELKSLKADLQIVVAF-RMLPESVWSMPPMGTFNLHASLLPNYRGAAPINWAIINGEKETGVTTFFLKHEIDTGSIIYQEKVSILEEDDLGSVYSKLMTKGSELVLKTVESIAKDEVTPLPQDETKAIHHAPKIFKETGKIDWNDSAVKIHNLVRGLSPYPAAWFILDDKICKVFKTKYSTDKSPLSPGQYESDGKTYLKFQTGDGVLELIEIQLEGKKRMGIEDFLRG 294
>gi|169831744|ref|YP_001717726.1| methionyl-tRNA formyltransferase [Candidatus Desulforudis audaxviator MP104C] >gi|169638588|gb|ACA60094.1| methionyl-tRNA formyltransferase [Candidatus Desulforudis audaxviator MP104C] (359 aa)
Score = 534, Expect = 1.4e-52, Identities = 109/302 (36%), Positives = 174/302 (57%)
  Q:     6 NSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISK-EGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           NS +   +VFMGTP+ A  +L AL+E  F V+ VV QPD+P GR  ++    VK  A+++ ++  QP  I++    + ++EL P   V  AFG+ +P  +L IP  GC+N+HASLLP+YRG APIHWAV+NGE ETGV  M   + +D GD+    K  I   D    +  ++  L   +++  L+++   E  P  QDES+ ++A  + ++ E I++ + A EI N +RGL   PGA+  +N + +K+++A     +    PG +       G+++ST    + + EVQ  G+ R   ++ L G
  S:     2 NSFRKPALVFMGTPDFAVPSLRALVESEFRVLRVVTQPDRPRGRGNKLAPGPVKAYALKQGLEILQPMNIRDHVFVDLIRELRPDFIVVVAFGRILPGMVLDIPRLGCVNVHASLLPRYRGAAPIHWAVMNGEPETGVTTMLMDEGLDTGDILLQEKTAIGPDDNFGVVHDRLAELGAVLLVRTLDRLTAGELVPRPQDESRATYAPPLRREHEVIDWTRTAEEIKNQVRGLDPWPGAHTMLNGRVLKVWRAEIAGDRDGGRPGQVLLADPVRGLVVSTGAGAVRLLEVQPAGRRRVRAEDFLRG 306
>gi|85858798|ref|YP_461000.1| methionyl-tRNA formyltransferase [Syntrophus aciditrophicus SB] >gi|123766242|sp|Q2LRX4|FMT_SYNAS Methionyl-tRNA formyltransferase >gi|85721889|gb|ABC76832.1| methionyl-tRNA formyltransferase [Syntrophus aciditrophicus SB] (312 aa)
Score = 533, Expect = 1.8e-52, Identities = 105/296 (35%), Positives = 168/296 (56%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           I+FMGTPE A  +L  L+   + + AVV QPD+P GR K+++   VK  A    I   QP  IK+      L++++P   V  AFGQ +P ++L  P  GCIN+H SLLP+YRG API+W +I+GE  TGV +M   + +D GD+    +  I   +    L  +++NL  D++L  +  +   + P   Q++S  S+A  + K+D  I + +    I N IRGLS  PGAY F+N K +K+F A          PG +  ++ +G+ ++  +  +++++VQ+E + R  V + L G+
  S:     6 ILFMGTPEFALPSLEILVRNGYPIAAVVTQPDRPKGRGKQLVAPPVKIAATSYQIPVLQPPGIKDPAFLEILEKISPDLIVVAAFGQILPKTVLDFPPLGCINVHPSLLPRYRGAAPINWTLIHGETRTGVTIMYMDEGLDTGDILLQEETPIPPEENFGILHDRLSNLGADLLLRAVRLLEAHQAPRNPQEDSLSSYAPMLKKEDGLIRWSEEVSTIANRIRGLSPAPGAYTFLNGKTLKIFAAAGIEQSVPGQPGEVGKLTDQGLQVTAGNGYVVLQDVQMENRKRMNVSDFLRGH 303
>gi|194014601|ref|ZP_03053218.1| methionyl-tRNA formyltransferase [Bacillus pumilus ATCC 7061] >gi|194013627|gb|EDW23192.1| methionyl-tRNA formyltransferase [Bacillus pumilus ATCC 7061] (317 aa)
Score = 533, Expect = 1.9e-52, Identities = 117/306 (38%), Positives = 185/306 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +IVFMGTP+ +   L  L+ + ++VV VV QPD+P GRK+ +    VK  A++  I   QP K++   EI+  L  L P   VT AFGQ +P  +L  P+FGCIN+HASLLP+ RGGAPIH+A++ G+K+TGV +M  ++++DAGD+    +V I+E D   TL  K++     ++ + +  V N    PI Q+E   ++A NI ++ E+I++ K   E+ N +RGL+  P AY   N   +K+++A     ++   PG +  + KEG +I T +   +L+  VQ  GK +   ++ L G + I++G  L
  S:     3 RIVFMGTPDFSVPVLQTLITEGYEVVGVVTQPDRPKGRKRVLTPPPVKVEALKHGITVLQPEKVRLDEEIDKVLA-LKPDLIVTAAFGQILPKRLLDEPQFGCINVHASLLPELRGGAPIHYAILQGKKKTGVTIMYMVERLDAGDMISKVEVEIDELDNVGTLHDKLSVAGAALLKDTVPNVLNGSISPIPQNEEAATYAPNIKREQERIDWAKTGEELYNQVRGLNPWPVAYTEWNGAHLKVWEAKKVPLEAQEEPGKVIELQKEGPVIGTGNKQGLLLTGVQPAGKKKMSGEDFLRG-ANIEMGQKL 310
>gi|196247687|ref|ZP_03146389.1| methionyl-tRNA formyltransferase [Geobacillus sp. G11MC16] >gi|196212471|gb|EDY07228.1| methionyl-tRNA formyltransferase [Geobacillus sp. G11MC16] (321 aa)
Score = 532, Expect = 2.2e-52, Identities = 118/305 (38%), Positives = 177/305 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIGVTL 317
           IVFMGTP+ A   L  LL+  + VVAVV QPDKP GRK+E++   VK  A +  I   QP KI+E E   ++    P   VT AFGQ +P ++L  P++GCIN+HASLLP+ RGGAPIH+A+  G+ +TGV +M   +++DAGD+    +V IEE+DT  TL  K++     ++   L  +      PI Q+E K ++A NI ++ E+I++ +    I N IR     P  Y   +    K++      + S  +PGTI ++ ++GI+++T  +  I + E+Q  GK R      L G  S + +G  L
  S:     6 IVFMGTPDFAVPVLRQLLDDGYRVVAVVTQPDKPKGRKRELVPPPVKVEAQKHGIPVLQPTKIREPEQYEQVLAFAPDLIVTAAFGQILPKALLDAPKYGCINVHASLLPELRGGAPIHYAIWQGKTKTGVTIMYMAEKLDAGDMLTQVEVPIEETDTVGTLHDKLSAAGAKLLSETLPLLLEGNLAPIPQEEEKATYAPNIRREQERIDWAQPGEAIYNHIRAFHPWPVTYTTYDGNVWKIWWGEKVPAPSLASPGTILSLEEDGIVVATGSETAIKITELQPAGKKRMAASEFLRGAGSRLAVGTKL 314
>gi|138894693|ref|YP_001125146.1| methionyl-tRNA formyltransferase [Geobacillus thermodenitrificans NG80-2] >gi|166214898|sp|A4IM47|FMT_GEOTN Methionyl-tRNA formyltransferase >gi|134266206|gb|ABO66401.1| Methionyl-tRNA formyltransferase [Geobacillus thermodenitrificans NG80-2] (319 aa)
Score = 531, Expect = 2.7e-52, Identities = 118/305 (38%), Positives = 177/305 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIGVTL 317
           IVFMGTP+ A   L  LL+  + VVAVV QPDKP GRK+E++   VK  A +  I   QP KI+E E   ++    P   VT AFGQ +P ++L  P++GCIN+HASLLP+ RGGAPIH+A+  G+ +TGV +M   +++DAGD+    +V IEE+DT  TL  K++     ++   L  +      PI Q+E K ++A NI ++ E+I++ +    I N IR     P  Y   +    K++      + S  +PGTI ++ ++GI+++T  +  I + E+Q  GK R      L G  S + +G  L
  S:     4 IVFMGTPDFAVPVLRQLLDDGYRVVAVVTQPDKPKGRKRELVPPPVKVEAQKHGIPVLQPTKIREPEQYEQVLAFAPDLIVTAAFGQILPKALLDAPKYGCINVHASLLPELRGGAPIHYAIWQGKTKTGVTIMYMAEKLDAGDMLTQVEVPIEETDTVGTLHDKLSAAGAKLLSETLPLLLEGNLAPIPQEEEKATYAPNIRREQERIDWAQPGEAIYNHIRAFHPWPVTYTTYDGNVWKIWWGEKVPAPSLASPGTILSLEEDGIVVATGSETAIKITELQPAGKKRMAASEFLRGAGSRLAVGTKL 312
>gi|166032718|ref|ZP_02235547.1| hypothetical protein DORFOR_02433 [Dorea formicigenerans ATCC 27755] >gi|166027075|gb|EDR45832.1| hypothetical protein DORFOR_02433 [Dorea formicigenerans ATCC 27755] (311 aa)
Score = 529, Expect = 4.6e-52, Identities = 116/307 (37%), Positives = 179/307 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           K++FMGTP+ +   L AL E   +VV  V QPDKP GR  ++ ++ VK+ A+ ++I  +QP KI+E E   ELK+ N    V  AFGQ +P  IL +  +GCIN+HASLLPKYRG API WAVI+GEK +GV  M+  + +D GD+    ++ ++  +T  +L  K+      + +  L+ + +       Q ES  ++A  + K+   IN+   AV+I  LIRGL+  P AY   NDK +KL++A      ++   GTI  + K+   + T +  + ++E+Q++GK R +    L GN  ++ G  LK
  S:     2 KVIFMGTPDFSVGTLEALAEAGHEVVLAVTQPDKPKGRGGKMQYTPVKEAALARDIPVYQPKKIREPECIEELKKYNADIMVVIAFGQILPKEILQMTPYGCINVHASLLPKYRGAAPIQWAVIDGEKFSGVTTMQMNEGLDTGDMILKTEIPLDPKETGGSLHDKLAEAGAKLCVETLKCLEDKTATWEPQGESTTAYAKMLDKNLGNINWNDPAVQIERLIRGLNPWPSAYTHWNDKVIKLWQADVVEDNTDQEAGTIVKVEKDSFYVQTGEGLLKIEELQLQGKKRMDAGAFLRGN-HLEYGEILK 309
>gi|154505953|ref|ZP_02042691.1| hypothetical protein RUMGNA_03495 [Ruminococcus gnavus ATCC 29149] >gi|153793971|gb|EDN76391.1| hypothetical protein RUMGNA_03495 [Ruminococcus gnavus ATCC 29149] (310 aa)
Score = 529, Expect = 5.2e-52, Identities = 109/296 (36%), Positives = 168/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +++FMGTP+ +   L AL+E   +V   V QPDKP GR KE+ F  VK+ A+   I  FQP K++E     EL        V  AFGQ +P +IL +  +GC+N+HASLLPKYRG API WA+I+GE  TGV  M+  + +D GD+    +V I   +T  +L  K++     + +  L+ +      P KQ E+   +A  ++K    I++  +A  I  LIRGL+  P AY    +K +K++ A  +  ++   PGT+ +++K+   + T D  ++V+E+QI GK R +    L G
  S:     2 RVIFMGTPDFSVGTLEALIEAGHEVCLAVTQPDKPKGRGKEMQFPPVKEAALSHGIPVFQPIKVREAACVEELAGYKADVIVVVAFGQILPKAILELTPYGCVNVHASLLPKYRGAAPIQWAIIDGEDVTGVTTMQMDEGLDTGDMLLKTEVPITAEETGESLHDKLSKAGAALCVETLKALEEGTIVPQKQGETPTHYASMLNKKMGNIDWNASAEAIERLIRGLNSWPSAYTHWENKVVKIWSAKVSKEQTKAQPGTVTDVTKDSFSVQTGDGTLIVQELQIPGKKRMKTDAFLRG 299
>gi|110600497|ref|ZP_01388716.1| methionyl-tRNA formyltransferase [Geobacter sp. FRC-32] >gi|110548798|gb|EAT62005.1| methionyl-tRNA formyltransferase [Geobacter sp. FRC-32] (312 aa)
Score = 528, Expect = 6.8e-52, Identities = 101/296 (34%), Positives = 178/296 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+FMGTPE A   L  L+++  +VVAV+ QPD+P GR ++ +   VK LA +  I   QP K++  E+   ++EL P   V  AFGQ +P S+L IP +GCIN+HASLLP++RG AP++W +I+G+ ETGV  M     +D GD+   +  +I+  + T +L  +++ +  D +   L+ +   +    KQD++   +A  + K+D  I++ ++   + NL+RG++  PG Y F++ K +K+++     ++    PGT+    ++G+ ++     ++++E+Q+EGK R    + L G
  S:     2 RIIFMGTPEFACPTLQKLIDRKEEVVAVITQPDRPRGRGQQTLPPPVKVLAEQHGIPVMQPVKVRVPEVVESIRELAPDLIVVVAFGQILPKSLLDIPPYGCINVHASLLPRWRGAAPLNWCIIDGDTETGVTTMMMDVGLDTGDMLLKKTTSIDPDENTQSLHDRLSIIGADALAETLDLLNAGKLVREKQDDALTCYASMLKKEDGLIDWSRDPRSVKNLVRGMTPWPGTYTFLDGKMLKVYRV--RIAEGEGEPGTVIGAGRQGLEVACTGGSVIIEELQLEGKKRLPAGDFLAG 297
>gi|116514364|ref|YP_813270.1| methionyl-tRNA formyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274904|sp|Q049P0|FMT_LACDB Methionyl-tRNA formyltransferase >gi|116093679|gb|ABJ58832.1| methionyl-tRNA formyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (315 aa)
Score = 527, Expect = 8.2e-52, Identities = 112/298 (37%), Positives = 184/298 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++F+GTP+     L  L++  + ++AVV QPDK +GRK+++++S VK++A+  ++  +QP ++ + +  +EL +L+    +T AFGQF+P   L   +   +N+H SLLPKYRGGAPI +AV NG+ ETGV +M  +K+MDAGD+Y    + I   +T+  +F+++  L  D++L  L K+ + E     QD S+V F+  ISK +E+I+ +  A E  NLIR L+  PGAY  I  +++K++KA V+ ++ S  A   + N  +  I  +      L+ EVQ  GK    +K+ LNG  +
  S:     4 VIFLGTPQFGATVLEGLIKAGYHILAVVTQPDKKVGRKQKVVYSPVKEVALANDLPLYQPVRLSKSDELDELLQLDADFIITAAFGQFLPTKFLKSAKIAAVNVHGSLLPKYRGGAPIQYAVRNGDAETGVTIMEMVKEMDAGDMYAQASLPIRPDETSGEVFEELAPLGRDLLLETLPKIASGEIVKKPQDPSQVVFSPTISKAEERISLKLTAKEAKNLIRALNPDPGAYLVIKGQRLKVWKAEVADDNTSLPAGHLLTNQGRFAISFAGNTVLNLL-EVQPNGKKAMAIKDFLNGQGK 303
>gi|15673875|ref|NP_268050.1| methionyl-tRNA formyltransferase [Lactococcus lactis subsp. lactis Il1403] >gi|13878482|sp|Q9CEE9|FMT_LACLA Methionyl-tRNA formyltransferase >gi|12724928|gb|AAK05991.1|AE006419_1 methyonyl-tRNA formyltransferase (EC 2.1.2.9) [Lactococcus lactis subsp. lactis Il1403] (319 aa)
Score = 527, Expect = 9.1e-52, Identities = 119/303 (39%), Positives = 192/303 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIG 314
           KI+FMGTP+ A   L  L++ + ++++AVV QPD+ +GRK+E+  + VK+LA+  N+   QP K+    E+     L E      VT AFGQF+P  +L + +F  +N HASLLPKYRGGAPIH+A++NGEKE GV +M  I++MDAGD+       I E D   T+F+K+  +  D++L  L K  + +     Q+E +V+F+ NIS ++EKI++ K+A EI N +RG++  P A+   N ++ K+++  V  +S  N   G I   +K+ + ++T +  + +  VQ  GK + ++ + LNG   +I++G
  S:     5 KIIFMGTPQFAATVLKGLIDSNQYEILAVVTQPDRKVGRKQELRMTPVKELALTVNLPVLQPEKLSGSVEMTQIMTLLESGEVGIVTAAFGQFLPGKLLDVAQFA-VNTHASLLPKYRGGAPIHYAIMNGEKEAGVTIMEMIRKMDAGDMIAQDSTPILEDDNVGTMFEKLALVGRDLLLETLPKYLSGQLKAQAQNEDEVTFSPNISPEEEKIDWNKSAREIFNKVRGMNPFPVAHTTWNGERFKIYETKVVDDSVGNLQAGEIVEKTKKSLKVATGEGLLELLFVQPAGKPKMDIVSFLNGLGQKIQVG 314
>gi|161507729|ref|YP_001577690.1| methionyl-tRNA formyltransferase FMT [Lactobacillus helveticus DPC 4571] >gi|160348718|gb|ABX27392.1| Methionyl-tRNA formyltransferase FMT [Lactobacillus helveticus DPC 4571] (315 aa)
Score = 525, Expect = 1.6e-51, Identities = 114/295 (38%), Positives = 180/295 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEG-ILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           ++FMGTPE +   L  L++ ++++ AVV QPDK +GRK++I  +  K  A + ++  FQP K+   E   ++ +++    VT A+GQF+P   L   +   +N+H SLLPKYRGGAPI +++ING+ ETG+ +M  +K+MDAGD+Y  + + IE  D   TLF K++ +  D++L  L  + +     I QD  KV F+ NI+K+ E+I     A E  N+IR L+  PGAY  +  K+ K++KA      ++  PG +  ++ +G   IS  D  +L + EVQ  GK + ++KN LNG
  S:     5 VIFMGTPEFSVPVLEGLIKNNYEIKAVVTQPDKKVGRKQKITKTPAKIAAEKHDLPVFQPVKLSGSEEMQQVIDMHADLIVTAAYGQFLPTKFLKSVKIAAVNVHGSLLPKYRGGAPIQYSLINGDAETGITIMEMVKKMDAGDIYSQKAIKIEPDDNAGTLFSKLSIVGRDLLLETLPSIIDGSIKKIPQDPDKVVFSPNITKEQERIVPTMTATEANNMIRALNPDPGAYMMLEGKRFKVWKAEVAKDSTDLKPGCV--VANKGRFAISFADGTVLNLLEVQPSGKKKMDIKNFLNG 301
>gi|167747882|ref|ZP_02420009.1| hypothetical protein ANACAC_02611 [Anaerostipes caccae DSM 14662] >gi|167652704|gb|EDR96833.1| hypothetical protein ANACAC_02611 [Anaerostipes caccae DSM 14662] (320 aa)
Score = 523, Expect = 2.7e-51, Identities = 122/317 (38%), Positives = 189/317 (59%)
  Q:     1 MGEKRNSCKNK-KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           M +KR S ++   +VFMGTPE A   L  L +    V A V QPDK  GR K++ F  VK+ A++  I   QP K ++ +   +L++L P   V  A+GQ +P+ IL+IP++GCIN+H SLLPKYRG  PI WAV+NGEKETG+  M   K +D GD+     + +++ +T+ TL  K+  L  D++L  LEK+ N      KQ++++ S+A  +SK+  +I F K+A EI   +RGL+  P AY  +  K +K++ A   +   +  PGTI  ++K+ ++++     + + E+Q+ GK R  V+  L G S +  G  L
  S:     1 MWKKRKSKEDAMNVVFMGTPEFAVPTLEKLTQ-FHHVAAAVTQPDKQKGRGKKLSFPPVKEAALKHGIPVLQPAKARDEQFIEDLEQLAPDVIVVVAYGQILPERILNIPKYGCINVHGSLLPKYRGAGPIQWAVLNGEKETGITTMYMEKGLDTGDMIDKAVIPLDQKETSGTLHDKLMELGADLLLETLEKLENGTAVRTKQNDNESSYAPMLSKEMGEIEFTKSAAEIEQWVRGLNPWPSAYTELGGKTLKIWDADIVSYDGDERPGTIIEVTKKQMIVACGQDALALNEIQLSGKKRMSVQAFLAG-SRVDTGTVL 318
>gi|160893329|ref|ZP_02074116.1| hypothetical protein CLOL250_00878 [Clostridium sp. L2-50] >gi|156865021|gb|EDO58452.1| hypothetical protein CLOL250_00878 [Clostridium sp. L2-50] (317 aa)
Score = 523, Expect = 2.9e-51, Identities = 114/302 (37%), Positives = 182/302 (60%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAV-------STNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           I++MGTPE A   L  +++   +V+A   QPDKP GR K +  + VK+ A+  +I  +QP K++E EN   +++  P A V  A+GQ +P+SIL+IP++GCINIHASLLPKYRG API WA+INGE E+GV  M   K +D GD+     V I ++DT  TL  K+ +    ++L+ L K+ +       QD+S   +A  + K+  +++F K+A  +  LIRGL   P AY  +N K +++++A        +    +   PG I +++K+   ++     + ++++Q EGK   +    L GN ++K G
  S:     3 IIYMGTPEFAVKPLQTIVDAGHNVLACFTQPDKPKGRGKTLQPTPVKEKALSLDIPVYQPVKLREEENVQIIRDYQPDAIVVAAYGQILPESILNIPKYGCINIHASLLPKYRGAAPIEWAIINGETESGVTTMYMAKGLDTGDMIEKTVVPITDTDTGVTLHDKLADAGAALILSTLTKLADHTAVRTPQDDSLSCYASMLKKEQGELDFTKDAASLERLIRGLQPWPVAYMKMNQKTVRIYEASVCEQTEETLEDGTKIVPGMIVHVTKKNFTVACGSGALTIRKLQPEGKKPMDCAAFLAGN-KLKTG 312
>gi|116512830|ref|YP_811737.1| methionyl-tRNA formyltransferase [Lactococcus lactis subsp. cremoris SK11] >gi|123320172|sp|Q02WP8|FMT_LACLS Methionyl-tRNA formyltransferase >gi|116108484|gb|ABJ73624.1| methionyl-tRNA formyltransferase [Lactococcus lactis subsp. cremoris SK11] (323 aa)
Score = 522, Expect = 3.2e-51, Identities = 116/296 (39%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK-EIENE----LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA-----PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KI+FMGTP+ A   L  L++ + ++++AVV QPD+ +GRK+E+  + VK+LA+  N+   QP K+   +E      L E      VT AFGQF+P  +L +  F  +N HASLLPKYRGGAPIH+A++NGEKE GV +M  I++MDAGD+       I E D   T+F+K+  +  D++L  L K    +     Q+E +V+F+ NIS ++EKI++ K+A EI N +RG++  P A+   N ++ K++++   +   NN+      G I   +K+ + ++T +  + +  VQ  GK + ++ + LNG
  S:     5 KIIFMGTPQFAATVLKGLIDSNQYEILAVVTQPDRKVGRKQELRMTPVKELALTVNLPVLQPEKLSGSVEMTQIMTLLESGEVGIVTAAFGQFLPGKLLDVARFA-VNTHASLLPKYRGGAPIHYAIMNGEKEAGVTIMEMIRKMDAGDMIAQNSTPILEEDNVGTMFEKLAFVGRDLLLETLPKYLEGQLKAQAQNEDEVTFSPNISPEEEKIDWNKSAREIFNKVRGMNPFPVAHTLWNGERFKIYESKVADEIVNNSDNPLQAGQIVEKTKKSLKVATGNGILELLTVQPAGKPKMDIVSFLNG 310
>gi|113968374|ref|YP_732167.1| methionyl-tRNA formyltransferase [Shewanella sp. MR-4] >gi|123325548|sp|Q0HPA7|FMT_SHESM Methionyl-tRNA formyltransferase >gi|113883058|gb|ABI37110.1| methionyl-tRNA formyltransferase [Shewanella sp. MR-4] (318 aa)
Score = 522, Expect = 3.6e-51, Identities = 107/298 (35%), Positives = 176/298 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L AL+    +V+AV  QPD+P GR K++  S VK+LA+  NI  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+ DT++TL++K+     D +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + SN APGTI + SK+GI ++T D  + +  +Q+ GK    V +ILN   +
  S:     6 IIFAGTPDFAARHLQALINSHHNVIAVYTQPDRPAGRGKKLTASPVKELAVSHNIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDDDTSATLYEKLALQGPDALLQALEGLANGTLTAEKQDEALANYAEKLSKEEARLDWSKSATQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSTTSSNAAPGTIISASKKGIEVATGDGVLTLLSMQLPGKKPLSVADILNARGD 305
>gi|153855355|ref|ZP_01996504.1| hypothetical protein DORLON_02518 [Dorea longicatena DSM 13814] >gi|149752175|gb|EDM62106.1| hypothetical protein DORLON_02518 [Dorea longicatena DSM 13814] (322 aa)
Score = 520, Expect = 5.4e-51, Identities = 118/306 (38%), Positives = 174/306 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K++FMGTP+ +   L AL+E   +VV  V QPDKP GR  ++ ++ VK+ A+   I  FQP KI+E +   EL++ N    V  AFGQ +P  IL +  +GCIN+HASLLP YRG API WAVING+K +GV  M+  + +D GD+    +V + E +T  +L  K+      + +  L+ + +       Q ES  ++A  + K    I++ K+A  I  LIRGL+  P AY   N K MK+++A   +  ++  PGTI  + K+G  + T D  + V  +QI GK R E    L G  +I+ G  L
  S:     8 KVIFMGTPDFSVGTLEALIEAGHEVVLAVTQPDKPKGRGGKMQYTPVKEAALAHGIPVFQPVKIREAQAVEELRKYNADIMVVIAFGQILPKEILEMTPYGCINVHASLLPSYRGAAPIQWAVINGDKVSGVTTMQMNEGLDTGDMIMKTEVPLAEDETGGSLHDKLAKAGAKLCVETLKALEDKTATWETQGESPTAYAKMLDKKLGDIDWSKSAKAIECLIRGLNPWPSAYTDWNGKVMKIWEAKVLDENTDATPGTIVKVEKDGFSVQTGDGLLKVLVLQIPGKKRMEADAFLRG-YQIETGCEL 314
>gi|114045539|ref|YP_736089.1| methionyl-tRNA formyltransferase [Shewanella sp. MR-7] >gi|123327057|sp|Q0I0S3|FMT_SHESR Methionyl-tRNA formyltransferase >gi|113886981|gb|ABI41032.1| methionyl-tRNA formyltransferase [Shewanella sp. MR-7] (318 aa)
Score = 520, Expect = 5.9e-51, Identities = 106/298 (35%), Positives = 176/298 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L AL+    +V+AV  QPD+P GR K++  S VK+LA+  +I  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+ DT++TL++K+     D +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + SN APGTI + SK+GI ++T D  + +  +Q+ GK    V +ILN   +
  S:     6 IIFAGTPDFAARHLQALINSHHNVIAVYTQPDRPAGRGKKLTASPVKELAVSHDIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDDDTSATLYEKLAQQGPDALLQALEGLANGTLTAEKQDEALANYAEKLSKEEARLDWSKSATQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQISTTSSNAAPGTIISASKKGIEVATGDGVLTLLSMQLPGKKPLSVADILNARGD 305
>gi|152994059|ref|YP_001338894.1| methionyl-tRNA formyltransferase [Marinomonas sp. MWYL1] >gi|150834983|gb|ABR68959.1| methionyl-tRNA formyltransferase [Marinomonas sp. MWYL1] (332 aa)
Score = 519, Expect = 6.7e-51, Identities = 117/306 (38%), Positives = 184/306 (60%)
  Q:    12 KIVFMGTPEIATYALNALL--------EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE--IKIGVTL 317
           +I+F GTPE A  +L ALL        E  +++V V  QPD+P GR ++++ S VK+LAI  +I  +QP   K+ E+  +L  L     +  A+G  +P  +L  P+FGCIN+HASLLP++RG APIH ++I G+ ETG+ +M+    +D GD+      +I+ +DT+ TL  ++  L    ++  LEK       P +QDES   +A  ++K +  +N+  +A  I   IRGLS  P AY       MK+  A +++ S   + PG I  +SKEGI+++T    IL+ E+Q  G  R +V++ LNG ++  ++IG  L
  S:     7 RIIFAGTPEFAAASLQALLTKMKDSNAENQYEIVGVYTQPDRPAGRGQKLVQSPVKQLAIVNDIPVYQPLNFKQDEDKAQLAALEADLMIVAAYGIILPKVVLDTPKFGCINVHASLLPRWRGAAPIHRSLIAGDGETGITIMQMDVGLDTGDMLLKAYCDIKPTDTSETLHDRLAVLGGSTLIEALEKFKAGTLVPEQQDESLTCYAAKLTKQEGNVNWSSSAELIERQIRGLSPWPVAYTNSLAGVMKIHAAHIASVSDEASTPGDILVVSKEGIIVATGQGSILITEIQFAGGKRMKVQDALNGKNKAALEIGQRL 325
>gi|146291134|ref|YP_001181558.1| methionyl-tRNA formyltransferase [Shewanella putrefaciens CN-32] >gi|166215512|sp|A4Y1C6|FMT_SHEPC Methionyl-tRNA formyltransferase >gi|145562824|gb|ABP73759.1| methionyl-tRNA formyltransferase [Shewanella putrefaciens CN-32] (318 aa)
Score = 519, Expect = 6.9e-51, Identities = 110/302 (36%), Positives = 178/302 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L ALL    +V+ V  QPD+P GR K++  S VK+LAI  NI  FQP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE++DT+++L++K+       +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++A  + + S  APGTI + SK+GI ++T D  + +  +Q+ GKN   V +ILN   E
  S:     2 KSLNIIFAGTPDFAARHLQALLNSQHNVIGVYTQPDRPAGRGKKLTASPVKELAIANNIPVFQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDNDTSASLYEKLAEQGPIALLQALEGLTNGTLAAEKQDEALANYAEKLSKEEARLDWNKSAKQLWQEVRAFNPWPVSYFEHQGNTIKVWQAHVSETISTAAPGTIISASKKGIEVATADGVLTLLSMQLPGKNPLNVADILNARGE 305
>gi|156932267|ref|YP_001436183.1| hypothetical protein ESA_00038 [Enterobacter sakazakii ATCC BAA-894] >gi|166214894|sp|A7MPE8|FMT_ENTS8 Methionyl-tRNA formyltransferase >gi|156530521|gb|ABU75347.1| hypothetical protein ESA_00038 [Enterobacter sakazakii ATCC BAA-894] (315 aa)
Score = 519, Expect = 7.2e-51, Identities = 105/299 (35%), Positives = 178/299 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL  S  VV V  QPD+P GR K+++   VK LA E +I  FQP  ++  EN+  +  LN    V  A+G  +P+++LS+P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+  K +D GD+       I   DT+++L+ K+  L    +L  LE +      P KQD+++ ++A  +SK++ ++++  +A ++   IR  +  P ++  I+++ +K++KA     +S+  PGTI +  K+GI ++T D  + ++ +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSSHQVVGVFTQPDRPAGRGKKLMPGPVKVLAQENDIPVFQPKSLRSAENQELVAALNADVMVVVAYGLILPEAVLSMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDKGLDTGDMLRKLSCPITADDTSASLYDKLAQLGPQGLLATLEDLAAGRAVPEKQDDAQATYADKLSKEEARLDWTLSAAQLERCIRAFNPWPVSFFMIDEQPVKVWKASVIRQQSHATPGTILDAGKQGIQVATTDGILNLESLQPAGKKPMSAQDLLNSRRE 306
>gi|56419707|ref|YP_147025.1| methionyl-tRNA formyltransferase [Geobacillus kaustophilus HTA426] >gi|73919394|sp|Q5L0S3|FMT_GEOKA Methionyl-tRNA formyltransferase >gi|56379549|dbj|BAD75457.1| methionyl-tRNA formyltransferase [Geobacillus kaustophilus HTA426] (319 aa)
Score = 519, Expect = 7.8e-51, Identities = 116/305 (38%), Positives = 174/305 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIGVTL 317
           IVFMGTP+ A   L  LL+  + V AVV QPDKP GRK+E +   VK  A  + I   QP KI+E E   ++    P   VT AFGQ +P ++L  P++GCIN+HASLLP+ RGGAPIH+A+  G+ +TGV +M  ++++DAGD+    +V I E+DT  TL  K++     ++   L  +      P+ QDE K ++A NI ++ E+I++ +    I N IR     P  Y   +    K++      +  +  PGTI  + + GI+++T  +  I + E+Q  GK R  V   L G  S + +G+ L
  S:     4 IVFMGTPDFAVPILRQLLDDGYHVAAVVTQPDKPKGRKREPVPPPVKVEAERRGIPVLQPTKIREPEQYEQVLAFAPDLIVTAAFGQILPKALLDAPKYGCINVHASLLPELRGGAPIHYAIWQGKTKTGVTIMYMVERLDAGDMLAQVEVPIAETDTVGTLHDKLSAAGAKLLSETLPLLLEGNIAPVPQDEEKATYAPNIRREQERIDWTQPGEAIYNHIRAFHPWPVTYTTQDGHIWKVWWGEKVPAPRSAPPGTILALEENGIVVATGNETAIRITELQPAGKKRMAVGEFLRGAGSRLAVGMKL 312
>gi|150390545|ref|YP_001320594.1| methionyl-tRNA formyltransferase [Alkaliphilus metalliredigens QYMF] >gi|166988360|sp|A6TRW7|FMT_ALKMQ Methionyl-tRNA formyltransferase >gi|149950407|gb|ABR48935.1| methionyl-tRNA formyltransferase [Alkaliphilus metalliredigens QYMF] (314 aa)
Score = 519, Expect = 8.1e-51, Identities = 115/306 (37%), Positives = 179/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           ++++MGTPE A   L++L+   +DVVAV  QPD+P GR K++  + VK+LA+   +  +QP K++E  +   +K L P   V  A+GQ +   IL IP +GCIN+HASLLPKYRG APIH A+I+GEK+TGV  M     +D GD+   ++V I   +T   L  ++  L  D ++  L +V        KQ++ + S+A  + K   +IN+ ++A  I NLIRG    P AY      ++K++K+    S+ +  PG I  + K GI + T    ++++ +Q  GK   +V+  L GN+ I+ GV L
  S:     2 RVIYMGTPEFAVAPLHSLIGNQYDVVAVFTQPDRPKGRGKKLQSTPVKELALAHGLMLYQPIKLRESSVVEIIKSLEPDVIVVVAYGQILSKEILEIPTYGCINVHASLLPKYRGAAPIHRAIIDGEKKTGVTTMYMDVGLDTGDMLLKKEVLIGADETAGELRDRLMALGADTLIKTLNQVQRGTLVGEKQNDLESSYAAMLDKGLGQINWNQSAEAIRNLIRGTIPWPMAYTTYLGNRVKIWKSRIEESEVSGKPGEILKVEKSGIFVKTGQGTLVIERIQFSGKKPLDVREYLAGNT-IEKGVLL 308
>gi|119943872|ref|YP_941552.1| methionyl-tRNA formyltransferase [Psychromonas ingrahamii 37] >gi|166215503|sp|A1SR38|FMT_PSYIN Methionyl-tRNA formyltransferase >gi|119862476|gb|ABM01953.1| methionyl-tRNA formyltransferase [Psychromonas ingrahamii 37] (316 aa)
Score = 518, Expect = 9.0e-51, Identities = 108/299 (36%), Positives = 177/299 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           I+F GTP+ A   L+AL+    +V+AV  QPD+P GR K +  S+VK+LA+E+ I  +QP   KE+++  +L  LN    +  A+G  +P  +L IP  GC+N+H SLLP++RG API  A+  G+ ETGV +M+  + +D GD+       IE  +T+++L++K+     D++++ + K+   E    KQD     +A  +SK +  I++ K+AV I   IR  +  P +Y  ++DK +K+ +A    +KS    GTI   SK GI ++T +  I ++ +Q+ GK    V++ILN   E+
  S:     6 IIFAGTPDFAAKHLSALINSEHNVIAVYTQPDRPAGRGKRLTASAVKELAMEQQIPVYQPANFKEVDSTKQLAALNADLMIVVAYGLLLPQLVLGIPRLGCLNVHGSLLPRWRGAAPIQRAIWAGDTETGVTIMQMDEGLDTGDMLAKVSCPIERDETSASLYEKLALQAPDVLVDTINKLVKGELKAEKQDPQLACYAKKLSKSEALIDWSKDAVFIERCIRAFNPWPVSYFVLDDKVIKVRQAGLLATKSEQTAGTIITASKNGIQVATGEGIINLEVLQLAGKKALPVQDILNSRREL 306
>gi|116618608|ref|YP_818979.1| methionyl-tRNA formyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097455|gb|ABJ62606.1| methionyl-tRNA formyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (321 aa)
Score = 518, Expect = 9.3e-51, Identities = 118/295 (40%), Positives = 181/295 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINF-EKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           +V MGTP  A   L ALLE + +DV AVV QPD+P GRK  +  S VK  A+ +N+   QP KI    E++ ++ ++NP   VT AFGQF+P  +L   +   +N HASLLPKYRGGAP+H+A++NG+KETGV +M  +K+MDAGDV  + KV I  +D   T+F K++    D++L  L K+      P+ Q+E +V+F+ NI  D + +NF  + A E+   IRGL  T  A+  + D+++K+      +  +   PGTI   SK+ + +++ +  ++ +  +Q  GK+   +   LNG
  S:     5 VVLMGTPSFAVPILEALLENNNYDVKAVVTQPDRPQGRKHTLTPSPVKVAALAQNVPVLQPEKISGSPEMQ-QVIDINPDFIVTAAFGQFLPTKLLDAAKIAAVNTHASLLPKYRGGAPVHYAIMNGDKETGVSIMYMVKKMDAGDVIDTIKVPITSTDNVGTMFDKLSIAGRDLLLKTLPKIATGNIDPVVQNEEEVTFSPNIPHDMQNLNFATETAQELDWHIRGLYPTHPAFVQVLDQRVKITDVTPLSELTAQEPGTIVEKSKKQLKVASANGTVVQINRLQPAGKSEMAISAYLNG 304
>gi|125624918|ref|YP_001033401.1| methionyl-tRNA formyltransferase [Lactococcus lactis subsp. cremoris MG1363] >gi|166214904|sp|A2RN27|FMT_LACLM Methionyl-tRNA formyltransferase >gi|124493726|emb|CAL98714.1| methionyl tRNA formyltransferase [Lactococcus lactis subsp. cremoris MG1363] (323 aa)
Score = 518, Expect = 9.8e-51, Identities = 116/296 (39%), Positives = 186/296 (62%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA-----PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KI+FMGTP+ A   L  L++ + ++++AVV QPD+ +GRK+E+  + VK+LA+  N+   QP K+    E+     L E      VT AFGQF+P  +L +  F  +N HASLLPKYRGGAPIH+A++NGEKE GV +M  I++MDAGD+       I E D   T+F+K+  +  D++L  L K    +     Q+E +V+F+ NIS ++EKI++ K+A EI N +RG++  P A+   N ++ K++++   +   NN+      G I   +K+ + ++T +  + +  VQ  GK + ++ + LNG
  S:     5 KIIFMGTPQFAATVLKGLIDSNKYEILAVVTQPDRKVGRKQELRMTPVKELALTVNLPVLQPEKLSGSVEMTQIMTLLESGEVGIVTAAFGQFLPGKLLVVARFA-VNTHASLLPKYRGGAPIHYAIMNGEKEAGVTIMEMIRKMDAGDMIAQNSTPILEEDNVGTMFEKLAFVGRDLLLETLPKYLEGQLKAQAQNEDEVTFSPNISPEEEKIDWNKSAREIFNKVRGMNPFPVAHTLWNGERFKIYESKVADEIVNNSDNPLQAGQIVEKTKKSLKVATGNGILELLTVQPAGKPKMDIVSFLNG 310
>gi|157692253|ref|YP_001486715.1| methionyl-tRNA formyltransferase [Bacillus pumilus SAFR-032] >gi|166988362|sp|A8FD38|FMT_BACP2 Methionyl-tRNA formyltransferase >gi|157681011|gb|ABV62155.1| methionyl-tRNA formyltransferase [Bacillus pumilus SAFR-032] (317 aa)
Score = 518, Expect = 1.1e-50, Identities = 115/306 (37%), Positives = 183/306 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFD-ILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +IVFMGTP+ +   L  L+ + ++VV VV QPD+P GRK+ +    VK  A++  I   QP K++   EI+  L  L P   VT AFGQ +P  +L  P+FGCIN+HASLLP+ RGGAPIH+A++ G+K+TGV +M  ++++DAGD+    +V I+E D   TL  K++     ++ + +  V +    PI Q+E   ++A NI ++ E++++ K   E+ N +RGL+  P AY   N   +K+++A     +     G +  + KEG +I T +   +L+  VQ  GK +   ++ L G + I+IG  L
  S:     3 RIVFMGTPDFSVPVLQTLITEGYEVVGVVTQPDRPKGRKRVLTPPPVKVEALKHGIPVLQPEKVRLDEEIDKVLA-LKPDLIVTAAFGQILPKRLLDEPQFGCINVHASLLPELRGGAPIHYAILQGKKKTGVTIMYMVERLDAGDMISKVEVEIDELDNVGTLHDKLSVAGAALLKDTVPNVLSGSISPIPQNEDAATYAPNIKREQERLDWTKTGEELYNQVRGLNPWPVAYTEWNGAHLKVWEAKKVPLEVQEEAGKVIELQKEGPVIGTGNKQGLLLTGVQPAGKKKMSGEDFLRG-ANIEIGQKL 310
>gi|24371631|ref|NP_715673.1| methionyl-tRNA formyltransferase [Shewanella oneidensis MR-1] >gi|33516867|sp|Q8EKQ9|FMT_SHEON Methionyl-tRNA formyltransferase >gi|24345387|gb|AAN53118.1|AE015454_12 methionyl-tRNA formyltransferase [Shewanella oneidensis MR-1] (318 aa)
Score = 517, Expect = 1.1e-50, Identities = 107/298 (35%), Positives = 175/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L AL+    +V+AV  QPD+P GR K++  S VK+LA+  +I  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+ DT+++L++K+     D +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + S  APGTI N SK+GI +ST D  + +  +Q+ GK    V +ILN   E
  S:     6 IIFAGTPDFAARHLQALINSHHNVIAVYTQPDRPAGRGKKLTASPVKELALSHSIPVYQPGSLRKEPAQQELASLNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDDDTSASLYEKLALQGPDALLQALEGLANGTLAAEKQDETLANYAEKLSKEEARLDWTKSATQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSTTSSTAAPGTIINASKKGIDVSTGDGVLTLLSMQLPGKKPLSVADILNARGE 305
>gi|37528513|ref|NP_931858.1| methionyl-tRNA formyltransferase [Photorhabdus luminescens subsp. laumondii TTO1] >gi|39931201|sp|Q7MYI1|FMT_PHOLL Methionyl-tRNA formyltransferase >gi|36787951|emb|CAE17068.1| methionyl-tRNA formyltransferase [Photorhabdus luminescens subsp. laumondii TTO1] (315 aa)
Score = 517, Expect = 1.3e-50, Identities = 109/299 (36%), Positives = 179/299 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE---LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +VV V+ +PDKP GR K++  S VK LA E+NI  FQP  ++  EN+   LK+  P   +  A+G  +P  +L+IPE GC+N+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+    +  I   DT+++L++K+ N+  D +L  L  + + +  P  Q+E+ V++A  +SK++ +IN+E +A  +   IR  +  P ++  +  + +K++KA +   +++  PGT+    KEGI I+T D  + + ++Q  GK      N+LN   E
  S:     6 RIVFAGTPDFAARHLEALLMSQHEVVGVLTRPDKPAGRGKKLTPSPVKVLAEERNITVFQPATLRSEENQQWVLKQ-QPDVLIVVAYGLILPKVVLNIPELGCLNVHGSLLPRWRGAAPIQRSLWAGDTETGVTIMQMDIGLDTGDMLYKARCPITPEDTSASLYEKLANIGPDALLKTLSLITSGKSQPETQNENLVTYAEKLSKEEARINWELSATHLERCIRAFNPWPMSFFEMEGQPIKVWKAEAIEEQTSVEPGTVLKADKEGIYIATADGILNITQLQPAGKKAMSAANLLNSKRE 306
>gi|149375619|ref|ZP_01893388.1| methionyl-tRNA formyltransferase [Marinobacter algicola DG893] >gi|149360021|gb|EDM48476.1| methionyl-tRNA formyltransferase [Marinobacter algicola DG893] (311 aa)
Score = 516, Expect = 1.4e-50, Identities = 104/300 (34%), Positives = 173/300 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           ++VF GTPE A  AL +LL     VV V  QPD+P GR +++  S VK++A+E  I  FQP  +K  E ++EL+ LN    +  A+G  +P  +L +P  GC+NIHASLLP++RG API  A+  G++ETG+ +M+    +D G +       IEE+DT  +L  ++  L  + ++  LE++   E     QDE++  +A  +SK++  I++ ++A  I  LIR  +  PG Y  + D ++++ +A   +  S+  PGT+    + GI I+     + +  +Q+ G   Q V +++NG  +I
  S:     2 RLVFAGTPEFAATALKSLLTTHHHVVGVYSQPDRPAGRGRKLTPSPVKQVAVEAGIPVFQPESLKSPEAQDELRSLNADVMIVAAYGLILPQVVLDLPRHGCLNIHASLLPRWRGAAPIQRAIAAGDRETGITIMQMDAGLDTGAMLLKAITPIEEADTGGSLHDRLAGLGGEAIVKALEQLEKGELQGEIQDEARACYARKLSKEEGHIDWTRDAPAISRLIRAFNPWPGTYTDLEDLRIRIHQAEILDDTSDKHPGTVIRRDRTGIDIACGLESLRITRLQLSGSRPQSVNDLINGGKDI 303
>gi|188996795|ref|YP_001931046.1| methionyl-tRNA formyltransferase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931862|gb|ACD66492.1| methionyl-tRNA formyltransferase [Sulfurihydrogenibium sp. YO3AOP1] (311 aa)
Score = 516, Expect = 1.7e-50, Identities = 119/281 (42%), Positives = 174/281 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPG-TINNISKEGILISTKDFDILVKEVQ 292
           K++F GTP+ A  +L AL+E +  VV V+ QPDKP GR ++I  + VK+ A++ NI  FQP KIK   EI   +K+LNP   V  A+G+ +P+ I++IP++  IN+HASLLP+YRG API  A++ G+ +TGVC+M  IK++DAGDVY  R+V I E D   +L  K+      +++  L+K+   E     QD  K ++A  I K + KI+F ++A EI N IR L   P AY    D+++K+  A       N  PG  I    KEGI++ T D  +L+K +Q
  S:     2 KVLFWGTPDFAVKSLKALIESNHQVVGVITQPDKPRGRGQKIQPTPVKEEALKHNIPVFQPEKIKNNQEILETIKKLNPDISVVVAYGKILPEEIINIPKYKTINVHASLLPEYRGAAPIQRAIMEGKDKTGVCIMEIIKELDAGDVYACREVEITEDDDIISLHDKLAEEGARLLIKVLDKIEKGEIDKKPQDHEKATYAKPIEKSEGKIDFSRSAKEIFNQIRALKVWPKAYAKFRDEEVKILDAKIVECNLNALPGEIIKADEKEGIVVKTGDGCLLLKIIQ 286
>gi|150422939|gb|EDN14889.1| methionyl-tRNA formyltransferase [Vibrio cholerae AM-19226] (315 aa)
Score = 516, Expect = 1.7e-50, Identities = 105/299 (35%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +++AV  QPD+P GR K++  S VK LA+E NI  +QP   K  E + +L  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT+++++ K+  L    +L  LE +       +KQD++  ++A+ +SK++ +IN+   A  I   IR  +  P ++  + +  +K+++A         APGTI    K GI ++T    ++++ +QI GK    V++ILN  ++
  S:     6 RIVFAGTPDFAARHLAALLSSEHEIIAVYTQPDRPAGRGKKLTASPVKTLALEHNIPVYQPENFKSDESKQQLAALNADLMVVVAYGLLLPKVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDSETGVTIMQMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQALLECLEDIAQGTAVAVKQDDALANYAHKLSKEEARINWNDEAAHIERCIRAFNPWPMSHFEVAENSIKVWQARVETQAVTQAPGTIVQADKSGIYVATGQGVLVLESLQIPGKKALPVQDILNARAD 306
>gi|184155727|ref|YP_001844067.1| methionyl-tRNA formyltransferase [Lactobacillus fermentum IFO 3956] >gi|183227071|dbj|BAG27587.1| methionyl-tRNA formyltransferase [Lactobacillus fermentum IFO 3956] (316 aa)
Score = 515, Expect = 2.2e-50, Identities = 119/305 (39%), Positives = 188/305 (61%)
  Q:    11 KKIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGV 315
           K IVFMGTP+ A   L AL++ + + V+AVV QPD+ +GRK+E+  + VK+LA+E  I+   P KI      + + EL P   +T AFGQF+PD +L+  +   IN+H SLLPKYRGGAPI +AV+NG+ ETGV +M  +K+MDAGD+     + I + D T T+F+K++ L  D++L+ L K+   +  P+KQDES+V F+ NI+++ E I+F   A  I +L+RGL   P     I+  + K++        ++  PG +  + K  ++I+        +  ++  GK + ++ + LNG+  +K GV
  S:     2 KSIVFMGTPQFAVPILKALIDSEDYQVLAVVSQPDRRVGRKRELRATPVKELALENGIEVLTPEKINHSPEMDRVIELAPDLIITAAFGQFLPDKLLAAAKVAAINVHGSLLPKYRGGAPIQYAVMNGDAETGVTIMYMVKKMDAGDIISQASLPITKQDDTGTMFEKLSLLGRDLLLDTLPKLLAGDITPVKQDESQVVFSPNITREQETIDFTLPADRIDDLVRGLRPAPVGNMVIDGLRTKVYDVTPLTETTDLQPGQVVRVEKHALIIAAGAGTTYQINSLKPAGKPKMDITDYLNGHQNLKPGV 310
>gi|117918493|ref|YP_867685.1| methionyl-tRNA formyltransferase [Shewanella sp. ANA-3] >gi|166215513|sp|A0KR60|FMT_SHESA Methionyl-tRNA formyltransferase >gi|117610825|gb|ABK46279.1| methionyl-tRNA formyltransferase [Shewanella sp. ANA-3] (318 aa)
Score = 514, Expect = 2.8e-50, Identities = 106/298 (35%), Positives = 175/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L AL+    +V+AV  QPD+P GR K++  S VK+LA+  +I  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+ DT++TL++K+     D +L  LE + N      KQDE   ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + SN APGTI + SK+GI ++T D  + +  +Q+ GK    V +ILN   +
  S:     6 IIFAGTPDFAARHLQALINSHHNVIAVYTQPDRPAGRGKKLTASPVKELAVSHDIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDDDTSATLYEKLALQGPDALLQALEGLANGTLTAEKQDEVLANYAEKLSKEEARLDWRKSATQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSTTSSNAAPGTIISASKKGIEVATGDGVLTLLSMQLPGKKPLSVADILNARGD 305
>gi|124548969|ref|ZP_01707413.1| methionyl-tRNA formyltransferase [Shewanella putrefaciens 200] >gi|124508136|gb|EAY52239.1| methionyl-tRNA formyltransferase [Shewanella putrefaciens 200] (318 aa)
Score = 514, Expect = 3.1e-50, Identities = 109/302 (36%), Positives = 176/302 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L ALL    +V+ V  QPD+P GR K++  S VK+LAI  NI  FQP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE++DT+++L++K+       +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++A  + + S  APGTI + SK GI ++T D  + +  +Q+ GK    V +ILN   E
  S:     2 KSLNIIFAGTPDFAARHLQALLNSQHNVIGVYTQPDRPAGRGKKLTASPVKELAIANNIPVFQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDNDTSASLYEKLAEQGPIALLQALEGLTNGTLAAEKQDEALANYAEKLSKEEARLDWNKSAKQLWQEVRAFNPWPVSYFEHQGNTIKVWQAHVSETISTAAPGTIISASKRGIEVATADGVLTLLSMQLPGKKPLNVADILNARGE 305
>gi|194537276|ref|YP_002072420.1| methionyl-tRNA formyltransferase [Vibrio cholerae V51] >gi|125621889|gb|EAZ50214.1| methionyl-tRNA formyltransferase [Vibrio cholerae V51] (315 aa)
Score = 514, Expect = 3.1e-50, Identities = 104/299 (34%), Positives = 171/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +++AV  QPD+P GR K++  S VK LA+E N+  +QP   K  E + +L  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT+++++ K+  L    +L  L+ +       +KQD+   ++AY +SK++ +IN+   A  I   IR  +  P ++  + +  +K+++A         APGTI    K GI ++T    ++++ +QI GK    V++ILN  ++
  S:     6 RIVFAGTPDFAARHLAALLSSEHEIIAVYTQPDRPAGRGKKLTASPVKTLALEHNVPVYQPENFKSDESKQQLAALNADLMVVVAYGLLLPKVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDSETGVTIMQMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQALLECLQDIAQGTAVAVKQDDGLANYAYKLSKEEARINWSDAATHIERCIRAFNPWPMSHFEVAENSIKVWQARVETQAVTQAPGTIVQADKSGIYVATGQGVLVLESLQIPGKKALPVQDILNARAD 306
>gi|168207270|ref|ZP_02633275.1| methionyl-tRNA formyltransferase [Clostridium perfringens E str. JGS1987] >gi|170661359|gb|EDT14042.1| methionyl-tRNA formyltransferase [Clostridium perfringens E str. JGS1987] (309 aa)
Score = 513, Expect = 3.3e-50, Identities = 118/307 (38%), Positives = 184/307 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  +  + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +D  MK+ +       SN  PGTI  + K GI +ST    ++++++Q     +  V+  +NGNS ++IG  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKSMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIRGILNNEITPEKQNEEETCYASMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDDLTMKVHQTRVEKGDSNKEPGTIIAVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNS-VEIGKVLK 309
>gi|169333676|ref|ZP_02860869.1| hypothetical protein ANASTE_00060 [Anaerofustis stercorihominis DSM 17244] >gi|169259670|gb|EDS73636.1| hypothetical protein ANASTE_00060 [Anaerofustis stercorihominis DSM 17244] (312 aa)
Score = 513, Expect = 3.8e-50, Identities = 115/300 (38%), Positives = 191/300 (63%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRK-KEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISK--EGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           K+V+MGTP+ A   L +++E   +V  VV QPDK   R+  +I++S VK+ A++  I+ FQPN++ + E+   +K L P   V CA+GQ +  +IL++ +FGCINIHASLLP  RG APIH ++ING+K TGV  M+  + +D GD+    ++ I +  T   L  KM  +   +++  L K+   E  P KQD++  ++A  I+K+D  I+F +N  +I N IRGL+  P +Y  +++K +K+++++  N  SN   GTI + +K  + +L++ KD  I +KE++++GK + +  +  NGN +I
  S:     2 KVVYMGTPDFAVGPLKSIIESGHEVKLVVSQPDKKNSRRGNKIVYSPVKQCALDNEIEVFQPNRVSDDESYEYIKSLKPDVIVVCAYGQIVKSNILNLVKFGCINIHASLLPHLRGAAPIHRSIINGDKVTGVTTMQMNEGLDTGDMLLKEEIEIGDDMTVGELHDKMEIIGSKLIVETLNKLEKGEINPKKQDDNLSTYANKITKEDCHIDFSENVKDIYNKIRGLNPFPLSYVNLDEKNIKIYESIIKNELSNEKCGTILSYNKKDKALLVAAKDGIIGIKELKMQGKKKMDAASFYNGNRDI 306
>gi|160901541|ref|YP_001567122.1| methionyl-tRNA formyltransferase [Petrotoga mobilis SJ95] >gi|160359185|gb|ABX30799.1| methionyl-tRNA formyltransferase [Petrotoga mobilis SJ95] (319 aa)
Score = 513, Expect = 3.9e-50, Identities = 115/299 (38%), Positives = 183/299 (61%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNS----KSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K+ KIVFMGTP+     L  L++ +F+VV V  QPDKP GR K+    +VK++A++ N+  FQP  + + E  + LKELNP   +T AFG+ +  ++L +P  GC N+HASLLPKYRG API   + NGEKETG+ + + ++ +DAGD+   + V IE +D    +++K+ +L  + VL  L    +L   P  Q+E + S+A  I+K+D  ++F  +A+++ N IR     PG       +++K+F +  ++     ++   PGTI  I K+GIL+  +D  + +KE+Q  GK R    + +NG
  S:     5 KDFKIVFMGTPDFGAQVLEELIKNNFNVVGVFSQPDKPKGRGKKFQPPAVKEVALKYNVPVFQPKSVNKGEGFDFLKELNPDIIITAAFGKILKTNVLKLPPKGCWNVHASLLPKYRGAAPIQRVIENGEKETGISIFKMVEALDAGDIAIQKSVPIEINDNYGIVYEKLLSLAKETVLEFLNSFDHLTLKP--QNEEEASYAEKITKEDLIVDFNNDAIKVHNKIRAYDPYPGVRSVYEKEEVKIFGSEFSDDLFTIENKEEPGTIIRIEKDGILVKCRDGAVKIKEIQFPGKKRISTIDAING 307
>gi|168214220|ref|ZP_02639845.1| methionyl-tRNA formyltransferase [Clostridium perfringens CPE str. F4969] >gi|168217030|ref|ZP_02642655.1| methionyl-tRNA formyltransferase [Clostridium perfringens NCTC 8239] >gi|170714297|gb|EDT26479.1| methionyl-tRNA formyltransferase [Clostridium perfringens CPE str. F4969] >gi|182380966|gb|EDT78445.1| methionyl-tRNA formyltransferase [Clostridium perfringens NCTC 8239] (309 aa)
Score = 513, Expect = 4.0e-50, Identities = 118/307 (38%), Positives = 186/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  ++ + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +D  MK+ +      +SN  PGTI  + K GI +ST    ++++++Q     +  V+  +NGNS ++IG  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKNMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIKGILNNEITPEKQNEEETCYASMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDDITMKVHQTRVEKGESNKEPGTIIAVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNS-VEIGKVLK 309
>gi|182420427|ref|ZP_02951646.1| methionyl-tRNA formyltransferase [Clostridium butyricum 5521] >gi|182375713|gb|EDT73313.1| methionyl-tRNA formyltransferase [Clostridium butyricum 5521] (308 aa)
Score = 512, Expect = 4.3e-50, Identities = 115/296 (38%), Positives = 182/296 (61%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           IVFMGTP+ A  +L  L+EK  +V A++ QPDKP GR K++ +S+VK+  ++ +I  +QP K+KE   +  +LK++ P   +  AFGQ +   +L IP++GCIN+H SLLP YRG API WAVI GEK +G   M     +D GD+    +V I +  T   L+  +     D++L  ++ V N    P KQ++ +  +A  + K+   I+++K A EI NLIRGL+  P AY    +++MK+F++   + K++  PGTI  ++KEG+ ++ KD  +L+K+VQ   K    +   +NG+
  S:     3 IVFMGTPDFAVPSLKRLIEKH-NVTAILTQPDKPKGRGKKMAYSAVKEEGLKHDIPIYQPVKLKEDRELIEKLKDIKPDFMIVVAFGQILTKEVLDIPKYGCINLHGSLLPMYRGAAPIQWAVIKGEKVSGNTTMLMDVGLDTGDMLMKDEVEIPDDMTAGELYDILKERGSDLLLQTIDGVINNTIVPQKQND-ETFYAKMLDKNIAVISWDKTAKEIHNLIRGLNPWPIAYTDYKNERMKIFESEVIDDKTSKCPGTIIEVTKEGMKVACKDSVLLIKKVQFPNKKPLTIAEYINGH 299
>gi|168210624|ref|ZP_02636249.1| methionyl-tRNA formyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|170711312|gb|EDT23494.1| methionyl-tRNA formyltransferase [Clostridium perfringens B str. ATCC 3626] (309 aa)
Score = 512, Expect = 4.6e-50, Identities = 118/307 (38%), Positives = 187/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  ++ + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +D  MK+ +      +SN  PGTI ++ K GI +ST    ++++++Q     +  V+  +NGNS ++IG  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKNMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIKGILNNEITPEKQNEEETCYASMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDDIIMKVHQTRVEKGESNKEPGTIISVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNS-VEIGKVLK 309
>gi|169342702|ref|ZP_02863743.1| methionyl-tRNA formyltransferase [Clostridium perfringens C str. JGS1495] >gi|169299208|gb|EDS81278.1| methionyl-tRNA formyltransferase [Clostridium perfringens C str. JGS1495] (309 aa)
Score = 512, Expect = 4.8e-50, Identities = 118/307 (38%), Positives = 185/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  ++ + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +D  MK+ +       SN  PGTI  + K GI +ST    ++++++Q     +  V+  +NGNS ++IG  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKNMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIKGILNNEITPEKQNEEETCYASMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDDLTMKVHQTRVEKGDSNKEPGTIIAVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNS-VEIGKVLK 309
>gi|18310725|ref|NP_562659.1| methionyl-tRNA formyltransferase [Clostridium perfringens str. 13] >gi|21542041|sp|Q8XJL3|FMT_CLOPE Methionyl-tRNA formyltransferase >gi|18145406|dbj|BAB81449.1| methionyl-tRNA formyltransferase [Clostridium perfringens str. 13] (309 aa)
Score = 512, Expect = 4.8e-50, Identities = 118/307 (38%), Positives = 186/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  ++ + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +D  MK+ +       SN  PGTI ++ K GI +ST    ++++++Q     +  V+  +NGNS ++IG  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKNMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIKGILNNEITPEKQNEEETCYAPMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDDITMKVHQTRVEKGDSNKEPGTIISVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNS-VEIGKVLK 309
>gi|110800829|ref|YP_696429.1| methionyl-tRNA formyltransferase [Clostridium perfringens ATCC 13124] >gi|110675476|gb|ABG84463.1| methionyl-tRNA formyltransferase [Clostridium perfringens ATCC 13124] (309 aa)
Score = 512, Expect = 4.8e-50, Identities = 118/307 (38%), Positives = 185/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  ++ + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +D  MK+ +       SN  PGTI  + K GI +ST    ++++++Q     +  V+  +NGNS ++IG  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKSMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIKGILNNEITPEKQNEEETCYASMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDDITMKVHQTRVEKGDSNKEPGTIIAVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNS-VEIGKVLK 309
>gi|188535244|ref|YP_001909041.1| 10-formyltetrahydrofolate:L-methionyl-tRNA (FMet) N-formyltransferase [Erwinia tasmaniensis] >gi|188030286|emb|CAO98175.1| 10-formyltetrahydrofolate:L-methionyl-tRNA (FMet) N-formyltransferase [Erwinia tasmaniensis] (315 aa)
Score = 512, Expect = 5.3e-50, Identities = 108/299 (36%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KI+F GTP+ A   L+ALL     VV V  QPD+P GR   +  S VK+LA + NI  FQP  ++  EN+ K   LN    V  A+G  +P  +L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       IE +DT++TL+ K+ +L    +L  L ++ +    P  QDES VS+A  +SK++ ++++  +A ++   IR  +  P +Y  I+++ +K++KA    + + + PG I   +K+GI + T D  + ++E+Q  GK   + +++LN   E
  S:     6 KIIFAGTPDFAARHLDALLSSGHQVVGVFTQPDRPAGRGNRVTASPVKQLAAQHNIPVFQPESLRSEENQQKVAALNADVMVVVAYGLILPKLVLEMPRHGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDIGLDTGDMLHKLSCPIEAADTSATLYDKLADLGPAGLLTTLAQLADGSARPQVQDESLVSYAEKLSKEEARLDWSLSAQQLERCIRAFNPWPISYFVIDEQPVKVWKASVLPAVNGHQPGEILQANKQGIQVVTADGVLNIEELQPAGKKAMKAQDLLNSRRE 306
>gi|87121017|ref|ZP_01076909.1| methionyl-tRNA formyltransferase [Marinomonas sp. MED121] >gi|86163855|gb|EAQ65128.1| methionyl-tRNA formyltransferase [Marinomonas sp. MED121] (325 aa)
Score = 511, Expect = 6.2e-50, Identities = 109/296 (36%), Positives = 183/296 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFD----VVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQP--NKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KIVF GTPE A  +L AL+E S D    V+AV  QPD+P GR ++++ S VK+LA+E  I  +QP   K++E    L  L+    V  A+G  +P S+L IP+ GCIN+HASLLP++RG APIH ++I G+KETG+ +M+    +D GD+      +I + DT++ L  ++  L   +++  LE++   ++   KQD++  ++A  ++K +  I++   A ++   IRGLS  PG+Y       +K+ +A + +   S+  PGT+  I+K+ ++++ K+  I + +VQ  G  +  +++ LNG
  S:     9 KIVFAGTPEFAAASLKALIESSNDENHEVIAVYSQPDRPAGRGQKLVASPVKQLALEHEIPVYQPLNFKLEEDRQVLANLDADIMVVAAYGLILPKSVLDIPKLGCINVHASLLPRWRGAAPIHRSLIEGDKETGITIMQMDVGLDTGDMLSKVSCDILDEDTSANLHDRLAPLGGALLVKTLEQIKEGKHQAEKQDDALANYASKLTKQEGLIDWHTPAADLARKIRGLSPWPGSYLETEKGNIKIHQASLHSLEASSFEPGTVIEINKDTVIVAAKEGSIALHKVQFPGGKQLAIRDALNG 311
>gi|160873156|ref|YP_001552472.1| methionyl-tRNA formyltransferase [Shewanella baltica OS195] >gi|189044560|sp|A9KUA1|FMT_SHEB9 Methionyl-tRNA formyltransferase >gi|160858678|gb|ABX47212.1| methionyl-tRNA formyltransferase [Shewanella baltica OS195] (318 aa)
Score = 511, Expect = 6.9e-50, Identities = 106/298 (35%), Positives = 174/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL    +V+ V  QPD+P GR K++  S VK+LA+  NI  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+SDT+++L++K+       +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + S  APGTI + SK+GI ++T D  + +  +Q+ GK    V +ILN   E
  S:     6 IIFAGTPDFAARHLQALLNSHHNVIGVYTQPDRPAGRGKKLTASPVKELAVANNIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTTLPIEDSDTSASLYEKLAEQGPVALLQALEGLVNGTLAAEKQDEALANYAEKLSKEEARLDWNKSAQQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSETTSTAAPGTIISASKKGIEVATADGVLTLLNMQLPGKKPLNVADILNARGE 305
>gi|94264679|ref|ZP_01288461.1| Methionyl-tRNA formyltransferase [delta proteobacterium MLMS-1] >gi|93454910|gb|EAT05154.1| Methionyl-tRNA formyltransferase [delta proteobacterium MLMS-1] (317 aa)
Score = 510, Expect = 7.2e-50, Identities = 119/309 (38%), Positives = 174/309 (56%)
  Q:     6 NSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGIL--ISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           ++ K  +I+F GTPE A   L ALL    +VVAVV QPDKP GR K++    VK+LA    I   QP KIK  +    + EL P   V  A+G+ +P ++L++P  G INIH SLLP YRG AP+ WA++NGE+ETGV +M+  + MD G +   R++ I + DTT +L  KM  L  + ++  LE +   + PP  QD++  + A  + K    I++ ++A  I   IR L   P A   + +  ++LFK    +  +   PGT+   + E  L  I+T    +LV E+Q EG  R  V+  L G+  IK G
  S:     2 STAKPLRIIFFGTPEFAVPPLTALLAHGEEVVAVVTQPDKPKGRSKKLCPPPVKELAQSSGIPVLQPAKIKGEDFLATIGELKPDLLVVAAYGRILPGALLNLPPLGTINIHGSLLPAYRGAAPMQWAILNGEQETGVTIMQMDEGMDTGAILLQRRLTINDDDTTGSLAAKMAPLGGEALVEALELLKAGKLPPQPQDDNLATLAPPLCKTMAAIDWRQSAARISCQIRALDPWPLARTTLGEHPVRLFKPRVADEPAGAEPGTVTVANPENNLLGIATGQGCLLVGEIQREGGKRLTVEAFLRGH-RIKPG 313
>gi|28210908|ref|NP_781852.1| methionyl-tRNA formyltransferase [Clostridium tetani E88] >gi|33516860|sp|Q895Q1|FMT_CLOTE Methionyl-tRNA formyltransferase >gi|28203347|gb|AAO35789.1| methionyl-tRNA formyltransferase [Clostridium tetani E88] (310 aa)
Score = 510, Expect = 8.2e-50, Identities = 119/307 (38%), Positives = 185/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE---LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTPE A  +L  L+ K F V AV  QPD+P GR K++  S +K++A+ +NIK  QP K+++       LK+L+P   +  A+GQ +   IL IP++GCIN+HASLLPKYRG API+WA+INGEK +G   M     +D GD+    +  IE++ T   L  K+     ++++  +  +      P KQ + +  +A  + K   KIN+   + +I NLI+GL+  P AY +     MK+++A   + K + +PG I ++SK GI ++TKD  +L+K++Q   K    V+  + GN +I+ G+ L+
  S:     3 KIVFMGTPEFAVPSLERLI-KEFGVKAVFTQPDRPKGRGKKLSISPIKEVALRENIKILQPQKLRDDREAIEFLKKLSPDFIIVVAYGQILSKEILDIPKYGCINLHASLLPKYRGAAPINWAIINGEKFSGNTTMFMDVGLDTGDMLLKDEFKIEDNTTAGELHNKLMESGGELLVKTINGLVEDSIEPEKQKDEESCYASMLDKKMAKINWNLESEDIKNLIKGLNPWPLAYTYYKGTMMKIYEAEIIDKKEDFSPGFIIDVSKGGIKVATKDGILLLKKIQFPSKKPMYVEEYIRGN-KIEKGIILE 310
>gi|183600720|ref|ZP_02962213.1| hypothetical protein PROSTU_04316 [Providencia stuartii ATCC 25827] >gi|188019700|gb|EDU57740.1| hypothetical protein PROSTU_04316 [Providencia stuartii ATCC 25827] (315 aa)
Score = 509, Expect = 9.3e-50, Identities = 104/299 (34%), Positives = 177/299 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KI+F GTP+ A   L ALL+    VV V+  PDKP GR K++  S VK LA E  I  FQP  +K ++N   +K+ N    +  A+G  +P ++L IP  GC+N+H SLLP++RG API  ++  G+ ETGV +M+  + +D GD+       I   DT++TL++K+  +  + +++ LE + N +  P KQD+S  ++A  +SK++ +I+++++A +I   IR  +  P +Y  + ++ +K+++A       N  PGTI +  K GI ++T +  + + ++Q  GK     +++LN   E
  S:     6 KIIFAGTPDFAAGHLAALLKTKHQVVGVLTPPDKPAGRGKKLTPSPVKVLAQEHQIPVFQPTTLKNVDNHQWIKDHNADLMIVVAYGFILPKAVLDIPRLGCLNVHGSLLPRWRGAAPIQRSIWAGDAETGVTIMQMDEGLDTGDMLYKASCPIMPEDTSATLYEKLAVIGPEALIHTLELISNQQCVPEKQDDSLANYAEKLSKEEARIDWQQSAEQIERCIRAFNPWPMSYFTVQEQLIKVWQAQVIAENHNEQPGTILSADKNGICVATGNGKLNITQLQPPGKKAMGAQDLLNSRRE 306
>gi|120552985|ref|YP_957336.1| methionyl-tRNA formyltransferase [Marinobacter aquaeolei VT8] >gi|120322834|gb|ABM17149.1| methionyl-tRNA formyltransferase [Marinobacter aquaeolei VT8] (311 aa)
Score = 509, Expect = 9.8e-50, Identities = 93/300 (31%), Positives = 176/300 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           +IVF GTP+ A  AL  LL   +D+V V  QPD+P GR ++++ S VK++A++  I  +QP  +K  E + EL  L P   +  A+G  +P ++L+IP  GC+NIHASLLP++RG API  A+  G+ ETG+ +M+  + +D GD+       I   DT  +L  ++  +    ++  +E++   +     Q+E++ ++A+ +SK++  I++ ++A EI  LIR  +  PG +  + ++++++ +A +    S+  PGT+    ++G+ ++     + +   Q+ G   Q + +++NG  ++
  S:     2 RIVFAGTPDFAATALKTLLNAGYDIVGVYTQPDRPAGRGRKLMPSPVKQVALDTGIPVYQPVSLKPEEAQQELASLQPDVMIVAAYGLILPKAVLNIPTHGCLNIHASLLPRWRGAAPIQRAIAAGDAETGITIMQMDEGLDTGDMLLKLDTPISADDTGGSLHDRLAEMGGKAIVQAMERLAKGDLTGEVQNEAEANYAHKLSKEEGHIDWSRSAQEIERLIRAFNPWPGTFTDLGEQRIRIHQASALKQGSDKGPGTVIARERDGVDVACGTGTLRITSAQLPGSKAQSINDLINGGKQV 303
>gi|126172287|ref|YP_001048436.1| methionyl-tRNA formyltransferase [Shewanella baltica OS155] >gi|166215509|sp|A3CYK4|FMT_SHEB5 Methionyl-tRNA formyltransferase >gi|125995492|gb|ABN59567.1| methionyl-tRNA formyltransferase [Shewanella baltica OS155] (318 aa)
Score = 509, Expect = 1.0e-49, Identities = 106/298 (35%), Positives = 174/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL    +V+ V  QPD+P GR K++  S VK+LA+  NI  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+SDT+++L++K+       +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + S  APGTI + SK+GI ++T D  + +  +Q+ GK    V +ILN   E
  S:     6 IIFAGTPDFAARHLQALLNSHHNVIGVYTQPDRPAGRGKKLTASPVKELAVANNIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTTLPIEDSDTSASLYEKLAEQGPVALLQALEGLANGTLAAEKQDEALANYAEKLSKEEARLDWNKSAQQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSETTSTAAPGTIISASKKGIEVATADGVLTLLNMQLPGKKPLNVADILNARGE 305
>gi|149116643|ref|ZP_01843363.1| methionyl-tRNA formyltransferase [Shewanella baltica OS223] >gi|146863368|gb|EDK48906.1| methionyl-tRNA formyltransferase [Shewanella baltica OS223] (318 aa)
Score = 509, Expect = 1.0e-49, Identities = 106/298 (35%), Positives = 174/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL    +V+ V  QPD+P GR K++  S VK+LA+  NI  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+SDT+++L++K+       +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + S  APGTI + SK+GI ++T D  + +  +Q+ GK    V +ILN   E
  S:     6 IIFAGTPDFAARHLQALLNSHHNVIGVYTQPDRPAGRGKKLTASPVKELAVANNIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTYLPIEDSDTSASLYEKLAEQGPVALLQALEGLANGTLAAEKQDEALANYAEKLSKEEARLDWNKSAKQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSETTSTAAPGTIISASKKGIEVATADGVLTLLSMQLPGKKPLNVADILNARGE 305
>gi|51892482|ref|YP_075173.1| 10-formyltetrahydrofolate:L-methionyl-tRNA N-formyltransferase [Symbiobacterium thermophilum IAM 14863] >gi|73919421|sp|Q67PR4|FMT_SYMTH Methionyl-tRNA formyltransferase >gi|51856171|dbj|BAD40329.1| 10-Formyltetrahydrofolate:L-methionyl-tRNA N-formyltransferase [Symbiobacterium thermophilum IAM 14863] (326 aa)
Score = 509, Expect = 1.0e-49, Identities = 115/303 (37%), Positives = 177/303 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINN-ISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           KI+FMGTPE A  +L ALLE  + VV VV QPDKP GR  ++  S VK++A+   +  FQP +++  E+  +LKEL     V  A+GQ +    L I   G IN+HASLLP++RG API  A++ G+ ETGVC M   + MD GDV  + +V I    T   L  ++  +  +++L  + +V   + P I Q    V++A  +   DE I++ + A E+ N IR L+  PGAY      ++K+++A V  N +    PGT+   + +EG  ++  D  +LV+EVQ  GK R + ++ +NG   +++G
  S:     3 KILFMGTPEFAAVSLRALLEAGYPVVGVVTQPDKPAGRGGKLRPSPVKEVALAHGLPVFQPRRLRRPEVVAQLKELGSDLTVVVAYGQILSREALEISPLGSINVHASLLPRWRGAAPIQRAIMAGDVETGVCTMWMDEGMDTGDVCLTARVPIGPDTTGGELHDELARVGAELLLETVRRVEAGDAPRIPQPAEGVTYAAKLEPADEVIDWARPAEELYNQIRALNPWPGAYTNGPRGRLKIWRASVVPNPEPGAEPGTVVALVRREGFTVAAGDGALLVREVQPHGKARMDAQSFVNGGG-VQVG 308
>gi|163722738|ref|ZP_02130275.1| methionyl-tRNA formyltransferase [Desulfatibacillum alkenivorans AK-01] >gi|161403736|gb|EDQ27967.1| methionyl-tRNA formyltransferase [Desulfatibacillum alkenivorans AK-01] (307 aa)
Score = 509, Expect = 1.1e-49, Identities = 112/306 (36%), Positives = 177/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPN--KIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +IVFMG P+ A   L  L E+ +DV AVV QPD+P GR +++    VK+ A+   +   QP   K  E  +EL       FV  A+G  +   +L++P+   INIHAS+LP YRG API W++ING+ +TGV  MR    MD GDV    +V+IE++DT+ TL  K++    D+++N L+ + ++   P  Q+  K ++A  +SK D +I +E+ A  I  LIRG++  PGA+ F++ K+M+  +A   +  +  APGT+ + +    L++T D  + +  VQ       + ++ L G + I  GV L
  S:     2 RIVFMGAPDFAVLPLKKLHEQGYDVAAVVTQPDRPKGRGRKLAPPPVKEEAMRLGLPVLQPENPKTPEFISELAGFEADVFVVIAYGHILTKEVLALPKIMPINIHASILPAYRGPAPIQWSIINGDAKTGVTAMRMDVGMDTGDVLSVAEVDIEDTDTSETLHDKLSQAGADLLINILDNLDSIT--PTPQEHDKATYARALSKADGEIRWEEPAFAIERLIRGVTPWPGAFTFLDGKRMRFLEARLWDEPTQAAPGTVISSTGGVFLVATGDGVLNITRVQGASGKPLKAEDYLRG-ARIDPGVKL 306
>gi|110801608|ref|YP_699029.1| methionyl-tRNA formyltransferase [Clostridium perfringens SM101] >gi|122956627|sp|Q0SS78|FMT_CLOPS Methionyl-tRNA formyltransferase >gi|110682109|gb|ABG85479.1| methionyl-tRNA formyltransferase [Clostridium perfringens SM101] (309 aa)
Score = 509, Expect = 1.1e-49, Identities = 117/307 (38%), Positives = 186/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  ++ + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +D  MK+ +      +SN  PGTI  + K GI +ST    ++++++Q     +  V+  +NGN+ I++G  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKNMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIKGILNNEITPEKQNEEETCYAPMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDDITMKVHQTRVEKGESNKEPGTIIAVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNT-IEVGKVLK 309
>gi|152998581|ref|YP_001364262.1| methionyl-tRNA formyltransferase [Shewanella baltica OS185] >gi|166215510|sp|A6WHB0|FMT_SHEB8 Methionyl-tRNA formyltransferase >gi|151363199|gb|ABS06199.1| methionyl-tRNA formyltransferase [Shewanella baltica OS185] (318 aa)
Score = 508, Expect = 1.2e-49, Identities = 106/298 (35%), Positives = 175/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL    +V+ V  QPD+P GR K++  S VK+LA+  NI  +QP  +++   + EL  LN    V  A+G  +P  +L+ P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+SDT+++L++K+       +L  LE + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++   + + S  APGTI + SK+GI ++T D  + +  +Q+ GK    V +ILN   E
  S:     6 IIFAGTPDFAARHLQALLNSHHNVIGVYTQPDRPAGRGKKLTASPVKELAVGNNIPVYQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLNTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTTLPIEDSDTSASLYEKLAEQGPVALLQALEGLANGTLAAEKQDEALANYAEKLSKEEARLDWNKSAQQLWQEVRAFNPWPVSYFEHQGNTIKVWQTQVSETTSTAAPGTIISASKKGIEVATADGVLTLLNMQLPGKKPLNVADILNARGE 305
>gi|194538945|ref|YP_002074009.1| methionyl-tRNA formyltransferase [Vibrio sp. Ex25] >gi|151937500|gb|EDN56357.1| methionyl-tRNA formyltransferase [Vibrio sp. Ex25] (315 aa)
Score = 508, Expect = 1.2e-49, Identities = 99/298 (33%), Positives = 176/298 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +IVF GTP+ A   L ALL    +V+AV   PD+P GR K++    VK+LA+E NI  +QP   K  E + EL +LN    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT++++++K+  L  + +++ L  +   +  P+KQD+   ++A  +SK++ +IN+  +A  I   +R  +  P ++    +  +K++++      S+   GTI    K GI ++T +  ++++++Q+ GK    V++ILN  +
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTNPDRPAGRGKKLAAPPVKQLALEHNIPVYQPESFKSDEAKQELADLNADLMVVVAYGMLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEATDTSASMYEKLAELGPEALIDCLADIATGKAEPVKQDDELANYAKKLSKEEARINWNDDAAHIERCVRAFNPWPMSHFEAAENSIKVWQSRVAEQTSDKPAGTIVQADKTGIYVATGNGVLVLEQLQVPGKKAMSVQDILNSRA 305
>gi|94266528|ref|ZP_01290216.1| Methionyl-tRNA formyltransferase [delta proteobacterium MLMS-1] >gi|94268713|ref|ZP_01291264.1| Methionyl-tRNA formyltransferase [delta proteobacterium MLMS-1] >gi|93451496|gb|EAT02325.1| Methionyl-tRNA formyltransferase [delta proteobacterium MLMS-1] >gi|93452857|gb|EAT03377.1| Methionyl-tRNA formyltransferase [delta proteobacterium MLMS-1] (317 aa)
Score = 508, Expect = 1.2e-49, Identities = 119/309 (38%), Positives = 173/309 (55%)
  Q:     6 NSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGIL--ISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           ++ K  +I+F GTPE A   L ALL    +VVAVV QPDKP GR K++    VK+LA    I   QP KIK  +    + EL P   V  A+G+ +P ++L++P  G INIH SLLP YRG AP+ WA++NGE+ETGV +M+  + MD G +   R++ I + DTT +L  KM  L    ++  LE +   + PP  QD++  + A  + K    I++ ++A  I   IR L   P A   + +  ++LFK    +  +   PGT+   + E  L  I+T    +LV E+Q EG  R  V+  L G+  IK G
  S:     2 STAKPLRIIFFGTPEFAVPPLTALLAHGEEVVAVVTQPDKPKGRSKKLCPPPVKELAQSSGIPVLQPAKIKGEDFLATIGELKPDLLVVAAYGRILPGALLNLPPLGTINIHGSLLPAYRGAAPMQWAILNGEQETGVTIMQMDEGMDTGAILLQRRLTINDDDTTGSLAAKMAPLGGQALVEALELLKAGKLPPQPQDDNLATLAPPLCKTMAAIDWRQSAARISCQIRALDPWPLARTTLGEHPVRLFKPRVADEPAGAEPGTVTVANPENNLLGIATGQGCLLVGEIQREGGKRLTVEAFLRGH-RIKPG 313
>gi|118578952|ref|YP_900202.1| methionyl-tRNA formyltransferase [Pelobacter propionicus DSM 2379] >gi|166215495|sp|A1ALC4|FMT_PELPD Methionyl-tRNA formyltransferase >gi|118501662|gb|ABK98144.1| methionyl-tRNA formyltransferase [Pelobacter propionicus DSM 2379] (319 aa)
Score = 508, Expect = 1.3e-49, Identities = 104/298 (34%), Positives = 175/298 (58%)
  Q:    10 NKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++ IVFMGTPE A   L AL+++   ++AVV QPD+P GR  +++   VK+LA+  +I   QP++++       +++L P   V  AFGQ +P ++L IP  GC+N+HASLLP+YRG AP++W +INGE ETGV  M     +D G +   R   I+E++   +L  +M +L  +++   L+ +      P  Q++S   +A  + K+   I++++ A +I N +RGL+  PGA   +N   +KLF+    +     APGT+   +   + ++  D  +L++E+Q+ GK R +  + L G
  S:     3 SRSIVFMGTPEFACPTLQALIDRGERLLAVVTQPDRPKGRGHKLMPPPVKELALAHDIPVLQPHRVRASAFVESIRQLAPELIVVVAFGQILPKALLDIPPLGCVNVHASLLPRYRGAAPLNWCIINGETETGVTTMLMDTGLDTGPMLLKRSTPIDENEDIVSLHDRMASLGAELLAETLDGLREGRIEPQPQNDSLSCYAPLLKKEHGLIDWQRPARQIHNQVRGLAAWPGAQTLLNGHALKLFRTRVADGAG--APGTVLCSTGGQLEVACLDGSLLIQELQLAGKKRLDSASFLAG 300
>gi|153830119|ref|ZP_01982786.1| methionyl-tRNA formyltransferase [Vibrio cholerae 623-39] >gi|148874383|gb|EDL72518.1| methionyl-tRNA formyltransferase [Vibrio cholerae 623-39] (315 aa)
Score = 508, Expect = 1.3e-49, Identities = 103/299 (34%), Positives = 171/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +++AV  QPD+P GR K++  S VK LA+E N+  +QP   K  E + +L  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT+++++ K+  L    +L  L+ +       +KQD+   ++A+ +SK++ +IN+   A  I   IR  +  P ++  + +  +K+++A         APGTI    K GI ++T    ++++ +QI GK    V++ILN  ++
  S:     6 RIVFAGTPDFAARHLAALLSSEHEIIAVYTQPDRPAGRGKKLTASPVKTLALEHNVPVYQPENFKSDESKQQLAALNADLMVVVAYGLLLPKVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDNETGVTIMQMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQALLECLQDIAQGTAVAVKQDDGLANYAHKLSKEEARINWSDAATHIERCIRAFNPWPMSHFEVAENSIKVWQARVETQAVTQAPGTIVQADKSGIYVATGQGVLVLESLQIPGKKALPVQDILNARAD 306
>gi|153212950|ref|ZP_01948544.1| methionyl-tRNA formyltransferase [Vibrio cholerae 1587] >gi|153826421|ref|ZP_01979088.1| methionyl-tRNA formyltransferase [Vibrio cholerae MZO-2] >gi|194535129|ref|YP_002070315.1| methionyl-tRNA formyltransferase [Vibrio cholerae RC385] >gi|124116176|gb|EAY34996.1| methionyl-tRNA formyltransferase [Vibrio cholerae 1587] >gi|149739807|gb|EDM54002.1| methionyl-tRNA formyltransferase [Vibrio cholerae MZO-2] >gi|150419923|gb|EDN12233.1| methionyl-tRNA formyltransferase [Vibrio cholerae RC385] (315 aa)
Score = 508, Expect = 1.3e-49, Identities = 103/299 (34%), Positives = 171/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +++AV  QPD+P GR K++  S VK LA+E N+  +QP   K  E + +L  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT+++++ K+  L    +L  L+ +       +KQD+   ++A+ +SK++ +IN+   A  I   IR  +  P ++  + +  +K+++A         APGTI    K GI ++T    ++++ +QI GK    V++ILN  ++
  S:     6 RIVFAGTPDFAARHLAALLSSEHEIIAVYTQPDRPAGRGKKLTASPVKTLALEHNVPVYQPENFKSDESKQQLAALNADLMVVVAYGLLLPKVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDSETGVTIMQMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQALLECLQDIAQGTAVAVKQDDGLANYAHKLSKEEARINWSDAATHIERCIRAFNPWPMSHFEVAENSIKVWQARVETQAVTQAPGTIVQADKSGIYVATGQGVLVLESLQIPGKKALPVQDILNARAD 306
>gi|163731096|ref|ZP_02138562.1| methionyl-tRNA formyltransferase [Vibrio fischeri MJ11] >gi|161395656|gb|EDQ19959.1| methionyl-tRNA formyltransferase [Vibrio fischeri MJ11] (315 aa)
Score = 507, Expect = 1.7e-49, Identities = 105/309 (33%), Positives = 182/309 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           K  +I+F GTP+ A   L+AL++   +V+ V  QPD+P GR K++  S VK+LA+E NI  FQP   K  E + EL + N    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT+++++ K+  L    +++ L  + +      KQD+   ++A  +SK++ KI++  +A+ I   +R  +  P ++  + DK +K++++   +   +  PGTI    K GI ++T    I+ +++Q+ GK    V++ILN   E  ++G TL
  S:     3 KPLRIIFAGTPDFAARHLSALIDSHHEVIGVYTQPDRPAGRGKKLTASPVKELALEHNIPVFQPENFKSDEAKQELADQNADLMVVVAYGLLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEATDTSASMYDKLAELGPVALVDCLSDIADGSAIAQKQDDELANYAKKLSKEEAKIDWTMDAIAIERCVRAFNPWPMSHFSVEDKAIKVWQSRVESYTGDATPGTIIQADKTGIYVATGSDAIVFEQLQVPGKKAMGVQDILNSRKEWFEVGNTL 314
>gi|146313353|ref|YP_001178427.1| methionyl-tRNA formyltransferase [Enterobacter sp. 638] >gi|166988366|sp|A4WF96|FMT_ENT38 Methionyl-tRNA formyltransferase >gi|145320229|gb|ABP62376.1| methionyl-tRNA formyltransferase [Enterobacter sp. 638] (315 aa)
Score = 507, Expect = 1.7e-49, Identities = 102/302 (33%), Positives = 179/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  +I+F GTP+ A   L+ALL     +V V  QPD+P GR K+++   VK LA + N+  FQP  ++  EN+  + +LN    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +MR    +D GD+       I   DT++TL+ K+ +L    ++  L+++ + +  P  QDE+ V++A  +SK++ ++++  +A ++   IR  +  P ++  I+++ +K++KA   N ++   PGTI   ++EGI ++T D  + ++ +Q  GK     +++LN   E
  S:     3 KKLRIIFAGTPDFAARHLDALLSSGHQIVGVFTQPDRPAGRGKKLMPGPVKVLAEKHNLPVFQPVSLRPQENQQLVSDLNADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDSETGVTIMRMDVGLDTGDMLYKLACPITAEDTSATLYDKLADLGPQGLIETLQQLADGKAQPEVQDEAFVTYAEKLSKEEAQLDWSLSAAQLERCIRAFNPWPMSWMTIDEQPVKIWKASVINREAKAEPGTIIEATREGIQVATADGILNLESLQPAGKKAMSAQDLLNSRRE 306
>gi|163803317|ref|ZP_02197195.1| methionyl-tRNA formyltransferase [Vibrio campbellii AND4] >gi|159172887|gb|EDP57726.1| methionyl-tRNA formyltransferase [Vibrio campbellii AND4] (315 aa)
Score = 507, Expect = 1.8e-49, Identities = 103/306 (33%), Positives = 178/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN-SEIKIGVTL 317
           +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E +I  +QP   K    + EL +LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT++++++K+  L  D ++  L  +   +  P+KQD+ + ++A  +SK++ +IN+  +A  I   +R  +  P ++    +  +K++++      S+   GTI    K GI + T +  ++++++Q+ GK    V++ILN   S  ++G  L
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKTIALEHDIPVYQPENFKSDHAKQELADLNADIMVVVAYGLLLPQVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEASDTSASMYEKLAGLGPDALIECLADIATGKAEPVKQDDEQANYAKKLSKEEARINWNDDAAHIERCVRAFNPWPMSHFETAENSIKVWQSRVEEQTSDKPAGTILQADKTGIYVVTGNGVLVLEQLQVPGKKAMSVQDILNSRASWFEVGTQL 314
>gi|153802786|ref|ZP_01957372.1| methionyl-tRNA formyltransferase [Vibrio cholerae MZO-3] >gi|124121699|gb|EAY40442.1| methionyl-tRNA formyltransferase [Vibrio cholerae MZO-3] (315 aa)
Score = 507, Expect = 2.0e-49, Identities = 102/299 (34%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +++AV  QPD+P GR K++  S VK LA+E N+  +QP   K  E + +L  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT+++++ K+  L    +L  L+++       +KQD++  ++A+ +SK++ +IN+   A  I   IR  +  P ++  + +  +K+++A          PGTI    K GI ++T    ++++ +QI GK    V++ILN  ++
  S:     6 RIVFAGTPDFAARHLAALLSSEHEIIAVYTQPDRPAGRGKKLTASPVKTLALEHNVPVYQPENFKSDESKQQLAALNADLMVVVAYGLLLPKVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDSETGVTIMQMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQALLECLQEIAQGTAVAVKQDDALANYAHKLSKEEARINWNDEAAHIERCIRAFNPWPMSHFEVAENSIKVWQARVETRAVTQTPGTIIQADKSGIYVATGQDVLVLESLQIPGKKALPVQDILNARAD 306
>gi|153224318|ref|ZP_01954375.1| methionyl-tRNA formyltransferase [Vibrio cholerae MAK 757] >gi|124117684|gb|EAY36427.1| methionyl-tRNA formyltransferase [Vibrio cholerae MAK 757] (315 aa)
Score = 507, Expect = 2.0e-49, Identities = 102/299 (34%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +++AV  QPD+P GR K++  S VK LA+E N+  +QP   K  E + +L  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT+++++ K+  L    +L  L+++       +KQD++  ++A+ +SK++ +IN+   A  I   IR  +  P ++  + +  +K+++A          PGTI    K GI ++T    ++++ +QI GK    V++ILN  ++
  S:     6 RIVFAGTPDFAARHLAALLSSEHEIIAVYTQPDRPAGRGKKLTASPVKTLALEHNVPVYQPENFKSDESKQQLAALNADLMVVVAYGLLLPKVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDSETGVTIMQMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQALLECLQEIAQGTAVAVKQDDALANYAHKLSKEEARINWNDEAAHIERCIRAFNPWPMSHFEVAENSIKVWQARVETRAVTQTPGTIIQADKSGIYVATGQDVLVLESLQIPGKKALPVQDILNARAD 306
>gi|182625882|ref|ZP_02953648.1| methionyl-tRNA formyltransferase [Clostridium perfringens D str. JGS1721] >gi|177908916|gb|EDT71408.1| methionyl-tRNA formyltransferase [Clostridium perfringens D str. JGS1721] (309 aa)
Score = 506, Expect = 2.2e-49, Identities = 117/307 (38%), Positives = 185/307 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           KIVFMGTP+ A  +L +L+ + F V AV  QPD+P GR K++  S VK++A+E NI  +QP ++K   E   ELK + P   +  AFGQ +P  +L IP++GCIN+HASLLPK+RG AP++W++I GEK TG   M     +D GD+    +V I ++ T   L   +     ++++  ++ + N E  P KQ+E +  +A  ++K+  KI++  +A +I NL+RGL+  P A    +   MK+ +      +SN  PGTI  + K GI +ST    ++++++Q     +  V+  +NGNS ++IG  LK
  S:     2 KIVFMGTPDFAVPSLKSLINE-FGVEAVFTQPDRPKGRGKKLGMSPVKEVALEHNIPVYQPLRLKNEPETIEELKNMEPDFIIVVAFGQILPKEVLDIPKYGCINLHASLLPKFRGAAPLNWSIIKGEKVTGNTTMLMDVGLDTGDMLLKDEVEITDNMTAGELHDILMERGGELLVRTIKGILNNEITPEKQNEEETCYASMLNKEIAKIDWSLSAQDIHNLVRGLNPWPVALTSYDHITMKVHQTRVEKGESNKEPGTIIAVDKTGIKVSTGKDILVIEKLQFPNSKQLFVEQFINGNS-VEIGKVLK 309
>gi|52842800|ref|YP_096599.1| methionyl tRNA formyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|73919401|sp|Q5ZSC5|FMT_LEGPH Methionyl-tRNA formyltransferase >gi|52629911|gb|AAU28652.1| methionyl tRNA formyltransferase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] (314 aa)
Score = 506, Expect = 2.4e-49, Identities = 107/306 (34%), Positives = 176/306 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILN-GNSEIKIGVTLK 318
           +VF GTPE     L+AL++    + AV  QPD+P GR +++  S VK+ AI   I  +QP   K  E  +EL  L P   V  A+G  +P ++L IP  GCIN+HASLLP++RG +PI  A+++G+ E+GV +M+    +D G + C     +  SDT  +L  K+  +    +L+ LE + +       Q+    ++A  I+K++ +IN+ ++AVEI   IR  +  P AY    +  +++ +A +T+  S   PG I NI K G+L++T D  +LV+++Q  G     V++ LN G +++  G+ L+
  S:     6 VVFAGTPEFGLPCLDALIQSRHHLKAVYTQPDRPAGRGRKLQESPVKEWAINHQIPVYQPLNFKNQEAVDELSALKPDVMVVIAYGLILPKAVLEIPRLGCINVHASLLPRWRGASPIQHAILHGDAESGVTIMQMDVGLDTGPMLCKAACPVTSSDTAGSLHDKLAKMSVKPLLDVLEALASNSAQFELQNNELATYAGKINKEEARINWHQSAVEIDRKIRAFNPWPVAYTLAGELMLRIHQAKATDIMSTEMPGMILNIDKNGMLVATSDNALLVEKIQFPGAKIISVRDWLNSGKTQLHTGLMLQ 314
>gi|153837688|ref|ZP_01990355.1| methionyl-tRNA formyltransferase [Vibrio parahaemolyticus AQ3810] >gi|149748978|gb|EDM59805.1| methionyl-tRNA formyltransferase [Vibrio parahaemolyticus AQ3810] (315 aa)
Score = 506, Expect = 2.7e-49, Identities = 99/298 (33%), Positives = 176/298 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +IVF GTP+ A   L ALL    +V+AV   PD+P GR K++    VK+LA+E NI  +QP   K  E + EL +LN    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT++++++K+  L  + +++ L  +   +  P+KQD+   ++A  +SK++ +IN+  +A  I   +R  +  P ++    +  +K++++      S+   GTI    K GI ++T +  ++++++Q+ GK    V++ILN  +
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTNPDRPAGRGKKLAAPPVKQLALEHNIPVYQPESFKSDEAKQELADLNADLMVVVAYGMLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEATDTSASMYEKLAELGPEALIDCLADIAAGKAVPVKQDDELANYAKKLSKEEARINWNDDAAHIERCVRAFNPWPMSHFEAAENSIKVWQSRVAEQTSDKPAGTIVQADKTGIYVATGNGVLVLEQLQVPGKKAMSVQDILNSRA 305
>gi|123444065|ref|YP_001008035.1| methionyl-tRNA formyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] >gi|166215598|sp|A1JRZ2|FMT_YERE8 Methionyl-tRNA formyltransferase >gi|122091026|emb|CAL13909.1| methionyl-tRNA formyltransferase [Yersinia enterocolitica subsp. enterocolitica 8081] (315 aa)
Score = 505, Expect = 2.7e-49, Identities = 103/299 (34%), Positives = 177/299 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L ALL     +V V  QPD+P GR  ++  S VK LA + +I  FQP  ++  EN+  + +LN    V  A+G  +P S+L++P  GCIN+H SLLP++RG API  ++  G+ +TGV +M+    +D GD+    + +I+  DT++TL+ K+  L    +L  L+++      P  QDE++V++A  +SK++ K+++  +AV++   IR  +  P +Y  ++++ +K+++A    +  N APGTI +  K GI ++T D  + + ++Q  GK      ++LN   E
  S:     6 RIIFAGTPDFAARHLGALLSSQHQIVGVFTQPDRPAGRGNKLTPSPVKVLAEQHDIPIFQPKSLRPEENQHLVADLNADIMVVVAYGLILPASVLAMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAKTGVTIMQMDVGLDTGDMLHKIECDIQPEDTSATLYDKLAQLGPQGLLVTLQQLAEGSAQPEVQDEAQVTYAEKLSKEEAKLDWSLSAVQLERCIRAFNPWPVSYFVVDEQPIKVWQAQVLATVDNAAPGTIIHADKHGIQVATADGVLNITQLQPAGKKAMSAADLLNSRRE 306
>gi|59713151|ref|YP_205927.1| methionyl-tRNA formyltransferase [Vibrio fischeri ES114] >gi|73919426|sp|Q5E1Q7|FMT_VIBF1 Methionyl-tRNA formyltransferase >gi|59481252|gb|AAW87039.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Vibrio fischeri ES114] (315 aa)
Score = 505, Expect = 2.7e-49, Identities = 105/309 (33%), Positives = 182/309 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           K  +I+F GTP+ A   L+AL++   +V+ V  QPD+P GR K++  S VK+LA+E NI  FQP   K  E + EL + N    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT+++++ K+  L    +++ L  + +      KQD+   ++A  +SK++ KI++  +A+ I   +R  +  P ++  + DK +K++++   +   +  PGTI    K GI ++T    I+ +++Q+ GK    V++ILN   E  ++G TL
  S:     3 KPLRIIFAGTPDFAARHLSALIDSHHEVIGVYTQPDRPAGRGKKLTASPVKELALEHNIPVFQPENFKSDEAKQELVDQNADLMVVVAYGLLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEATDTSASMYDKLAELGPVALVDCLSDIADGSAIAQKQDDELANYAKKLSKEEAKIDWTMDAIAIERCVRAFNPWPMSHFSVEDKAIKVWQSRVESYTGDATPGTIIQADKTGIYVATGSDAIVFEQLQVPGKKAMGVQDILNSRKEWFEVGNTL 314
>gi|54295431|ref|YP_127846.1| hypothetical protein lpl2517 [Legionella pneumophila str. Lens] >gi|73919402|sp|Q5WTK7|FMT_LEGPL Methionyl-tRNA formyltransferase >gi|53755263|emb|CAH16757.1| hypothetical protein [Legionella pneumophila str. Lens] (314 aa)
Score = 505, Expect = 3.0e-49, Identities = 106/306 (34%), Positives = 176/306 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILN-GNSEIKIGVTLK 318
           +VF GTPE     L+AL++    + AV  QPD+P GR +++  S VK+ AI   I  +QP   K  E  +EL  L P   V  A+G  +P ++L IP  GCIN+HASLLP++RG +PI  A+++G+ E+GV +M+    +D G + C     +  SDT  +L  K+  +    +L+ LE + +       Q+    ++A  I+K++ +IN+ ++AVEI   IR  +  P AY    +  +++ +A +T+  S   PG + NI K G+L++T D  +LV+++Q  G     V++ LN G +++  G+ L+
  S:     6 VVFAGTPEFGLPCLDALIQSRHHLKAVYTQPDRPAGRGRKLQESPVKEWAINHQISVYQPLNFKNQEAVDELSALKPDVMVVIAYGLILPKAVLEIPRLGCINVHASLLPRWRGASPIQHAILHGDAESGVTIMQMDVGLDTGPMLCKAACPVTSSDTAGSLHDKLAKMSVKPLLDVLEALASNSAQFELQNNELATYAGKINKEEARINWHQSAVEIDRKIRAFNPWPVAYTLAGELMLRIHQAKATDIMSTEMPGMVLNIDKTGMLVATSDNALLVEKIQFPGAKVISVRDWLNSGKTQLHTGLMLQ 314
>gi|167621967|ref|YP_001672261.1| methionyl-tRNA formyltransferase [Shewanella halifaxensis HAW-EB4] >gi|189044559|sp|B0TLC9|FMT_SHEHH Methionyl-tRNA formyltransferase >gi|167351989|gb|ABZ74602.1| methionyl-tRNA formyltransferase [Shewanella halifaxensis HAW-EB4] (321 aa)
Score = 505, Expect = 3.0e-49, Identities = 102/298 (34%), Positives = 175/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++F GTP+ A   L AL++   +V+AV  QPD+P GR K++  S VK LA+E  I  FQP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+ ETGV +M+    +D GD+    ++ IE+SDT++TL++K+       ++  L  +     P  KQDES  ++A  +SK++ ++++ K+A  +   IR  +  P ++       +K++++  ++  S+  PGTI +  K GI I+T +  +++ ++Q+ GK    V +ILN  ++
  S:     6 VIFAGTPDFAARHLQALIDSEHNVIAVYTQPDRPAGRGKKLQASPVKALALENGIAVFQPKSLRDEDAQAELTALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDSETGVTIMQMDIGLDTGDMLLKTQLKIEDSDTSATLYEKLAEQGPSALIEALAGIAQDSLPAEKQDESLANYAEKLSKEEARLDWSKSATALWREIRAFNPWPVSHYEHEGNTIKVWQSHVSDETSSKLPGTILSADKNGISIATGEGVLIITQMQLPGKKPLSVADILNSRAD 305
>gi|94499927|ref|ZP_01306463.1| methionyl-tRNA formyltransferase [Oceanobacter sp. RED65] >gi|94428128|gb|EAT13102.1| methionyl-tRNA formyltransferase [Oceanobacter sp. RED65] (313 aa)
Score = 505, Expect = 3.4e-49, Identities = 104/296 (35%), Positives = 170/296 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K+VF GTP+ A   L ALL    DVVAV  QPD+P GR K++  S VK+LA+E  I  +QP   K+ E+   L  L P   V  A+G  +P ++L IP+ GCIN HASLLP++RG API  A+  G+  +GV +M+    +D G +    +  I  SDT  +L  ++  +    V++ + +  N +     QD+S   +A  ++KD+  +++  +A E+   IR  +  P  Y  + D +++L +A       N  PGTI +I+K+GI+++  +F ++++++Q+  K    V ++LNG
  S:     2 KVVFAGTPDFAASHLQALLNNHVDVVAVYTQPDRPAGRGKKLTPSPVKRLALENQIPVYQPENFKQQEDRDALSALQPDLMVVVAYGLLLPQAVLDIPKHGCINSHASLLPRWRGAAPIQRAIEAGDSVSGVTVMQMEAGLDTGPMIKKVETPIMPSDTGGSLHDRLMEMGSQAVVDVVAQFANGQVVAEVQDDSLSCYAKKLTKDEALVDWRSSAEEVARKIRAFNPFPCCYTLLGDHRIRLLQAQIFPQNHNALPGTIMSINKQGIMVACGEFAVVLEKIQLPSKKPMNVADVLNG 299
>gi|170760650|ref|YP_001787824.1| methionyl-tRNA formyltransferase [Clostridium botulinum A3 str. Loch Maree] >gi|169407639|gb|ACA56050.1| methionyl-tRNA formyltransferase [Clostridium botulinum A3 str. Loch Maree] (313 aa)
Score = 504, Expect = 4.0e-49, Identities = 117/301 (38%), Positives = 180/301 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K+  IVFMGTP+ A  +L  L+E+ F+V AV  QPD+P GR K++  S+VK++A+E NI+ +QP ++K  E    +LKE+NP   +  AFGQ +   +L IP++GCIN+HASLLPKYRG API+WA+I GE E+G   M   + +D GD+     V IE+  T   L   +      ++++ ++ +        KQ    + +A  ++K   KI++ K + EI  LIRGL+  P AY    ++ MK++ +      SN  PGTI  +SKEGI ++T D  + +  VQ  GK   +V+  + G++
  S:     2 KDTTIVFMGTPDFAVPSLKKLIEE-FNVKAVFTQPDRPKGRGKKLAMSAVKEVALENNIEVYQPIRLKNDEICIKKLKEINPDFIIVVAFGQILSKEVLDIPKYGCINLHASLLPKYRGAAPINWAIIKGETESGNTTMFMDEGLDTGDMLLKNTVKIEDDMTFGELHDILMETGSKLLVDTIKGLKEGTIKREKQKSENIIYASMLNKQMGKIDWNKTSKEINLLIRGLNPRPVAYTQYKNEAMKIYNSSILKESSNKTPGTILKVSKEGIKVATGDGILSITTVQFPGKKPMKVEEYIKGHT 304
>gi|110637974|ref|YP_678181.1| methionyl-tRNA formyltransferase [Cytophaga hutchinsonii ATCC 33406] >gi|110280655|gb|ABG58841.1| methionyl-tRNA formyltransferase [Cytophaga hutchinsonii ATCC 33406] (302 aa)
Score = 504, Expect = 4.0e-49, Identities = 117/297 (39%), Positives = 173/297 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           +I++MGTP+ A  +L  L+E  FDV AVV  PDKP GR  +I +S+VK+ A++ NI   QP K+K+   IE EL   N   F+  AF + +P+ I  +P  G  N+H SLLPKY+G API+WA+INGE ETG        Q+D GD+    K  I   DT  T++ K+  L  D+VL  +  + +  Y    Q    +  A  I K+   I++  + + I NLIRGL+  P A+    +K  K+FKA+   +++N A G+I + +K GI ++  D  + + E+Q EGK R  V++ L GN
  S:     4 RIIYMGTPDFAVPSLEILIENGFDVAAVVTAPDKPAGRGLKIQYSAVKEAALKHNIPVLQPEKLKDERFIE-ELISYNANLFIVVAF-RMLPEIIWQMPSIGTFNLHGSLLPKYQGAAPINWAIINGETETGCTTFFLKHQIDTGDIILQDKTPILPDDTFETVYNKLKVLGADLVLKTVRMIESETYTSTPQKGQAIH-APKIYKETGAIDWNNSCIAINNLIRGLNPFPSAWFVHAEKTYKVFKAIPEVTQTNAAIGSIKSDNKTGIKVACADGWLSLIEIQAEGKKRMSVQDFLKGN 300
>gi|146297086|ref|YP_001180857.1| methionyl-tRNA formyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166214884|sp|A4XL81|FMT_CALS8 Methionyl-tRNA formyltransferase >gi|145410662|gb|ABP67666.1| methionyl-tRNA formyltransferase [Caldicellulosiruptor saccharolyticus DSM 8903] (311 aa)
Score = 504, Expect = 4.1e-49, Identities = 112/295 (37%), Positives = 184/295 (62%)
  Q:    13 IVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           IVFMGTP+ A   L  L+E+  F++  VV QPDKP+GRK+ +    VK+ A++ N+   QP+++K   E    LK++NP   V  A+G+ +P  IL IP++GCIN+HASLLP+YRG API   +++G+  TG+ +M+  + +D GD+     + IE++D   TL KK++ L   +++  L+ + N+   P+KQD +K ++A  I K + +I+++ +AV+I N  R L   PG +     K +K+   +    ++  N   GTI  I++ GIL+  KD  I +KE+Q+EG  +   ++ +NG
  S:     3 IVFMGTPDFAANILQKLIEEPQFNIKLVVTQPDKPVGRKQILTPPPVKEFALKFNLNVVQPDRLKGNEEFFEVLKKINPEVIVVVAYGKILPKEILQIPKYGCINVHASLLPEYRGAAPIQRVLMDGKNYTGITIMKMDEGLDTGDILLQEGIEIEQNDDVITLSKKLSELGAKLLIETLKNISNI--VPVKQDATKATYAPPIDKKEGQISWDMSAVQIYNRFRALKIWPGIFTIYKGKLLKIHEMEIAKLDNLENVQNGTILGINETGILVKVKDGVIKLKELQLEGGRKMSARDFVNG 301
>gi|148358672|ref|YP_001249879.1| methionyl tRNA formyltransferase [Legionella pneumophila str. Corby] >gi|166214905|sp|A5IAY3|FMT_LEGPC Methionyl-tRNA formyltransferase >gi|148280445|gb|ABQ54533.1| methionyl tRNA formyltransferase [Legionella pneumophila str. Corby] (314 aa)
Score = 504, Expect = 4.1e-49, Identities = 105/306 (34%), Positives = 176/306 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILN-GNSEIKIGVTLK 318
           +VF GTPE     L+AL++    + AV  QPD+P GR +++  S VK+ AI   +  +QP   K  E  +EL  L P   V  A+G  +P ++L IP  GCIN+HASLLP++RG +PI  A+++G+ E+GV +M+    +D G + C     +  SDT  +L  K+  +    +L+ LE + +       Q+    ++A  I+K++ +IN+ ++AVEI   IR  +  P AY    +  +++ +A +T+  S   PG + NI K G+L++T D  +LV+++Q  G     V++ LN G +++  G+ L+
  S:     6 VVFAGTPEFGLSCLDALIQSRHHLKAVYTQPDRPAGRGRKLQESPVKEWAINNQVPVYQPLNFKNQEAIDELSALKPDVMVVIAYGLILPKAVLEIPRLGCINVHASLLPRWRGASPIQHAILHGDAESGVTIMQMDVGLDTGPMLCKATCPVTSSDTAGSLHDKLAKMSVKPLLDVLEALASNSAQFELQNNELATYAGKINKEEARINWHQSAVEIDRKIRAFNPWPVAYTLAEELMLRIHQAKATDIMSTEMPGMVLNIDKNGMLVATNDNALLVEKIQFPGAKVISVRDWLNSGKTQLHTGLMLQ 314
>gi|189426266|ref|YP_001953443.1| methionyl-tRNA formyltransferase [Geobacter lovleyi SZ] >gi|189422525|gb|ACD96923.1| methionyl-tRNA formyltransferase [Geobacter lovleyi SZ] (316 aa)
Score = 504, Expect = 4.2e-49, Identities = 106/297 (35%), Positives = 170/297 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           +I+FMGTPE A   L  LL+++ +VVAV  QPD+P GR +++    VK+LA+   I   QP K++  E+  +++ L P   V  AFGQ +P ++L IP  GC+N+HASLLP+YRG AP++W ++NGE ETGV  M     +D G +   +   I   +   +L  +M+ L  +++   L+ +      P  QD+S+  +A  + K+   I+++K AV I N IRGLS  PGA   +    +KL++  S+  +    PGTI    K GI ++     +++ E+Q  G  + +  + L G+
  S:     5 RIIFMGTPEFACPTLQTLLDRTENVVAVFTQPDRPKGRGQKLQPPPVKELALRHGIPVHQPPKVRTPEVIEQIRALQPDLIVVIAFGQILPKALLEIPPQGCVNVHASLLPRYRGAAPLNWCIVNGETETGVTTMLMDVGLDTGPMLLKKTTPIAPDEDIQSLHDRMSQLGAELLGETLDGLKTGRIVPEAQDDSQSCYAPLLKKEHGLIDWQKPAVTIHNQIRGLSAWPGAVTSLGGAPLKLYR--SSIGQGAGTPGTIIATGKNGIEVACGHGSLIIHELQAAGSKKMDAASFLAGH 301
>gi|91226302|ref|ZP_01261142.1| methionyl-tRNA formyltransferase [Vibrio alginolyticus 12G01] >gi|91189313|gb|EAS75592.1| methionyl-tRNA formyltransferase [Vibrio alginolyticus 12G01] (315 aa)
Score = 504, Expect = 4.2e-49, Identities = 99/298 (33%), Positives = 176/298 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +IVF GTP+ A   L ALL    +V+AV   PD+P GR K++    VK+LA+E NI  +QP   K  E + EL +LN    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT++++++K+  L  + +++ L  +   +  P+KQD+   ++A  +SK++ +IN+  +A  I   +R  +  P ++    +  +K++++      S+   GTI    K GI ++T +  ++++++Q+ GK    V++ILN  +
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTNPDRPAGRGKKLAAPPVKQLALEHNIPVYQPESFKSDEAKQELADLNADLMVVVAYGMLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEATDTSASMYEKLAELGPEALIDCLVDIAAGKAVPVKQDDELANYAKKLSKEEARINWNDDAAHIERCVRAFNPWPMSHFEAAENSIKVWQSRVAEQTSDKPAGTIVQADKTGIYVATGNGVLVLEQLQVPGKKAMSVQDILNSRA 305
>gi|168182586|ref|ZP_02617250.1| methionyl-tRNA formyltransferase [Clostridium botulinum Bf] >gi|182674259|gb|EDT86220.1| methionyl-tRNA formyltransferase [Clostridium botulinum Bf] (313 aa)
Score = 504, Expect = 4.3e-49, Identities = 117/301 (38%), Positives = 181/301 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K+  IVFMGTP+ A  +L  ++EK F+V AV  QPD+P GR K++  S+VK++A++ NI+ +QP K+K  E    +LKE+NP   +  AFGQ +   +L IP++GCIN+HASLLPKYRG API+WA+I GEKE+G   M   + +D GD+     V IE+  T   L   +     +++++ ++ +        KQ    + +A  ++K   KI++ K + EI  LIRGL+  P AY    ++ MK++ +      SN  PGTI  +SK GI ++T D  + +  VQ  GK   +V+  + G++
  S:     2 KDTTIVFMGTPDFAVPSLKKIIEK-FNVKAVFTQPDRPKGRGKKLAMSAVKEVALQNNIEVYQPIKLKNDEICIKKLKEINPDFIIVVAFGQILSKEVLDIPKYGCINLHASLLPKYRGAAPINWAIIKGEKESGNTTMFMDEGLDTGDMLLKNTVKIEDDMTFGELHDILMETGSELLVDTIKGLKEGTIKREKQKSENIIYASMLNKQMGKIDWNKTSKEINLLIRGLNPRPVAYTQYKNETMKIYNSSILKESSNKTPGTILKVSKVGIKVATGDGILSITTVQFPGKKPMKVEEYIKGHT 304
>gi|153834315|ref|ZP_01986982.1| methionyl-tRNA formyltransferase [Vibrio harveyi HY01] >gi|148869323|gb|EDL68337.1| methionyl-tRNA formyltransferase [Vibrio harveyi HY01] (315 aa)
Score = 504, Expect = 4.3e-49, Identities = 103/306 (33%), Positives = 179/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN-SEIKIGVTL 317
           +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E +I  +QP   K  E + EL +LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT++++++K+  L  D +++ L  +   +  P+KQD+   ++A  +SK++ +I++  +A  I   +R  +  P ++    +  +K++++      S+   GTI    K GI + T +  ++++++Q+ GK    V++ILN   S  ++G  L
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKTIALEHDIPVYQPENFKSDEAKQELADLNADIMVVVAYGLLLPQVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEASDTSASMYEKLAGLGPDALIDCLADIAAGKAEPVKQDDELANYAKKLSKEEARIDWNDDAAHIERCVRAFNPWPMSHFEAAENSIKVWQSRVEEQTSDKPAGTIVQADKTGIYVVTGNGVLVLEQLQVPGKKAMSVQDILNSRASWFEVGTQL 314
>gi|54298583|ref|YP_124952.1| hypothetical protein lpp2647 [Legionella pneumophila str. Paris] >gi|73919400|sp|Q5X1U6|FMT_LEGPA Methionyl-tRNA formyltransferase >gi|53752368|emb|CAH13800.1| hypothetical protein [Legionella pneumophila str. Paris] (314 aa)
Score = 503, Expect = 4.7e-49, Identities = 105/306 (34%), Positives = 176/306 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILN-GNSEIKIGVTLK 318
           +VF GTPE     L+AL++    + AV  QPD+P GR +++  S VK+ AI   I  +QP   K  E  +EL  L P   V  A+G  +P ++L IP  GCIN+HASLLP++RG +PI  A+++G+ E+GV +M+    +D G + C     +  SDT  +L  K+  +    +L+ LE + +       Q+    ++A  I+K++ +IN+ ++AVEI   IR  +  P AY    +  +++ +A +T+  S   PG + N+ K G+L++T D  +LV+++Q  G     V++ LN G +++  G+ L+
  S:     6 VVFAGTPEFGLPCLDALIQSRHHLKAVYTQPDRPAGRGRKLQESPVKEWAINHQIPVYQPLNFKNQEAVDELSALKPDVMVVIAYGLILPKAVLEIPRLGCINVHASLLPRWRGASPIQHAILHGDAESGVTIMQMDVGLDTGPMLCKATCPVTSSDTAGSLHDKLAKMSVKPLLDVLEALASNSAQFELQNNELATYAGKINKEEARINWHQSAVEIDRKIRAFNPWPVAYTLAGELMLRIHQAKATDIMSTEMPGMVLNVDKNGMLVATNDNALLVEKIQFPGAKVISVRDWLNSGKTQLHTGLMLQ 314
>gi|156972727|ref|YP_001443634.1| methionyl-tRNA formyltransferase [Vibrio harveyi ATCC BAA-1116] >gi|166215597|sp|A7N122|FMT_VIBHB Methionyl-tRNA formyltransferase >gi|156524321|gb|ABU69407.1| hypothetical protein VIBHAR_00392 [Vibrio harveyi ATCC BAA-1116] (315 aa)
Score = 503, Expect = 4.9e-49, Identities = 103/306 (33%), Positives = 179/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN-SEIKIGVTL 317
           +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E +I  +QP   K  E + EL +LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT++++++K+  L  D +++ L  +   +  P+KQD+   ++A  +SK++ +I++  +A  I   +R  +  P ++    +  +K++++      S+   GTI    K GI + T +  ++++++Q+ GK    V++ILN   S  ++G  L
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKTIALEHDIPVYQPENFKSDEAKQELADLNADIMVVVAYGLLLPQVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEASDTSASMYEKLAGLGPDALIDCLADIAAGKAKPVKQDDELANYAKKLSKEEARIDWNDDAAHIERCVRAFNPWPMSHFEAAENSIKVWQSRVEEQTSDKPAGTILQADKTGIYVVTGNGVLVLEQLQVPGKKAMSVQDILNSRASWFEVGTQL 314
>gi|2914332|pdb|1FMT|A Chain A, Methionyl-Trnafmet Formyltransferase From Escherichia Coli >gi|2914333|pdb|1FMT|B Chain B, Methionyl-Trnafmet Formyltransferase From Escherichia Coli >gi|5822477|pdb|2FMT|A Chain A, Methionyl-Trnafmet Formyltransferase Complexed With Formyl- Methionyl-Trnafmet >gi|5822478|pdb|2FMT|B Chain B, Methionyl-Trnafmet Formyltransferase Complexed With Formyl- Methionyl-Trnafmet (314 aa)
Score = 503, Expect = 5.8e-49, Identities = 105/299 (35%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + EL     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     5 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 305
>gi|16131167|ref|NP_417746.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|89110723|ref|AP_004503.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli W3110] >gi|157162761|ref|YP_001460079.1| methionyl-tRNA formyltransferase [Escherichia coli HS] >gi|170018477|ref|YP_001723431.1| methionyl-tRNA formyltransferase [Escherichia coli ATCC 8739] >gi|170082808|ref|YP_001732128.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|194439996|ref|ZP_03072054.1| methionyl-tRNA formyltransferase [Escherichia coli 101-1] >gi|120451|sp|P23882|FMT_ECOLI Methionyl-tRNA formyltransferase >gi|166988365|sp|A8A592|FMT_ECOHS Methionyl-tRNA formyltransferase >gi|189044510|sp|B1IQ12|FMT_ECOLC Methionyl-tRNA formyltransferase >gi|581088|emb|CAA45207.1| methionyl-tRNA formyltransferase [Escherichia coli] >gi|581089|emb|CAA54368.1| methionyl-tRNA formyltransferase; methionyl-tRNAMetf formyltransferase [Escherichia coli] >gi|1789683|gb|AAC76313.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli str. K-12 substr. MG1655] >gi|85676754|dbj|BAE78004.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli W3110] >gi|157068441|gb|ABV07696.1| methionyl-tRNA formyltransferase [Escherichia coli HS] >gi|169753405|gb|ACA76104.1| methionyl-tRNA formyltransferase [Escherichia coli ATCC 8739] >gi|169890643|gb|ACB04350.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli str. K12 substr. DH10B] >gi|194421048|gb|EDX37077.1| methionyl-tRNA formyltransferase [Escherichia coli 101-1] (315 aa)
Score = 503, Expect = 5.8e-49, Identities = 105/299 (35%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + EL     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|167750830|ref|ZP_02422957.1| hypothetical protein EUBSIR_01813 [Eubacterium siraeum DSM 15702] >gi|167656265|gb|EDS00395.1| hypothetical protein EUBSIR_01813 [Eubacterium siraeum DSM 15702] (306 aa)
Score = 502, Expect = 6.0e-49, Identities = 117/293 (39%), Positives = 171/293 (58%)
  Q:    16 MGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE------LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           MGTP+ A  AL  L  K  +V+AV  QPDKP  R K++    VK+ A +  I  +QP  +++ E+       LK+L P   V  A+GQ +P+SIL +P++ CINIHASLLPKYRG API   +I+GE E+GV  M   K +D GD+  SR V I    T   L   +     ++++  L+        P+ QD+S   +A  I+K+  +I+F KNA+++ N IRG+S +P AY FI DK++K++ AV T+  S+   GT+ N +   ++   K   I   +VQ EG  R    + LNGN
  S:     1 MGTPDFAVSALEEL-HKHHNVMAVFTQPDKPKNRGKKMQAPPVKECAEKYGIPVYQPLSLRKGEDAEKSLELLKQLAPDCIVVAAYGQLLPESILELPKYKCINIHASLLPKYRGAAPIQKCIIDGETESGVTTMLMAKGLDTGDMLMSRSVKITPDMTGGELHDSLAATGGELIIETLKACEEGTIKPVPQDDSLSCYAGLITKEMCRIDFSKNAIDVYNFIRGMSPSPCAYTFIGDKRLKVYFAVMTDITSDKPCGTVVNENDLTVVCGDKKC-IRFTDVQGEGGKRMNTASFLNGN 297
>gi|90581175|ref|ZP_01236974.1| methionyl-tRNA formyltransferase [Vibrio angustum S14] >gi|90437696|gb|EAS62888.1| methionyl-tRNA formyltransferase [Vibrio angustum S14] (314 aa)
Score = 502, Expect = 6.1e-49, Identities = 102/302 (33%), Positives = 172/302 (56%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  +IVF GTP+ A   L ALL     VVAV  QPD+P GR K++  S VK +A+E +I  +QP  ++  E + EL  +     V  A+G  +P  +L  P  GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT++T+++K+ +L  D +++ L  + N     +KQD+   ++A  +SK++  I++  +A  I   +R  +  P +Y  + ++ +K+++A         APGTI +  K+GIL++T +  + +  +Q  GK      ++LN   E
  S:     3 KPLRIVFAGTPDFAARHLAALLSSQHQVVAVYTQPDRPAGRGKKLTASPVKNIALEHDIPVYQPASLRNEEAQQELAAIEADIMVVVAYGLLLPQEVLDTPRLGCINVHGSILPRWRGAAPIQRSIWAGDTETGVTIMQMDIGLDTGDMLKVATLPIEATDTSATMYEKLADLGPDALIDCLSDIANGTAVAVKQDDELANYAKKLSKEEALIDWSMDAAAIERCVRAFNPWPMSYFTVAEQNIKVWQAAVETDNQGKAPGTILSADKQGILVATGNGALRLLSLQPPGKKAMTAADLLNSRRE 306
>gi|28899817|ref|NP_799422.1| methionyl-tRNA formyltransferase [Vibrio parahaemolyticus RIMD 2210633] >gi|31340069|sp|Q87KD4|FMT_VIBPA Methionyl-tRNA formyltransferase >gi|28808069|dbj|BAC61306.1| methionyl-tRNA formyltransferase [Vibrio parahaemolyticus RIMD 2210633] (315 aa)
Score = 502, Expect = 7.0e-49, Identities = 98/298 (32%), Positives = 176/298 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +IVF GTP+ A   L ALL    +V+AV   PD+P GR K++    VK+LA+E NI  +QP   K  E + EL +LN    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT++++++K+  L  + +++ L  +   +  P+KQD+   ++A  ++K++ +IN+  +A  I   +R  +  P ++    +  +K++++      S+   GTI    K GI ++T +  ++++++Q+ GK    V++ILN  +
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTNPDRPAGRGKKLAAPPVKQLALEHNIPVYQPESFKSDEAKQELADLNADLMVVVAYGMLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIEATDTSASMYEKLAELGPEALIDCLADIAAGKAVPVKQDDELANYAKKLNKEEARINWNDDAAHIERCVRAFNPWPMSHFEAAENSIKVWQSRVAEQTSDKPAGTIVQADKTGIYVATGNGVLVLEQLQVPGKKAMSVQDILNSRA 305
>gi|188492657|ref|ZP_02999927.1| methionyl-tRNA formyltransferase [Escherichia coli 53638] >gi|188487856|gb|EDU62959.1| methionyl-tRNA formyltransferase [Escherichia coli 53638] (315 aa)
Score = 501, Expect = 8.2e-49, Identities = 104/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S +K LA EK +  FQP  ++  EN+  + EL     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPIKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|187935454|ref|YP_001885414.1| methionyl-tRNA formyltransferase [Clostridium botulinum B str. Eklund 17B] >gi|187723607|gb|ACD24828.1| methionyl-tRNA formyltransferase [Clostridium botulinum B str. Eklund 17B] (309 aa)
Score = 501, Expect = 9.9e-49, Identities = 113/298 (37%), Positives = 181/298 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           KIVFMGTP+ A  +   L+E+  +V AV+ QPDKP GR K++ +S VK+ A++ +I  +QP K+K   EI  +LKE+NP   +  AFGQ +   +L IP++GCIN+HASLLP YRG AP++W +I GEK++G   M     +D GD+    +V I E  T+  L   +     +++L  +E ++N    PIKQ E +  +A  + K+   IN+  +A +I NL+RGL+  P AY     ++MKL+K    + + +N PGTI  ++K+G+ +      +++++VQ        ++  +NG+S
  S:     2 KIVFMGTPDFAVPSFKKLIEEH-EVKAVLTQPDKPKGRGKKLAYSPVKEEALKHDIPVYQPTKLKDDKEIIEKLKEINPDFIIVVAFGQILTKEVLDIPKYGCINLHASLLPMYRGAAPLNWVIIKGEKKSGNTTMLMDVGLDTGDMLLKEEVEIHEDMTSGELHDILMISGGELLLKTIEGLYNGSIKPIKQ-EGETFYAKMLDKELAHINWNDDAYDIHNLVRGLNPWPIAYTEYKGERMKLYKTKVLDKEVSNKPGTIIEVNKDGVKVVCGKNVLIIEKVQFPNGKPLTIEQYINGHS 300
>gi|91204616|emb|CAJ70844.1| strongly similar to methionyl-tRNA formyltransferase [Candidatus Kuenenia stuttgartiensis] (320 aa)
Score = 500, Expect = 1.0e-48, Identities = 113/295 (38%), Positives = 174/295 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIND-------KKMKLFKA---VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++FMGTPE A  +L+ L +  ++VVAVV QPD+P GR K++  S VK  A+E   +  QP  + +  +  +LK   P   V  AFGQ +   I+ IP F CINIH+SLLPKYRG API+WA+I GE  +GV  M    +MDAGD+   +  +I   +    L K+++ +  +++L  L+ +        KQDE KV+FA  + K+D  I++ +   EI N IRG++  PGAY F N        K++ L K       +++ +  PGT+   +  GI ++T D  I + ++Q EGK   + ++ + G
  S:     3 VIFMGTPEFAVPSLSFLAKSRYNVVAVVTQPDRPKGRSKKLCPSPVKIKAMELGWEILQPANVNDEPVIKQLKRYAPDFIVVVAFGQLLSSRIIDIPRFKCINIHSSLLPKYRGAAPINWAIIKGETMSGVTSMVMTIKMDAGDIIAQKSASISSDENAGELEKRLSFMGAELLLETLDSIATETARYKKQDEEKVTFAPKLKKEDGLISWVEKTQEIHNRIRGVTPLPGAYAFYNKNNLPETRKRIILLKTRIHEGCSTQESIIPGTVVETATCGIHVATLDGSICITQLQPEGKRAMDAQDFIRG 309
>gi|196154846|ref|YP_002124335.1| methionyl-tRNA formyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|88772399|gb|EAR03687.1| methionyl-tRNA formyltransferase [Alteromonas macleodii 'Deep ecotype'] >gi|196110625|gb|ACG64341.1| methionyl-tRNA formyltransferase [Alteromonas macleodii 'Deep ecotype'] (312 aa)
Score = 500, Expect = 1.1e-48, Identities = 110/307 (35%), Positives = 180/307 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNL----VYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIGVTLK 318
           K++F GTP+ A   L+ALLE   +V+AV  QPD+P GR K++  S VK LA E  I  +QP  +K  + + EL  LN    V  A+G  +P ++L+ P+ GCIN+H S+LPK+RG API  ++  G+ ETGV +M+  + +D GD+     + I   DT++T+++K+  L    + D+V ND E      Y P KQD+++ ++A  +SK++  I++  +A +I   IR  +  P A+  + D+ +K++ A       N  PGT+ +  K GI I+T    + +  +QI GK      +++N   S  ++G  +K
  S:     2 KVIFAGTPDFAAKHLSALLESEHEVIAVYTQPDRPAGRGKKLTASPVKVLAEENAIPVYQPQSLKAQDAQEELASLNADLMVVVAYGLILPTAVLNAPKLGCINVHGSILPKWRGAAPIQRSIWAGDAETGVTIMQMDEGLDTGDMLHIATLPIANDDTSATMYEKLATLGPKALVDVV-NDFE-----SYTPTKQDDTQATYANKLSKEEALISWSDDAKQIERNIRAFNPWPVAWMQVEDQNVKVWSADVVTLDKNVKPGTVISADKAGITIATGRDALRITSLQIPGKKALPAADVINARQSWFEVGRCIK 309
>gi|156315058|ref|XP_001617930.1| hypothetical protein NEMVEDRAFT_v1g156333 [Nematostella vectensis] >gi|156196541|gb|EDO25830.1| predicted protein [Nematostella vectensis] (323 aa)
Score = 500, Expect = 1.1e-48, Identities = 116/300 (38%), Positives = 184/300 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNN------APGTINNISKEG-ILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           KI+F GTP I+   L  +L   F+V  V+ QPD+P  R K+I  S VK+LA++ +I+  QP  +K   E+   +K L P   V  A+G  +P  +L IP+ GCINIH SLLPKYRG API  A++  EK TGV +++    MD GD+   +++ IE ++T+ TL  K+ NL   ++++ L    N  YP  KQDE  VS+A  I K +  IN+ +++  I   IRG +  PG + F+++  +K+++A S ++K+ +       PGTI NI+  G I++   +  +L+ ++Q+ GK  Q  K+ ++G S +
  S:     6 KIIFAGTPGISETVLKNILNNKFNVELVLTQPDRPANRGKKITQSPVKELALKHDIEVIQPELVKNNHELFARIKHLQPDIMVVVAYGLILPQELLDIPKLGCINIHVSLLPKYRGAAPIQRAILANEKVTGVTIIKMDSGMDTGDILMQQELKIESTETSGTLHDKLANLGALMIVDYLANHEN--YPVKKQDEVNVSYAPKIEKKEAHINWNEDSHIIERKIRGFNPVPGCFTFLDESLIKIWQADSIDNKNKDYLSIGIKPGTIVNITGVGLIVLCGNNSLLLITKLQVAGKKAQSAKDYVHGQSNL 313
>gi|168180608|ref|ZP_02615272.1| methionyl-tRNA formyltransferase [Clostridium botulinum NCTC 2916] >gi|182668488|gb|EDT80467.1| methionyl-tRNA formyltransferase [Clostridium botulinum NCTC 2916] (313 aa)
Score = 500, Expect = 1.1e-48, Identities = 116/301 (38%), Positives = 182/301 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K+  IVFMGTP+ A  +L  L+E+ F+V AV  QPD+P GR K++  S+VK++A++ NI+ +QP K+K  E    +LKE++P   +  AFGQ +   +L+IP++GCIN+HASLLPKYRG API+WA+I GE E+G   M   + +D GD+     V IE+  T   L   +     +++++ ++ +        KQ    + +A  ++K   KI++ K + EI  LIRGL+  P AY    ++ MK++ +      SN  PGTI  +SKEGI ++T D  + +  VQ  GK   +V+  + G++
  S:     2 KDTTIVFMGTPDFAVPSLKKLIEE-FNVRAVFTQPDRPKGRGKKLAMSAVKEVALQNNIEVYQPIKLKNDEICIKKLKEISPDFIIVVAFGQILSKEVLNIPKYGCINLHASLLPKYRGAAPINWAIIKGENESGNTTMFMDEGLDTGDMLLKNTVKIEDDMTFGELHDILMESGSELLVDTIKGLKEGTIEREKQKSENIIYASMLNKQMGKIDWNKTSKEINLLIRGLNPRPVAYTQYKNETMKIYNSSILKESSNKTPGTILKVSKEGIKVATGDGILSITTVQFPGKKPMKVEEYIKGHT 304
>gi|83589749|ref|YP_429758.1| methionyl-tRNA formyltransferase [Moorella thermoacetica ATCC 39073] >gi|123766805|sp|Q2RK24|FMT_MOOTA Methionyl-tRNA formyltransferase >gi|83572663|gb|ABC19215.1| methionyl-tRNA formyltransferase [Moorella thermoacetica ATCC 39073] (311 aa)
Score = 500, Expect = 1.1e-48, Identities = 106/296 (35%), Positives = 168/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++VFMGTP+ A  +L AL+    +  AV+ QPD+P GR K+++   VK  A+   +   QP+ +K+ E   +L+ L P   V  AFG+ +   IL +P  GC+N+HASLLP+YRG APIH AV+NGE ETGV  M    Q+DAGD+    K+ I    TT  +  ++  +   ++++ LE +     P + QDE+  ++A  +  ++E I++E+ A  I N IRGL+  PGAY   + +++K++ A  T+  +    G +  + +EG ++      +LV  VQ  GK        L G
  S:     2 RLVFMGTPDFAVPSLQALVAAGHEFAAVITQPDRPRGRGKKLLPPPVKSTALAAGLPVRQPSDMKDREFLEDLRLLQPELIVVVAFGRILSREILDLPARGCVNLHASLLPRYRGAAPIHRAVMNGEVETGVTTMWMAPQLDAGDIILQEKLPIPPEATTGEIHDRLAEVGAGLLVHTLELIAASRAPRLPQDEALATYAPPLKPEEEVIHWEQPAQVIYNQIRGLNPWPGAYTLRSGERLKIYGARLTDPSAIGRAGRVVEVGREGFVVQAGTGRLLVTSVQPPGKKIMPASAYLQG 299
>gi|89074759|ref|ZP_01161217.1| methionyl-tRNA formyltransferase [Photobacterium sp. SKA34] >gi|89049523|gb|EAR55084.1| methionyl-tRNA formyltransferase [Photobacterium sp. SKA34] (314 aa)
Score = 500, Expect = 1.2e-48, Identities = 101/302 (33%), Positives = 172/302 (56%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  +IVF GTP+ A   L ALL     VVAV  QPD+P GR K++  S VK +A+E +I  +QP  ++  E + EL  +     V  A+G  +P  +L  P  GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE +DT++T+++K+ +L  D +++ L  + N     +KQD+   ++A  +SK++  I++  +A  I   +R  +  P +Y  + ++ +K+++A   +      PGTI +  K+GIL++T +  + +  +Q  GK      ++LN   E
  S:     3 KPLRIVFAGTPDFAARHLAALLSSQHQVVAVYTQPDRPAGRGKKLTSSPVKNIALEHDIPVYQPASLRNEEAQQELAAIKADIMVVVAYGLLLPQEVLDTPRLGCINVHGSILPRWRGAAPIQRSIWAGDTETGVTIMQMDIGLDTGDMLKVATLPIEATDTSATMYEKLADLGPDALIDCLSDIANSTAVAVKQDDELANYAKKLSKEEALIDWTMDAAAIERCVRAFNPWPMSYFTVAEQNIKVWQATVEDDNQGKVPGTILSADKQGILVATGNGALRLLSLQPPGKKAMTAADLLNSRRE 306
>gi|153941333|ref|YP_001391805.1| methionyl-tRNA formyltransferase [Clostridium botulinum F str. Langeland] >gi|152937229|gb|ABS42727.1| methionyl-tRNA formyltransferase [Clostridium botulinum F str. Langeland] (313 aa)
Score = 500, Expect = 1.2e-48, Identities = 116/301 (38%), Positives = 181/301 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K+  IVFMGTP+ A  +L  L+E+ F+V AV  QPD+P GR K++  S+VK++A++ NI+ +QP K+K  E    +LKE++P   +  AFGQ +   +L IP++GCIN+HASLLPKYRG API+WA+I GE E+G   M   + +D GD+     V IE+  T   L   +     +++++ ++ +        KQ    + +A  ++K   KI++ K + EI  LIRGL+  P AY    ++ MK++ +      SN  PGTI  +SKEGI ++T D  + +  VQ  GK   +V+  + G++
  S:     2 KDTTIVFMGTPDFAVPSLKKLIEE-FNVKAVFTQPDRPKGRGKKLAMSAVKEVALQNNIEVYQPIKLKNDEICIKKLKEISPDFIIVVAFGQILSKEVLDIPKYGCINLHASLLPKYRGAAPINWAIIKGENESGNTTMFMDEGLDTGDMLLKNTVKIEDDMTFGELHDILMESGSELLVDTIKGLKEGTIEREKQKSENIIYASMLNKQMGKIDWNKTSKEINLLIRGLNPRPVAYTQYKNETMKIYNSSILKESSNKTPGTILKVSKEGIKVATGDGILSITTVQFPGKKPMKVEEYIKGHT 304
>gi|194684587|emb|CAR46443.1| methionyl-tRNA formyltransferase [Proteus mirabilis HI4320] (316 aa)
Score = 500, Expect = 1.3e-48, Identities = 105/299 (35%), Positives = 171/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L ALL     +V V+  PDKP GR K++  + VK+LA+  NI  +QP  +K  EN   +K L P   +  A+G  +P ++L IP  GC+N+H SLLPK+RG API  A+  G+ ETGV +M+    +D GD+       I   DT+++L+ K+  L    ++N L+ + + E    KQD+S  ++A  +SK++ KIN+  +A +I   IR  +  P ++  ++D+ +K+++A V  +  +N  PGT+    K GI I T +  + + ++Q  GK      + LN   +
  S:     6 RIIFAGTPDFAARHLAALLSTQHHIVGVLTPPDKPAGRGKKLTINPVKELALTNNIPVYQPTSLKPEENHEWIKALQPDVMIVVAYGMILPKAVLDIPRLGCLNVHGSLLPKWRGAAPIQRALWAGDTETGVTIMQMDVGLDTGDMLYKASCPITHQDTSASLYAKLAELGPKALINTLDLIISGELKAEKQDDSLANYAEKLSKEEAKINWSLSAQQIERCIRAFNPWPMSFFMLDDQPVKVWEAQVIASDNTNQIPGTLLKADKTGIYIVTGEGILNITKLQPSGKKPMASADFLNSKRD 307
>gi|148380463|ref|YP_001255004.1| methionyl-tRNA formyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|153931476|ref|YP_001384686.1| methionyl-tRNA formyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|153934523|ref|YP_001388207.1| methionyl-tRNA formyltransferase [Clostridium botulinum A str. Hall] >gi|148289947|emb|CAL84060.1| putative methionyl-tRNA formyltransferase [Clostridium botulinum A str. ATCC 3502] >gi|152927520|gb|ABS33020.1| methionyl-tRNA formyltransferase [Clostridium botulinum A str. ATCC 19397] >gi|152930437|gb|ABS35936.1| methionyl-tRNA formyltransferase [Clostridium botulinum A str. Hall] (313 aa)
Score = 500, Expect = 1.3e-48, Identities = 116/301 (38%), Positives = 182/301 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K+  IVFMGTP+ A  +L  L+E+ F+V AV  QPD+P GR K++  S+VK++A++ NI+ +QP K+K  E    +LKE++P   +  AFGQ +   +L+IP++GCIN+HASLLPKYRG API+WA+I GE E+G   M   + +D GD+     V IE+  T   L   +     +++++ ++ +        KQ    + +A  ++K   KI++ K + EI  LIRGL+  P AY    ++ MK++ +      SN  PGTI  +SKEGI ++T D  + +  VQ  GK   +V+  + G++
  S:     2 KDTTIVFMGTPDFAVPSLKKLIEE-FNVKAVFTQPDRPKGRGKKLAMSAVKEVALQNNIEVYQPIKLKNDEICIKKLKEISPDFIIVVAFGQILSKEVLNIPKYGCINLHASLLPKYRGAAPINWAIIKGENESGNTTMFMDEGLDTGDMLLKNTVKIEDDMTFGELHDILMESGSELLVDTIKGLKEGTIEREKQKSENIIYASMLNKQMGKIDWNKTSKEINLLIRGLNPRPVAYTQYKNETMKIYNSSILKESSNKTPGTILKVSKEGIKVATGDGILSITTVQFPGKKPMKVEEYIKGHT 304
>gi|168752264|ref|ZP_02777286.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4113] >gi|188013844|gb|EDU51966.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4113] (320 aa)
Score = 499, Expect = 1.3e-48, Identities = 104/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWVEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|15803815|ref|NP_289849.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 EDL933] >gi|15833407|ref|NP_312180.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. Sakai] >gi|168708903|ref|ZP_02741180.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4045] >gi|168738879|ref|ZP_02771156.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4115] >gi|168758515|ref|ZP_02783522.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4401] >gi|168764970|ref|ZP_02789977.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4501] >gi|168769149|ref|ZP_02794156.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4486] >gi|168777855|ref|ZP_02802862.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4196] >gi|168783854|ref|ZP_02808861.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4076] >gi|168786177|ref|ZP_02811184.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC869] >gi|168796527|ref|ZP_02821534.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4042] >gi|168802717|ref|ZP_02827724.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC508] >gi|195939835|ref|ZP_03085217.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4024] >gi|21542040|sp|Q8X8F1|FMT_ECO57 Methionyl-tRNA formyltransferase >gi|12517917|gb|AAG58409.1|AE005556_2 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli O157:H7 EDL933] >gi|13363626|dbj|BAB37576.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Escherichia coli O157:H7 str. Sakai] >gi|187767010|gb|EDU30854.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4196] >gi|188998872|gb|EDU67858.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4076] >gi|189354684|gb|EDU73103.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4401] >gi|189361852|gb|EDU80271.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4486] >gi|189365130|gb|EDU83546.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC4501] >gi|189374012|gb|EDU92428.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC869] >gi|189375352|gb|EDU93768.1| methionyl-tRNA formyltransferase [Escherichia coli O157:H7 str. EC508] (315 aa)
Score = 499, Expect = 1.3e-48, Identities = 104/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWVEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|82778585|ref|YP_404934.1| methionyl-tRNA formyltransferase [Shigella dysenteriae Sd197] >gi|123742077|sp|Q32B62|FMT_SHIDS Methionyl-tRNA formyltransferase >gi|81242733|gb|ABB63443.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Shigella dysenteriae Sd197] (315 aa)
Score = 499, Expect = 1.5e-48, Identities = 104/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|193066482|ref|ZP_03047526.1| methionyl-tRNA formyltransferase [Escherichia coli E22] >gi|194430290|ref|ZP_03062785.1| methionyl-tRNA formyltransferase [Escherichia coli B171] >gi|192925863|gb|EDV80513.1| methionyl-tRNA formyltransferase [Escherichia coli E22] >gi|194411679|gb|EDX28006.1| methionyl-tRNA formyltransferase [Escherichia coli B171] (315 aa)
Score = 499, Expect = 1.5e-48, Identities = 104/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|82545650|ref|YP_409597.1| methionyl-tRNA formyltransferase [Shigella boydii Sb227] >gi|123769392|sp|Q31VY9|FMT_SHIBS Methionyl-tRNA formyltransferase >gi|81247061|gb|ABB67769.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Shigella boydii Sb227] (315 aa)
Score = 499, Expect = 1.6e-48, Identities = 104/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERYIRAFNPWPMSWLEIERQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|163751681|ref|ZP_02158900.1| methionyl-tRNA formyltransferase [Shewanella benthica KT99] >gi|161328420|gb|EDP99576.1| methionyl-tRNA formyltransferase [Shewanella benthica KT99] (319 aa)
Score = 498, Expect = 1.8e-48, Identities = 105/298 (35%), Positives = 174/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           IVF GTP+ A   L AL++    V+ V  QPD+P GR K++  S VK LA+E NI  +QP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETG+ +M+    +D GD+    ++ IE+ DT+ +L+ K+     D ++  L  + N E    KQDE+  ++A  +SK++ ++++ K+A+++   IR  +  P ++   ND  +K+ +A  + S S+   GTI +  K GI I+T +  + ++ +Q+ GK    V +ILN   +
  S:     6 IVFAGTPDFAARHLQALIDSEHHVIGVYSQPDRPAGRGKKLQASPVKTLALEHNIPIYQPKSLRDEAAQQELSGLNADLMVVVAYGLILPQVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGITIMQMDLGLDTGDMLLKTQLTIEDDDTSGSLYDKLALQGPDALIQALAGLANGELKAEKQDETLANYAKKLSKEEAELDWNKSALQLWREIRAFNPWPISHFSHNDASIKVRQAKVSESISDAPAGTIISADKNGIEIATGEGVLSLQNMQLPGKKPLSVGDILNSRGD 305
>gi|170755463|ref|YP_001782052.1| methionyl-tRNA formyltransferase [Clostridium botulinum B1 str. Okra] >gi|169120675|gb|ACA44511.1| methionyl-tRNA formyltransferase [Clostridium botulinum B1 str. Okra] (313 aa)
Score = 498, Expect = 2.0e-48, Identities = 115/301 (38%), Positives = 180/301 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K+  IVFMGTP+ A  +   L+E+ F+V AV  QPD+P GR K++  S+VK++A++ NI+ +QP K+K  E    +LKE++P   +  AFGQ +   +L IP++GCIN+HASLLPKYRG API+WA+I GE E+G   M   + +D GD+     V IE+  T   L   +     +++++ ++ +        KQ    + +A  ++K   KI++ K + EI  LIRGL+  P AY    ++ MK++ +      SN  PGTI  +SKEGI ++T D  + +  VQ  GK   +V+  + G++
  S:     2 KDTTIVFMGTPDFAVPSFKKLIEE-FNVKAVFTQPDRPKGRGKKLAMSAVKEVALQNNIEVYQPIKLKNDEICIKKLKEISPDFIIVVAFGQILSKEVLDIPKYGCINLHASLLPKYRGAAPINWAIIKGENESGNTTMLMDEGLDTGDMLLKNTVKIEDDMTFGELHDILMESGSELLVDTIKGLKEGTIEREKQKSGNIIYASMLNKQMGKIDWNKTSKEINLLIRGLNPRPVAYTQYKNETMKIYNSSILKESSNKTPGTILKVSKEGIKVATGDGILSITTVQFPGKKPMKVEEYIKGHT 304
>gi|15640077|ref|NP_229704.1| methionyl-tRNA formyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121587248|ref|ZP_01677021.1| methionyl-tRNA formyltransferase [Vibrio cholerae 2740-80] >gi|121727877|ref|ZP_01680936.1| methionyl-tRNA formyltransferase [Vibrio cholerae V52] >gi|147673280|ref|YP_001218367.1| methionyl-tRNA formyltransferase [Vibrio cholerae O395] >gi|153817572|ref|ZP_01970239.1| methionyl-tRNA formyltransferase [Vibrio cholerae NCTC 8457] >gi|153821938|ref|ZP_01974605.1| methionyl-tRNA formyltransferase [Vibrio cholerae B33] >gi|194532247|ref|YP_002067677.1| methionyl-tRNA formyltransferase [Vibrio cholerae MO10] >gi|172047502|sp|A5F4B4|FMT_VIBC3 Methionyl-tRNA formyltransferase >gi|14548058|sp|Q9KVU4|FMT_VIBCH Methionyl-tRNA formyltransferase >gi|9654438|gb|AAF93223.1| methionyl-tRNA formyltransferase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121548494|gb|EAX58550.1| methionyl-tRNA formyltransferase [Vibrio cholerae 2740-80] >gi|121629821|gb|EAX62236.1| methionyl-tRNA formyltransferase [Vibrio cholerae V52] >gi|125618248|gb|EAZ46790.1| methionyl-tRNA formyltransferase [Vibrio cholerae MO10] >gi|126511840|gb|EAZ74434.1| methionyl-tRNA formyltransferase [Vibrio cholerae NCTC 8457] >gi|126520558|gb|EAZ77781.1| methionyl-tRNA formyltransferase [Vibrio cholerae B33] >gi|146315163|gb|ABQ19702.1| methionyl-tRNA formyltransferase [Vibrio cholerae O395] (315 aa)
Score = 498, Expect = 2.1e-48, Identities = 101/299 (33%), Positives = 170/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTP+ A   L ALL    +++AV  QP++P GR K++  S VK LA+E N+  +QP   K  E + +L  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + IE SDT+++++ K+  L    +L  L+ +       +KQD+   ++A+ +SK++ +IN+   A  I   IR  +  P ++  + +  +K+++A          PGTI    K GI ++T    ++++ +QI GK    V++ILN  ++
  S:     6 RIVFAGTPDFAARHLAALLSSEHEIIAVYTQPERPAGRGKKLTASPVKTLALEHNVPVYQPENFKSDESKQQLAALNADLMVVVAYGLLLPKVVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDSETGVTIMQMDVGLDTGDMLKIATLPIEASDTSASMYDKLAELGPQALLECLQDIAQGTAVAVKQDDGLANYAHKLSKEEARINWSDAATHIERCIRAFNPWPMSHFEVAENSIKVWQARVETRAVTQTPGTIIQADKSGIYVATGQDVLVLESLQIPGKKALPVQDILNARAD 306
>gi|193071562|ref|ZP_03052471.1| methionyl-tRNA formyltransferase [Escherichia coli E110019] >gi|192955150|gb|EDV85644.1| methionyl-tRNA formyltransferase [Escherichia coli E110019] (315 aa)
Score = 498, Expect = 2.2e-48, Identities = 103/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S +K LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPIKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAKLGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|157156687|ref|YP_001464755.1| methionyl-tRNA formyltransferase [Escherichia coli E24377A] >gi|191169306|ref|ZP_03031055.1| methionyl-tRNA formyltransferase [Escherichia coli B7A] >gi|166988364|sp|A7ZSH6|FMT_ECO24 Methionyl-tRNA formyltransferase >gi|157078717|gb|ABV18425.1| methionyl-tRNA formyltransferase [Escherichia coli E24377A] >gi|190900661|gb|EDV60461.1| methionyl-tRNA formyltransferase [Escherichia coli B7A] (315 aa)
Score = 498, Expect = 2.2e-48, Identities = 103/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S +K LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPIKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|194435068|ref|ZP_03067306.1| methionyl-tRNA formyltransferase [Shigella dysenteriae 1012] >gi|194416675|gb|EDX32806.1| methionyl-tRNA formyltransferase [Shigella dysenteriae 1012] (315 aa)
Score = 498, Expect = 2.2e-48, Identities = 103/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S +K LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPIKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLKMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|157373175|ref|YP_001471775.1| methionyl-tRNA formyltransferase [Shewanella sediminis HAW-EB3] >gi|189044557|sp|A8FP74|FMT_SHESH Methionyl-tRNA formyltransferase >gi|157315549|gb|ABV34647.1| methionyl-tRNA formyltransferase [Shewanella sediminis HAW-EB3] (329 aa)
Score = 498, Expect = 2.2e-48, Identities = 105/298 (35%), Positives = 176/298 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L AL++   +++ V  QPD+P GR K++  S VK LAIE N+  FQP  ++  + + EL  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  A+  G+ ETGV +M+    +D GD+    ++ IE++DT+++L++K+     D ++  L  +   E    KQDES  ++A  +SK++ ++++ K+A+E+   IR  +  P ++    D  +K+ ++  +N  S+   GTI +  K+GI I+T D  + +  +Q+ GK    V +ILN   E
  S:     6 IIFAGTPDFAARHLQALIDSEHNIIGVYSQPDRPAGRGKKLQASPVKSLAIEHNLPVFQPKSLRDEQAQAELANLNADIMVVVAYGLILPKVVLDTPKLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDIGLDTGDMLLKTRLPIEDNDTSASLYEKLALQGPDALIEALTGLAKGELTAEKQDESLANYAEKLSKEEAELDWSKSALELWREIRAFNPWPISHFTHQDASIKVRESAVSNLSSDAPAGTIISAGKQGIDIATGDGVLTLLNMQLPGKKPLSVGDILNSRGE 305
>gi|88801026|ref|ZP_01116575.1| methionyl-tRNA formyltransferase [Reinekea sp. MED297] >gi|88776229|gb|EAR07455.1| methionyl-tRNA formyltransferase [Reinekea sp. MED297] (314 aa)
Score = 497, Expect = 2.4e-48, Identities = 103/298 (34%), Positives = 169/298 (56%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           IVF GTP+ A   L ALL    +V+AV  QPD+P GR +++  S VK LA+E +I  +QP   K+    +ELK LN    V  A+G  +P  +L  P  GC+N+HASLLP++RG APIH A++ G+  TGV +M+    +D GD+  +    IE  DT+ TL  ++  +    ++  L+++ N    P+ QD+    +A  + K +  I+++ +A +I   IRGL+  PGA+     + ++L KA +  S +   PG I  +S  G+ ++T    + ++ +Q+ GK    + ++LN   +
  S:     5 IVFAGTPDFAAEHLRALLNSHHNVIAVYSQPDRPAGRGRKLTASPVKALALEHDIPVYQPLNFKDEASVDELKSLNADLMVVVAYGLILPQVVLDSPRLGCVNVHASLLPRWRGAAPIHRALLAGDDRTGVTIMQMDAGLDTGDMLVTADCAIEADDTSQTLHDRLIEIGGPALITALDQLENGSAQPVVQDDEFACYARKLEKSEGMIDWQTSATDIDRQIRGLTPWPGAFTQWQGQTVRLHKAQAIQSGTEAEPGHIVEMSAAGLKVATGKGLLKIETLQLPGKKAMAISDLLNSRRD 304
>gi|27364479|ref|NP_760007.1| methionyl-tRNA formyltransferase [Vibrio vulnificus CMCP6] >gi|31340072|sp|Q8DDE4|FMT_VIBVU Methionyl-tRNA formyltransferase >gi|27360598|gb|AAO09534.1|AE016800_139 Methionyl-tRNA formyltransferase [Vibrio vulnificus CMCP6] (315 aa)
Score = 497, Expect = 2.7e-48, Identities = 103/301 (34%), Positives = 179/301 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAP-GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K  +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E NI  +QP   K  E +  L +LN    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + I+ SDT++T++ K+  L   +++  L  +       IKQD+ + ++A  +SK++ +IN++ +A  I   +R  +  P ++  + +  +K++++    + S++AP GTI    K GI ++T    ++++++QI GK    V+++LN  +
  S:     3 KPLRIVFAGTPDFAAQHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKTIALEHNIPVYQPENFKSDEAKQALADLNADIMVVVAYGLLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIDASDTSATMYDKLAKLGPVVLVECLADIAAGTAIAIKQDDERANYAKKLSKEEARINWQDDAEHIERCVRAFNPWPMSHFEVAENSIKVWQS-RVEASSHDAPAGTILKADKSGIYVATGHGCLVLEQIQIPGKKAMPVQDVLNARA 305
>gi|188588955|ref|YP_001920561.1| methionyl-tRNA formyltransferase [Clostridium botulinum E3 str. Alaska E43] >gi|188499236|gb|ACD52372.1| methionyl-tRNA formyltransferase [Clostridium botulinum E3 str. Alaska E43] (309 aa)
Score = 497, Expect = 2.8e-48, Identities = 113/298 (37%), Positives = 181/298 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           KIVFMGTP+ A  +   L+E+  +V AV+ QPDKP GR K++ +S VK+ A++ +I  +QP K+K   EI  +LKE+NP   +  AFGQ +   +L IP++GCIN+HASLLP YRG AP++W +I GEK++G   M     +D GD+    +V I E  TT  L   +     +++L  +E + +    P+KQ E +  +A  + K+   IN+ ++A +I NL+RGL+  P AY     ++MKL+K      + +N PGTI  ++KEG+ ++     +++++VQ        ++  +NG+S
  S:     2 KIVFMGTPDFAVPSFRKLIEEH-EVKAVLTQPDKPKGRGKKLAYSPVKEEALKYDIPVYQPTKLKDDKEIIEKLKEINPDFIIVVAFGQILTKEVLDIPKYGCINLHASLLPMYRGAAPLNWVIIKGEKKSGNTTMLMDVGLDTGDMLLKEEVEIHEDMTTGELHDILMISGGELLLKTIEGLCSGSIKPVKQ-EGETFYAKMLDKELAHINWTEDAYDIHNLVRGLNPWPIAYTEYKGERMKLYKTKVLYKEVSNKPGTIIEVNKEGVKVACGKNVLIIEKVQFPNGKPLTIEQYINGHS 300
>gi|194466506|ref|ZP_03072493.1| methionyl-tRNA formyltransferase [Lactobacillus reuteri 100-23] >gi|194453542|gb|EDX42439.1| methionyl-tRNA formyltransferase [Lactobacillus reuteri 100-23] (317 aa)
Score = 497, Expect = 2.8e-48, Identities = 117/302 (38%), Positives = 187/302 (61%)
  Q:    13 IVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNSEIKIG 314
           +VFMGTPE A   L +L++   +DV AV+ QPD  IGRK+ +  S VK+LA + NI+  QP K+    E+E ++  L P   +T A+GQF+P  +L+  +   IN+H SLLPKYRGGAPI +++ING+KETGV +M  +K+MDAGD+   R + IE++D + T+FKK++ L  D++L  L K+ + +  P+ QD  KV F+ NI+ + E+I+F   A  I   +RGL   P     I+  + K++       K++  PG +  ++K  ++I+  D     + +++  GK   ++ + LNG+ +I  G
  S:     5 VVFMGTPEFAVPILQSLIDNPEYDVQAVLTQPDHHIGRKRTLHQSPVKELAEQYNIEVLQPAKLSKSPEME-KIISLQPDLMITAAYGQFLPTKLLAAAKIAAINVHGSLLPKYRGGAPIQYSIINGDKETGVSIMYMVKKMDAGDIISQRSIPIEDTDDSGTMFKKLSLLGRDLLLETLPKLISGDVNPVAQDPDKVVFSPNITSEQEQIDFRLPAHLIDAKVRGLRPAPLGNMVIDGLRTKIYDVTPLEEKTDLEPGKVVRVTKHQLVIAAGDGTTYQINKLKPAGKKAMDITSYLNGHKDITEG 310
>gi|15643294|ref|NP_228338.1| methionyl-tRNA formyltransferase [Thermotoga maritima MSB8] >gi|6685431|sp|Q9WYZ8|FMT_THEMA Methionyl-tRNA formyltransferase >gi|4981041|gb|AAD35613.1|AE001728_14 methionyl-tRNA formyltransferase [Thermotoga maritima MSB8] (313 aa)
Score = 497, Expect = 2.8e-48, Identities = 107/296 (36%), Positives = 173/296 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVF+GTPE A   L  L++  F+VV VV QPDKP GR +++  + VK +A +  + F QP  I  KE    L+ + P   +  ++G+ + + +LS+P  GC NIH SLLPKYRG +PI   + NGE+ TGV + + +K++DAG +   ++++++  +T   L K++  L  ++++  LEK+        +QD S+ ++A  I K+D  ++F K+A  + N IR     PGA  F+ + ++KLF   + +S S + PG IN I +EG  I T D  + V+ +Q  GK +       NG
  S:     2 RIVFVGTPEFAAEILEHLIKNGFNVVGVVTQPDKPRGRGRKVAPTPVKAVAEKHEVPFIQPESINKKEALEFLRSVRPDVIIVASYGKILGEKVLSLPRLGCYNIHPSLLPKYRGASPIQRVLENGEERTGVTIYKMVKELDAGPIALQKEISVDPFETFDQLEKRLIELSKEMLIEFLEKLKTGNIELKEQDHSRATYAPMIKKEDLIVDFSKDAESVKNKIRAYDSRPGARAFLGNVEVKLFGVTAIDS-SGDEPGLINYIDREGAWIGTGDGKVKVRYIQFPGKKKMTFWEAKNG 298
>gi|153953995|ref|YP_001394760.1| methionyl-tRNA formyltransferase [Clostridium kluyveri DSM 555] >gi|146346876|gb|EDK33412.1| Hypothetical protein CKL_1370 [Clostridium kluyveri DSM 555] (310 aa)
Score = 497, Expect = 2.8e-48, Identities = 117/297 (39%), Positives = 175/297 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           IVFMGTP+ +  +L  L+E+ F V AVV QPDKP GR +++ FS VK+ A++ NI  +QP K+K   E+ + LK++ P   V  A+GQ +   IL IP+ GCIN+HASLLPKYRG API+W +I GE+ +G   M     +D GDV  S    IEE+ T   L   +     +++++ L+ +        KQ ES  ++A  +SKD  KIN+  ++ +I   +RGL+  P AY     K MK+++    +  S    G I ++ KEGI ++  +  IL+K++Q  G    EVK  + G+S
  S:     3 IVFMGTPDFSVPSLRRLVEE-FQVRAVVTQPDKPKGRGRKMTFSPVKEEALKYNIPVYQPTKLKDDREVIDALKKIKPEFIVVIAYGQLLTKEILDIPKIGCINLHASLLPKYRGAAPINWCIIEGEERSGNTTMFMDTGLDTGDVLLSSTFEIEENMTAGQLHDILMENGAELLVDTLKGLKEGTVKRKKQGESPTAYAKMLSKDMAKINWNLSSKKIKCFVRGLNPWPIAYTPYKQKNMKVYEVAVLDEISKKEAGYILDVGKEGIKVACGEGVILIKKIQFPGGKPMEVKEYIKGHS 301
>gi|162447191|ref|YP_001620323.1| methionyl-tRNA formyltransferase [Acholeplasma laidlawii PG-8A] >gi|161985298|gb|ABX80947.1| methionyl-tRNA formyltransferase [Acholeplasma laidlawii PG-8A] (304 aa)
Score = 497, Expect = 2.9e-48, Identities = 120/297 (40%), Positives = 178/297 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSIL-SIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           IVFMGTPE +   L  L+E+ + V  VV QPD+ +GRKK +  S VK LA+  NI+ FQP K+++    + +L P   +T ++GQ +P ++L +IP    INIH SLLPKYRGGAPI +A+ NG+ +TG+ LM  + +MDAG +    +V+IE  D   TL  K++    D++  +L  V N  Y    Q+E +V+FA+ +   DE ++F K+A    N IRGLS   GA+  I +  +K+FK+ + +   +   G I  I  + I I T D  I + E+Q  GK + +VK+ LNG S
  S:     2 IVFMGTPEFSVPILEMLIEEKYPVGLVVTQPDRFVGRKKILTPSPVKSLALAHNIEVFQPEKLRQDYQHIIDLKPSLIITASYGQILPKALLEAIP---AINIHGSLLPKYRGGAPIQYALFNGDDKTGITLMEMVYKMDAGAMIKKVEVDIEPLDDYGTLSNKLSLAGRDLLKENLMSVLNKTYQSTPQNEDEVTFAFTLKYSDEALDFNKSASWNHNRIRGLSPNVGAHFNIKNTTVKVFKS-AISDIIDIQRGEI-RIENKRIFIGTSDRAIELIELQQSGKKQMKVKDYLNGQS 294
>gi|606222|gb|AAA58085.1| methionyl-tRNA formyltransferase [Escherichia coli] (315 aa)
Score = 496, Expect = 3.2e-48, Identities = 104/299 (34%), Positives = 174/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + EL     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P   DE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVXDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|170682749|ref|YP_001745550.1| methionyl-tRNA formyltransferase [Escherichia coli SMS-3-5] >gi|170520467|gb|ACB18645.1| methionyl-tRNA formyltransferase [Escherichia coli SMS-3-5] (315 aa)
Score = 496, Expect = 3.4e-48, Identities = 104/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ + +APGTI   SK+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSSPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTVTKSAPGTILEASKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|187778896|ref|ZP_02995369.1| hypothetical protein CLOSPO_02491 [Clostridium sporogenes ATCC 15579] >gi|187772521|gb|EDU36323.1| hypothetical protein CLOSPO_02491 [Clostridium sporogenes ATCC 15579] (305 aa)
Score = 496, Expect = 3.6e-48, Identities = 118/302 (39%), Positives = 181/302 (59%)
  Q:    16 MGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           MGTP+ A  +L  L+EK F+V AV  QPD+P GR K++  S+VK++A+E NI+ +QP K+K  E    +LKE+NP   +  AFGQ +   +L IP++GCIN+HASLLPKYRG API+WA+I GEKE+G   M   + +D GD+     V I +  T   L   +     ++++  ++ +        KQ    + +A  ++K   KI++ K + EI  LIRGL+  P AY    ++ MK++ +      SN  PGTI  +SKEGI ++T+D  + +  VQ  GK   +V+  + G+ +I+ G+ L
  S:     1 MGTPDFAVPSLKKLIEK-FNVKAVFTQPDRPKGRGKKLAMSAVKEVALENNIEVYQPIKLKNDEICIKKLKEINPDFIIVVAFGQILSKEVLDIPKYGCINLHASLLPKYRGAAPINWAIIKGEKESGNTTMFMDEGLDTGDMLLKNTVKIADDMTAGELHDILMESGSELLVTTIKGLKEGTVKREKQKSENIIYASMLNKQMGKIDWNKTSKEINLLIRGLNPRPVAYTQYKNETMKIYNSSILKESSNKTPGTILKVSKEGIKVATRDGILSITTVQFPGKKPMKVEEYIKGH-DIEEGLVL 303
>gi|83857046|ref|ZP_00950574.1| methionyl-tRNA formyltransferase [Croceibacter atlanticus HTCC2559] >gi|83848413|gb|EAP86282.1| methionyl-tRNA formyltransferase [Croceibacter atlanticus HTCC2559] (315 aa)
Score = 496, Expect = 3.6e-48, Identities = 112/301 (37%), Positives = 177/301 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDES-KVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           ++ +I+FMGTPE AT  L+ ++ + ++VV VV  PDKP GR ++I  S VK  A++K +K  QP  +K  E   +L EL+P   +  AF + +P  +   PE+G  N+HASLLP+YRG APIHWA+INGE  TGV      +++D G++   ++  I   +T   L  K+ NL    V   L+ +         Q ++  +  AY ++ D+ ++++     E+ N IRGL+  P AY  +     + +MKL+K      + + +PGTI NI    + I+ KD  ILV+E+Q+ GK +  +K++LNG S
  S:     2 RDLRILFMGTPEFATTILDHVINEDYNVVGVVTAPDKPAGRGRKIHESHVKGYAVKKGLKVLQPTNLKSEEFSEQLNELDPNVIIVVAF-RMLPKQVWQYPEYGTFNLHASLLPQYRGAAPIHWAIINGETTTGVSTFFIDEKIDTGEMILQKETTITPDETVGDLHDKLMNLGCSTVTETLKLISEDTVTTTPQPQNITLKTAYKLNNDNTRVDWSLPVNEVYNKIRGLNPFPVAYTILYQDNEELRMKLYKVRMRQEEHSKSPGTI-NIEDSTLKIAAKDGFILVEELQLPGKRKMAIKDLLNGFS 307
>gi|33152993|ref|NP_874346.1| methionyl-tRNA formyltransferase [Haemophilus ducreyi 35000HP] >gi|39931234|sp|Q7VK98|FMT_HAEDU Methionyl-tRNA formyltransferase >gi|33149218|gb|AAP96735.1| methionyl-tRNA formyltransferase [Haemophilus ducreyi 35000HP] (316 aa)
Score = 495, Expect = 4.1e-48, Identities = 102/297 (34%), Positives = 177/297 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIN----DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           I+F GTPE A   L ALL    ++VAV  QPDKP GR K++  S VK+LA++ NI  +QP  ++  + + EL  LN    V  A+G  +P+++L IP +GC+N+H SLLP++RG API  A+  G++ETGV +M+    +D GD+       IE  +T+++L+ K+  L    +L  L+ +   ++ P KQD    ++A  +SK + K+++   A ++   IR  +  P ++  +     ++ +K+++A +  +   +A GT+  + K GI I+T +  + + ++Q +GK    V++ LNG +
  S:     6 IIFAGTPEFAAQHLQALLASQHNIVAVYTQPDKPAGRGKKLQASPVKQLALQHNIPVYQPKSLRNPQAQAELNALNGDVMVVVAYGLILPEAVLHIPRYGCLNVHGSLLPRWRGAAPIQRAIWAGDQETGVTIMQMDAGLDTGDMLHKVSTKIEADETSASLYMKLAKLAPPALLAVLDGLTEQQFKPEKQDNQLANYAEKLSKQEAKLDWNLPAYQLAQNIRAFNPWPMSFLTVEVEGVEQHVKVYQA-TVLAHQYHAVGTVLQVDKNGIQIATSEGVLNITQLQPQGKKPMSVQDFLNGRA 307
>gi|42524170|ref|NP_969550.1| hypothetical protein Bd2757 [Bdellovibrio bacteriovorus HD100] >gi|73919380|sp|Q6MJL7|FMT_BDEBA Methionyl-tRNA formyltransferase >gi|39576378|emb|CAE80543.1| fmt [Bdellovibrio bacteriovorus HD100] (318 aa)
Score = 495, Expect = 4.2e-48, Identities = 113/303 (37%), Positives = 171/303 (56%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVST---NSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           ++ F+GTPE A  +L ALL ++ F+VV VV QPD+P GRK ++  S VK LA   N+K   P  +K    +  E+K       V  AFGQ +    L    FGC+N+H S+LP++RG API  A+  G+ E+GV L + +K++DAGD+   R+V I        L   +  L  +++  +L         P  QDESKV+ A  I K + +I++  +A  I   IRG    PG Y F+  KK+KL +A  T    S  +  PGTI  + ++ I ++T D  + + EVQ E +NR  + + L G++ +K+G
  S:     5 RVCFLGTPEFAVTSLKALLSDEHFEVVGVVTQPDRPAGRKLQLTPSPVKALAQAHNLKVLAPESLKANPLMLQEIKTWGAEVAVVVAFGQILTQEFLDSFRFGCVNVHGSVLPRWRGAAPIQRAIEAGDVESGVTLQKMVKKLDAGDIIGIRRVKITPDMNALQLHDVLAQLGAELLQVELMDYVRGNLAPTPQDESKVTLAKKIEKMESQIDWSTSAKAIDGKIRGFVYGPGTYTFLQGKKLKLHRATVTRDGGSIGSAKPGTITAVHEDHISVATGDGVLQLFEVQPESRNRMAIADFLKGHA-LKVG 313
>gi|24114565|ref|NP_709075.1| methionyl-tRNA formyltransferase [Shigella flexneri 2a str. 301] >gi|30064609|ref|NP_838780.1| methionyl-tRNA formyltransferase [Shigella flexneri 2a str. 2457T] >gi|110807135|ref|YP_690655.1| methionyl-tRNA formyltransferase [Shigella flexneri 5 str. 8401] >gi|122957163|sp|Q0T015|FMT_SHIF8 Methionyl-tRNA formyltransferase >gi|39931272|sp|Q83PZ0|FMT_SHIFL Methionyl-tRNA formyltransferase >gi|24053760|gb|AAN44782.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Shigella flexneri 2a str. 301] >gi|30042868|gb|AAP18591.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Shigella flexneri 2a str. 2457T] >gi|110616683|gb|ABF05350.1| methionyl-tRNA formyltransferase [Shigella flexneri 5 str. 8401] (315 aa)
Score = 495, Expect = 4.3e-48, Identities = 103/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S +K LA E+ +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCINIH SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPIKVLAEEEGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINIHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|170769544|ref|ZP_02903997.1| methionyl-tRNA formyltransferase [Escherichia albertii TW07627] >gi|170121601|gb|EDS90532.1| methionyl-tRNA formyltransferase [Escherichia albertii TW07627] (315 aa)
Score = 494, Expect = 5.4e-48, Identities = 103/299 (34%), Positives = 174/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +  APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPIFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKTVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITTEDTSGTLYDKLAELGPQGLITTLKQLADGTVKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATKAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|37681410|ref|NP_936019.1| methionyl-tRNA formyltransferase [Vibrio vulnificus YJ016] >gi|39931193|sp|Q7MGK5|FMT_VIBVY Methionyl-tRNA formyltransferase >gi|37200162|dbj|BAC95990.1| methionyl-tRNA formyltransferase [Vibrio vulnificus YJ016] (315 aa)
Score = 494, Expect = 5.4e-48, Identities = 104/301 (34%), Positives = 178/301 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAP-GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           K  +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E NI  +QP   K  E +  L +LN    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ ETGV +M+    +D GD+     + I+ SDT++T++ K+  L    ++  L  +       IKQD+ + ++A  +SK++ +IN++ +A  I   +R  +  P ++  + +  +K++++    + S++AP GTI    K GI I+T    ++++++QI GK    V+++LN  +
  S:     3 KPLRIVFAGTPDFAAQHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKTIALEHNIPVYQPENFKSDEAKQALADLNADIMVVVAYGLLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIDASDTSATMYDKLAKLGPVALVECLADIAAGTAIAIKQDDERANYAKKLSKEEARINWQDDAEHIERCVRAFNPWPMSHFEVAENSIKVWQS-RVEASSHDAPAGTILKADKSGIYIATGHGCLVLEQIQIPGKKAMPVQDVLNARA 305
>gi|77917860|ref|YP_355675.1| methionyl-tRNA formyltransferase [Pelobacter carbinolicus DSM 2380] >gi|77543943|gb|ABA87505.1| methionyl-tRNA formyltransferase [Pelobacter carbinolicus DSM 2380] (315 aa)
Score = 494, Expect = 5.5e-48, Identities = 107/298 (35%), Positives = 167/298 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           + +FMGTPE A   L  LLE   D+  V  QPD+  GR K +    VK+LA+  N+   QP K+++     +++ L P   V  A+GQ +P S+L IP +GCIN+HASLLP+YRG API+ AV++GE+ TGV  M     +D GD+   R   I   +T   L  ++  L  + +   L ++ +       QD+++  +A  + K+D  I++ + A  I NL+RGLS  PGAY   N + +KL + V+    S   PGT+ +  + G+ I+  +  + V+E+Q+ GK +    + L G S
  S:     8 RTIFMGTPEFALPTLQGLLEAGVDLCGVFTQPDRRKGRGKVLAPPPVKELALRHNLPVLQPEKLRDPSAVEQIRSLKPDLIVVVAYGQILPKSVLDIPRYGCINVHASLLPRYRGAAPINKAVVDGEQVTGVTTMLMDVGLDTGDILVKRATEIGNEETAGELHDRLALLGREAMEETLRRLCDGTLRSEAQDDAQSCYAPMMKKEDGCIDWSRPAGVIHNLVRGLSPWPGAYTRWNGQTLKLGRTVAEEG-SEAEPGTVVSADETGVCIACGEGVLRVRELQLAGKKKLPAGDFLRGTS 306
>gi|187730742|ref|YP_001881971.1| methionyl-tRNA formyltransferase [Shigella boydii CDC 3083-94] >gi|187427734|gb|ACD07008.1| methionyl-tRNA formyltransferase [Shigella boydii CDC 3083-94] (315 aa)
Score = 494, Expect = 5.6e-48, Identities = 103/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QD++ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDKTLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIERQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|77962771|ref|ZP_00826588.1| COG0223: Methionyl-tRNA formyltransferase [Yersinia mollaretii ATCC 43969] (320 aa)
Score = 494, Expect = 5.9e-48, Identities = 101/299 (33%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L ALL     +V V  QPD+P GR  ++  S VK LA ++ I  FQP  ++  EN+  + +LN    V  A+G  +P S+L++P  GCIN+H SLLP++RG API  +V  G+ +TGV +M+    +D GD+    + +I+  DT++TL+ K+  L    +L  L+++      P  QDE++V++A  +SK++ K+++  +A ++   IR  +  P +Y  ++++ +K+++A    +  N  PGTI +  K GI ++T +  + + ++Q  GK      ++LN   E
  S:    11 RIIFAGTPDFAARHLGALLSSQHQIVGVFTQPDRPAGRGNKLTPSPVKILAEQQGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPASVLAMPRLGCINVHGSLLPRWRGAAPIQRSVWAGDAKTGVTIMQMDVGLDTGDMLHKIECDIQPEDTSATLYDKLAQLGPQGLLITLQELAEGRAQPEVQDEAQVTYAEKLSKEEAKLDWSLSAAQLERCIRAFNPWPVSYFVVDEQSVKVWQAQVLPAVGNTQPGTIIHADKHGIQVATAEGVLNITQLQPAGKKAMSAADLLNSRRE 311
>gi|84393440|ref|ZP_00992197.1| methionyl-tRNA formyltransferase [Vibrio splendidus 12B01] >gi|84375956|gb|EAP92846.1| methionyl-tRNA formyltransferase [Vibrio splendidus 12B01] (321 aa)
Score = 494, Expect = 6.4e-48, Identities = 109/306 (35%), Positives = 181/306 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI-----NDKKMKLFKAVSTNSKSNNAP-GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN-SEIKIGVTL 317
           +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E NI  +QP   K  E + EL +LN    V  A+G  +P ++L  P  GCIN+H S+LP++RG API  ++  G+KETGV +M+    +D GD+     + IE +DT++++++K+  L  D ++  L  + + +    KQD+   ++A  +SK++ KI++  +A  I   +R  +  P ++  I     ND+K         + +S +AP G+I    K GI ++T D  ++++++Q+ GK    V++ILN   S  ++G  L
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKNIALENNIPVYQPENFKSDEAKQELADLNADIMVVVAYGLLLPQAVLDTPRLGCINVHGSILPRWRGAAPIQRSIWAGDKETGVTIMQMDIGLDTGDMLSIATLPIEATDTSASMYEKLAGLGPDALVECLADIASGKAVAEKQDDELANYAKKLSKEEAKIDWNDSAEHIERCVRAFNPWPMSHFAIVDSSSNDEKSIKVWQTRVDEESTSAPAGSIIKADKTGIYVATGDKVLVLEQLQVPGKKAMSVQDILNSRASWFEVGTQL 320
>gi|74313806|ref|YP_312225.1| methionyl-tRNA formyltransferase [Shigella sonnei Ss046] >gi|123732291|sp|Q3YWX2|FMT_SHISS Methionyl-tRNA formyltransferase >gi|73857283|gb|AAZ89990.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Shigella sonnei Ss046] (315 aa)
Score = 493, Expect = 6.7e-48, Identities = 103/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  E++  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +N APGTI   +K+GI ++T D  + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQESQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|150016030|ref|YP_001308284.1| methionyl-tRNA formyltransferase [Clostridium beijerinckii NCIMB 8052] >gi|189044505|sp|A6LSJ8|FMT_CLOB8 Methionyl-tRNA formyltransferase >gi|149902495|gb|ABR33328.1| methionyl-tRNA formyltransferase [Clostridium beijerinckii NCIMB 8052] (308 aa)
Score = 492, Expect = 8.9e-48, Identities = 115/306 (37%), Positives = 186/306 (60%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN---ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           IVFMGTP+ A  +L  ++ K ++V A++ QPDKP GR K++ +S+VK+  ++  I  +QP K+K+  +   +LKEL P   +  AFGQ +   +L IP++GCIN+HASLLP YRG AP++WA+INGEK +G   M     +D GD+    +V I  + TT  L   +     D+++  +E +   +  P KQ  ++  +A  + K+   I++ K+A EI NL+RGL+  P AY    +++MK+++      KSN  PGTI ++SK G+ +S K+  +L+K VQ        ++  +NG+ EI+  + L+
  S:     3 IVFMGTPDFAVPSLQRMI-KEYNVTAILTQPDKPKGRGKKMAYSAVKEEGLKHEIPIYQPIKLKDDRDLIEKLKELKPDFIIVVAFGQILTKEVLDIPKYGCINLHASLLPMYRGAAPLNWAIINGEKSSGNTTMLMDVGLDTGDMILKDEVEITNNMTTGELHDILMVRGADLLVKSIEGISKGDIVPEKQG-NETFYAKMLDKNIANIDWNKSAEEIHNLVRGLNPWPIAYTDYKNERMKIYETEVLKEKSNKEPGTIIDVSKNGVKVSCKEDVLLIKRVQFPNGKPLTIEQYINGH-EIEENIILQ 308
>gi|109896354|ref|YP_659609.1| methionyl-tRNA formyltransferase [Pseudoalteromonas atlantica T6c] >gi|123065190|sp|Q15ZY3|FMT_PSEA6 Methionyl-tRNA formyltransferase >gi|109698635|gb|ABG38555.1| methionyl-tRNA formyltransferase [Pseudoalteromonas atlantica T6c] (315 aa)
Score = 492, Expect = 9.0e-48, Identities = 113/299 (37%), Positives = 170/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNA-PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KIVF GTPE A   L+AL+E    V+A   QPD+P GR K++  S+VK+LA + +I  +QP  +K  E + +L  LN    V  A+G  +P  IL  P++GC+N+H SLLPK+RG API  A+  G+ ETGV +M+  K +D G V    ++ I   DT++TL+ K+  L    +L  L  + +L   P  QD +  ++A  +SK + KI++   A ++   +R     P AY   N   +K+  A V      +NA PG I    K  I + T D  +L+K +Q+ GK     ++ILNG+S+
  S:     6 KIVFAGTPEFAANHLSALIESEHQVIAAYTQPDRPAGRGKKLHASAVKQLAQQHDIPVYQPASLKSEEAQQQLAALNADVMVVVAYGLILPQIILDTPKYGCLNVHGSLLPKWRGAAPIQRAIWAGDAETGVTIMQMDKGLDTGAVLSELRLAITPIDTSATLYTKLAELGPKGLLETLASLGDLT--PQAQDNTLATYAEKLSKQEAKIDWTMTAAQLERNVRAFDPWPVAYFEANGAAIKVRSAEVQQTPICDNAKPGQIIQADKHAIGVQTGDGVLLIKTLQLPGKKPLATQDILNGHSD 306
>gi|86147130|ref|ZP_01065446.1| methionyl-tRNA formyltransferase [Vibrio sp. MED222] >gi|85835014|gb|EAQ53156.1| methionyl-tRNA formyltransferase [Vibrio sp. MED222] (321 aa)
Score = 492, Expect = 9.3e-48, Identities = 109/306 (35%), Positives = 184/306 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIND------KKMKLFKAVSTNSKSNNAP-GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN-SEIKIGVTL 317
           +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E NI  +QP   K  E + EL +LN    V  A+G  +P ++L  P  GCIN+H S+LP++RG API  ++  G+KETGV +M+    +D GD+     + IE +DT++++++K+  L  D ++  L  + + +    KQD+   ++A  +SK++ KI++  +A  I   +R  +  P ++  I D      K +K+++    + +S +AP G+I    K GI ++T D  ++++++Q+ GK    V++ILN   S  ++G  L
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKNIALENNIPVYQPENFKSDEAKQELADLNADIMVVVAYGLLLPQAVLDTPRLGCINVHGSILPRWRGAAPIQRSIWAGDKETGVTIMQMDIGLDTGDMLSIATLPIEATDTSASMYEKLAGLGPDALVECLADIASGKAVAEKQDDELANYAKKLSKEEAKIDWNDSAEHIERCVRAFNPWPMSHFAIVDSSSSDEKSIKVWQ-TRVDEESTSAPAGSIIKADKTGIYVATGDKVLVLEQLQVPGKKAMSVQDILNSRASWFEVGTQL 320
>gi|157959860|ref|YP_001499894.1| methionyl-tRNA formyltransferase [Shewanella pealeana ATCC 700345] >gi|189044558|sp|A8GYH2|FMT_SHEPA Methionyl-tRNA formyltransferase >gi|157844860|gb|ABV85359.1| methionyl-tRNA formyltransferase [Shewanella pealeana ATCC 700345] (321 aa)
Score = 492, Expect = 9.7e-48, Identities = 102/298 (34%), Positives = 173/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++F GTP+ A   L AL++   +V+AV  QPD+P GR K++  S VK LA+E +I  FQP  +++   + EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+ ETGV +M+    +D GD+     + IE++DT+STL++K+       ++  L  +     P  KQDES  ++A  +SK++ ++++ K A  +   IR  +  P ++       +K++++  ++  S+  PGTI +  K GI I+T +  + + ++Q+ GK    V +ILN  ++
  S:     6 VIFAGTPDFAARHLQALIDSEHNVIAVYTQPDRPAGRGKKLQASPVKALALENDIAVFQPKSLRDEDAQAELAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDIGLDTGDMLLKTLLPIEDNDTSSTLYEKLAEQGPTALVEALAGIAEGTLPAEKQDESLANYAEKLSKEEARLDWSKPASALWREIRAFNPWPVSHYEHEGNTIKVWQSSVSDETSSQQPGTILSADKSGISIATGEGVLTITQMQLPGKKPLSVADILNSRAD 305
>gi|91212714|ref|YP_542700.1| methionyl-tRNA formyltransferase [Escherichia coli UTI89] >gi|117625570|ref|YP_858893.1| methionyl-tRNA formyltransferase [Escherichia coli APEC O1] >gi|122990716|sp|Q1R645|FMT_ECOUT Methionyl-tRNA formyltransferase >gi|166214893|sp|A1AGH9|FMT_ECOK1 Methionyl-tRNA formyltransferase >gi|91074288|gb|ABE09169.1| methionyl-tRNA formyltransferase [Escherichia coli UTI89] >gi|115514694|gb|ABJ02769.1| methionyl-tRNA formyltransferase [Escherichia coli APEC O1] (315 aa)
Score = 492, Expect = 1.0e-47, Identities = 102/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    ++V V  QPD+P GR K+++ S VK LA +K +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +  APGTI   +K+GI ++T D  + +  +Q  GK    V+++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNIVGVFTQPDRPAGRGKKLMPSPVKVLAEDKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTTTKAAPGTILEANKQGIQVATGDGILNLLSMQPAGKKAMSVQDLLNSRRE 306
>gi|26249872|ref|NP_755912.1| methionyl-tRNA formyltransferase [Escherichia coli CFT073] >gi|33301135|sp|Q8FD13|FMT_ECOL6 Methionyl-tRNA formyltransferase >gi|26110300|gb|AAN82486.1|AE016767_246 Methionyl-tRNA formyltransferase [Escherichia coli CFT073] (315 aa)
Score = 492, Expect = 1.0e-47, Identities = 102/299 (34%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    ++V V  QPD+P GR K+++ S VK LA +K +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +  APGTI   +K+GI ++T D  + +  +Q  GK    V+++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNIVGVFTQPDRPAGRGKKLMPSPVKVLAEDKGLPVFQPVSLRPQENQQRVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTTTKAAPGTILEANKQGIQVATGDGILNLLSMQPAGKKAMSVQDLLNSRRE 306
>gi|77957299|ref|ZP_00821358.1| COG0223: Methionyl-tRNA formyltransferase [Yersinia bercovieri ATCC 43970] (320 aa)
Score = 492, Expect = 1.0e-47, Identities = 101/299 (33%), Positives = 174/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L ALL     +V V  QPD+P GR  ++  S VK LA ++ I  FQP  ++  EN+  + +LN    V  A+G  +P S+L++P  GCIN+H SLLP++RG API  +V  G+ +TGV +M+    +D GD+    + +I+  DT++TL+ K+  L    +L  L+++      P  QDE++V++A  +SK++ K+++  +A ++   IR  +  P +Y  ++++ +K+++A    +  N  PGTI +  K GI ++T    + + ++Q  GK      ++LN   E
  S:    11 RIIFAGTPDFAARHLGALLSSQHQIVGVFTQPDRPAGRGNKLTPSPVKVLAEQQGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPASVLAMPRLGCINVHGSLLPRWRGAAPIQRSVWAGDAKTGVTIMQMDVGLDTGDMLHKIECDIQPEDTSATLYDKLAQLGPQGLLITLQQLAEGRAQPEVQDEAQVTYAEKLSKEEAKLDWSLSAAQLERCIRAFNPWPVSYFVVDEQPVKVWQAEVLPAVDNTKPGTIIHADKHGIQVATAQGVLNITQLQPAGKKAMSAADLLNSRRE 311
>gi|148544396|ref|YP_001271766.1| methionyl-tRNA formyltransferase [Lactobacillus reuteri F275] >gi|184153760|ref|YP_001842101.1| methionyl-tRNA formyltransferase [Lactobacillus reuteri F275] >gi|148531430|gb|ABQ83429.1| methionyl-tRNA formyltransferase [Lactobacillus reuteri F275] >gi|183225104|dbj|BAG25621.1| methionyl-tRNA formyltransferase [Lactobacillus reuteri F275] (317 aa)
Score = 492, Expect = 1.1e-47, Identities = 116/302 (38%), Positives = 186/302 (61%)
  Q:    13 IVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGNSEIKIG 314
           +VFMGTPE A   L +L++   +DV AV+ QPD  IGRK+ +  S VK+LA + NI+  QP K+    E+E ++  L P   +T A+GQF+P  +L+  +   IN+H SLLPKYRGGAPI +++ING+KETGV +M  +K+MDAGD+   R + IE++D + T+FKK++ L  D++L  L K+ + +  P+ QD   V F+ NI+ + E+I+F   A  I   +RGL   P     I+  + K++       K++  PG +  ++K  ++I+  D     + +++  GK   ++ + LNG+ +I  G
  S:     5 VVFMGTPEFAVPILQSLIDNPEYDVQAVLTQPDHHIGRKRTLHQSPVKELAEQYNIEVLQPAKLSKSPEME-KIISLQPDLMITAAYGQFLPTKLLAAAKIAAINVHGSLLPKYRGGAPIQYSIINGDKETGVSIMYMVKKMDAGDIISQRSIPIEDTDDSGTMFKKLSLLGRDLLLETLPKLISGDVNPVAQDPDNVVFSPNITSEQEQIDFRLPAHLIDAKVRGLRPAPLGNMVIDGLRTKIYDVTPLEEKTDLEPGKVVRVTKHQLVIAAGDGTTYQINKLKPAGKKAMDITSYLNGHKDITEG 310
>gi|77974957|ref|ZP_00830494.1| COG0223: Methionyl-tRNA formyltransferase [Yersinia frederiksenii ATCC 33641] (320 aa)
Score = 492, Expect = 1.1e-47, Identities = 102/308 (33%), Positives = 179/308 (58%)
  Q:     3 EKRNSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++ N   + +I+F GTP+ A   L ALL     +V V  QPD+P GR  ++  S VK LA ++ I  FQP  ++  EN+  + +L     V  A+G  +P S+L++P  GCIN+H SLLP++RG API  ++  G+ +TGV +M+    +D GD+    + +I+  DT++TL+ K+  L    +L  L+++      P  QDE++V++A  +SK++ K+++  +AV++   IR  +  P +Y  ++++ +K+++A    +  N APGTI +  K GI ++T    + + ++Q  GK      ++LN   E
  S:     2 QETNVSDSLRIIFAGTPDFAARHLGALLSSQHQIVGVFTQPDRPAGRGNKLTPSPVKVLAEQQGIPVFQPKSLRPEENQHLVADLKADIMVVVAYGLILPASVLAMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAKTGVTIMQMDVGLDTGDMLHKIECDIQPQDTSATLYDKLAQLGPQGLLVTLQQLAEGRAQPEVQDEAQVTYAEKLSKEEAKLDWSLSAVQLERCIRAFNPWPVSYFVVDEQPVKVWQAQVLAAVDNVAPGTIIHADKHGIQVATAKGVLNITQLQPAGKKAMSAADLLNSRRE 311
>gi|108761879|ref|YP_629656.1| methionyl-tRNA formyltransferase [Myxococcus xanthus DK 1622] >gi|108465759|gb|ABF90944.1| methionyl-tRNA formyltransferase [Myxococcus xanthus DK 1622] (312 aa)
Score = 491, Expect = 1.1e-47, Identities = 103/297 (34%), Positives = 168/297 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           +IVFMGTPE A  +L A  E   DVVAVV QPDKP GR   +    VK+LA+ + +   QP K++      EL++  P   V  A+G+ +P  +L +P  GC+N+H SLLP++RG API WA+ +G+ ETGV LM   + +D G V   +++ I   +T+++L+ K+  L  +++   L    + E  P+ Q    +  A  I KD  +++F K AVE+   +R  +  PGA+  +  K +K+ +A +     + APGT+     +GI ++  +  +++ ++Q EGK      + L G+
  S:     5 RIVFMGTPEFAVSSLAACFELG-DVVAVVTQPDKPKGRGNTVTAPPVKELALSRGVPVLQPTKLRTPPFAEELRQYAPDVCVVTAYGRILPKDLLELPTHGCVNVHGSLLPRFRGAAPIQWAIAHGDTETGVSLMVMDEGLDTGPVLAMKRMAIAPDETSASLYPKLAALGGEVLREFLPAYLSGELKPVPQPSEGMVLAPIIEKDQGRLDFTKPAVELERRLRAFTPWPGAFTTLGGKLLKVHRAQARG--GSGAPGTVLASGPDGIEVACGEGSLVLLDLQPEGKRVMRAADFLQGH 300
>gi|104774279|ref|YP_619259.1| methionyl-tRNA formyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|103423360|emb|CAI98213.1| Methionyl-tRNA formyltransferase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (299 aa)
Score = 491, Expect = 1.1e-47, Identities = 107/285 (37%), Positives = 176/285 (61%)
  Q:    26 LNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +  L++  + ++AVV QPDK +GRK+++++S VK++A+  ++  +QP ++ + +  +EL +L+    +T AFGQF+P   L   +   +N+H SLLPKYRGGAPI +AV NG+ ETGV +M  +K+MDAGD+Y    + I   +T+  +F+++  L  D++L  L K+ + E     QD S+V F+  ISK +E+I+ +  A E  NLIR L+  PGAY  I  +++K++KA V+ ++ S  A   + N  +  I  +      L+ EVQ  GK    +K+ LNG  +
  S:     1 MEGLIKAGYHILAVVTQPDKKVGRKQKVVYSPVKEVALANDLPLYQPVRLSKSDELDELLQLDADFIITAAFGQFLPTKFLKSAKIAAVNVHGSLLPKYRGGAPIQYAVRNGDAETGVTIMEMVKEMDAGDMYAQASLPIRPDETSGEVFEELAPLGRDLLLETLPKIASGEIVKKPQDPSQVVFSPTISKAEERISLKLTAKEAKNLIRALNPDPGAYLVIKGQRLKVWKAEVADDNTSLPAGHLLTNQGRFAISFAGNTVLNLL-EVQPNGKKAMAIKDFLNGQGK 287
>gi|149190436|ref|ZP_01868707.1| methionyl-tRNA formyltransferase [Vibrio shilonii AK1] >gi|148835690|gb|EDL52656.1| methionyl-tRNA formyltransferase [Vibrio shilonii AK1] (315 aa)
Score = 491, Expect = 1.2e-47, Identities = 99/298 (33%), Positives = 176/298 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E +I  +QP   K  E + ELK+LN    V  A+G  +P ++L  P+ GCIN+H S+LP++RG API  ++  G+ +TGV +M+    +D GD+     + IE +DT++T++ K+  L    ++  L  + +    P KQ++ + ++A  +SKD+ KI++ + A  I   +R  +  P ++  + +  +K++++   ++ + +  GTI    K GI ++T    ++++++QI GK    V ++LN  +
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKNIALEHDIPVYQPVNFKSDEAKQELKDLNADIMVVVAYGLLLPQAVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDAQTGVTIMQMDIGLDTGDMLKIATLPIEATDTSATMYDKLAELGPQALVECLADIASGNAAPEKQNDDEANYASKLSKDEAKIDWNQPAEFIERCVRAFNPWPMSFFSVEENNIKVWQSRVEDNATESVAGTILKADKTGIYVATGQGTLVLEQIQIPGKKAMPVSDVLNSKA 305
>gi|193217009|ref|YP_002000251.1| methionyl-tRNA formyltransferase [Mycoplasma arthritidis 158L3-1] >gi|193002332|gb|ACF07547.1| methionyl-tRNA formyltransferase [Mycoplasma arthritidis 158L3-1] (285 aa)
Score = 491, Expect = 1.2e-47, Identities = 111/287 (38%), Positives = 170/287 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNR 298
           KI+  GT   +     +LL+   F+VV ++ QP++ + R K +I + V KLA E  +  FQPNKIKEI +ELKE     F+T A+GQ IP+ IL++P+   IN+H S+L KYRG AP+  A++N EKETG+ L+  I +MDAGD+    KV IEE DT   ++ K+  +  + +   L+K++  E    KQDESKV+FA  I  +D +++ E +  E +N IR  ++ PGA+   N K++K+F+A +  +KS              +++   D  + + E Q EGK R
  S:     6 KIILAGTGTFSAKIFKSLLDNDRFEVVGLISQPNRALDRSKNVILTPVAKLAKEYQVTLFQPNKIKEIVDELKEREFDFFITAAYGQIIPNDILALPKKAAINVHGSILEKYRGAAPVQHAILNDEKETGISLIYMIDKMDAGDIIAIEKVQIEEDDTALEIYDKLAKVAIENLPLWLDKLYKNEIIATKQDESKVTFASKIKNEDAELHLEMSTKEALNKIRAFNDQPGAFIVKNQKRLKIFQATNQKNKSP-------------LVLEFADGKLYLIEYQFEGKKR 280
>gi|149011397|ref|ZP_01832644.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP19-BS75] >gi|147764387|gb|EDK71318.1| methionyl-tRNA formyltransferase [Streptococcus pneumoniae SP19-BS75] (280 aa)
Score = 491, Expect = 1.3e-47, Identities = 101/266 (37%), Positives = 169/266 (63%)
  Q:    42 QPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           QPD+ +GRKK I  + VK+ A E  +  +QP K+    E+E+ +K L     VT AFGQF+P  +L   +F  +N+HASLLP++RGGAPIH+A+I G++E GV +M  +K+MDAGD+   R + I + D   TLF+K+  +  D++L+ L      +  P  QD S+V+F+ NI  ++EK+++ K   ++ N IRG++  P A+ F+   + K+++A+    + N  PG I +I K+ ++++T +  + +K+VQ  GK + ++ + LNG
  S:     3 QPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEDLMK-LGADGIVTAAFGQFLPSKLLDSMDFA-VNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGN--PGEILSIGKKELIVATAEGALSLKQVQPAGKPKMDIASFLNG 267
>gi|114561211|ref|YP_748724.1| methionyl-tRNA formyltransferase [Shewanella frigidimarina NCIMB 400] >gi|122301206|sp|Q08A29|FMT_SHEFN Methionyl-tRNA formyltransferase >gi|114332504|gb|ABI69886.1| methionyl-tRNA formyltransferase [Shewanella frigidimarina NCIMB 400] (318 aa)
Score = 490, Expect = 1.5e-47, Identities = 103/302 (34%), Positives = 174/302 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  KI+F GTP+ A   L AL++   DV+A   QPD+P GR K++  S VK LA+E  I  FQP  ++  E + EL  LN    +  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+ ETGV +M+    +D GD+     + IE +DT+++L++K+       ++  L  + +      KQDE+  ++A  +SK++ ++++ K+A ++   IR  +  P +Y       +K+++A  +    + APGTI   +K+GI I+T +  +++K +Q+  K   +V +ILN   +
  S:     2 KPLKIIFAGTPDFAARHLQALIDSEHDVIATYTQPDRPAGRGKKLTASPVKALALEHAIPVFQPASLRNEEAQAELAALNADIMIVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDIGLDTGDMLLKTHLPIEATDTSASLYEKLAEQGPKALVQALIGLSDGSLKAQKQDETLANYAEKLSKEEARLDWNKSAKQLWQDIRAFNPWPVSYFEHQQSVIKVWQADYSAELCSQAPGTIIAATKQGIEIATAEGKLMIKTMQLPNKKPLDVADILNARGD 305
>gi|165918163|ref|ZP_02218249.1| methionyl-tRNA formyltransferase [Coxiella burnetii RSA 334] >gi|165918023|gb|EDR36627.1| methionyl-tRNA formyltransferase [Coxiella burnetii RSA 334] (314 aa)
Score = 490, Expect = 1.5e-47, Identities = 102/299 (34%), Positives = 173/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK-EIENE-LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KIVF GTP+ A   L AL++ S  V+AV  QPD+P GR ++I+ S VK++A +  I   QP  ++ E+E E L  +N    V  A+G  +P   L+    GC+N+HASLLP++RG API  A++ G++ETG+ +M+  + +D GDV       I   DT + L  +++ +  D++L  L K+   +    KQDE+  ++A  I K +  IN+ K+AVEI   +R  + TP A+ +   + M++++A   + K++  PG + +  K+GI I+     + + ++Q+ GK      + +N + +
  S:     4 KIVFAGTPQFAVPTLRALIDSSHRVLAVYTQPDRPSGRGQKIMESPVKEIARQNEIPIIQPFSLRDEVEQEKLIAMNADVMVVVAYGLILPKKALNAFRLGCVNVHASLLPRWRGAAPIQRAILAGDRETGISIMQMNEGLDTGDVLAKSACVISSEDTAADLHDRLSLIGADLLLESLAKLEKGDIKLEKQDEASATYASKIQKQEALINWRKSAVEIARQVRAFNPTPIAFTYFEGQPMRIWRATVVDEKTDFEPGVLVDADKKGISIAAGSGILRLHQLQLPGKRVCSAGDFINAHGD 304
>gi|77978259|ref|ZP_00833691.1| COG0223: Methionyl-tRNA formyltransferase [Yersinia intermedia ATCC 29909] (320 aa)
Score = 490, Expect = 1.8e-47, Identities = 103/308 (33%), Positives = 178/308 (57%)
  Q:     3 EKRNSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++ N   + +I+F GTP+ A   L ALL     +V V  QPD+P GR  ++  S VK LA +  I   QP  +K  EN+  + +LN    V  A+G  +P S+L++P  GCIN+H SLLP++RG API  AV  G+ +TGV +M+    +D GD+    + +I+  DT++TL+ K+  L    +L  L+++      P  Q+E++V++A  +SK++ K+++  +AV++   IR  +  P +Y  ++++ +K+++A    +  +  PGTI +  K GI ++T D  + + ++Q  GK      ++LN   E
  S:     2 QETNVSDSLRIIFAGTPDFAARHLGALLSSQHQIVGVFTQPDRPAGRGNKLTPSPVKILAEQHGIPVLQPKSLKPEENQHLVADLNADIMVVVAYGLILPASVLAMPRLGCINVHGSLLPRWRGAAPIQRAVWAGDAKTGVTIMQMDVGLDTGDMLHKIECDIQPEDTSATLYDKLAQLGPQGLLVTLQQLAEGSTQPEVQNEAQVTYAEKLSKEEAKLDWSLSAVQLERCIRAFNPWPVSYFVVDEQPIKVWQAQVFAAVEDIKPGTIIHADKHGIQVATADGVLNITQLQPAGKKAMSAADLLNSRRE 311
>gi|78484537|ref|YP_390462.1| methionyl-tRNA formyltransferase [Thiomicrospira crunogena XCL-2] >gi|78362823|gb|ABB40788.1| methionyl-tRNA formyltransferase [Thiomicrospira crunogena XCL-2] (312 aa)
Score = 490, Expect = 1.9e-47, Identities = 92/285 (32%), Positives = 173/285 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGK 296
           +I+F GTP+ +   L  L++   +VVAV  QPD+P GR +++  S VK+ A+E +I  +QP  +K  E + EL+ L     +  A+G  +P ++L +P++GC+NIHAS+LP++RG API  A+  G+ ETGV +M+    +D GD+    K  I+  DT  TL  +++ L  D ++  L  +   +  P+KQDE +V++A  ++K + +++++ +A  +   ++  +  P A+     + +++++A   ++ +  +PG + ++SK G+ ++T    +L+K+VQ  GK
  S:     6 RIIFAGTPDFSVPPLKTLIDSEHEVVAVYTQPDRPAGRGRKLTASPVKQTALEHDIPVYQPVSLKTPEAQAELEALQADVMIVVAYGLILPKAVLDMPKYGCLNIHASILPRWRGAAPIQRAIQMGDAETGVTIMQMDVGLDTGDMLTILKTPIKPEDTAQTLHDRLSALGCDAMMTTLSNLQTDQLSPVKQDERQVTYAEKLNKAEAELDWQASAQTLARQVQAFNPWPVAFTQYQGQPLRIWQAEVGHASTQKSPGLVISVSKTGMEVATGKGSLLIKQVQPSGK 292
>gi|95928562|ref|ZP_01311309.1| methionyl-tRNA formyltransferase [Desulfuromonas acetoxidans DSM 684] >gi|95135352|gb|EAT17004.1| methionyl-tRNA formyltransferase [Desulfuromonas acetoxidans DSM 684] (314 aa)
Score = 489, Expect = 2.1e-47, Identities = 102/296 (34%), Positives = 168/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           + VFMGTP+ A   L  L+E    +V V  QPD+P GR K++    VK+LA+E +I  FQP K+++ E   +L+ L+P   V  A+GQ +P ++L IP++GCIN+HASLLP++RG API+ A+++G+  TGV  M     +D GD+   + ++I   +T   L  ++  L  + +   L ++        KQD+S  ++A  + K+D  I++ K A +I NL+RGL   PGAY  ++ + +KL K      +    PG +   S E ++++     + +  +Q+ GK      + L G
  S:     8 RTVFMGTPDFALDTLQGLIESGVQMVGVYTQPDRPKGRGKKLAAPPVKELALEHDIPVFQPQKLRDEEAVKQLRSLSPDLIVVVAYGQILPQAVLDIPKYGCINVHASLLPRHRGAAPINKAIVDGDPMTGVTTMMMDVGLDTGDMLVKKSLSIHPDETAGQLHDRLAPLGREAMEETLARLCAGTLAREKQDDSLSTYASMMKKEDGCIDWSKEARQIHNLVRGLDPWPGAYTLLDGQTLKLAKTRCVEGQGE--PGQVLEASGETVIVACGQGALQLGALQLPGKKMLSAADFLRG 303
>gi|187931618|ref|YP_001891602.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712527|gb|ACD30824.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. mediasiatica FSC147] (313 aa)
Score = 488, Expect = 2.6e-47, Identities = 109/299 (36%), Positives = 177/299 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   I+F GTP+I+   L  L +  +++ AV+ QPD+  GR K++ FS VK++A+  +   FQP   K   E+  ++K+L P   V  A+G  +P   L IP +GC+NIH SLLPK+RG API  A+  G+ +TGVC+M+    +D GD+  + ++ I+E+DT+ TL  K   L    +L  LEK+  ++  P    + + ++A+ I+K +  I+F K+A +I   IR  +  PGAY  ++D+ +K+  F+ +  N+  N   GTI +I + G  I+T D  I  +++Q   K    + +ILNG
  S:     2 KKLNIIFAGTPDISAQVLKDLYKSQYNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPRYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGVCIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEP---QQGEPTYAHKITKQEGLIDFTKSAWQISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNT-DNRKAGTIIDIYRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNG 301
>gi|170724407|ref|YP_001758433.1| methionyl-tRNA formyltransferase [Shewanella woodyi ATCC 51908] >gi|169809754|gb|ACA84338.1| methionyl-tRNA formyltransferase [Shewanella woodyi ATCC 51908] (320 aa)
Score = 488, Expect = 2.9e-47, Identities = 105/298 (35%), Positives = 175/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           ++F GTP+ A   L AL+    +V+AV  + DKP GR K++  S VK LA+E  I  +QP  ++  + + EL  LN    V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  A+ +G+ ETGV +M+    +D GD+    ++ IE+SDT+++L++K+     + ++  L  +   E    KQDE+  ++A  +SK++ ++++ K+A ++   IR  +  P ++    D  +K+ +A  + SKS    GTI +  KEGI I+T D  + +  +Q+ GK    V +ILN  SE
  S:     6 VIFAGTPDFAARHLQALINSEHNVIAVYSRADKPAGRGKKLQASPVKMLALENEIPVYQPTSLRDEQAQAELASLNADIMVVVAYGLILPKVVLDTPKLGCINVHGSILPRWRGAAPIQRALWSGDTETGVTIMQMDIGLDTGDMLLKTQLPIEDSDTSASLYEKLAEQGPEALVEALTGLAKGELAAEKQDEALANYAEKLSKEEAELDWNKSAAQLWREIRAFNPWPISHFSHQDASIKVREAHVSQSKSQAPAGTIISAGKEGIEIATGDGVLTLLNMQLPGKKPLSVADILNSRSE 305
>gi|149280329|ref|ZP_01886450.1| methionyl-tRNA formyltransferase [Pedobacter sp. BAL39] >gi|149228878|gb|EDM34276.1| methionyl-tRNA formyltransferase [Pedobacter sp. BAL39] (297 aa)
Score = 488, Expect = 3.1e-47, Identities = 118/292 (40%), Positives = 173/292 (59%)
  Q:    16 MGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDES-KVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           MGTP+ A  +LNAL+E  FDV AVV   DKP GR ++I  S+VK+ A+ K IK  QP K+K+ E   ELK +N    V  AF + +P+++ ++P  G IN+HASLLP+YRG API+ A+INGEKE+GV       ++D GDV  S KV I+ +DT   L  K+      +++  ++ + + +Y    Q +S ++  A  I K+   I++ +   +I NLIRGLS  P AY  +N K +K+F A    ++   A G   +  K  +  STKD  I + ++Q EGK R  V+  L G
  S:     1 MGTPDFAVASLNALVEAGFDVAAVVTAADKPAGRGQKIQESAVKQYAVAKGIKVLQPLKLKDPEFLEELKSINADLQVVVAF-RMLPEAVWNMPAKGTINLHASLLPQYRGAAPINHAIINGEKESGVTTFFLKHEIDTGDVIFSEKVEIQNNDTAGDLHDKLMATGAGLLVKTVKAIESGDYQEQPQPQSGELKHAPKIFKEHCLIDWNQPVAKIYNLIRGLSPYPTAYTLLNGKTLKVFSAEMEETEPGIAAGGFLSDGKTFLKFSTKDGFIKLTDLQYEGKKRMTVEEFLRG 294
>gi|153206914|ref|ZP_01945732.1| methionyl-tRNA formyltransferase [Coxiella burnetii 'MSU Goat Q177'] >gi|120576987|gb|EAX33611.1| methionyl-tRNA formyltransferase [Coxiella burnetii 'MSU Goat Q177'] (314 aa)
Score = 488, Expect = 3.2e-47, Identities = 101/299 (33%), Positives = 173/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK-EIENE-LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KIVF GTP+ A   L AL++ S  V+AV  QPD+P GR ++I+ S VK++A +  I   QP  ++ E+E E L  +N    V  A+G  +P   L+    GC+N+HASLLP++RG API  A++ G++ETG+ +M+  + +D GD+       I   DT + L  +++ +  D++L  L K+   +    KQDE+  ++A  I K +  IN+ K+AVEI   +R  + TP A+ +   + M++++A   + K++  PG + +  K+GI I+     + + ++Q+ GK      + +N + +
  S:     4 KIVFAGTPQFAVPTLRALIDSSHRVLAVYTQPDRPSGRGQKIMESPVKEIARQNEIPIIQPFSLRDEVEQEKLIAMNADVMVVVAYGLILPKKALNAFRLGCVNVHASLLPRWRGAAPIQRAILAGDRETGISIMQMNEGLDTGDMLAKSACVISSEDTAADLHDRLSLIGADLLLESLAKLEKGDIKLEKQDEASATYASKIQKQEALINWRKSAVEIARQVRAFNPTPIAFTYFEGQPMRIWRATVVDEKTDFEPGVLVDADKKGISIAAGSGILRLHQLQLPGKRVCSAGDFINAHGD 304
>gi|152977799|ref|YP_001343428.1| methionyl-tRNA formyltransferase [Actinobacillus succinogenes 130Z] >gi|171472916|sp|A6VKJ6|FMT_ACTSZ Methionyl-tRNA formyltransferase >gi|150839522|gb|ABR73493.1| methionyl-tRNA formyltransferase [Actinobacillus succinogenes 130Z] (317 aa)
Score = 487, Expect = 3.6e-47, Identities = 104/302 (34%), Positives = 180/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGD----VYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KN  I+F GTP+ A   L ALL  + +V+AV  QPDKP GR K++  S VK+LA + N+  +QP  ++  E ++EL  LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  A+  G+K+TGV +M+  + +D GD    VYC     I   +T++TL++K+  L    ++  L+ + +  + P  QD+S+  +A  ++K++ K+++   A ++   IR  +  P A+  +    N++++K+++A         A GT+    K+G+ I+T D  + +  +Q  GK    V++ LNG ++
  S:     2 KNLNIIFAGTPDFAAQHLQALLASNHNVIAVYTQPDKPAGRGKKLQASPVKQLAQQHNLPVYQPKSLRNEEAQSELAALNADVMVVVAYGLILPKAVLEAPRLGCLNVHGSILPRWRGAAPIQRAIWAGDKQTGVTVMQMNEGLDTGDMLHKVYCE----ITPQETSATLYQKLAQLAPSALIEVLDHLEDGSFQPQVQDDSQSCYADKLTKEEAKLDWTLPAAQLERNIRAFNPAPTAFLTLNLNGNEERIKIYQA-DVLPHQEKAAGTVLACDKKGVQIATADGVLNITRLQPSGKKPMSVQDFLNGRAD 308
>gi|109645778|ref|ZP_01369698.1| methionyl-tRNA formyltransferase [Desulfitobacterium hafniense DCB-2] >gi|109643727|gb|EAT53280.1| methionyl-tRNA formyltransferase [Desulfitobacterium hafniense DCB-2] (320 aa)
Score = 487, Expect = 4.0e-47, Identities = 107/296 (36%), Positives = 172/296 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFK-AVSTNSKSNNA-----------PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++VFMGTP+ A   L AL     DV  V  QPD+P GR K +  S VK  A E  +  +QP K+K  E+   LKEL P   +  A+GQ +   IL +P +GCIN+HASLLP +RG APIHW+++ G++ TGV  M+  + +D GD+    ++ I E  TT  L   +      +++  LE++   + P   Q +  V +A  ++++ EKI++ ++A +I N IRGL+  PG+Y    ++ +K++K ++S  ++ + A           PG I    ++G+L+ T +  I + EVQ  GK     ++   G
  S:     2 RLVFMGTPDFAVPTLQALAAHGHDVAGVFTQPDRPSGRGKNLKPSPVKTAAQELGLPVYQPPKVKSPESLEILKELAPEVIIVVAYGQLLSKEILGLPPYGCINVHASLLPDWRGAAPIHWSILKGDQRTGVTTMQMDEGLDTGDMLLKTELPIGEDTTTGELHDALAQAGAQLLIATLEQLHKGKLPRTPQ-KGPVRYASLLTREHEKIDWARSAQDIHNQIRGLNPWPGSYILFREETVKVWKSSISAQARGDGAEPGLPALKDFKPGEIIAWDQQGLLVQTGEGLIRIVEVQPAGKKPMPARDFFLG 310
>gi|29655280|ref|NP_820972.1| methionyl-tRNA formyltransferase [Coxiella burnetii RSA 493] >gi|154706101|ref|YP_001425401.1| methionyl-tRNA formyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|161831370|ref|YP_001595981.1| methionyl-tRNA formyltransferase [Coxiella burnetii RSA 331] >gi|189044506|sp|A9KH14|FMT_COXBN Methionyl-tRNA formyltransferase >gi|189044507|sp|A9N9H5|FMT_COXBR Methionyl-tRNA formyltransferase >gi|33516855|sp|Q83AA8|FMT_COXBU Methionyl-tRNA formyltransferase >gi|29542552|gb|AAO91486.1| methionyl-tRNA formyltransferase [Coxiella burnetii RSA 493] >gi|154355387|gb|ABS76849.1| methionyl-tRNA formyltransferase [Coxiella burnetii Dugway 5J108-111] >gi|161763237|gb|ABX78879.1| methionyl-tRNA formyltransferase [Coxiella burnetii RSA 331] (314 aa)
Score = 486, Expect = 4.3e-47, Identities = 101/299 (33%), Positives = 173/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK-EIENE-LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KIVF GTP+ A   L AL++ S  V+AV  QPD+P GR ++I+ S VK++A +  I   QP  ++ E+E E L  +N    V  A+G  +P   L+    GC+N+HASLLP++RG API  A++ G++ETG+ +M+  + +D GDV       I   DT + L  +++ +  D++L  L K+   +    KQDE+  ++A  I K +  I++ K+AVEI   +R  + TP A+ +   + M++++A   + K++  PG + +  K+GI I+     + + ++Q+ GK      + +N + +
  S:     4 KIVFAGTPQFAVPTLRALIDSSHRVLAVYTQPDRPSGRGQKIMESPVKEIARQNEIPIIQPFSLRDEVEQEKLIAMNADVMVVVAYGLILPKKALNAFRLGCVNVHASLLPRWRGAAPIQRAILAGDRETGISIMQMNEGLDTGDVLAKSACVISSEDTAADLHDRLSLIGADLLLESLAKLEKGDIKLEKQDEASATYASKIQKQEALIDWRKSAVEIARQVRAFNPTPIAFTYFEGQPMRIWRATVVDEKTDFEPGVLVDADKKGISIAAGSGILRLHQLQLPGKRVCSAGDFINAHGD 304
>gi|170288210|ref|YP_001738448.1| methionyl-tRNA formyltransferase [Thermotoga sp. RQ2] >gi|170175713|gb|ACB08765.1| methionyl-tRNA formyltransferase [Thermotoga sp. RQ2] (313 aa)
Score = 486, Expect = 4.5e-47, Identities = 107/296 (36%), Positives = 174/296 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVF+GTPE A   L  L++  F+VV VV QPDKP GR +++  + VK +A +  + F QP  I  KE    L+ + P   +  ++G+ + + +LS+P  GC NIH SLLPKYRG +PI   + NGE+ TGV + + ++++DAG +   R+++I+  +T   L K++  L  ++ +  LEK+   +    +QD S+ ++A  I K+D  ++F K+A  + N IR     PGA  F+ + ++KLF   + +S S + PG I+ I +EG  I T    + VK +Q+ GK +     + NG
  S:     2 RIVFVGTPEFAAEILEHLIKNGFNVVGVVTQPDKPRGRGRKVEPTPVKVVAEKHRVPFIQPESINKKEALEFLRSVGPDVIIVASYGKILGEKVLSLPSLGCYNIHPSLLPKYRGASPIQRVLENGEERTGVTIYKMVRELDAGPIALQREISIDPFETFDQLEKRLIELSKEMSIEFLEKLKVGDIELKEQDHSRATYAPMIKKEDLIVDFSKDAESVKNKIRAYDSRPGARAFLGNDEVKLFGVTAIDS-SGDEPGLIHYIDREGAWIGTGKGMVKVKYLQLPGKKKLTFWELRNG 298
>gi|151570484|gb|EDN36138.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. novicida GA99-3549] (313 aa)
Score = 486, Expect = 4.7e-47, Identities = 109/299 (36%), Positives = 176/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   I+F GTP+I+   L  L +   ++ AV+ QPD+  GR K++ FS VK++A+  +   FQP   K   E+  ++K+L P   V  A+G  +P   L IP +GC+NIH SLLPK+RG API  A+  G+ +TG+C+M+    +D GD+  + ++ I+E+DT+ TL  K   L    +L  LEK+  ++  P    + + S+A+ I+K +  I+F K+A +I   IR  +  PGAY  ++D+ +K+  F+ +  N+  N   GTI +I + G  I+T D  I  +++Q   K    + +ILNG
  S:     2 KKLNIIFAGTPDISAQVLKDLYKSQHNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPRYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGICIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEP---QQGEPSYAHKITKQEGLIDFTKSAWQISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNT-DNRKAGTIIDIDRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNG 301
>gi|62259769|gb|AAX77868.1| unknown protein [synthetic construct] (348 aa)
Score = 486, Expect = 4.8e-47, Identities = 109/299 (36%), Positives = 176/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   I+F GTP+I+   L  L +   ++ AV+ QPD+  GR K++ FS VK++A+  +   FQP   K   E+  ++K+L P   V  A+G  +P   L IP +GC+NIH SLLPK+RG API  A+  G+ +TGVC+M+    +D GD+  + ++ I+E+DT+ TL  K   L    +L  LEK+  ++  P    + + ++A+ I+K +  I+F K+A +I   IR  +  PGAY  ++D+ +K+  F+ +  N+  N   GTI +I + G  I+T D  I  +++Q   K    + +ILNG
  S:    28 KKLNIIFAGTPDISAQVLKDLYKSQHNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPRYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGVCIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEP---QQGEPTYAHKITKQEGLIDFTKSAWQISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNT-DNRKAGTIIDIYRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNG 327
>gi|110643526|ref|YP_671256.1| methionyl-tRNA formyltransferase [Escherichia coli 536] >gi|191174466|ref|ZP_03035967.1| methionyl-tRNA formyltransferase [Escherichia coli F11] >gi|123343556|sp|Q0TCH4|FMT_ECOL5 Methionyl-tRNA formyltransferase >gi|110345118|gb|ABG71355.1| methionyl-tRNA formyltransferase [Escherichia coli 536] >gi|190905274|gb|EDV64912.1| methionyl-tRNA formyltransferase [Escherichia coli F11] (315 aa)
Score = 485, Expect = 5.8e-47, Identities = 101/299 (33%), Positives = 174/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    ++V V  QPD+P GR K+++ S VK  A +K +  FQP  ++  EN+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ TL+ K+  L    ++  L+++ +    P  QDE+ V++A  +SK++ +I++  +A ++   IR  +  P ++  I  + +K++KA   ++ +  APGTI   +K+GI ++T D  + +  +Q  GK    V+++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHNIVGVFTQPDRPAGRGKKLMPSPVKVQAEDKGLPVFQPVSLRPQENQQLVADLQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAKPEVQDETLVTYAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTTTKAAPGTILEANKQGIQVATGDGILNLLSMQPAGKKAMSVQDLLNSRRE 306
>gi|90413778|ref|ZP_01221766.1| methionyl-tRNA formyltransferase [Photobacterium profundum 3TCK] >gi|90325247|gb|EAS41744.1| methionyl-tRNA formyltransferase [Photobacterium profundum 3TCK] (314 aa)
Score = 485, Expect = 6.6e-47, Identities = 99/302 (32%), Positives = 174/302 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E ++  +QP  ++  + + EL  LN    +  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G++ETGV +M+  + +D GD+     + IE +DT++T++ K+  L  + +++ L ++        KQ++   ++A  ++K++ KI++   A  I   IR  +  P +Y  + ++ +K++ AV         PGTI +  K+GI ++T    + + E+Q  GK   + ++ILN   E
  S:     3 KPLRIVFAGTPDFAARHLAALLSSQHEVIAVYTQPDRPAGRGKKLTASPVKNIALENDLPVYQPASLRNEDAQQELSALNADIMIVVAYGLLLPKIVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDEETGVTIMQMDEGLDTGDMLTIATLAIEPTDTSATMYDKLAGLGPNALIDCLSEISAGTAIAKKQNDELANYAKKLNKEEAKIDWAMEATAIERCIRAFNPWPMSYFAVAEQNVKVWHAVVEADNQGKTPGTILSADKQGITVATGKGALRLIELQPPGKKAMKAQDILNSRRE 306
>gi|167344056|ref|ZP_02289897.1| methionyl-tRNA formyltransferase [Listeria monocytogenes FSL J1-208] (215 aa)
Score = 485, Expect = 7.2e-47, Identities = 97/212 (45%), Positives = 145/212 (68%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEK 223
           KI+FMGTPE +   L  L   ++DVVAVV QPD+P+GRK+ +    VKK A+E  I  +QP K++   E+E EL  L     VT A+GQ +P+S+L  P+ G IN+HASLLP+YRGGAP+H+A+++G+ ETGV +M  ++++DAGD+   RK+ I + D T T+F K++ L  +++++ L      +   I QD  KV+FA NIS++ EKI++ K
  S:     3 KIIFMGTPEFSVPVLKQL-ANTYDVVAVVTQPDRPVGRKRVLTPPPVKKAALELAIPVYQPEKLRTSSELE-ELIALKADLLVTAAYGQILPNSLLESPKHGAINVHASLLPEYRGGAPVHYALLDGKTETGVTIMYMVEKLDAGDMISQRKIPITDEDNTGTMFDKLSKLGAELLMDTLPDFLAGKITAIPQDPEKVTFARNISREQEKIDWTK 215
>gi|54310618|ref|YP_131638.1| methionyl-tRNA formyltransferase [Photobacterium profundum SS9] >gi|73919412|sp|Q6LLJ2|FMT_PHOPR Methionyl-tRNA formyltransferase >gi|46915061|emb|CAG21836.1| Putative Methionyl-tRNA formyltransferase [Photobacterium profundum SS9] (314 aa)
Score = 484, Expect = 7.5e-47, Identities = 100/302 (33%), Positives = 174/302 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E ++  +QP  ++  + + EL  L     V  A+G  +P  +L  P+ GCIN+H S+LP++RG API  ++  G++ETGV +M+  + +D GD+     + IE +DT++T++ K+  L  + +++ L ++        KQ++   ++A  ++K++ KI++   A  I   IR  +  P +Y  + ++ +K++ AV        APGTI +  K+GI ++T    + + E+Q  GK   + ++ILN   E
  S:     3 KPLRIVFAGTPDFAARHLAALLSSQHEVIAVYTQPDRPAGRGKKLTASPVKNIALENDLPVYQPASLRNEDAQQELAALKADIMVVVAYGLLLPKFVLDTPKLGCINVHGSILPRWRGAAPIQRSIWAGDEETGVTIMQMDEGLDTGDMLTIATLPIEPTDTSATMYDKLAGLGPNALIDCLSEISAGTAIAEKQNDELANYAKKLNKEEAKIDWAMEATAIERCIRAFNPWPMSYFAVAEQNVKVWHAVVEAENQGKAPGTILSADKQGITVATGKGALRLIELQPPGKKAMKAQDILNSRRE 306
>gi|124485019|ref|YP_001029635.1| methionyl-tRNA formyltransferase [Methanocorpusculum labreanum Z] >gi|124362560|gb|ABN06368.1| methionyl-tRNA formyltransferase [Methanocorpusculum labreanum Z] (309 aa)
Score = 484, Expect = 7.6e-47, Identities = 112/303 (36%), Positives = 182/303 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-MKLFKAVSTNSKSNNAPG-TINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           +++FMGTPE A  +L A+  K  ++V ++ + DKP  R   I FS VK+ A+E  I  FQP  +K+  +  ELK L+P   V  A+G  IPD+IL +P+   IN+H SLLPKYRG AP+ ++V+NG+ ETGV +M    ++DAGDV  ++ + ++E+ +   +   +  L  + ++  L+ + +     I QDE+KV+FA +ISK++  I++   A  + N IRGLS  PGA   + D K +K++KA   +   +  PG  ++ I K+G ++ T D  + +   + EGK       I+NG+  +K+G
  S:     2 RVLFMGTPEYALSSLRAVFAKH-EIVGILTRADKPNRRGNRIEFSPVKQFALEHGIPVFQPENMKDPALLEELKALSPDISVVVAYGMMIPDAILELPKHNTINLHGSLLPKYRGAAPMQYSVLNGDSETGVSIMYVTARLDAGDVIHAKSIPLDENASYGEVHDLLAELGAEALIEALDLLESGRAVRIPQDETKVTFAPSISKEECVIDWTLPATVVHNRIRGLSPIPGANTRLPDGKLLKIYKAEKVSGDYSGEPGMVVDVIKKKGPVVMTGDGAVCILSAKPEGKREMPGFEIVNGHY-LKVG 306
>gi|148269535|ref|YP_001243995.1| methionyl-tRNA formyltransferase [Thermotoga petrophila RKU-1] >gi|166215525|sp|A5IJP6|FMT_THEP1 Methionyl-tRNA formyltransferase >gi|147735079|gb|ABQ46419.1| methionyl-tRNA formyltransferase [Thermotoga petrophila RKU-1] (313 aa)
Score = 484, Expect = 7.7e-47, Identities = 108/296 (36%), Positives = 172/296 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVF+GTPE A   L  L++  F+VV VV QPDKP GR +++  + VK +A +  + F QP  I  KE    L+ + P   +  ++G+ + + +LS+P  GC NIH SLLPKYRG +PI   + NGE+ TGV + + ++++DAG +   R+++I+  +T   L K++  L  ++ +  LEK+   +    +QD S+ ++A  I K+D  ++F K+A  + N IR     PGA  F+ + ++KLF   + +S S + PG IN I+KEG  I T    + V  +Q  GK +       NG
  S:     2 RIVFVGTPEFAAEILEHLIKNGFNVVGVVTQPDKPRGRGRKVEPTPVKVVAEKHRVPFIQPESINKKEALEFLRSVGPDVIIVASYGKILGEKVLSLPSLGCYNIHPSLLPKYRGASPIQRVLENGEERTGVTIYKMVRELDAGPIALQREISIDPFETFDQLEKRLIELSKEMSIEFLEKLKVGDIELKEQDHSRATYAPMIKKEDLIVDFSKDAESVKNKIRAYDSRPGARAFLGNDEVKLFGVTAIDS-SGDEPGLINYINKEGAWIGTGRGKVKVGCIQFPGKRKMTFWEAKNG 298
>gi|151571937|gb|EDN37591.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. novicida GA99-3548] (313 aa)
Score = 484, Expect = 7.8e-47, Identities = 109/299 (36%), Positives = 176/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   I+F GTP+I+   L  L +   ++ AV+ QPD+  GR K++ FS VK++A+  +   FQP   K   E+  ++K+L P   V  A+G  +P   L IP +GC+NIH SLLPK+RG API  A+  G+ +TG+C+M+    +D GD+  + ++ I+E+DT+ TL  K   L    +L  LEK+  ++  P    + + S+A+ I+K +  I+F K+A +I   IR  +  PGAY  ++D+ +K+  F+ +  N+  N   GTI +I + G  I+T D  I  +++Q   K    + +ILNG
  S:     2 KKLNIIFAGTPDISAQVLKDLYKSQHNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPRYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGICIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEP---QQGEPSYAHKITKQEGLIDFTKSAWQISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNT-DNRKVGTIIDIDRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNG 301
>gi|56708025|ref|YP_169921.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110670496|ref|YP_667053.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. tularensis FSC198] >gi|134301840|ref|YP_001121808.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. tularensis WY96-3418] >gi|123359491|sp|Q14HS3|FMT_FRAT1 Methionyl-tRNA formyltransferase >gi|166214897|sp|A4IXN6|FMT_FRATW Methionyl-tRNA formyltransferase >gi|73919393|sp|Q5NGC1|FMT_FRATT Methionyl-tRNA formyltransferase >gi|54114089|gb|AAV29678.1| NT02FT0514 [synthetic construct] >gi|56604517|emb|CAG45558.1| Methionyl-tRNA formyltransferase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320829|emb|CAL08941.1| Methionyl-tRNA formyltransferase [Francisella tularensis subsp. tularensis FSC 198] >gi|134049617|gb|ABO46688.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568751|gb|EDN34405.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. tularensis FSC033] >gi|157122369|gb|EDO66509.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica FSC022] (313 aa)
Score = 484, Expect = 7.9e-47, Identities = 109/299 (36%), Positives = 176/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   I+F GTP+I+   L  L +   ++ AV+ QPD+  GR K++ FS VK++A+  +   FQP   K   E+  ++K+L P   V  A+G  +P   L IP +GC+NIH SLLPK+RG API  A+  G+ +TGVC+M+    +D GD+  + ++ I+E+DT+ TL  K   L    +L  LEK+  ++  P    + + ++A+ I+K +  I+F K+A +I   IR  +  PGAY  ++D+ +K+  F+ +  N+  N   GTI +I + G  I+T D  I  +++Q   K    + +ILNG
  S:     2 KKLNIIFAGTPDISAQVLKDLYKSQHNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPRYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGVCIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEP---QQGEPTYAHKITKQEGLIDFTKSAWQISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNT-DNRKAGTIIDIYRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNG 301
>gi|144575152|gb|AAZ43932.2| methionyl-tRNA formyltransferase [Mycoplasma synoviae 53] (280 aa)
Score = 483, Expect = 9.8e-47, Identities = 124/291 (42%), Positives = 178/291 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGA-YCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVK 302
           KIV  GTPE +      ++ K+F+VVA+V QPDKP  R + +  S VKKLA++ N+K FQP KI  I  ELKEL+    +T AFGQ+IP++IL++P+   +NIH SLLPKYRG API  A++N E ETGV L+   K+MDAGD+    K+ IEESD + TLF+K++NL  + +++ +  +    Y  I QDESKV+ A  + K+D  ++  K   E +  I+  +  PGA Y   N+K +K++ A  T +K  NAP           + +  D DI + + QIE K R  +K
  S:     3 KIVLAGTPEFSVPIFKEII-KNFEVVAIVTQPDKPAKRGQNLQESPVKKLALKYNLKLFQPEKISMIYEELKELDFDYMLTAAFGQYIPENILNLPKKFPLNIHGSLLPKYRGAAPIQHALLNNETETGVQLIIMTKKMDAGDILKEAKIKIEESDISLTLFEKLSNLAAENIVSWIHDLDQNNYQRIIQDESKVTLASKLLKEDSFLDKTKTKKENIAKIKAFALNPGARYINENNKLVKVYFA--TENKIKNAP-----------VFTCVDGDIFLNDYQIESKKRVTLK 280
>gi|89895439|ref|YP_518926.1| hypothetical protein DSY2693 [Desulfitobacterium hafniense Y51] >gi|89334887|dbj|BAE84482.1| hypothetical protein [Desulfitobacterium hafniense Y51] (320 aa)
Score = 483, Expect = 1.0e-46, Identities = 109/296 (36%), Positives = 170/296 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNA-----------PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++VFMGTP+ A   L AL     DV  V  QPD+P GR K +  S VK  A E  +  +QP+K+K  E+   LKEL P   +  A+GQ +   IL +P +GCIN+HASLLP +RG APIHW+++ G++ TGV  M+  + +D GD+    ++ I E  TT  L   +      +++  LE++   E P   Q +  V +A  ++++ EKI++ ++A  I N IRGL+  PG+Y    ++ +K++K+ VS     + A           PG I    ++G+L+ T +  I + EVQ  GK     ++   G
  S:     2 RLVFMGTPDFAVPTLQALAAHGHDVAGVFTQPDRPSGRGKNLKPSPVKAAAQELGLPVYQPHKVKSPESLEILKELIPEVIIVVAYGQLLSKEILELPPYGCINVHASLLPDWRGAAPIHWSILEGDQRTGVTTMQMDEGLDTGDMLLKAELPIGEDTTTGELHDDLAQAGAQLLIATLEQLRKGELPRTPQ-KGPVRYASLLTREHEKIDWARSAQAIHNQIRGLNPWPGSYTLFREETVKVWKSRVSGEEGGSEAEPNRLALKDARPGEIIAWDQQGLLVQTGEGLIRIAEVQPAGKKPMPARDFFLG 310
>gi|191638612|ref|YP_001987778.1| Methionyl-tRNA formyltransferase [Lactobacillus casei] >gi|190712914|emb|CAQ66920.1| Methionyl-tRNA formyltransferase [Lactobacillus casei BL23] (318 aa)
Score = 483, Expect = 1.1e-46, Identities = 104/295 (35%), Positives = 171/295 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKE---LNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEG-ILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++F+GTPE A   L  L+ + +D++AV+ QPD+ +GRK+ +  S VK+ A + +I   QP K+     EL +   + P   VT A+GQF+P   L   +   +N+H SLLPKYRGGAPI ++++NG+ ETGV ++  +K+MDAGD++   K+ +  +D T T+F K++ L  D++L  L K+         QD  KV+F+  I+K+ E +N    A  +   IR L    G Y ++N ++ KL+     ++ S    G+I    K   ++++ +     V E+Q  GK +Q + + LNG
  S:     4 VIFLGTPEFAVPILEGLIAQHYDILAVMTQPDRKVGRKQRLAASPVKQAAQKHDIPVLQPEKLSG-SPELAQAIAMAPDLIVTAAYGQFLPTKFLEAAKIIAVNVHGSLLPKYRGGAPIQYSIMNGDSETGVTIIEMVKKMDAGDMFAQAKLPLTRADDTGTVFAKLSLLGRDLLLETLPKIIAGTATRTPQDPDKVTFSPTITKEQEHLNIHLPAKALDQWIRALRPDVGGYVYLNGQRTKLWAITPLSAGSTLPAGSIVERDKHRLVMVAGQQTTFQVDELQPAGKAKQSIADFLNG 301
>gi|88860598|ref|ZP_01135235.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Pseudoalteromonas tunicata D2] >gi|88817193|gb|EAR27011.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Pseudoalteromonas tunicata D2] (321 aa)
Score = 482, Expect = 1.3e-46, Identities = 98/299 (32%), Positives = 173/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L AL++   ++VAV C PD+P GR K++    VK+LA+  +I+  QP+ +K  E++ EL ELN    V  A+G  +P +IL  P+FGCIN+H S+LP++RG API  A+  G++E+GV +M+    +D GD+       I + +T+++L+ K+  L    ++  +  + N +    KQD+ + ++A  +SK++  I++   A +I   +R  +  P  +   +   +K+++A   N +     GTI    K GI+I+T    + + ++Q EGK     ++ LNG ++
  S:    10 RIIFAGTPDFAARHLQALIDSEHEIVAVYCPPDRPAGRGKKLKACEVKELAVAHDIQVLQPSSLKSTEVQQELAELNADLMVVVAYGLLLPKAILDTPKFGCINVHGSILPRWRGAAPIQRAIWAGDEESGVTIMQMDVGLDTGDMLSIVTCPIAKDETSTSLYDKLAQLGPQAMIATVADIANGQAIATKQDDEQANYAKKLSKEEANIDWTMAADQIERNVRSFNPWPICFTEFSGHTVKIWQAEIVNQQGQ--AGTILQADKNGIIIATAQHALKITQLQPEGKKPMSAQDFLNGRAD 308
>gi|89256594|ref|YP_513956.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica] >gi|115315023|ref|YP_763746.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|156502724|ref|YP_001428789.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167010621|ref|ZP_02275552.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica FSC200] >gi|122324966|sp|Q0BLC5|FMT_FRATO Methionyl-tRNA formyltransferase >gi|123094504|sp|Q2A2U6|FMT_FRATH Methionyl-tRNA formyltransferase >gi|166214895|sp|A7NCY0|FMT_FRATF Methionyl-tRNA formyltransferase >gi|89144425|emb|CAJ79724.1| Methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica LVS] >gi|115129922|gb|ABI83109.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica OSU18] >gi|134253722|gb|EBA52816.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica 257] >gi|156253327|gb|ABU61833.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. holarctica FTNF002-00] (313 aa)
Score = 482, Expect = 1.4e-46, Identities = 109/299 (36%), Positives = 175/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   I+F GTP+I+   L  L +   ++ AV+ QPD+  GR K++ FS VK++A+  +   FQP   K   E+  ++K+L P   V  A+G  +P   L IP +GC+NIH SLLPK+RG API  A+  G+ +TGVC+M+    +D GD+  + ++ I+E+DT+ TL  K   L    +L  LEK+  ++  P    + + ++A+ I+K +  I+F K+A  I   IR  +  PGAY  ++D+ +K+  F+ +  N+  N   GTI +I + G  I+T D  I  +++Q   K    + +ILNG
  S:     2 KKLNIIFAGTPDISAQVLKDLYKSQHNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIPRYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGVCIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEP---QQGEPTYAHKITKQEGLIDFTKSAWRISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNT-DNRKAGTIIDIYRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNG 301
>gi|168211477|ref|ZP_02637102.1| methionyl-tRNA formyltransferase [Clostridium perfringens B str. ATCC 3626] >gi|170710513|gb|EDT22695.1| methionyl-tRNA formyltransferase [Clostridium perfringens B str. ATCC 3626] (317 aa)
Score = 482, Expect = 1.5e-46, Identities = 120/306 (39%), Positives = 177/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLS--------ETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+ A  +L  ++EK F+V A+V QPDKP GR K++  S +KK+ +   I  FQP KI+    I N+LKEL P   +  A+GQ +   IL IP  GCI +HASLLP YRG API+W +INGE +TG   +     +D GD+    +V I ES T   L+  +     +++   +  +   +   +KQ     S+   ++K   KIN+  ++  I NLIRGLS          P AY +  D   K+FK+ S  +   + PG I + + EGI ++TK+  ++++ +Q  G    EVK  L GN +I+ G+ L
  S:     2 KIVFMGTPDFAVPSLKKMIEK-FNVSAIVTQPDKPSGRGKKVSISPIKKVGLSNEIPIFQPEKIRTDSVIINKLKELKPDFIIVVAYGQILTKEILDIPRLGCICLHASLLPMYRGSAPINWCLINGETKTGNTTILMDTGIDTGDMLMRSEVEISESMTAGELYNLLKINGAELLEETINGIITGKICGVKQPNDGSSYVKMLNKQMAKINWNDSSTNIHNLIRGLSSWPYKNINSWPTAYTYYKDIPFKIFKSKSLEANIIDPPGCIIDANDEGIKVATKNGILIIEILQFPGGKPLEVKEFLKGN-KIEKGIIL 316
>gi|186458612|ref|ZP_02968920.1| methionyl-tRNA formyltransferase [bacterium Ellin514] >gi|184204850|gb|EDU01901.1| methionyl-tRNA formyltransferase [bacterium Ellin514] (316 aa)
Score = 482, Expect = 1.6e-46, Identities = 105/298 (35%), Positives = 171/298 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +I+FMGT E+A  +L AL +++ F VVAVV QPD+P GR  ++  S VK++A++  +   QP + +  E    L E  P   V  A+GQ +P SIL +P FGC+N+H SLLPKYRG API WA+++GE  TGV +M+    +D GD+       I+  D +  L  ++  +   +++  + +  + +     Q    VS+A  I K+D K+++ + A  + N +RG +  PGA+  +  +     +K+++A      S N PG I +  K GI+I+  +  + V  +Q EG  R   ++ L G+S
  S:     5 RIIFMGTAELACASLEALTQQTDFSVVAVVTQPDRPKGRDLKLQPSPVKQVALKHALPVLQPERARNPEFVQSLAEFKPDLIVVAAYGQILPKSILELPRFGCLNVHTSLLPKYRGAAPIQWAILDGEPVTGVTIMKMDAGLDTGDILTQETTPIQHEDNSQLLHDRLAQIGAALLVPTIREFVSGKIIARPQPVEGVSYARKILKEDGKLDWTQPAHVLWNRVRGFTPWPGAFTHLPAEPKPLLLKIWQAEVIEGASGN-PGEILSADKTGIIIACGEKALKVTTLQREGGRRMNAQDFLTGHS 308
>gi|189218178|ref|YP_001938820.1| Methionyl-tRNA formyltransferase [Methylokorus infernorum V4] >gi|189185036|gb|ACD82221.1| Methionyl-tRNA formyltransferase [Methylacidiphilum infernorum V4] (320 aa)
Score = 481, Expect = 1.7e-46, Identities = 105/306 (34%), Positives = 181/306 (59%)
  Q:    12 KIVFMGTPEIATYALNAL-LEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           ++VF+GT +    +L A+ L+  + + AVV Q DKP+GR+KE+I S +K+ A++ +I  FQP  I    +  +++ L P   V C +GQ +  ++L IP  G +NIH SLLPKYRG +PI  A++N +KETGV ++   + +D GD+  S K+ +  +DT  TL  ++  L   +++  LE +   + P I Q+ +  S+A  I K+   I++ K+  EI  +IR  +  P A+  +      K +K+FK + ++ ++   PG +  I + GIL++  +   +L++EVQ+EG+ R    +   G + + IG  L
  S:     3 RVVFIGTGDFGVPSLEAIALDGRYTIPAVVTQADKPLGRQKEVIPSPIKRTALKHHIWVFQPENINSAGSIQQIQFLKPDLLVVCDYGQILSKAVLEIPSIGALNIHGSLLPKYRGASPIQAAIMNRDKETGVTVIWMDEGIDTGDILMSDKLLVRSTDTAETLHHRLAELGARLIIQSLEAIRAGKAPRIPQNNALASYAKKIKKEQALIDWTKDRHEIDAMIRAFNPWPVAFTTVWIGGEKKILKIFKVIISH-RAKGMPGEVVRIDRHGILVAAGRSGGLLLREVQLEGRKRMHAADFARG-ARLAIGTVL 314
>gi|56459129|ref|YP_154410.1| methionyl-tRNA formyltransferase [Idiomarina loihiensis L2TR] >gi|73919397|sp|Q5QXI6|FMT_IDILO Methionyl-tRNA formyltransferase >gi|56178139|gb|AAV80861.1| Methionyl-tRNA formyltransferase [Idiomarina loihiensis L2TR] (316 aa)
Score = 481, Expect = 1.9e-46, Identities = 107/300 (35%), Positives = 170/300 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNL---VYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           +IVF GTP+ A   L  LL++S  VV V  QPD+P GR K+   S+VKKLA+E  +  +QP  +K  E++  L +L P   V  A+G  +P ++L IP  GC+N+H SLLP++RG API  A+  G+ E+GVC+M+    +D G V    +  I   +T+++L+ K+ +L       VL DL+   +   P   Q ++  ++A  ++K + KI++ + A  I   +R  +  P ++C     K     +K+  A      SN  PGTI N + EGI + T D  + + + Q+ GK  Q    ++NG S +
  S:     2 RIVFAGTPDFAAQHLQQLLDESHQVVGVYTQPDRPAGRGKKPQPSAVKKLALEHQLPVYQPESLKSEEDQAALADLKPDVMVVVAYGLLLPQAVLDIPTKGCLNVHGSLLPRWRGAAPIQRAIWAGDLESGVCIMQMEAGLDTGPVLHEERCAISPDETSASLYHKLESLGPEALTKVLKDLDGYQSQAKP---QSDANATYAKKLTKQEGKIDWTQPAAFIERCVRAFNPWPMSWCQSEHLKAGQNTVKIHAAELIQGASNKGPGTIINSTHEGIDVVTGDGILRITQAQMPGKKAQPASTLVNGYSNV 308
>gi|170016868|ref|YP_001727787.1| methionyl-tRNA formyltransferase [Leuconostoc citreum KM20] >gi|169803725|gb|ACA82343.1| Methionyl-tRNA formyltransferase [Leuconostoc citreum KM20] (323 aa)
Score = 481, Expect = 1.9e-46, Identities = 109/295 (36%), Positives = 171/295 (57%)
  Q:    13 IVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELN--PFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFE-KNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           +V MGTP+ A   L AL+ + ++ V+AVV QPD+P GRK  +  S VK  A+   +   QP KI       + +N  P   +T AFGQF+P  +L+  +   +N HASLLPKYRGGAP+H+A++NG+ ETGV +M  +K+MDAGDV    KV I  +D   T+F K++    D++L  L K+      P+KQ    V+F+ NI  D + +NFE + A ++   +RGL  T  AY  +  +++K+ +    +  +    G +   +K+ + I+  +  +L V  +Q  GK+   ++  LNG
  S:     5 VVLMGTPQFAVPILEALVADDNYHVLAVVTQPDRPQGRKHILTPSPVKVAALAHKLPVLQPEKIAGSSEMAQIINWQPDFIITAAFGQFLPTKLLAAAQIAAVNTHASLLPKYRGGAPVHYAIMNGDNETGVSIMYMVKEMDAGDVIDVVKVPITSTDNVGTMFDKLSLAGRDLLLATLPKIVAGNISPVKQAIDDVTFSPNIPHDKQNLNFEVETAKQLDWHVRGLYPTHPAYVQVAGQRIKITQVQPLDETTTQPAGYVVEKNKKELKIAAANHTVLRVLRLQPAGKSEMPIQAYLNG 304
>gi|120596856|ref|YP_961430.1| methionyl-tRNA formyltransferase [Shewanella sp. W3-18-1] >gi|166215514|sp|A1RDX6|FMT_SHESW Methionyl-tRNA formyltransferase >gi|120556949|gb|ABM22876.1| methionyl-tRNA formyltransferase [Shewanella sp. W3-18-1] (318 aa)
Score = 480, Expect = 2.2e-46, Identities = 104/302 (34%), Positives = 173/302 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFA--FVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L ALL    +V+ V  QPD+P GR K++  S VK+LA+  NI  +QP  +++   +       A   V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+KETGV +M+    +D GD+     + IE+SDT+++L++K+       +L  L+ + N      KQDE+  ++A  +SK++ ++++ K+A ++   +R  +  P +Y       +K+++A  + + S  APGTI + SK GI ++T D  + +  +Q+ GK    V +ILN   E
  S:     2 KSLNIIFAGTPDFAARHLQALLNSQHNVIGVYTQPDRPAGRGKKLTASPVKELAVANNIPVYQPGSLRKEPAQQALAALNADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDKETGVTVMQMDVGLDTGDMLLKTYLPIEDSDTSASLYEKLAEQGPVALLQALKGLANGTLAAEKQDEALANYAEKLSKEEARLDWNKSAKQLWQEVRAFNPWPVSYFEHQGNTIKVWQAHVSETISTAAPGTIISASKRGIEVATADGVLTLLSMQLPGKKPLNVADILNARGE 305
>gi|53803079|ref|YP_115238.1| methionyl-tRNA formyltransferase [Methylococcus capsulatus str. Bath] >gi|73919406|sp|Q603G2|FMT_METCA Methionyl-tRNA formyltransferase >gi|53756840|gb|AAU91131.1| methionyl-tRNA formyltransferase [Methylococcus capsulatus str. Bath] (308 aa)
Score = 480, Expect = 2.4e-46, Identities = 106/298 (35%), Positives = 168/298 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-------VKEVQIEGKNRQEVKNILNGNS 309
           +IVF GTPE A   L AL+       AV  QPD+P GR ++I  S VK+LAIE  +  FQP  +K  E    L  L P   V  A+G  +P  +L++P FGC+NIHASLLP++RG API  A++ G++ETGV LMR   ++DAG +   R  +I + DTT++L  ++  L  ++++  L  +         QDES+V++A  I K + +++++K+A  +   +R  +  P A   +    ++++ A   +   +  PG+        I+  TK+ D+        + EVQ  GK R   K+ LN ++
  S:     2 RIVFAGTPEFAVPTLRALIASGHPPCAVYTQPDRPAGRGRKIAPSPVKQLAIEHGLPVFQPASLKGPEERERLVALEPDLMVVVAYGLILPTPVLTVPRFGCVNIHASLLPRWRGAAPIQRAILAGDRETGVTLMRIEPRLDAGPMLGKRSCSIGDDDTTASLHDRLAGLGAEMLIELLPGLAADRLTGEIQDESQVTYAEKIEKSEARLDWQKDATSLSRRVRAFNPWPVAETTLEGTVLRIWSAQVLDPAPDAPPGS--------IIACTKNLDVACGRGALRILEVQPPGKRRMSAKDFLNAHA 300
>gi|148654180|ref|YP_001281273.1| methionyl-tRNA formyltransferase [Psychrobacter sp. PRwf-1] >gi|148573264|gb|ABQ95323.1| methionyl-tRNA formyltransferase [Psychrobacter sp. PRwf-1] (348 aa)
Score = 479, Expect = 2.8e-46, Identities = 102/280 (36%), Positives = 169/280 (60%)
  Q:     1 MGEKRNSCKNKKIVFMGTPEIATYALNALLEK----SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE-------LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIND-------KKMKLFKAVSTNSKSNNA--PGTINNISKEGILIS 280
           M    NS   ++++F GTPE A  +L AL+E+    + ++VAV  QPD+  GR +++  S VK+LA+E N+   QP   K+   E       L    P   V  A+G  +P  +L  P +GC+NIHASLLP++RG APIH A++ G+ +TG+ +M+  K +D GD+      +I + +TT++L  KM ++  D ++  L+ +   +    KQD+S  ++A  +SK +  I++ ++A  I   IRG+   PGAY F+ D       K++K+  A+  N+       PGT+ ++ K  IL++
  S:     1 MSINNNSSTRQRVIFAGTPEFAAISLKALIEQQNELNIEIVAVYTQPDRKAGRGQKLTASPVKQLALEHNLPVEQPLTFKKSVEEGLAARETLASYKPDVMVVAAYGLILPMGVLETPTYGCLNIHASLLPRWRGAAPIHRALLAGDAQTGITIMQMDKGLDTGDMLYKVAYDIADDETTASLHDKMADMGADAIVEVLKDLPKYQTQAQKQDDSLATYAEKLSKAEGAIDWTQSAAHIERQIRGMHPYPGAYTFLADPEGNSEPKRVKVLAALPVNASQTTVVEPGTVISVGKNAILVA 300
>gi|116495107|ref|YP_806841.1| methionyl-tRNA formyltransferase [Lactobacillus casei ATCC 334] >gi|122263476|sp|Q038H3|FMT_LACC3 Methionyl-tRNA formyltransferase >gi|116105257|gb|ABJ70399.1| methionyl-tRNA formyltransferase [Lactobacillus casei ATCC 334] (318 aa)
Score = 479, Expect = 3.2e-46, Identities = 104/295 (35%), Positives = 170/295 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKE---LNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEG-ILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++F+GTPE A   L  L+ + +D++AV+ QPD+ +GRK  +  S VK+ A + +I   QP K+     EL +   + P   VT A+GQF+P   L   +   +N+H SLLPKYRGGAPI ++++NG+ ETGV ++  +K+MDAGD++   K+ +  +D T T+F K++ L  D++L  L K+         QD  KV+F+  I+K+ E +N    A  +   IR L    G Y ++N ++ KL+     ++ S    G+I    K   ++++ +     V E+Q  GK +Q + + LNG
  S:     4 VIFLGTPEFAVPILEGLIAQHYDILAVMTQPDRKVGRKLRLAASPVKQAAQKHDIPVLQPEKLSG-SPELAQAIAMAPDLIVTAAYGQFLPTKFLEAAKIIAVNVHGSLLPKYRGGAPIQYSIMNGDSETGVTIIEMVKKMDAGDMFAQAKLPLTRADDTGTVFAKLSLLGRDLLLETLPKIIAGTATRTPQDPDKVTFSPTITKEQEHLNIHLPAKALDQWIRALRPDVGGYVYLNGQRTKLWAITPLSAGSTLPAGSIVERDKHRLVMVAGQQTTFQVDELQPAGKAKQSIADFLNG 301
>gi|71278840|ref|YP_266801.1| methionyl-tRNA formyltransferase [Colwellia psychrerythraea 34H] >gi|123761123|sp|Q48AS9|FMT_COLP3 Methionyl-tRNA formyltransferase >gi|71144580|gb|AAZ25053.1| methionyl-tRNA formyltransferase [Colwellia psychrerythraea 34H] (327 aa)
Score = 479, Expect = 3.5e-46, Identities = 110/298 (36%), Positives = 177/298 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPP----IKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGA-YCFINDK----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTPE A   L AL+    ++VAV C PDKP GR K++   + K LAIE +I   QP   K  E + +L + N    V  A+G  +P+ IL+ P  GCIN+H S+LPK+RG API  ++  G+K+TGV +M+  K +D GD+  S +  IE +DT+++L++K+ NL    ++N L  +   +Y      I QD+   ++A  + K + ++N++ +A E+   IR     P A + F   +    ++++++A     + N  PGTI    KEGI ++T    + ++ +Q+ GK    VK+ILNG S+
  S:     7 IIFAGTPEFAAQHLAALINSEHNIVAVYCPPDKPAGRGKKLTACATKLLAIEHDIIVEQPINFKNEEDQQQLAKYNADIMVVVAYGLLLPEVILNSPRLGCINVHGSILPKWRGAAPIQRSLEAGDKKTGVTIMQMDKGLDTGDMILSAECEIENTDTSASLYEKLANLGPTALVNTLTIMAEPDYQASNHNIAQDDELATYAKKLDKTEAELNWQFSADELHRKIRAYIPWPVAQFTFTESEGKQHRLRIWQASVQEYRGNADPGTIIKADKEGIEVATTSGSLRLEVIQLPGKKALAVKDILNGRSD 315
>gi|120435798|ref|YP_861484.1| methionyl-tRNA formyltransferase [Gramella forsetii KT0803] >gi|117577948|emb|CAL66417.1| methionyl-tRNA formyltransferase [Gramella forsetii KT0803] (315 aa)
Score = 478, Expect = 3.7e-46, Identities = 109/299 (36%), Positives = 183/299 (61%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVF-NLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++ +IVFMGTPE A  +L A+L+  ++VV V+  PDKP GR +++  S+VK  A+ K++K  QP  +K  E ++EL EL P   V  AF + +P S+  +PE+G  N+HASLLP+YRG API+WA+INGE++TGV      +++D G +    +++I+E++   +L  ++ N+   +++  L+ +  N      ++D   +  A  +SK++ KI++     +I NLIRGL+  P A+C++ +     K+K++       +     GTI  IS   I ++  +  ILV E+Q+ GK +   K +LNG
  S:     2 RDLRIVFMGTPEFAVNSLEAILDAGYNVVGVITAPDKPAGRGRKLRESAVKSYALSKDLKVLQPANLKSEEFQSELIELKPNVQVVVAF-RMLPKSVWDLPEYGTFNLHASLLPQYRGAAPINWAIINGEEKTGVSTFFLDEKIDTGAMIFQEEISIDETENLESLHDRLMNMGAKLIVRTLKTIASNTVTTEAQEDSETLRDAPKLSKENTKIDWNAPVEKIYNLIRGLNPYPAAWCYLANSSEELKVKIYDIEKVKQEHRLPNGTI-TISDNMIKVAAINGYILVNEIQLPGKRKMLSKALLNG 305
>gi|110832991|ref|YP_691850.1| methionyl-tRNA formyltransferase [Alcanivorax borkumensis SK2] >gi|122959727|sp|Q0VTE2|FMT_ALCBS Methionyl-tRNA formyltransferase >gi|110646102|emb|CAL15578.1| methionyl-tRNA formyltransferase [Alcanivorax borkumensis SK2] (330 aa)
Score = 478, Expect = 3.7e-46, Identities = 102/300 (34%), Positives = 176/300 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKM---NNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVST--NSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           K  ++ F GTP+ A  +L A+L+    VVAV+ QPD+  GR K++  S VK+LA  + I   QP  +K   I  +L++LN  A V  A+G  IP ++L +P  GC+N+H SLLP++RG API  A+  G+ ETG  +M+    +D G +  S  + I +S+T   L  ++      +   VL DLEK      P   Q +  +++A+ +SK + +++F      + N IR  +  P ++  +N + M++++A  +   +++N+ PG I ++  +GI ++T D  ++++E+Q+ GK R  V ++L GN
  S:     2 KPLRLAFAGTPDFAAASLQAVLDNGHQVVAVLTQPDRAAGRGKKLQQSPVKQLAHSQGITVLQPENLKGEAIHQQLRDLNLDALVVVAYGLIIPQAVLDMPRLGCLNVHGSLLPRWRGAAPIQRAITAGDTETGNTIMQMEAGLDTGPMLLSESLPIGDSETGGELHDRLAAQGARLLVTVLQDLEKYLANATP---QPDEGITYAHKLSKAEARLDFRLPTGALYNRIRAFNPFPVSWVPLNGQPMRIWRASESPQPAQANDEPGYILSVDDQGIHVATGDGSLILEELQLPGKRRMAVSDLLRGN 305
>gi|118497395|ref|YP_898445.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. novicida U112] >gi|195536087|ref|ZP_03079094.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. novicida FTE] >gi|166214896|sp|A0Q626|FMT_FRATN Methionyl-tRNA formyltransferase >gi|118423301|gb|ABK89691.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. novicida U112] >gi|194372564|gb|EDX27275.1| methionyl-tRNA formyltransferase [Francisella tularensis subsp. novicida FTE] (313 aa)
Score = 478, Expect = 4.1e-46, Identities = 108/299 (36%), Positives = 175/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL--FKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   I+F GTP+I+   L  L +   ++ AV+ QPD+  GR K++ FS VK++A+  +   FQP   K   E+  ++K+L P   V  A+G  +P   L I  +GC+NIH SLLPK+RG API  A+  G+ +TG+C+M+    +D GD+  + ++ I+E+DT+ TL  K   L    +L  LEK+  ++  P    + + S+A+ I+K +  I+F K+A +I   IR  +  PGAY  ++D+ +K+  F+ +  N+  N   GTI +I + G  I+T D  I  +++Q   K    + +ILNG
  S:     2 KKLNIIFAGTPDISAQVLKDLYKSQHNIQAVLTQPDRAKGRGKKVQFSPVKEVALANHTPVFQPLSFKKNPEVLEQIKQLKPDVIVVIAYGIIVPQEFLDIARYGCLNIHVSLLPKWRGAAPIQRAIQAGDTKTGICIMQMDAGLDTGDILNTLEIEIQETDTSQTLHDKFAKLSIKPLLETLEKIEIIKPEP---QQGEPSYAHKITKQEGLIDFTKSAWQISCHIRAFTPWPGAYFILDDEAIKVGEFEILYQNT-DNRKAGTIIDIDRSGFDIATSDKIIRFRQLQFPNKKMLNIVDILNG 301
>gi|157372745|ref|YP_001480734.1| methionyl-tRNA formyltransferase [Serratia proteamaculans 568] >gi|166988370|sp|A8GKG6|FMT_SERP5 Methionyl-tRNA formyltransferase >gi|157324509|gb|ABV43606.1| methionyl-tRNA formyltransferase [Serratia proteamaculans 568] (314 aa)
Score = 476, Expect = 6.5e-46, Identities = 99/299 (33%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL     +V V  QPD+P GR  ++  S VK LA + ++  FQP  ++  EN+  + +LN    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       IE  DT+++L+ K+  L    +L  L+++         QDES V++A  +SK++ ++++   AV++   +R  +  P +Y  I+D+ +K+++A      ++  PGTI +  K GI ++T +  + + ++Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSGHQIVGVFTQPDRPAGRGNKLTPSPVKVLAEQHHLPVFQPKSLRPEENQHLVADLNADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDHETGVTIMQMDVGLDTGDMMHKIACPIEADDTSASLYDKLAQLGPQGMLTTLQQMAAGTAKREVQDESLVTYAEKLSKEEARLDWNLPAVQLERCVRAFNPWPVSYFTIDDQPVKVWQATVLAQNADAEPGTIIHADKHGIQVATAEGILNLTQLQPAGKKPMSAQDLLNSRRE 306
>gi|196195393|gb|EDX90352.1| methionyl-tRNA formyltransferase [Alcanivorax sp. DG881] (330 aa)
Score = 476, Expect = 7.7e-46, Identities = 103/300 (34%), Positives = 174/300 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNN---LVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNS--KSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           K  ++ F GTP+ A  +L A+L+    VVAV+ QPD+  GR K++  S VK+LA  ++I   QP  +K  +I  +L++L+  A V  A+G  IP ++L IP   C+N+H SLLP++RG API  A+  G+ ETG  +M+    +D G +  S  + I ES+T   L  ++      +   VLNDLE       P   Q +  V++A+ +SK + +++F      + N IR  +  P ++  +N + M++++A  +    + N+ PG I  +  +GI ++T D  ++++E+Q+ GK R  V ++L GN
  S:     2 KPLRLAFAGTPDFAAASLQAVLDSDHQVVAVLTQPDRAAGRGKKVQQSPVKQLAASQDIAVLQPENLKGEDIRQQLRDLDLDALVVVAYGLIIPQAVLDIPRLSCLNVHGSLLPRWRGAAPIQRAITTGDTETGNTIMQMEAGLDTGPMLLSEALPIGESETGGELHDRLATQGARLLVTVLNDLEHHLANATP---QPDEGVTYAHKLSKAEARLDFRLPTRALYNRIRAFNPFPVSWVPLNGQPMRIWQASESPQPGQDNDEPGHILAVDDQGIHVATGDGALILEELQLPGKRRMAVSDLLRGN 305
>gi|126658839|ref|ZP_01729983.1| methionyl-tRNA formyltransferase [Cyanothece sp. CCY0110] >gi|126619937|gb|EAZ90662.1| methionyl-tRNA formyltransferase [Cyanothece sp. CCY0110] (331 aa)
Score = 475, Expect = 1.0e-45, Identities = 116/306 (37%), Positives = 181/306 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKEL---NPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTN---------------------SKSNNAPG-TINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +++F GTP+ A   L  LL    F+V+ VV QPDK  GR K+II S+VKK+A++ NI  +QP +IK+ ++ L +L       FV  A+GQ +   IL +P+ GC+N+H S+LP+YRG API W + NG+++TG+  M   + MD GD+      +I   D    + +K+ N   D+++  LEK+ N +  PI Q++ + ++A  I+KDD  I++ K+A+ I N IRG    P  +    D K+K+   +  N                      K    PG  I+ I K G +I T +  +L+  VQ  GK  Q   +++NG S +K+G  L
  S:     2 QVIFFGTPQFAVPTLQKLLNHPQFNVIGVVTQPDKRRGRGKKIIPSAVKKVALDHNITVWQPKRIKKDQDTLIQLRNSEADVFVVVAYGQILSSEILQMPKLGCVNVHGSILPQYRGAAPIQWCLYNGDRKTGITTMLMDEGMDTGDMLLKAYTDINLFDNAHEIAEKLANQGADLLIETLEKLDNNQMKPIPQNDDEATYASLINKDDFIIDWNKSAIAIHNQIRGF--YPNCFTSFRDNKLKITATIPINDNYLQALDDNFDGLKKHIESLDKMTGNPGEVISLIKKFGPVIQTGEGLLLLSNVQPSGKRPQSGWDLVNG-SHLKVGEIL 330
>gi|86609442|ref|YP_478204.1| methionyl-tRNA formyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] >gi|123751673|sp|Q2JK54|FMT_SYNJB Methionyl-tRNA formyltransferase >gi|86557984|gb|ABD02941.1| methionyl-tRNA formyltransferase [Synechococcus sp. JA-2-3B'a(2-13)] (322 aa)
Score = 474, Expect = 1.2e-45, Identities = 105/307 (34%), Positives = 180/307 (58%)
  Q:    12 KIVFMGTPEIATYALNALLE--KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKS------NNAPGTINNISK-EGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           ++VF GTPE A  +L  LL+    F+VV +VCQPD+P GR ++++    K LA    I  +QP +++   ++   L+ L    FV  A+GQ +P ++L +P+ GC+N+H SLLP YRG API WA+ NGE ETGV  M   + MD G +    K+ I    T+  L  ++  L  ++++  L K+   E  PI QD S+ ++A  + K D  +++++ A  + N IR  S  P  +  I  +++K+ ++ S    S        +PG +  +++ EGI ++T +  +L++  Q+ GK  Q   +++NG  ++K+G+  +
  S:     2 RVVFFGTPEFALPSLQILLQPQSPFEVVGLVCQPDRPQGRGQKVLPPPTKVLAQAHGIPVWQPVRLRRDPQVLAALEALAADVFVVVAYGQILPLTVLQMPKLGCVNVHGSLLPAYRGAAPIQWAIANGETETGVTTMLMDEGMDTGAILLQAKLPIGPEQTSLELAPQLAQLGAELLVETLLKLEKGELTPIPQDGSRATYAPLLKKQDFHLDWQRPAQALHNQIRAFS--PNCFTGIEGQRIKIVRSASPQLHSPPPEIPQGSPGEVVGLARGEGIYVATGEGSLLIRRAQLPGKKEQSAWDLVNG-GQLKVGMRFE 317
>gi|152972196|ref|YP_001337342.1| methionyl-tRNA formyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] >gi|166214903|sp|A6TEU1|FMT_KLEP7 Methionyl-tRNA formyltransferase >gi|150957045|gb|ABR79075.1| methionyl-tRNA formyltransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] (315 aa)
Score = 474, Expect = 1.2e-45, Identities = 101/299 (33%), Positives = 170/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL     VV V  QPD+P GR K+++ S VK LA   N+  FQP+ ++  +N+  + +L     V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    +L  L ++ N    P  QDES V  A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      ++  PGTI   +K+GI ++T D  + ++ +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLSSEHQVVGVFTQPDRPAGRGKKLMPSPVKVLAEAHNLPVFQPSSLRPQDNQRLVADLGADIMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDSETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGSLYDKLAELGPQGLLATLAQLANGTARPEVQDESLVCHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIDGQPVKVWRASVIAEAAHAEPGTIVAATKQGIQVATGDGILSLESLQPAGKKAMSAQDLLNSRRE 306
>gi|86606347|ref|YP_475110.1| methionyl-tRNA formyltransferase [Synechococcus sp. JA-3-3Ab] >gi|123765590|sp|Q2JTY2|FMT_SYNJA Methionyl-tRNA formyltransferase >gi|86554889|gb|ABC99847.1| methionyl-tRNA formyltransferase [Synechococcus sp. JA-3-3Ab] (322 aa)
Score = 474, Expect = 1.4e-45, Identities = 103/307 (33%), Positives = 181/307 (58%)
  Q:    12 KIVFMGTPEIATYALNALLE--KSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA------PGTINNISK-EGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           ++VF GTPE A  +L  LL+    F+VV +VCQPD+P GR ++++    K LA    I  +QP +++   E+   L+ L    FV  A+GQ +P ++L +P+ GCIN+HASLLP YRG API WA+ NGE ETGV  M   + MD G +    K+ IE   T   L  ++     ++++  L K+   E  PI QD+S+ ++A  + K D ++++++ A  + N IR  S  P  +  +  +++K+ ++ +       A      PG +  +++ EG+ ++T +  +L++  Q+ G+  Q   +++NG  ++++G+  +
  S:     2 RVVFFGTPEFALPSLQILLQPQSPFEVVGLVCQPDRPQGRGQKVLPPPTKILAQAHGIPVWQPGRLRRDPEVLAALEALAADVFVVVAYGQILPPAVLQMPKLGCINVHASLLPAYRGAAPIQWAIANGETETGVTTMLMDEGMDTGAILLQAKLPIEPEQTGLELASQLAQRGAELLVETLVKLEKGELTPIPQDDSRATYAPLLKKQDFQLDWQRPAQALHNQIRAFS--PDCFTGLQGQRIKIVRSAAPQLHPPPAELPPGSPGEVVGLARGEGVYVATGEGSLLIRRAQLPGRKEQSACDLVNG-GQLRVGMRFE 317
>gi|182626304|ref|ZP_02954060.1| methionyl-tRNA formyltransferase [Clostridium perfringens D str. JGS1721] >gi|177908402|gb|EDT70944.1| methionyl-tRNA formyltransferase [Clostridium perfringens D str. JGS1721] (317 aa)
Score = 473, Expect = 1.5e-45, Identities = 118/306 (38%), Positives = 179/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLS--------ETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+ +  +L  ++EK ++V A+V QPDKP GR K++  S +K++ +   I  FQP KI+    I N+LKEL P   +  A+GQ +   IL IP  GCI +HASLLP YRG API+W +INGE +TG   +     +D GD+    +V I ES T   L+  +     +++   +  +   +   IKQ     S+   ++K   KIN+  +++ I NLIRGLS          P AY +  D  +K+FK+ S  +   + PG I + + EGI ++TK+  ++++ +Q  G    EVK  L GN +I+ G+ L
  S:     2 KIVFMGTPDFSVPSLKKMIEK-YNVSAIVTQPDKPSGRGKKVSISPIKEVGLSNEIPIFQPEKIRTDSVIINKLKELKPDFIIVVAYGQILTKEILDIPRLGCICLHASLLPMYRGSAPINWCLINGEIKTGNTTILMDTGIDTGDMLMRSEVEISESMTAGELYNLLKVNGAELLEETINGIITGKICGIKQPNDVSSYVKMLNKQMAKINWNDSSINIHNLIRGLSSWPYKNINSWPTAYTYYKDIPVKIFKSKSLEANIIDPPGCIIDANNEGIKVATKNGILIIEILQFPGGKPLEVKEFLKGN-KIEKGIVL 316
>gi|77359004|ref|YP_338579.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Pseudoalteromonas haloplanktis TAC125] >gi|123587109|sp|Q3IDI3|FMT_PSEHT Methionyl-tRNA formyltransferase >gi|76873915|emb|CAI85136.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Pseudoalteromonas haloplanktis TAC125] (321 aa)
Score = 473, Expect = 1.6e-45, Identities = 93/299 (31%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L AL++    +V V  QPD+P GR K++  S VK+LA+E N+  FQP  +K  +  NEL  LN    +  A+G  +P +IL  P  GC+N+H S+LP++RG API  A+  G+++TGV +M+  + +D GD+    +  I  ++T+++L+ K+ +L    +++ +  + N +  P  Q+++  ++A  +SKD+  I++  +A +I   IR  +  P  +  +  + +K+++A  V  +S   +  G + +  K G+++   +  + + ++Q +GK    + + LNG S+
  S:     6 RIIFAGTPDFAARHLQALIQSEHQIVGVYSQPDRPAGRGKKLKASEVKELALEHNLPVFQPQSLKTEDALNELTRLNADIMIVVAYGLILPKAILDAPRLGCLNVHGSILPRWRGAAPIQRAIWAGDEQTGVTIMQMNEGLDTGDMLHISRCPISATETSASLYTKLADLGPGALIDTINNLANGKITPEPQNDAAANYAKKLSKDEANIDWSMSAAQIERNIRAFNPWPVCFTQMGGQPVKIYQAHVVEQSSSQPDNNGRVLSSDKNGVIVGCGEHALCITQLQPQGKKPMAINDFLNGRSD 308
>gi|71894535|ref|YP_278643.1| methionyl-tRNA formyltransferase [Mycoplasma synoviae 53] (275 aa)
Score = 472, Expect = 2.0e-45, Identities = 121/286 (42%), Positives = 175/286 (61%)
  Q:    17 GTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGA-YCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVK 302
           GTPE +      ++ K+F+VVA+V QPDKP  R + +  S VKKLA++ N+K FQP KI  I  ELKEL+    +T AFGQ+IP++IL++P+   +NIH SLLPKYRG API  A++N E ETGV L+   K+MDAGD+    K+ IEESD + TLF+K++NL  + +++ +  +    Y  I QDESKV+ A  + K+D  ++  K   E +  I+  +  PGA Y   N+K +K++ A  T +K  NAP           + +  D DI + + QIE K R  +K
  S:     3 GTPEFSVPIFKEII-KNFEVVAIVTQPDKPAKRGQNLQESPVKKLALKYNLKLFQPEKISMIYEELKELDFDYMLTAAFGQYIPENILNLPKKFPLNIHGSLLPKYRGAAPIQHALLNNETETGVQLIIMTKKMDAGDILKEAKIKIEESDISLTLFEKLSNLAAENIVSWIHDLDQNNYQRIIQDESKVTLASKLLKEDSFLDKTKTKKENIAKIKAFALNPGARYINENNKLVKVYFA--TENKIKNAP-----------VFTCVDGDIFLNDYQIESKKRVTLK 275
>gi|110800003|ref|YP_695451.1| methionyl-tRNA formyltransferase [Clostridium perfringens ATCC 13124] >gi|110674650|gb|ABG83637.1| methionyl-tRNA formyltransferase [Clostridium perfringens ATCC 13124] (317 aa)
Score = 472, Expect = 2.1e-45, Identities = 118/306 (38%), Positives = 177/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLS--------ETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+ A  +L  ++EK F+V A++ QPDKP GR K++  S +K++ +   I  FQP KI+    I N+LKEL P   +  A+GQ +   IL IP  GCI +HASLLP YRG API+W +INGE +TG   +     +D GD+    +V I ES T   L+  +     +++   +  +   +   IKQ     S+   ++K    IN+  ++  I NLIRGLS          P AY +  D  +K+FK+ S  +   + PG I + + EGI ++TK+  ++++ +Q  G    EVK  L GN +I+ G+ L
  S:     2 KIVFMGTPDFAVPSLKKMIEK-FNVSAIITQPDKPSGRGKKLTISPIKEVGLSNEIPIFQPEKIRTDSVIINKLKELKPDFIIVVAYGQILTKEILDIPRLGCICLHASLLPMYRGSAPINWCLINGEIKTGNTTILMDTSIDTGDMLMRSEVEISESMTAGELYNLLKINGAELLEETINGIIAGKICGIKQPNDGSSYVKMLNKQMANINWNDSSTNIHNLIRGLSSWPYKNINSWPTAYTYYKDIPVKIFKSKSLEANIIDPPGYIIDANDEGIKVATKNGILIIEILQFPGGKPLEVKEFLKGN-KIEKGIIL 316
>gi|119475267|ref|ZP_01615620.1| methionyl-tRNA formyltransferase [marine gamma proteobacterium HTCC2143] >gi|119451470|gb|EAW32703.1| methionyl-tRNA formyltransferase [marine gamma proteobacterium HTCC2143] (324 aa)
Score = 472, Expect = 2.3e-45, Identities = 101/300 (33%), Positives = 175/300 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VSTNSKSNNAP-GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           +++F GTP+ A   L ++LE+   +VVAV  QPD+P GR K++  S VK++A+E NI  FQP   K +E++  LK +N    +  A+G  +P  IL  P +GCIN+HASLLP++RG API  A+  G+ E+GV +M+  + +D GD+  +   NIE S+T  +L  K+  L    +   L+++   +     Q     ++A  ISKD+  IN+++ A  I   IR  +  P AY  ++ +++K++ A  V+ +   +  P GTI    ++ I+++  D  + ++ +Q+ G     +  ++N  +E+
  S:     6 RLIFAGTPDFAAAHLKSILEQGKHEVVAVYSQPDRPSGRGKKLTPSPVKQVALEHNIPVFQPLNFKAVEDQQTLKAINADLMIVAAYGLLLPPVILQTPNYGCINVHASLLPRWRGAAPIQRAIEAGDSESGVVIMQMDEGLDTGDMLLTASCNIENSETGGSLLDKLTALGIRALNQALDRIAEHQISATAQPRQNTTYAAKISKDELTINWQQAATVIERKIRAFNPFPVAYTNLDGRRIKIWLANVVAKDQFDSTQPAGTIVYADRQTIIVNCGDGQLSLQTIQLPGGKALPISAVMNSKAEM 311
>gi|145637961|ref|ZP_01793601.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittHH] >gi|145268852|gb|EDK08815.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittHH] (318 aa)
Score = 471, Expect = 2.4e-45, Identities = 103/302 (34%), Positives = 182/302 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI+ +QP  ++  E ++ELK LN    V  A+G  +P ++L +P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + N ++   KQD S+ ++A  +SK++ ++++   A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNIRVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDVPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLENSKFIAEKQDGSQSNYAEKLSKEEAQLDWSLPAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGILNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|163788100|ref|ZP_02182546.1| methionyl-tRNA formyltransferase [Flavobacteriales bacterium ALC-1] >gi|159876420|gb|EDP70478.1| methionyl-tRNA formyltransferase [Flavobacteriales bacterium ALC-1] (319 aa)
Score = 471, Expect = 2.6e-45, Identities = 106/299 (35%), Positives = 183/299 (61%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKV----FNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFK----AVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++ +IVFMGTP+ A   L  LL+ +++VV V+  PD+  GR +++  S+VK+ A+E N+   QP  +K      ELK LN    +  AF + +P  +  +PE+G  N+HASLLP+YRG APIHWA+INGE +TGV      +++D G +  S + +I E  T   L  ++ ++   +V+  +E++     + E  P  +D   +  AY +++D+ KI++ ++   I N IRGL+  P A+CF+++K+ +L      A+   ++ +N        +KE + ++ K+  I +KE+Q+ GK + +VK++LNG
  S:     5 RDLRIVFMGTPDFAVATLKTLLDHNYNVVGVITAPDRKAGRGQKLRASAVKQFALEHNLNVLQPKNLKAESFIEELKALNANLQIIVAF-RMLPKVVWQMPEYGTFNLHASLLPQYRGAAPIHWAIINGETKTGVTTFFIDEKIDTGAIILSDETSIAEETTVGDLHDELMSIGSQLVIKTVEQIETDSVSTEIQPQSED---LKTAYKLNRDNCKIDWTQSIDTIYNKIRGLNPFPTAWCFLDNKEKELLTIKIYAIEKLTEKHNYDAGFIIATKEELKVACKEGYINIKEIQLPGKRKMDVKSLLNG 309
>gi|16272566|ref|NP_438783.1| methionyl-tRNA formyltransferase [Haemophilus influenzae Rd KW20] >gi|1169712|sp|P44787|FMT_HAEIN Methionyl-tRNA formyltransferase >gi|1573619|gb|AAC22283.1| methionyl-tRNA formyltransferase (fmt) [Haemophilus influenzae Rd KW20] (318 aa)
Score = 471, Expect = 2.7e-45, Identities = 104/302 (34%), Positives = 181/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + N ++   KQD S+ ++A  +SK++ ++N+  +A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNIPVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLENGKFIAEKQDGSQSNYAEKLSKEEAQLNWSLSAMQLERNIRAFNPWPIAYFSTEDKDGNAHTLKVYQAKVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQSAGKKPMSAQDLLNGRAE 309
>gi|91774542|ref|YP_544298.1| methionyl-tRNA formyltransferase [Methylobacillus flagellatus KT] >gi|122985660|sp|Q1H4Y0|FMT_METFK Methionyl-tRNA formyltransferase >gi|91708529|gb|ABE48457.1| methionyl-tRNA formyltransferase [Methylobacillus flagellatus KT] (308 aa)
Score = 470, Expect = 3.1e-45, Identities = 106/297 (35%), Positives = 172/297 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVL---NDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           KI++ GTP+ A  AL AL++ S +V  V+ QPD+P GR  ++  S VK LA+E  I   QP  +K+  ++  +   +  A V  A+G  IP ++LS+P +GC NIHASLLP++RG API  A++ G+KETGV +M  +  +DAG +     + I E DT  TL   +  +  +++L   + LE+   LE  P  QDES V++A  + K +  I++ KNA E+   +R  +  P A+  +  +  +++ A + +  +   PG I ++   GIL+      + + E+Q+ G  R + K+ L GN
  S:     2 KIIYAGTPDFAVPALRALIQSSHEVSLVLTQPDRPAGRGLKLKPSPVKSLALEHGIPLLQPETLKDEAVQARIAAEHADALVVAAYGLIIPATVLSMPRYGCYNIHASLLPRWRGAAPIQRALLAGDKETGVTIMEVVPALDAGAMILRGTLPITEHDTAQTLHDGLAEIGAELMLQAMDKLEREGRLEAEP--QDESLVTYAQKLQKAEAVIDWRKNADELSRQVRAFNPFPVAHSTLKGETCRIWMAQAVSGTAE--PGMIASVDN-GILVGCGRGLLRIDELQLPGGKRLQAKDFLAGN 298
>gi|127514665|ref|YP_001095862.1| methionyl-tRNA formyltransferase [Shewanella loihica PV-4] >gi|166215511|sp|A3QJF5|FMT_SHELP Methionyl-tRNA formyltransferase >gi|126639960|gb|ABO25603.1| methionyl-tRNA formyltransferase [Shewanella loihica PV-4] (324 aa)
Score = 470, Expect = 3.4e-45, Identities = 96/302 (31%), Positives = 171/302 (56%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  KI+F GTP+ A   L AL++    V+ V  QPD+P GR K++  S VK LA+E +I  +QP  ++  + + EL  L     V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+  TGV +M+    +D GD+     + IE+ DT+++L++K+       ++  L+ +      P  QDE+  ++A  +SK++ ++++ K A ++   +R  +  P ++    D  +K+++A  +   +  APGTI    K+GI ++T +  ++++ +Q+ GK    V ++LN   +
  S:     2 KPLKILFAGTPDFAARHLQALIDSEHQVIGVYSQPDRPAGRGKKLQASPVKALALEHDIPVYQPVSLRNEDAQAELAALGADIMVVVAYGLILPQVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDAATGVTIMQMDIGLDTGDMLLKTHLPIEDRDTSASLYEKLAEQGPSALIQALKGLAEGSLTPEPQDEALANYAEKLSKEEAQLDWRKPAEQLWREVRAFNPWPASHFPHQDAAIKVWQASVSIEAAKQAPGTIIRADKQGIAVATGEGALVLETIQLPGKKAMAVADVLNARGD 305
>gi|145629885|ref|ZP_01785677.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 22.1-21] >gi|145639369|ref|ZP_01794974.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittII] >gi|144977739|gb|EDJ87686.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 22.1-21] >gi|145271416|gb|EDK11328.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittII] (318 aa)
Score = 470, Expect = 3.5e-45, Identities = 104/302 (34%), Positives = 181/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + N ++   KQD S+ ++A  +SK++ ++N+  +A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFSGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNIPVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLENGKFIAEKQDGSQSNYAEKLSKEEAQLNWSLSAMQLERNIRAFNPWPIAYFSTEDKDGNAHTLKVYQAKVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQSAGKKPMSAQDLLNGRAE 309
>gi|119471680|ref|ZP_01614065.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Alteromonadales bacterium TW-7] >gi|119445459|gb|EAW26746.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Alteromonadales bacterium TW-7] (317 aa)
Score = 470, Expect = 3.6e-45, Identities = 94/299 (31%), Positives = 175/299 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L AL+    ++V V  QPD+P GR K++  S VK LA+E ++  FQP  +K  E   EL  LN    +  A+G  +P +IL+ P  GC+N+H S+LP++RG API  A+  G++ETGV +M+  + +D GD+    +  I +++T+++L+ K+  L    +++ + K+ N +  P  Q++   ++A  +SK++  I++  +AV+I   IR  +  P  +  + ++ +K+++A   +   +  PG I    K G++++  +  + + ++Q +GK    + + LNG S+
  S:     6 RIIFAGTPDFAARHLQALINSEHEIVGVYSQPDRPAGRGKKLKASEVKALALENDLPVFQPQSLKNDEALAELTALNADIMIVVAYGLILPKAILNAPRLGCLNVHGSILPRWRGAAPIQRAIWAGDEETGVTIMQMDEGLDTGDMLHISRCPISDTETSASLYNKLAELGPSALIDTVNKLANDDITPEPQNDELANYAKKLSKEEANIDWSMSAVQIERNIRSFNPWPVCFTQMGEQTVKIYQAKVVD--QSGKPGEILTSDKNGVVVACGEHALSITQLQPQGKKPMAISDFLNGRSD 304
>gi|160872198|ref|ZP_02062330.1| methionyl-tRNA formyltransferase [Rickettsiella grylli] >gi|159120997|gb|EDP46335.1| methionyl-tRNA formyltransferase [Rickettsiella grylli] (314 aa)
Score = 470, Expect = 4.0e-45, Identities = 97/300 (32%), Positives = 175/300 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEI--ENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           K++F GTPE A  +L+AL   ++ + AV  QPD+P GR ++++ S VKK+A+E  +   QP  ++E   + +L  L+    V  A+G  +P ++L++P FGCIN+HASLLP++RG API  A++ G++ETG+ +M+  + +D G++      +IE +DT  TL  ++  L    +L  L+ + +  Y    Q+E + ++A  I+K + +I++E+ A+ +  L+R     P A   +    +++ KA      ++  PG I  + +EGI ++T    + + EVQ  G     + + ++G SE+
  S:     2 KLIFAGTPEFALPSLHAL-ASAYKLCAVYTQPDRPAGRGRKLLMSPVKKMALENKLPVIQPFSLRESKEQKKLASLHADLMVVVAYGLILPPAVLAMPRFGCINVHASLLPRWRGAAPIQRAILAGDRETGITIMQMDEGLDTGEIIKKFPCSIEPTDTNKTLQDRLAELGAHALLESLKWIESGSYRSEPQNEKESTYAKKINKSEAEIDWEQPAIYLDRLVRAFYPKPVARVVLGKSILRICKAEVLEETTSEKPGLILKVDREGIDVATGKGVLRLLEVQWPGGRCLPISSFIHGQSEL 302
>gi|149910329|ref|ZP_01898972.1| methionyl-tRNA formyltransferase [Moritella sp. PE36] >gi|149806577|gb|EDM66545.1| methionyl-tRNA formyltransferase [Moritella sp. PE36] (317 aa)
Score = 469, Expect = 4.1e-45, Identities = 100/302 (33%), Positives = 170/302 (56%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  +I+F GTP+ A   L+AL+    +V+AV  QPD+P GR K++  S VK+LA+  +I  FQP  ++  E +  L  LN    V  A+G  +P  +L  P  GCIN+H SLLP++RG API  A+  G+ ETGV +M+    +D G +       I + +T+++L+ K+  L    +L  L  + N       QD+   ++A  +SK++  I++ ++AVEI   +R  +  P +Y  I ++ +K+++   + + +   PGT+   +K GI ++T +  + +  +Q+ GK    V++ILN   E
  S:     3 KPLRIIFAGTPDFAAKHLSALINSEHEVIAVYSQPDRPAGRGKKLKPSDVKQLAVSHDIPVFQPISLRNEEAQQALSALNADLMVVVAYGLILPQIVLDTPRLGCINVHGSLLPRWRGAAPIQRAIWAGDAETGVTIMQMDLGLDTGAMLHKVTCPIADDETSASLYDKLAALGPQGLLETLAHISNNTAVAEVQDDELSNYASKLSKEEANIDWTQSAVEIERQVRAFNPWPVSYTQIAEQNVKIWQTSVSEATTEAQPGTVIAATKHGIQVATGNGVLTLLNMQLAGKKAMPVQDILNARKE 306
>gi|187735473|ref|YP_001877585.1| methionyl-tRNA formyltransferase [Akkermansia muciniphila ATCC BAA-835] >gi|187425525|gb|ACD04804.1| methionyl-tRNA formyltransferase [Akkermansia muciniphila ATCC BAA-835] (314 aa)
Score = 469, Expect = 4.1e-45, Identities = 100/301 (33%), Positives = 172/301 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYC-FINDKK----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIK 312
           +IVFMGT +IA  A  +L+  S D+  +V QPD+P+GR + +   ++K +A E  I   QP+ ++  +  + L+ LNP   V  A+GQ +   ++ +   GCIN HASLLP++RG A I  A+ +G+ ETG+ +M  ++++DAGD+       +E S+T  TL  K+  +  D++L  +  +       I+Q E   ++A  + + D KI++ + A EI  +IR     PG +  + N KK    MK+F   S   ++   PG + +  ++G+LI+     +LV +VQ+EG  R  +  ++ G+  +K
  S:     2 RIVFMGTGDIAIPAFRSLIRHS-DLAGLVTQPDRPVGRHQVLTAPAIKNIAREAGIPVLQPHSLRSPDALSNLRRLNPDLIVVMAYGQILSQEVIDMAPMGCINAHASLLPRHRGAACIQSAIKSGDAETGITIMHIVRKLDAGDIIAQISTPLEGSETGGTLHDKLARMTPDVLLPVIHSIEKGTATRIRQQEILATYAPKLLRADGKIDWTRPAEEIGRMIRAYDPWPGTFTNYWNRKKRIRNMKIFPGFSILPEAEGKPGQVLSAGEQGLLIACGSGGLLVTDVQLEGSTRMNISQLIAGHPNLK 308
>gi|126663450|ref|ZP_01734447.1| methionyl-tRNA formyltransferase [Flavobacteria bacterium BAL38] >gi|126624398|gb|EAZ95089.1| methionyl-tRNA formyltransferase [Flavobacteria bacterium BAL38] (315 aa)
Score = 469, Expect = 4.1e-45, Identities = 109/298 (36%), Positives = 181/298 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDES-KVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +IVFMGTP+ A   LN + + ++D+V V+  PDKP GR +++  S+VK+ A+EKN++  QP  +K  +   ELK L+    V  AF + +P+ +  +P+ G  N+HASLLP+YRG API+WA+INGE +TGV       ++D G +  S++  I  ++T   L  ++ ++  + VL  L+ + + +     Q+ + +V  AY ++K++ KI++ ++   I NLIRGLS  P A+ +I D +    +K++ A    S+ ++  G I    KE I I+TKD  + ++ +Q  GK R     +LNG S
  S:     5 RIVFMGTPDFAVGILNTIYQNNYDIVGVITAPDKPAGRGQKVSTSAVKEYALEKNLRLLQPTNLKSEDFLAELKSLDANLQVVVAF-RMLPEVVWRMPKLGTFNLHASLLPEYRGAAPINWAIINGETKTGVTSFFIDDKIDTGAIILSKETAIGTNETAGELHDRLMHVGSETVLETLQLIESEKASTTLQENNLEVKTAYKLNKENCKIDWSQSGRTIFNLIRGLSPYPAAWTYIKDGENEWNVKIYIASFEKSEHSDTIGKITTTKKE-IFINTKDGVLKIESLQFPGKKRMLAHELLNGIS 307
>gi|90406715|ref|ZP_01214908.1| Methionyl-tRNA formyltransferase [Psychromonas sp. CNPT3] >gi|90312168|gb|EAS40260.1| Methionyl-tRNA formyltransferase [Psychromonas sp. CNPT3] (320 aa)
Score = 469, Expect = 4.2e-45, Identities = 101/303 (33%), Positives = 171/303 (56%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           KN  I+F GTP+ A   L ALL+    VVAV  QPD+  GR K+++ S+VK+LA++ NI  +QP   K+  + NE  +L     V  A+G  +P +IL +P  GC+N+H SLLP++RG API  A+  G+ +TGV +M+    +D G +       I   +++++L++K+  L    ++  +EK+   E     QD+S  ++A  +SKD+  IN+  +A  I   +R  +  P +Y  +    +K+ +    + +++  PGTI    K GI ++T    + ++ +Q+ GK    V++ILN   E+
  S:     2 KNLNIIFAGTPDFAAKHLQALLDAQCHVVAVYTQPDRRAGRGKKLMMSAVKQLALDNNIAVYQPENFKQEDVRNEFADLKADLMVVVAYGLILPSAILEMPRLGCLNVHGSLLPRWRGAAPIQRAIWAGDAQTGVTIMQMDVGLDTGAMLSKVICPINAQESSASLYEKLAKLAPPALIETIEKLAKGEITAEIQDDSLATYAKKLSKDEALINWSDDAKFIERCVRAFNPWPMSYFQLAGNAVKVHQVSVLDIETDALPGTILMAYKTGIQVATGKGVLNLEVIQLAGKKAMPVQDILNSRREL 306
>gi|168212409|ref|ZP_02638034.1| methionyl-tRNA formyltransferase [Clostridium perfringens CPE str. F4969] >gi|170716001|gb|EDT28183.1| methionyl-tRNA formyltransferase [Clostridium perfringens CPE str. F4969] (317 aa)
Score = 469, Expect = 4.3e-45, Identities = 116/306 (37%), Positives = 177/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLS--------ETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+ +  +L  ++EK ++V A+V QPDKP GR K++  S +K++ +   I  FQP KI+    I N+LKE+ P   +  A+GQ +   IL IP  GCI +HASLLP YRG API+W +INGE +TG   +     +D GD+    +V I ES T   L+  +     +++   +  +   +   +KQ     S+   ++K   KIN+  ++  I NLIRGLS          P AY +  D   K+FK+ S  +   + PG I + + EGI ++TK+  ++++ +Q  G    EVK  L GN +I+ G+ L
  S:     2 KIVFMGTPDFSVPSLKKMIEK-YNVSAIVTQPDKPSGRGKKVSISPIKEVGLSNEIPIFQPEKIRTDSVIINKLKEIEPDFIIVVAYGQILTKEILDIPRLGCICLHASLLPMYRGSAPINWCLINGETKTGNTTILMDTGIDTGDMLMRSEVEISESMTAGELYNLLKINGAELLEETINGIITGKICGVKQPNDGSSYVKMLNKQMAKINWNDSSTNIHNLIRGLSSWPYKNINSWPTAYTYYKDIPFKIFKSKSLEANIIDPPGYIIDANDEGIKVATKNGILIIEILQFPGGKPLEVKEFLKGN-KIEKGIIL 316
>gi|42630886|ref|ZP_00156424.1| COG0223: Methionyl-tRNA formyltransferase [Haemophilus influenzae R2866] (318 aa)
Score = 469, Expect = 5.1e-45, Identities = 103/302 (34%), Positives = 182/302 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + N ++   KQD+S+ ++A  +SK++ ++++  +A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFSGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNIPVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLENGKFIAEKQDDSQSNYAEKLSKEEAQLDWSLSAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|167031104|ref|YP_001666335.1| methionyl-tRNA formyltransferase [Pseudomonas putida GB-1] >gi|189044567|sp|B0KF29|FMT_PSEPG Methionyl-tRNA formyltransferase >gi|166857592|gb|ABY95999.1| methionyl-tRNA formyltransferase [Pseudomonas putida GB-1] (310 aa)
Score = 468, Expect = 6.1e-45, Identities = 100/299 (33%), Positives = 168/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTPE A   L ALL+  +++VAV  QPD+P GR ++++ S+VK LA+  +I  FQP  ++  + + EL  L P   V  A+G  +P ++L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  TL  ++  +    V+  +  + +       QD++  ++A+ ++KD+ +I++ + AVE+  LIR  +  P  +  ++ + +K+  A  +  K   APG I + SK+G++++  D  + +  +Q+ G       ++ N   E
  S:     2 RIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMPSAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQAVLDIPRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISADDTGGTLHDRLAEMGPPAVVQAIAGLADGSLQGEVQDDALATYAHKLNKDEARIDWSRPAVELERLIRAFNPWPVCHSTLDGESVKVLAANLSTGKG--APGEILSASKDGLVVACGDQALSLTRLQLPGGKALSFSDLFNSRRE 300
>gi|53732510|ref|ZP_00349506.1| COG0223: Methionyl-tRNA formyltransferase [Haemophilus influenzae R2846] (318 aa)
Score = 468, Expect = 6.2e-45, Identities = 103/302 (34%), Positives = 181/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L   ++++ L+ + N ++   KQD S+ ++A  +SK++ ++++   A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNIPVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSVLIDVLDNLENSKFIAEKQDGSQSNYAEKLSKEEAQLDWSLPAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|77456244|ref|YP_345749.1| methionyl-tRNA formyltransferase [Pseudomonas fluorescens PfO-1] >gi|123606497|sp|Q3KKE6|FMT_PSEPF Methionyl-tRNA formyltransferase >gi|77380247|gb|ABA71760.1| methionyl-tRNA formyltransferase [Pseudomonas fluorescens PfO-1] (319 aa)
Score = 468, Expect = 6.6e-45, Identities = 99/299 (33%), Positives = 168/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTPE A   L ALL+  +++VAV  QPD+P GR ++++ S VK+LA+E NI+  QP  ++  + + EL  L P   V  A+G  +P ++L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  +L  ++  +    V+  +  +         Q++   ++A+ ++KD+ +I++ + AVE+  L+R  +  P  +  +N + +K+  A  T ++   APGTI   SK+G++++  +  + +  +Q+ G       ++ N   E
  S:     6 RIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMPSPVKQLALENNIQVLQPPTLRNADAQAELAALKPDLMVVVAYGLILPQAVLDIPRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISAEDTGGSLHDRLAEMGPPAVVQAIAGLAAGTLEGEVQNDELATYAHKLNKDEARIDWSRPAVELERLVRAFNPWPITHSTLNGEALKVLAA--TLAEGKGAPGTILGASKDGLIVACGEQALCLTRLQLPGGKALNFSDLFNSRRE 304
>gi|114330412|ref|YP_746634.1| methionyl-tRNA formyltransferase [Nitrosomonas eutropha C91] >gi|122314566|sp|Q0AJ02|FMT_NITEC Methionyl-tRNA formyltransferase >gi|114307426|gb|ABI58669.1| methionyl-tRNA formyltransferase [Nitrosomonas eutropha C91] (316 aa)
Score = 468, Expect = 6.8e-45, Identities = 99/297 (33%), Positives = 162/297 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           KI+F GTP  A  AL A+ +  FD++ V+ QPD+P GR  ++  S VK LA + NI   QP  +K  +I+ +L+ L P   +  A+G  +P+++L IP  GCINIHASLLP++RG API  A++ G+ ETG+ +M+  + +D G V   R   IE  DT +TL  K+ +L    ++  L  +   +  P  QD +   +A  I K + +I++ +++  I  +IR  +  PGA+  ++   +KL++A   N       G I      GI+++     + +  +Q  G  +      L G+
  S:     2 KIIFAGTPVFAAKALEAVQKSGFDILLVLTQPDRPAGRGMKLQASPVKILAQQYNIPLLQPETLKSPDIQTQLETLKPDVMIVAAYGLILPEAVLRIPRHGCINIHASLLPRWRGAAPIQRALLEGDAETGISIMQMDQGLDTGAVLLKRAFLIEPHDTAATLHDKLADLGGKCIVETLTLLDQDKLTPTLQDNASACYAAKIRKSEAEIDWTRDSTHIDRMIRTFNPYPGAFTSLHGSMIKLWQANIINRSDTRQAGEIIAADHNGIIVACGRDALSINILQKAGGKKLTAAQFLAGH 300
>gi|162453281|ref|YP_001615648.1| hypothetical protein sce5005 [Sorangium cellulosum 'So ce 56'] >gi|189044556|sp|A9FL08|FMT_SORC5 Methionyl-tRNA formyltransferase >gi|161163863|emb|CAN95168.1| fmt1 [Sorangium cellulosum 'So ce 56'] (311 aa)
Score = 467, Expect = 6.9e-45, Identities = 104/306 (33%), Positives = 168/306 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNA-PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           + +F GTP IA  +L AL   + DVV VVCQPD+P GR  E+    VK  A+E  +   QP K++  E    +        +  A+G+ +P ++L  P  GC+N+HAS+LP+YRG API WA++ GE ETG+ LM+  + MD G VY  R+  I    T   L   +  L   +V  DL +  + E  P  QD    + A  + K+D +I +E++A +I + IRG++  PGA+  I+ K +K+  A V + +    A PGT+    +  ++++     I +   Q+EG+      +++ G + ++ G+ L
  S:     2 RALFFGTPAIAVPSLEALASIA-DVVGVVCQPDRPAGRGLELKAPPVKVKALELGVPVLQPEKVRTPEFAAWVAGAGADVALVIAYGRILPKAVLEAPRRGCMNLHASILPRYRGAAPITWAIVGGETETGISLMQMDEGMDTGPVYAVRRTPIGPDTTADELAIDLGALAARVVREDLRRAVDGELAPTPQDHEAATHAALLKKEDGRIRWERSARQIHDHIRGMTSWPGAFTTIDGKALKVLAAHVESEADQGGAPPGTVVMAGRSVVVVACGAGAIQIVRAQVEGRKPLAAADLVAGRT-LQAGMVL 309
>gi|148827777|ref|YP_001292530.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittGG] >gi|166214900|sp|A5UH91|FMT_HAEIG Methionyl-tRNA formyltransferase >gi|148719019|gb|ABR00147.1| hypothetical protein CGSHiGG_06230 [Haemophilus influenzae PittGG] (318 aa)
Score = 467, Expect = 7.9e-45, Identities = 103/302 (34%), Positives = 180/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + N ++   KQD S+ ++A  +SK++ ++++   A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNIPVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDESLDTGDMLHKVYCDILPTETSTSLYNKLAELATSALIDVLDNLENSKFIAEKQDGSQSNYAEKLSKEEAQLDWSLPAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|160881303|ref|YP_001560271.1| methionyl-tRNA formyltransferase [Clostridium phytofermentans ISDg] >gi|160429969|gb|ABX43532.1| methionyl-tRNA formyltransferase [Clostridium phytofermentans ISDg] (315 aa)
Score = 467, Expect = 8.5e-45, Identities = 107/306 (34%), Positives = 181/306 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA-----PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTPE A  +L  L++   +V+ +V QPDKP+GRK  +    VK+ A+ +NI  +QP  +K  E  + +KE+ P   +  A+G+ IP  IL  P++GC+++H SLLPKYRG +PI+ A++NGEK TG+ +M   + +D GD+       I + +T   L  ++  +   +++  + ++ N      KQ ES   +A  I  D  +I++   A  I + IRGLS +P A+ ++N KK+K+ KA+ ++ K  +A      G + +I +  I +    + I++ E+Q+EG      K+ +NG  +I+ G+ L
  S:     2 KILFMGTPEFARVSLEYLIKNKCEVIGIVTQPDKPVGRKMTLTPPPVKEYALSENIPVYQPQTLKSAEFFDLIKEIAPDIIIVAAYGKLIPKYILDFPQYGCVDVHGSLLPKYRGASPINAAIMNGEKVTGITIMYMDEGIDTGDMILKESTGIGKHETFGELHDRLAEIGGKLLIEAINQIQNGTVKREKQPESDTFYAKKIDDDMCEIDWNIPAKVIYDKIRGLSPSPAAFTWLNGKKLKILKAIYSDYKDVSAIKDKKSGEVIDI-RNNIEVFAIGYTIIILELQLEGGKIMSAKDFVNGR-KIEKGMIL 312
>gi|78043011|ref|YP_360315.1| methionyl-tRNA formyltransferase [Carboxydothermus hydrogenoformans Z-2901] >gi|123743169|sp|Q3AC19|FMT_CARHZ Methionyl-tRNA formyltransferase >gi|77995126|gb|ABB14025.1| methionyl-tRNA formyltransferase [Carboxydothermus hydrogenoformans Z-2901] (308 aa)
Score = 466, Expect = 1.0e-44, Identities = 109/296 (36%), Positives = 167/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI-KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNIS-KEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IV+MGTPE A   L  L+    +V  VV +PD   GR K++I S VK  A E +++   P K  +E+  E+  + P   V  A+G+ +P  IL+IP +GC+NIHASLLP YRG API   ++ GEKETG+ +M   + +D GD+    KV I +  T   L K +  +  D+++  L+++     P + QD    ++A  + K+DE I++  +A +I N IR L+  PGAY     KK+K++KA      S   PG I     K G L++T +  + + E+Q EG  +   ++ LNG
  S:     2 RIVYMGTPEFAVKPLAKLISHH-EVALVVTKPDAAAGRGKKVISSPVKLFAQENHLRVITPLKFNEEVYQEILAVKPEVIVVAAYGKLLPREILNIPPYGCLNIHASLLPFYRGAAPIERCLMAGEKETGITIMFMDEGLDTGDIALQEKVAINQEITGGELRKILAEIGADLIIEALKRLREGGLPRVPQDHQLATYAPPLKKEDEIIHWADSAEKIRNQIRALNPVPGAYTVFRGKKIKIWKA-KVGEFSGKKPGEIIFADRKNGFLVATGERGLQILELQPEGGKKMSWESFLNG 297
>gi|15603425|ref|NP_246499.1| methionyl-tRNA formyltransferase [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431515|sp|P57949|FMT_PASMU Methionyl-tRNA formyltransferase >gi|12721952|gb|AAK03644.1| Fmt [Pasteurella multocida subsp. multocida str. Pm70] (317 aa)
Score = 466, Expect = 1.1e-44, Identities = 99/299 (33%), Positives = 179/299 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIND-----KKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           KI+F GTP  A   L ALL     VVAV  QPDKP GR K++  S VK+LA + NI  +QP  ++++E   E++ ++    V  A+G  +P ++L++P  GC+N+H SLLP++RG API  A+  G+K+TG+ +M+  + +D GD+      +I + +T+++L+ K+  +    +L+ L+ +   ++   KQD+ +  +A  +SK++ ++N+  +A ++   IR  +  P +Y    D     + +K++KA +     +   GTI +  K GI I+T +  + + ++Q  GK   + +++LNG +E
  S:     5 KIIFAGTPAFAAQHLQALLNSHHQVVAVYTQPDKPAGRGKKLQASPVKQLAEQHNIPVYQPKSLRKVEAQEEMRAIDADVMVVVAYGLILPQTVLAMPRLGCLNVHGSLLPRWRGAAPIQRAIWAGDKQTGITIMQMDEGLDTGDMLYKVYCDIAQDETSTSLYAKLMEIAPPALLHVLDGLDKGKFVSEKQDDIESCYAEKLSKEEAELNWHVSAEQLERHIRAFNPWPVSYFSTRDLQGNTQVIKVYKA-AVLPHVDKVAGTILSADKNGIQIATAEGVLNLLQLQPAGKKPMDARDLLNGRAE 309
>gi|148377891|ref|YP_001256767.1| methionyl-tRNA formyltransferase [Mycoplasma agalactiae PG2] >gi|148291937|emb|CAL59328.1| Methionyl-tRNA formyltransferase [Mycoplasma agalactiae PG2] (279 aa)
Score = 465, Expect = 1.2e-44, Identities = 110/290 (37%), Positives = 164/290 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEV 301
           KI+  GTPE A      ++  +F VV +V QPDKP  R + +  +  K LA + NI+ FQP KI +I +EL+ L+    VT AFGQ IP S+L I +   +N+H S+LPKYRG AP+  A++N +K TGV LM  +K MDAGDV+   +  I E+D  S+L KK++ L  D ++  L K+   E     QD+SKV+F+  ++K+D +I  +    + ++ IR     PGA+ +IN K++KLF A             I  + K GI +   D  I   + Q + K R ++
  S:     2 KILLAGTPEFAVPIFEKII-NNFTVVGIVSQPDKPNQRGRVLTSTPTKALAQKYNIRCFQPEKIGQIADELRALDYDYLVTAAFGQLIPTSVLQIAKKLNLNVHGSILPKYRGAAPVQHALLNNDKTTGVSLMEMVKAMDAGDVFAKIEFEISETDVASSLLKKISLLTADHIVEWLNKIDKGELAREVQDKSKVTFSPKLNKEDAEITKDFTCDQAISKIRAYEYNPGAFAYINGKRVKLFFA-------------IKKVVKAGIKLELSDGVIYAVDYQFDSKKRVKI 277
>gi|148545340|ref|YP_001265442.1| methionyl-tRNA formyltransferase [Pseudomonas putida F1] >gi|166215501|sp|A5VWJ8|FMT_PSEP1 Methionyl-tRNA formyltransferase >gi|148509398|gb|ABQ76258.1| methionyl-tRNA formyltransferase [Pseudomonas putida F1] (310 aa)
Score = 465, Expect = 1.3e-44, Identities = 100/299 (33%), Positives = 166/299 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTPE A   L ALL+  +++VAV  QPD+P GR ++++ S+VK LA+  +I  FQP  ++  + + EL  L P   V  A+G  +P  +L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  TL  ++  +    V+  +  + +       QD++  ++A+ ++KD+ +I++ + AVE+  LIR  +  P  +  ++ + +K+  A    S    APG I + SK+G++++  D  + +  +Q+ G       ++ N   E
  S:     2 RIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMPSAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISAEDTGGTLHDRLAEMGPPAVVQAIAGLADGSLQGEIQDDALATYAHKLNKDEARIDWTRPAVELERLIRAFNPWPVCHSMLDGESVKVLAA--NLSTGQGAPGEILSASKDGLVVACGDQALSLTRLQLPGGKALSFSDLFNSRRE 300
>gi|93007291|ref|YP_581728.1| methionyl-tRNA formyltransferase [Psychrobacter cryohalolentis K5] >gi|92394969|gb|ABE76244.1| methionyl-tRNA formyltransferase [Psychrobacter cryohalolentis K5] (363 aa)
Score = 465, Expect = 1.3e-44, Identities = 104/297 (35%), Positives = 183/297 (61%)
  Q:    12 KIVFMGTPEIATYALNALLEK----SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE-------LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSK--SNNAPGTINNISKEGILIST-KDFDI--------------LVKEVQIEGKNRQEVKNILNGN 308
           K+VF GTPE A  +L AL+++    +  +VAV  QPD+  GR +++  S+VK++A+  +I   QP   K+   E       L++  P   +  A+G  +P  +L+ P +GC+NIHASLLP++RG APIH A++ G+ ETGV +M+  K +D GD+      +IE  DT ++L  KM  L    ++  L+ + + +   I QD+S+ ++A  + K++ +I++ ++A  I   IRGL+  PGAY F+  +++K+  ++  N+   ++   GT+ ++ ++ IL++  KD +I               V ++Q  G      + I +GN
  S:    26 KVVFAGTPEFAAVSLEALIKQQQALNISIVAVYSQPDRKAGRGQKLAASAVKQVALAHDIAVEQPETFKKSSIEGVIARQTLQDYQPDVMIVAAYGLILPVGVLNTPTYGCLNIHASLLPRWRGAAPIHRALLAGDSETGVTIMQMNKGLDTGDMLYKVSASIESDDTAASLHDKMAELGATAIITVLQDLPHYQAQAIVQDDSQANYAEKLVKNEGEIDWTQSATVIERQIRGLTPWPGAYTFLAGQRVKILASLPVNASQPTDKQAGTVISVGRKAILVACGKDNNIDTDVNSEKPQASTLAVTQLQFAGSKPVSAEQICHGN 350
>gi|168216177|ref|ZP_02641802.1| methionyl-tRNA formyltransferase [Clostridium perfringens NCTC 8239] >gi|182381585|gb|EDT79064.1| methionyl-tRNA formyltransferase [Clostridium perfringens NCTC 8239] (317 aa)
Score = 465, Expect = 1.4e-44, Identities = 118/306 (38%), Positives = 177/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE---IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETP--------GAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVFMGTP+ A  +L  ++EK F+V A+V QPDKP GR K++  S +K++ +   I  FQP KI+    I N+LKEL P   +  A+GQ +   IL IP  GCI +HASLLP YRG API+W +INGE +TG   +     +D G++    +V I ES T   L+  +     +++   +  +   +   IKQ     S+   ++K    IN+  ++  I NLIRGLS  P         AY +  D  +K+FK+ S  +   + PG I + + EGI ++TK+  ++++ +Q  G    EVK  L GN +I+ G+ L
  S:     2 KIVFMGTPDFAVPSLKKMIEK-FNVSAIVTQPDKPSGRGKKVSISPIKEVELSNEILIFQPEKIRTDSVIINKLKELKPDFIIVVAYGQILTKEILDIPRLGCICLHASLLPMYRGSAPINWCLINGEIKTGNTTILMDTSIDTGNMLMRSEVEISESMTAGELYNLLKINGAELLEETINGIITGKICGIKQPNDGSSYVKMLNKQMANINWNDSSTNIHNLIRGLSSWPYKNINSWLTAYTYYKDIPVKIFKSKSLEANIIDPPGYIIDANDEGIKVATKNGILIIEILQFPGGKPLEVKEFLKGN-KIEKGIIL 316
>gi|167560578|ref|ZP_02353581.1| hypothetical protein Sententeri_27454 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] (315 aa)
Score = 465, Expect = 1.5e-44, Identities = 98/299 (32%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L+    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    ++  L+++ +    P  Q+E+ V+ A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      + + PGTI   +K+GI ++T    + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLTSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLHADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQGLITTLKQLADGTAAPEAQNEALVTHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIDGQPVKVWQASVIEDATQSLPGTILAATKQGIQVATGKGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|168823235|ref|ZP_02835235.1| hypothetical protein Salentericaenterica_27882 [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] (315 aa)
Score = 464, Expect = 1.6e-44, Identities = 98/299 (32%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L+    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    ++  L+++ +    P  Q+E+ V+ A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      + + PGTI   +K+GI ++T    + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLTSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQHLVADLHADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQGLITTLKQLADGTATPEAQNEALVTHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLKIDGQPVKVWQASVIEDATQSLPGTILAATKQGIQVATGKGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|168468036|ref|ZP_02701873.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] >gi|168478346|ref|ZP_02707369.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Virchow str. SL491] >gi|195628883|gb|EDX48293.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] (315 aa)
Score = 464, Expect = 1.6e-44, Identities = 98/299 (32%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L+    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    ++  L+++ +    P  Q+E+ V+ A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      + + PGTI   +K+GI ++T    + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLTSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLHADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQGLITTLKQLADGTATPEAQNEALVTHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIDGQPVKVWQASVIEDATQSLPGTILAATKQGIQVATGKGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|16766696|ref|NP_462311.1| methionyl-tRNA formyltransferase [Salmonella typhimurium LT2] >gi|56415327|ref|YP_152402.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62181913|ref|YP_218330.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161616433|ref|YP_001590398.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|167546867|ref|ZP_02342428.1| hypothetical protein Sentent_26469 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] >gi|167995182|ref|ZP_02576272.1| hypothetical protein Sententer_01000064_0100027300 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] >gi|168224003|ref|ZP_02649235.1| hypothetical protein Senterenterica_26700 [Salmonella enterica subsp. enterica serovar Agona str. SL483] >gi|168229049|ref|ZP_02654280.1| hypothetical protein Sententeric_24992 [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] >gi|168234464|ref|ZP_02659522.1| hypothetical protein Sententerica_26017 [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] >gi|168239760|ref|ZP_02664818.1| hypothetical protein Senteenterica_26528 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] >gi|168245234|ref|ZP_02670166.1| hypothetical protein Senterienterica_26564 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] >gi|194442945|ref|YP_002042659.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194451913|ref|YP_002047432.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194471458|ref|ZP_03077442.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194736618|ref|YP_002116351.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] >gi|189044562|sp|A9N8B2|FMT_SALPB Methionyl-tRNA formyltransferase >gi|21542048|sp|Q8ZLM6|FMT_SALTY Methionyl-tRNA formyltransferase >gi|73919416|sp|Q57J63|FMT_SALCH Methionyl-tRNA formyltransferase >gi|73919417|sp|Q5PIT7|FMT_SALPA Methionyl-tRNA formyltransferase >gi|16421963|gb|AAL22270.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Salmonella typhimurium LT2] >gi|56129584|gb|AAV79090.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] >gi|62129546|gb|AAX67249.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] >gi|161365797|gb|ABX69565.1| hypothetical protein SPAB_04248 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] >gi|194401608|gb|ACF61830.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL254] >gi|194410217|gb|ACF70436.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] >gi|194457822|gb|EDX46661.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] >gi|194712120|gb|ACF91341.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] (315 aa)
Score = 464, Expect = 1.6e-44, Identities = 98/299 (32%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L+    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    ++  L+++ +    P  Q+E+ V+ A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      + + PGTI   +K+GI ++T    + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLTSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQHLVADLHADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQGLITTLKQLADGTATPEAQNEALVTHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIDGQPVKVWQASVIEDATQSLPGTILAATKQGIQVATGKGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|145631965|ref|ZP_01787718.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 22.4-21] >gi|144982379|gb|EDJ89956.1| methionyl-tRNA formyltransferase [Haemophilus influenzae R3021] (318 aa)
Score = 464, Expect = 1.7e-44, Identities = 102/302 (33%), Positives = 181/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  E + ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + + ++   KQD+S+ ++A  +SK++ ++++  +A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNISVYQPKSLRKEEAQTELKALNVDVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDAQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLESGKFISEKQDDSQSNYAEKLSKEEAQLDWSLSAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|148826744|ref|YP_001291497.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittEE] >gi|166214899|sp|A5UEB3|FMT_HAEIE Methionyl-tRNA formyltransferase >gi|148716904|gb|ABQ99114.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittEE] (318 aa)
Score = 464, Expect = 1.8e-44, Identities = 101/302 (33%), Positives = 181/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + +I  +QP  ++  E+++ELK LN    V  A+G  +P  +L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + + ++   KQD+S+ ++A  +SK++ ++++   AV++   IR  +  P AY    D+      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNDIPVYQPKSLRKEEVQSELKALNADVIVVVAYGLILPKVVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDAQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLESGKFTAEKQDDSQSNYAEKLSKEEAQLDWSLPAVQLERNIRAFNPWPIAYFSTEDRDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQPAGKKLMSAQDLLNGRAE 309
>gi|145633870|ref|ZP_01789591.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 3655] >gi|145635939|ref|ZP_01791625.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittAA] >gi|144985242|gb|EDJ92085.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 3655] >gi|145266798|gb|EDK06816.1| methionyl-tRNA formyltransferase [Haemophilus influenzae PittAA] (318 aa)
Score = 464, Expect = 1.8e-44, Identities = 103/302 (34%), Positives = 180/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + N ++   KQD S+ ++A  +SK++ ++++   A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQNNIPVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLENSKFIAEKQDGSQSNYAEKLSKEEAQLDWSLPAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|114566757|ref|YP_753911.1| methionyl-tRNA formyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|122318217|sp|Q0AXL4|FMT_SYNWW Methionyl-tRNA formyltransferase >gi|114337692|gb|ABI68540.1| methionyl-tRNA formyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (314 aa)
Score = 464, Expect = 2.0e-44, Identities = 101/296 (34%), Positives = 167/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLE-YPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGT   A  +L AL+    ++  VV QPDK  GR +++  + VK++A +  ++  Q   IK  E+   +K+  P   +  ++GQ IP SIL  P  GCIN+HASLLP+YRG AP+  A+++G K +G+ +M   + +D GD+     + ++++     L K + ++  D++L  ++++   E  P + QD+S+ S+A  ISK+DE IN+ + A  I N IR L+  PGAY +IN  K+K+F +   +   +     +  + K    + T +  + V E+Q  GK R      L G
  S:     2 RIVFMGTSHFAIPSLKALIASEHEIAGVVSQPDKQRGRGRKVTPTPVKEIAEQYKLELLQTANIKTPESIKRIKQWKPELIIVVSYGQIIPLSILEYPRHGCINVHASLLPRYRGAAPVQRALMDGIKSSGITIMFMDEGLDTGDIIMQEAIAVDDNINHGELEKILADMGADLLLQVVDRLVQGEKLPRVVQDDSQASYAARISKEDEIINWSEPAYAIHNRIRALNPQPGAYSYINGTKVKIFASKVRSEAGSGVIAEVIEVDKNTFQVQTGEGILEVLEIQKAGKKRMPTSEFLKG 300
>gi|16762875|ref|NP_458492.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] >gi|29144362|ref|NP_807704.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] >gi|21542046|sp|Q8Z1X0|FMT_SALTI Methionyl-tRNA formyltransferase >gi|25320691|pir||AI1009 methionyl-tRNA formyltransferase (EC 2.1.2.9) [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) >gi|16505182|emb|CAD09178.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Typhi] >gi|29140000|gb|AAO71564.1| methionyl-tRNA formyltransferase [Salmonella enterica subsp. enterica serovar Typhi Ty2] (315 aa)
Score = 463, Expect = 2.3e-44, Identities = 97/299 (32%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    ++V V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L+    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    ++  L+++ +    P  Q+E+ V+ A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      + + PGTI   +K+GI ++T    + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLTSGHNIVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQHLVADLHADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQGLITTLKQLADGTATPEAQNEALVTHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIDGQPVKVWQASVIEDATQSLPGTILAATKQGIQVATGKGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|119773184|ref|YP_925924.1| methionyl-tRNA formyltransferase [Shewanella amazonensis SB2B] >gi|166215508|sp|A1S1J8|FMT_SHEAM Methionyl-tRNA formyltransferase >gi|119765684|gb|ABL98254.1| methionyl-tRNA formyltransferase [Shewanella amazonensis SB2B] (320 aa)
Score = 463, Expect = 2.3e-44, Identities = 103/302 (34%), Positives = 168/302 (55%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  KI+F GTP+ A   L ALL    +V+AV  QPD+P GR +++  S VK LA+E  I  +QP  ++  E + EL  L     V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+ ETGV +M+    +D GD+     + IE+ DT+++L++K+       +L+ L  +        KQDE+  ++A  +SK++ +++F K A  +   +R  +  P +Y     + +K+++       S  A GTI    K+GI I+T D  + + ++Q+ GK   +V +ILN   +
  S:     2 KPLKIIFAGTPDFAARHLQALLTSEHEVIAVYTQPDRPAGRGQKLTPSPVKSLALEHQIPVYQPKSLRKEEAQQELAALGADIMVVVAYGLILPKVVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDVGLDTGDMLLKTHLPIEDDDTSASLYEKLAGQGPAALLDALAALSEGTLSAEKQDEALANYAEKLSKEEARLDFAKPAKNLWQEVRAFNPWPVSYFEHQGQTIKVWQTSVLAEPSTKASGTIVAAGKQGIDIATADGMLRIHKMQLPGKKPMDVADILNSRGD 305
>gi|168264712|ref|ZP_02686685.1| hypothetical protein Salmentericaenterica_26861 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (315 aa)
Score = 463, Expect = 2.4e-44, Identities = 98/299 (32%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ALL    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L+    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    ++  L+++ +    P  Q+E+ V+ A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      + + PGTI   +K+GI ++T    + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDALLTSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVADLHADVMVVVAYGLILPKAMLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQGLITTLKQLADGTATPEAQNEALVTHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIDGQPVKVWQASVIEDATQSLPGTILAATKQGIQVATGKGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|167554204|ref|ZP_02347945.1| hypothetical protein Sentente_27167 [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] (315 aa)
Score = 462, Expect = 2.7e-44, Identities = 97/299 (32%), Positives = 172/299 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+A+L    +VV V  QPD+P GR K+++ S VK LA EK +  FQP  ++  EN+  + +L+    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I   DT+ +L+ K+  L    ++  L+++ +    P  Q+E+ V+ A  +SK++ +I++  +A ++   IR  +  P ++  I+ + +K+++A      + + PGTI   +K+GI ++T    + +  +Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDAMLTSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQHLVADLHADVMVVVAYGLILPKAVLDMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLACPITAEDTSGSLYNKLAELGPQGLITTLKQLADGTATPEAQNEALVTHAEKLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIDGQPVKVWQASVIEDATQSLPGTILAATKQGIQVATGKGILNLLSLQPAGKKAMSAQDLLNSRRE 306
>gi|91214903|ref|ZP_01251876.1| methionyl-tRNA formyltransferase [Psychroflexus torquis ATCC 700755] >gi|91187330|gb|EAS73700.1| methionyl-tRNA formyltransferase [Psychroflexus torquis ATCC 700755] (309 aa)
Score = 462, Expect = 3.1e-44, Identities = 111/292 (38%), Positives = 182/292 (62%)
  Q:    16 MGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQ-DESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYC--FIND--KKMKLFKA---VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           MGTPE A   L+ L   SF++V VV  PDKP GR K++  S+VK  A+  +++  QP  +K  + +++LK L+P   V  AF + +P ++   P++G  N+HASLLP+YRG API+WA+INGEK+TGV      +++D G +  S+ ++I E D   TL  K+  L  D+V+  ++ +   +  P  Q + S++  A  ++K++ KI+++++   IV+ IRGLS  P A+    I D  KK+K++KA   +S + K   + G   N   + I ++ K+  + ++E+Q  GK + EVK +LNG
  S:     1 MGTPEFAVGILDRLQTSSFNIVGVVTAPDKPAGRGKQLKSSAVKTYALHHDLEVLQPTNLKSEDFQDDLKRLDPNLIVVVAF-RMLPKAVWDFPDYGTFNLHASLLPQYRGAAPINWAIINGEKKTGVTTFFIDEEIDTGKIIDSKSISIAEKDNVETLHDKLMTLGADVVIETVKAIEQAKVEPQAQANISELKAAPKLTKENTKIDWKQSGNAIVDFIRGLSPFPVAWTELTIEDEIKKIKVYKASFEISDHQKEIGSTGL--NTEIKTIDVAVKNGYVHLEELQFPGKKKMEVKALLNG 299
>gi|124007788|ref|ZP_01692490.1| methionyl-tRNA formyltransferase [Microscilla marina ATCC 23134] >gi|123986734|gb|EAY26515.1| methionyl-tRNA formyltransferase [Microscilla marina ATCC 23134] (308 aa)
Score = 462, Expect = 3.3e-44, Identities = 107/297 (36%), Positives = 172/297 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESK-VSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSK-----SNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           +I+F+GTP+ A  +L  L++  F+VVAVV   DK  GR  +I  S+VK  A+E NI   QP ++K  E   EL        +  AF + +P+++ ++P  G  N+HASLLP YRG API+WA+INGEKETGV      +++D G++    K  I   D   T+++K+ N+   +VL  +  +   +YP   QD SK    A  I ++  +I++ K + ++ NL+RGL+  P A+  ++ K  K++K      +         PG     +K+ +   T D  I V+++++EGK R +VK+ L+GN
  S:     2 RIIFLGTPDFAVPSLKVLVDNGFNVVAVVTATDKRAGRGNKIKTSAVKDFALEHNIPVLQPERLKAPEFIEELASYQADLQIVVAF-RMLPEAVWNMPSLGTFNLHASLLPDYRGAAPINWAIINGEKETGVTTFFLKQKIDTGNIIFQEKAPILPEDNIGTMYEKLKNIGGGLVLKTVRAIQAGKYPQTAQDLSKETPPAPKIFRETCEIDWNKTSEQVHNLVRGLAPIPAAWTMLSGKNCKIYKTSLATPQLPEGVEAKQPGEYVTDNKKYLYFKTGDGFIAVEDLKLEGKKRMDVKSFLSGN 305
>gi|153092374|gb|EDN73437.1| methionyl-tRNA formyltransferase [Mannheimia haemolytica PHL213] (317 aa)
Score = 461, Expect = 3.5e-44, Identities = 104/298 (34%), Positives = 178/298 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIN----DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL+   +V+AV  QPDKP GR K++  S VK+LA   NI  +QP  ++  E + ELK LN    V  A+G  +P+++L+ P++GC+N+H SLLP++RG API  ++  G+ ETGV +M     +D GD+       IE ++T+++L+ K+  L    +L  L  + N  +   KQDE+  ++A  +SK++ K++++  AV++   IR  +  P ++  +     ++ +K+ +A +       A GT+ N+ K GI I+T+   + + ++Q  GK    V++ LNG ++
  S:     6 IIFAGTPDFAAQHLQALLDSEHNVIAVYTQPDKPAGRGKKLQASPVKQLAEAHNIPVYQPKSLRKEEAQAELKALNADVMVVVAYGLILPEAVLNAPKYGCLNVHGSLLPRWRGAAPIQRSIWAGDTETGVTIMLMDVGLDTGDMLHKVTTPIEPNETSASLYAKLAELAPLALLEVLNGLANHTFKAEKQDEALSNYAEKLSKEEAKLDWQLPAVQLERNIRAFNPWPFSFLTLTVDGVEQSIKIHQA-TVLPHQEKAAGTVINVDKTGIQIATQQGVLNITQLQPAGKKPMSVQDFLNGRAD 308
>gi|89210631|ref|ZP_01189018.1| Methionyl-tRNA formyltransferase [Halothermothrix orenii H 168] >gi|89159729|gb|EAR79390.1| Methionyl-tRNA formyltransferase [Halothermothrix orenii H 168] (316 aa)
Score = 461, Expect = 3.6e-44, Identities = 109/286 (38%), Positives = 171/286 (59%)
  Q:    13 IVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI--KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIV---LNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLF------KAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNR 298
           IVFMG+P+ A   L  L  E    + AVV QPD+  GR  ++  + VK++A +  +K  Q + I  +E    L++L+P A V  AFGQ +   +L +P +GCIN+HASLLP+YRG +PIH A+ING+K TGV  M   +  D GD+   ++V I   DT  TL  K+ ++  D++   LND+EK      P  KQ E K S+AY I +   ++++ +++ +I NL+RG++  PGAY     K +K++        V+ N K   A   I    ++GI++ T D  + + E+Q+ G+ +
  S:     3 IVFMGSPDFAVPGLEKLYNEPGITIKAVVTQPDRKKGRGHKLRPTPVKQMAHKLGLKVLQTDNINREEFITNLRDLSPEAIVVVAFGQKLGKKVLELPSYGCINLHASLLPRYRGASPIHRAIINGDKVTGVTTMYMDEGWDTGDIIYKKEVKINREDTAGTLHDKLASIGGDLLVKTLNDIEKGVA---PREKQSEDKASYAYKIDRKIGELDWSRSSEDIFNLVRGVNPWPGAYTTWKGKLLKIWWVEPLKLTVTENDKKMEAGEVITASQEDGIIVKTGDDAVKIIELQLAGRKK 297
>gi|167855266|ref|ZP_02478035.1| methionyl-tRNA formyltransferase [Haemophilus parasuis 29755] >gi|167853630|gb|EDS24875.1| methionyl-tRNA formyltransferase [Haemophilus parasuis 29755] (316 aa)
Score = 461, Expect = 3.9e-44, Identities = 102/309 (33%), Positives = 180/309 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAY--CFIN--DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           K   I+F GTP+ A   L ALL    +V+AV  QPDKP GR K++  S VK+LA   +I  +QP  ++  E + EL+ LN    V  A+G  +P+++L  P++GC+N+H SLLP++RG API  ++  G+ ETGV +M+    +D GD+       I  ++T+++L+ K+  L    +L  L  + + ++ P KQ + + ++A  ++K++ K+++   A ++   IR  +  P AY    +N  ++++K+++A     +     GT+  + K GI I+T+   + + ++Q  GK    V++ LNG  +  K+G  L
  S:     2 KKLNIIFAGTPDFAATHLQALLNSEHNVIAVYTQPDKPAGRGKKLQASPVKQLAEAHHIPVYQPKSLRKEEAQAELQALNADVMVVVAYGLILPEAVLKAPKYGCLNVHGSLLPRWRGAAPIQRSIWAGDTETGVTIMQMDIGLDTGDMLHKVTTPILATETSASLYAKLAELAPPALLEVLNGLTSGQFKPEKQQDEQANYAEKLTKEEAKLDWNMTACQLERNIRAFNPAPMAYLTLMVNEVEERIKVYQAEVLPHQEKTV-GTVLAVDKNGIQIATQQGVLNITQLQPAGKKPMSVQDFLNGRGDWFKVGSVL 316
>gi|188585960|ref|YP_001917505.1| methionyl-tRNA formyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350647|gb|ACB84917.1| methionyl-tRNA formyltransferase [Natranaerobius thermophilus JW/NM-WN-LF] (313 aa)
Score = 461, Expect = 3.9e-44, Identities = 106/307 (34%), Positives = 183/307 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEK-NAVEIVNLIRGLSETPGAYCFINDKKMKLFKA---VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           + +FMGTP+ +   + A+   + ++  VV QPD+  GR KE+     K+ A E  I  FQP  I        L ++ P   VT A+GQ +P  IL +P    IN+HASLLP+YRG APIH AV++G+++TGV +M    +MDAGD+     V+I ++DTT  ++K++  +   +++  ++ +   +  P+KQDE++VS+A  + K+DE ++F K    E+ N +RGL+  PGA+     K++K+++     S++  SN+ PG I  I+++G ++      +++ ++Q  GK     +  + G  +IK G+ L+
  S:     2 RTIFMGTPDFSVPFIEAIARSTHNLNLVVTQPDRRKGRGKELQPPPAKRKAEELGIDVFQPESIHNNYAYQILSDIEPHLIVTAAYGQILPRKILDLPRIKAINVHASLLPEYRGAAPIHRAVMDGKEQTGVTIMEMCDKMDAGDILNYESVDIGKTDTTGDVYKQIITVGPQLLIETMDLLEKNQVTPLKQDENQVSYAPKLKKEDEYLDFSKYTNTEVFNRVRGLNPWPGAFTKFEGKRLKIWETKVHNSSSFNSNSKPGEIIEINQQGPVVKCCQGSVILTKIQPSGKKAMTGEQFIRG-YDIKSGIQLE 313
>gi|165977023|ref|YP_001652616.1| methionyl-tRNA formyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190150918|ref|YP_001969443.1| methionyl-tRNA formyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165877124|gb|ABY70172.1| methionyl-tRNA formyltransferase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189916049|gb|ACE62301.1| methionyl-tRNA formyltransferase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (316 aa)
Score = 460, Expect = 4.5e-44, Identities = 99/298 (33%), Positives = 177/298 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIN----DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL+   +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  + + ELK LN    V  A+G  +P+++L+ P++GC+N+H SLLP++RG API  ++  G++ETGV +M+    +D GD+       I   +T+++L+ K+  L    +L  L  + +  +   KQDE+  ++A  +SK++ K+++   A ++   IR  +  P ++  +     ++ +K+++A +       A GT+    K GI I+T++  + + ++Q  GK    V++ LNG ++
  S:     6 IIFAGTPDFAAQHLQALLDSEHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQHNIPVYQPKSLRKEDAQAELKALNADVMVVVAYGLILPEAVLNAPKYGCLNVHGSLLPRWRGAAPIQRSIWAGDQETGVTIMQMDIGLDTGDMLHKVTTPIAADETSASLYAKLAELAPPALLEVLNGLESQAFKAEKQDEALSNYAEKLSKEEAKLDWNLTACQLERNIRAFNPWPISFLTLEVDGVEQSVKVYQA-NVLPHQAKAAGTVLQADKNGIQIATQEGVLNITQLQPSGKKPMSVQDFLNGRAD 308
>gi|26986812|ref|NP_742237.1| methionyl-tRNA formyltransferase [Pseudomonas putida KT2440] >gi|33516857|sp|Q88RR2|FMT_PSEPK Methionyl-tRNA formyltransferase >gi|24981408|gb|AAN65701.1|AE016196_12 methionyl-tRNA formyltransferase [Pseudomonas putida KT2440] (310 aa)
Score = 460, Expect = 5.4e-44, Identities = 100/299 (33%), Positives = 165/299 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTPE A   L ALL+  +++VAV  QPD+P GR ++++ S+VK LA+  +I  FQP  ++  + + EL  L P   V  A+G  +P  +L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  TL  ++  +    V+  +  + +       QD++  ++A+ ++KD+ +I++   AVE+  LIR  +  P  +  ++ + +K+  A    S    APG I + SK+G++++  D  + +  +Q+ G       ++ N   E
  S:     2 RIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMPSAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISAEDTGGTLHDRLAEMGPPAVVQAIAGLADGSLQGEIQDDALATYAHKLNKDEARIDWTHPAVELERLIRAFNPWPVCHSTLDGESVKVLAA--NLSTGQGAPGEILSASKDGLVVACGDQALSLTRLQLPGGKALSFSDLFNSRRE 300
>gi|104779337|ref|YP_605835.1| methionyl-tRNA formyltransferase [Pseudomonas entomophila L48] >gi|123381103|sp|Q1IH35|FMT_PSEE4 Methionyl-tRNA formyltransferase >gi|95108324|emb|CAK13018.1| methionyl-tRNA formyltransferase [Pseudomonas entomophila L48] (310 aa)
Score = 459, Expect = 6.2e-44, Identities = 99/299 (33%), Positives = 166/299 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTPE A   L ALL+  +++VAV  QPD+P GR ++++ S+VK LA+  +I  +QP  ++  E + EL  L P   V  A+G  +P  +L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  TL  ++  +    V+  +  + +       QD++  ++A+ ++KD+ +I++ + AVE+  LIR  +  P  +  ++ + +K+  A  +  K    PG I + SK+G++++  D  + +  +Q+ G       ++ N   E
  S:     2 RIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMPSAVKALAVAHDIPVYQPQTLRNPEAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISAEDTGGTLHDRLAAMGPGAVVQAIAGLADGSLQGEVQDDTLATYAHKLNKDEARIDWNRPAVELERLIRAFNPWPVCHSTLDGESVKVLAANLSTGKG--TPGEILSASKDGLVVACGDGALSLTRLQLPGGKALAFSDLFNSRRE 300
>gi|68249188|ref|YP_248300.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 86-028NP] >gi|81336406|sp|Q4QMV7|FMT_HAEI8 Methionyl-tRNA formyltransferase >gi|68057387|gb|AAX87640.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 86-028NP] (318 aa)
Score = 459, Expect = 6.4e-44, Identities = 102/302 (33%), Positives = 180/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  Q DKP GR K++  S VK+LA + NI  +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L   ++++ L+ + N ++   KQD S+ ++A  +SK++ ++++   A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQSDKPAGRGKKLQASPVKQLAEQNNIPVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSVLIDVLDNLENSKFIAEKQDGSQSNYAEKLSKEEAQLDWSLPAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGVLNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|146297904|ref|YP_001192495.1| methionyl-tRNA formyltransferase [Flavobacterium johnsoniae UW101] >gi|146152322|gb|ABQ03176.1| methionyl-tRNA formyltransferase [Flavobacterium johnsoniae UW101] (315 aa)
Score = 459, Expect = 6.7e-44, Identities = 109/296 (36%), Positives = 177/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEY-PPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+FMGTPE A   L+ +++ ++DVV V+   DKP GR ++I +S+VK+ A+  N+   QP  +K+     ELK LN    +  AF + +P  +  +P  G  N+HASLLP YRG API+WA+INGE +TGV       ++D G +  + ++ IE ++    L  ++ NL    V++ L+ + N      I++D + +  AY ++K++ KI++ K+  EI NLIRGLS  P A+CF+ DK     +K+++A       +   G + +  KE I I+ K+  I +  +Q+ GK R +V  +LNG
  S:     5 RIIFMGTPEFAVGILDTIIKNNYDVVGVITAADKPAGRGQKIKYSAVKEYALANNLTLLQPTNLKDESFLAELKALNANLQIVVAF-RMLPKVVWEMPNLGTFNLHASLLPNYRGAAPINWAIINGETKTGVTTFFIDDKIDTGAMILNSEIAIEPAENAGQLHDRLMNLGSTTVIDTLKVIENGNVITTIQEDNNDIKTAYKLNKENCKIDWTKSGDEINNLIRGLSPYPAAWCFLKDKNEELSIKIYEAKLLEEAHSYEAGKLISGKKE-IKIAIKNGFIQLLSLQLPGKKRMQVAELLNG 305
>gi|28867418|ref|NP_790037.1| methionyl-tRNA formyltransferase [Pseudomonas syringae pv. tomato str. DC3000] >gi|33516856|sp|Q88B42|FMT_PSESM Methionyl-tRNA formyltransferase >gi|28850652|gb|AAO53732.1| methionyl-tRNA formyltransferase [Pseudomonas syringae pv. tomato str. DC3000] (314 aa)
Score = 459, Expect = 7.4e-44, Identities = 104/306 (33%), Positives = 167/306 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           +IVF GTPE A   L ALL+    +VAV  QPD+P GR ++++ S VK+LA++ +I   QP  ++  E + EL  L P   V  A+G  +P  +L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  TL  ++  L    VL  +  +         QD+S  ++A+ ++KD+ +I++ + A E+  L+R  +  P  +  +N++ +K+  A    ++   APGTI + SK+G++++     + +  +Q+ G       ++ N   E   IG  L
  S:     6 RIVFAGTPEFAAEHLKALLDSPHQIVAVYTQPDRPAGRGQKLMPSPVKQLALQHDIPVMQPPTLRAPEAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVMRMEAGLDTGPMLLKAVTPISAQDTGGTLHDRLAELGPPAVLQAIAGLAEGSLVGEAQDDSLANYAHKLNKDEARIDWTRPADELERLVRAFNPWPICHSTLNEEALKVLAA--DLAEGQGAPGTILSASKDGLIVACGQNALRLTRLQLPGGKPLNFTDLFNSRREKFAIGTVL 312
>gi|145642284|ref|ZP_01797849.1| methionyl-tRNA formyltransferase [Haemophilus influenzae R3021] >gi|145273040|gb|EDK12921.1| methionyl-tRNA formyltransferase [Haemophilus influenzae 22.4-21] (318 aa)
Score = 459, Expect = 7.4e-44, Identities = 102/302 (33%), Positives = 180/302 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K+  I+F GTP+ A   L A+L    +V+AV  Q DKP GR K++  S VK+LA + NI+ +QP  ++  E ++ELK LN    V  A+G  +P ++L  P  GC+N+H S+LP++RG API  ++  G+ +TGV +M+  + +D GD+      +I  ++T+++L+ K+  L    +++ L+ + N ++   KQD S+ ++A  +SK++ ++++   A+++   IR  +  P AY    DK      +K+++A     +   A GTI +  K GI I+T D  + + ++Q  GK     +++LNG +E
  S:     2 KSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQSDKPAGRGKKLQASPVKQLAEQNNIRVYQPKSLRKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRLGCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKVYCDILPTETSTSLYNKLAELAPSALIDVLDNLENSKFIAEKQDGSQSNYAEKLSKEEAQLDWSLPAMQLERNIRAFNPWPIAYFSTEDKDGNAQTLKVYQAEVLPHQDKPA-GTILSADKNGIQIATVDGILNLLQLQPAGKKPMSAQDLLNGRAE 309
>gi|73749414|ref|YP_308653.1| methionyl-tRNA formyltransferase [Dehalococcoides sp. CBDB1] >gi|73661130|emb|CAI83737.1| methionyl-tRNA formyltransferase [Dehalococcoides sp. CBDB1] (312 aa)
Score = 458, Expect = 9.5e-44, Identities = 97/285 (34%), Positives = 157/285 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGK 296
           KIVFMG+PE A   L  LL + +D+  V  QPD+P GR +E+    VK LA+E  +  +QP  +K+ E +  LKEL P   V  A+G  +P ++L IP +G +NIH SLLP+YRG  P+   ++ G++  GV LM+    +D G VY    V I   DTT  L  K+  +   ++L  L ++ +L  P + QD ++ S+   ++K+   IN++ +AVEI   +R     PG +   N K +K+ +A   N      P  +    +  +++ +   ++ +  +Q+EGK
  S:     5 KIVFMGSPEFALTPLKMLLAEGYDICGVYTQPDRPAGRGRELCPPPVKTLALEHGLAVYQPQSLKKPEEQAFLKELKPDVIVVAAYGLILPQAVLDIPVYGVLNIHPSLLPRYRGATPVAATLLGGDEWAGVSLMKLEAGLDTGPVYSRSMVAIRPEDTTPILADKLAFIGGCMLLELLSQIPSLPEPKV-QDNTQASYFGMVTKEMGLINWQTSAVEIERRVRAFFPWPGVFTTFNQKTLKILEAKPRNLGLGLKPSEVRVYEQSRVMVGSASGELEIIRLQLEGK 290
>gi|53729237|ref|ZP_00133763.2| COG0223: Methionyl-tRNA formyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] >gi|126209051|ref|YP_001054276.1| methionyl-tRNA formyltransferase [Actinobacillus pleuropneumoniae L20] >gi|166214869|sp|A3N2N5|FMT_ACTP2 Methionyl-tRNA formyltransferase >gi|126097843|gb|ABN74671.1| methionyl-tRNA formyltransferase [Actinobacillus pleuropneumoniae L20] (316 aa)
Score = 458, Expect = 9.8e-44, Identities = 98/298 (32%), Positives = 177/298 (59%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIN----DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL+   +V+AV  QPDKP GR K++  S VK+LA + NI  +QP  ++  + + ELK LN    V  A+G  +P+++L+ P++GC+N+H SLLP++RG API  ++  G++ETGV +M+    +D GD+       I   +T+++L+ K+  L    +L  L  + +  +   KQD++  ++A  +SK++ K+++   A ++   IR  +  P ++  +     ++ +K+++A +       A GT+    K GI I+T++  + + ++Q  GK    V++ LNG ++
  S:     6 IIFAGTPDFAAQHLQALLDSEHNVIAVYTQPDKPAGRGKKLQASPVKQLAEQHNIPVYQPKSLRKEDAQAELKALNADVMVVVAYGLILPEAVLNAPKYGCLNVHGSLLPRWRGAAPIQRSIWAGDQETGVTIMQMDIGLDTGDMLHKVTTPIAADETSASLYAKLAELAPPALLEVLNGLESQAFKAEKQDDALSNYAEKLSKEEAKLDWNLTACQLERNIRAFNPWPISFLTLEVDGVEQSVKVYQA-NVLPHQAKAAGTVLQADKNGIQIATQEGVLNITQLQPSGKKPMSVQDFLNGRAD 308
>gi|71066693|ref|YP_265420.1| methionyl-tRNA formyltransferase [Psychrobacter arcticus 273-4] >gi|71039678|gb|AAZ19986.1| methionyl-tRNA formyltransferase [Psychrobacter arcticus 273-4] (361 aa)
Score = 457, Expect = 1.0e-43, Identities = 93/269 (34%), Positives = 164/269 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEK----SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE-------LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTN-SKSNNAP-GTINNISKEGILIS 280
           ++VF GTPE A  +L  L+ +    + D+VAV  QPD+  GR ++   S+VK++A+  NI   QP   K+   E        ++  P   +  A+G  +P  +L+ P +GC+NIH SLLP++RG APIH A++ G+ ETG+ +M+  K +D GD+    +  IE  DT ++L  KM  L    +   L+ + + +   I QD+S+ ++A  + K + +I++ ++A  I   IRGL+  PGAY F+  +++K+  ++  N S+  + P GT+ ++ ++ +L++
  S:    26 RVVFAGTPEFAAISLEVLINQQDALNIDIVAVYSQPDRKAGRGQKFAESAVKQVALAHNIAVEQPETFKKSSIEGMTARQTFQDYQPDVMIVAAYGLILPIGVLNTPTYGCLNIHGSLLPRWRGAAPIHRAILAGDTETGITIMQMDKGLDTGDMLYKVRAPIESDDTAASLHDKMAELGATAITTVLQDLAHYQAQAIAQDDSQANYAEKLVKTEGEIDWTQSATVIERQIRGLTPWPGAYTFLAGQRVKILASLPVNASQPTDQPAGTVISVGRKAVLVA 307
>gi|147670023|ref|YP_001214841.1| methionyl-tRNA formyltransferase [Dehalococcoides sp. BAV1] >gi|189044508|sp|A5FPB5|FMT_DEHSB Methionyl-tRNA formyltransferase >gi|146270971|gb|ABQ17963.1| methionyl-tRNA formyltransferase [Dehalococcoides sp. BAV1] (315 aa)
Score = 457, Expect = 1.0e-43, Identities = 97/285 (34%), Positives = 157/285 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGK 296
           KIVFMG+PE A   L  LL + +D+  V  QPD+P GR +E+    VK LA+E  +  +QP  +K+ E +  LKEL P   V  A+G  +P ++L IP +G +NIH SLLP+YRG  P+   ++ G++  GV LM+    +D G VY    V I   DTT  L  K+  +   ++L  L ++ +L  P + QD ++ S+   ++K+   IN++ +AVEI   +R     PG +   N K +K+ +A   N      P  +    +  +++ +   ++ +  +Q+EGK
  S:     8 KIVFMGSPEFALTPLKMLLAEGYDICGVYTQPDRPAGRGRELCPPPVKTLALEHGLAVYQPQSLKKPEEQAFLKELKPDVIVVAAYGLILPQAVLDIPVYGVLNIHPSLLPRYRGATPVAATLLGGDEWAGVSLMKLEAGLDTGPVYSRSMVAIRPEDTTPILADKLAFIGGCMLLELLSQIPSLPEPQV-QDNTQASYFGMVTKEMGLINWQTSAVEIERRVRAFFPWPGVFTTFNQKTLKILEAKPRNLGLGLKPSEVRVYEQSRVMVGSASGELEIIRLQLEGK 293
>gi|119509940|ref|ZP_01629082.1| methionyl-tRNA formyltransferase [Nodularia spumigena CCY9414] >gi|119465406|gb|EAW46301.1| methionyl-tRNA formyltransferase [Nodularia spumigena CCY9414] (333 aa)
Score = 457, Expect = 1.1e-43, Identities = 110/297 (37%), Positives = 170/297 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTN---------------------SKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           KIVF GTP+ A   L  LL +  F V+AVV QPDK   R  ++I S VK +AI  N+  +QP +IK   E   +L+E +   FV  A+GQ +   IL +P+ GC+N+H S+LPKYRG API W + NGE ETG+  M     MD G +       I   D    L +++  +  D+++  L K+ N E  P+ QDE++ ++A  I K +  +++ K+A+++ N IRG    P       D+ +K+  +V                        S  + +PG + +I+K  G +  T +  +L++EVQ+ GK  Q   + +NGN
  S:     2 KIVFFGTPDFAVPTLEKLLNQPDFQVLAVVTQPDKRRERGNKLIPSPVKTVAINHNLPVWQPQRIKKDTETLTQLRECDADVFVVVAYGQILSPEILDMPKLGCVNVHGSILPKYRGAAPIQWCLYNGETETGITTMLMDAGMDTGAMLLKATTPIALLDNAQDLAQRLCVIGGDLLVETLFKLENREIAPVPQDEAEATYAPLIQKHNYTLDWSKSAIQLHNQIRGF--YPNCTATFRDQGIKIIASVPLGDAYGYEPTPELTEIYQKLPELSTISGSPGQVVSIAKGIGAIAQTGEGLLLLREVQLAGKRPQSGWDFVNGN 322
>gi|167628042|ref|YP_001678542.1| methionyl-tRNA formyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|189044511|sp|B0U0T8|FMT_FRAP2 Methionyl-tRNA formyltransferase >gi|167598043|gb|ABZ88041.1| methionyl-tRNA formyltransferase [Francisella philomiragia subsp. philomiragia ATCC 25017] (312 aa)
Score = 457, Expect = 1.1e-43, Identities = 104/299 (34%), Positives = 169/299 (56%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K   IVF GTP+I+   L  L +   ++ AV+ QPD+  GR K+I FS VK++AI  N    QP   K   ++  +++EL P   V  A+G  +P   L IP++GC+NIH SLLPK+RG API  A+  G+ +TG+C+M+    +D GD+  + +V I+++DT+ +L  K   L    +L  LE +  ++  P    + + ++A+ I+K +  I+F K+A EI   IR  +  P A+  +  +++K+         +N+    I +I+K G  I+T D  I  K++Q   K    + +ILNG
  S:     2 KKLNIVFAGTPDISAQVLKDLYQSQHNIQAVLTQPDRAKGRGKKIQFSPVKEVAIANNTLVLQPLSFKKDPQVLEQIRELKPDVIVVIAYGIIVPQEFLDIPKYGCLNIHVSLLPKWRGAAPIQRAIQAGDSKTGICIMQMDAGLDTGDILNTLEVEIQDTDTSQSLHDKFAKLSIKPLLETLENIDTIKPQP---QQGEPTYAHKITKQEGLIDFTKSAKEISCHIRAFTPWPSAFFMLEGEQVKVGDFEILEKSANDEVTAIIDITKNGFDIATNDKIIRFKQLQFPNKKMLNIADILNG 300
>gi|117923459|ref|YP_864076.1| methionyl-tRNA formyltransferase [Magnetococcus sp. MC-1] >gi|117607215|gb|ABK42670.1| methionyl-tRNA formyltransferase [Magnetococcus sp. MC-1] (312 aa)
Score = 457, Expect = 1.2e-43, Identities = 98/297 (32%), Positives = 165/297 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           ++VFMGTP+ AT  L ALL+    VVAV  QPDKP+GR  ++  + VK+LA +  I  +QPN+++E E    L+ L P   V  A+GQ +   +L IP  GCIN+HASLLP++RG API  A++ G+ ++GV +M   + +D G +Y +   +I+   T   L  ++      +++  L ++ +    P  Q E  V++A  + K++  +++ + A++I   ++     P A+     K +KLF A  +    +  PG +  + K+G +++  D  + V +VQ  GK R      L G+
  S:     5 RVVFMGTPDFATGTLQALLDGPDTVVAVFTQPDKPVGRGMKMQKTPVKQLAEQHGIPVYQPNRLREAEAVTALRALRPDVVVVVAYGQILSREVLEIPTHGCINVHASLLPRWRGAAPIQRAILAGDAQSGVTIMAMEEGLDTGPMYSTVVQSIDNHTTGGQLHDQLMAAGGGLLVETLARIKHEGLTPQIQPEQGVTYAAKLKKEEGLVDWSQPAIQIQRAVQAFDPWPCAFTLWQGKPLKLFAA--SVVVGHGTPGEVIEVEKDGFVVACGDGALRVAQVQAAGKKRMSSGEWLRGH 301
>gi|50122920|ref|YP_052087.1| methionyl-tRNA formyltransferase [Pectobacterium atrosepticum SCRI1043] >gi|73919392|sp|Q6D001|FMT_ERWCT Methionyl-tRNA formyltransferase >gi|49613446|emb|CAG76897.1| methionyl-tRNA formyltransferase [Erwinia carotovora subsp. atroseptica SCRI1043] (315 aa)
Score = 457, Expect = 1.2e-43, Identities = 98/299 (32%), Positives = 168/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+ LL    +VV V  QPD+P GR  ++  S VK LA + +I  FQP  ++  EN+  ++ L+    V  A+G  +P  +LS+P  GCIN+H SLLP +RG API  A+  G+ ETGV +M+    +D G +       I   DT++TL+ K+  L    +L  LE++ +       Q+++  ++A  +SK++ ++N+  +A ++   IR  +  P +Y  ++++ +K++KA        + PGTI    K+GI ++  D  + ++E+Q  GK     +++LN   E
  S:     6 RIIFAGTPDFAARHLDVLLSSGHEVVGVFTQPDRPAGRGNKLTPSPVKVLAEQHSIPVFQPKSLRPAENQAMVEALDADVMVVVAYGLILPQPVLSMPRLGCINVHGSLLPLWRGAAPIQRALWAGDSETGVTIMQMDVGLDTGAMLHKIACPILPQDTSATLYDKLAALGPRGLLETLERLADSSAVAEAQNDAFATYAEKLSKEEARLNWLLSAEQLERCIRAFNPWPVSYFIVDEQPVKVWKAEVIAKSHGSQPGTILQADKQGIQVAAADGILNIQELQPAGKKVMSAQDLLNSRRE 306
>gi|52426257|ref|YP_089394.1| methionyl-tRNA formyltransferase [Mannheimia succiniciproducens MBEL55E] >gi|52308309|gb|AAU38809.1| Fmt protein [Mannheimia succiniciproducens MBEL55E] (318 aa)
Score = 457, Expect = 1.3e-43, Identities = 97/302 (32%), Positives = 182/302 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPF--AFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  KI+F GTP+ A   L ALL     V+AV  QPDKP GR K++  S VK+LA + NI  +QP  +++ E + +         V  A+G  +P ++L +P  GC+N+H S+LP++RG API  A+  G+K+TGV +M+  + +D GD+      +I   +T+++L+ K+  L    +++ L+++ + ++   KQ++SK ++A  +SK++ K+++  +A ++   IR  +  P A+  +     ++++K+++A       N+A GT+    K+G+ I+T +  + ++++Q  GK    V++ LNG ++
  S:     3 KPLKIIFAGTPDFAAQHLQALLNSHHQVIAVYTQPDKPAGRGKKLQASPVKQLAEQYNIPVYQPKSLRKEEAQAQFAQLQADVMVVVAYGLILPKAVLEMPRLGCLNVHGSILPRWRGAAPIQRAIWAGDKQTGVTIMQMDEGLDTGDMLHKVYCDITAEETSASLYHKLATLAPPALIDVLDELESGKFIAEKQEDSKSNYAEKLSKEEAKLDWSLSAAQLERNIRAFNPAPVAFLTVPVNEAEERIKVYRA-EVLPHQNSAAGTVLAFDKKGLRIATAEGVLNIQQLQPSGKKPMSVQDFLNGRAD 309
>gi|73919404|sp|Q65QF1|FMT_MANSM Methionyl-tRNA formyltransferase (317 aa)
Score = 456, Expect = 1.3e-43, Identities = 97/302 (32%), Positives = 182/302 (60%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPF--AFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K  KI+F GTP+ A   L ALL     V+AV  QPDKP GR K++  S VK+LA + NI  +QP  +++ E + +         V  A+G  +P ++L +P  GC+N+H S+LP++RG API  A+  G+K+TGV +M+  + +D GD+      +I   +T+++L+ K+  L    +++ L+++ + ++   KQ++SK ++A  +SK++ K+++  +A ++   IR  +  P A+  +     ++++K+++A       N+A GT+    K+G+ I+T +  + ++++Q  GK    V++ LNG ++
  S:     2 KPLKIIFAGTPDFAAQHLQALLNSHHQVIAVYTQPDKPAGRGKKLQASPVKQLAEQYNIPVYQPKSLRKEEAQAQFAQLQADVMVVVAYGLILPKAVLEMPRLGCLNVHGSILPRWRGAAPIQRAIWAGDKQTGVTIMQMDEGLDTGDMLHKVYCDITAEETSASLYHKLATLAPPALIDVLDELESGKFIAEKQEDSKSNYAEKLSKEEAKLDWSLSAAQLERNIRAFNPAPVAFLTVPVNEAEERIKVYRA-EVLPHQNSAAGTVLAFDKKGLRIATAEGVLNIQQLQPSGKKPMSVQDFLNGRAD 308
>gi|126668177|ref|ZP_01739138.1| methionyl-tRNA formyltransferase [Marinobacter sp. ELB17] >gi|126627326|gb|EAZ97962.1| methionyl-tRNA formyltransferase [Marinobacter sp. ELB17] (343 aa)
Score = 456, Expect = 1.3e-43, Identities = 104/309 (33%), Positives = 176/309 (56%)
  Q:     3 EKRNSCKNK-KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPN--KIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNN-----APGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           EK N   N  +IVF GTP+ A  AL ALL   ++VV V  QPD+P GR ++++   VK+ A++  I  FQP+  K+++   +L  L P   +  A+G  +P S+LSIP  GC+NIHASLLP++RG API  A+  G+ E+G+ +M+  + +D G +       I   DT  +L  ++ +L  + ++  L+ +      P  Q   +  +A+ ++K + +I++  +A  I  LIR  +  PG +  + D++++L  A +   K        +PGT+    +EGI I+  +  + V +VQ+ G   Q V +++NG  +I
  S:    19 EKSNREPNTVRIVFAGTPDFAATALKALLAAKYNVVGVYSQPDRPAGRGRKLLQGPVKQAALDAGIAVFQPDNFKMEDARQQLAGLQPDVMIVAAYGLILPASVLSIPVHGCLNIHASLLPRWRGAAPIQRAIAAGDPESGITIMQMDEGLDTGAMLLKVSTPIHPEDTGGSLHDRLADLGGEAIVGALQLLEQNTLKPQAQQNEQACYAHKLAKQEGQIDWHGDAQSIERLIRAFNPWPGTFTDLGDQRIRLHLAQAQKHKQEQSGKKASPGTVLARQREGIDIACGEGVLRVSQVQLPGARAQSVNDLINGGKQI 335
>gi|163743816|ref|ZP_02151189.1| methionyl-tRNA formyltransferase [Phaeobacter gallaeciensis 2.10] >gi|161382965|gb|EDQ07361.1| methionyl-tRNA formyltransferase [Phaeobacter gallaeciensis 2.10] (301 aa)
Score = 456, Expect = 1.4e-43, Identities = 98/296 (33%), Positives = 166/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTP+ +   L+AL+E   D+ AV CQP +P GR K+   + V   A     +   P  +K+ +   E   LN    V  A+G  +P ++L  P  GC+NIHASLLP++RG APIH A++ G+ +TGVC+M+    +D G V      +I   +TT+ L  +++ +  ++++  L ++ NL   P+ Q +  V++A+ I K + ++++ + AVE+   IRGLS  PGA+C I+ +++KL       S+  +  G    +  + + I+  +  + +  +Q  GK  QE +  L G
  S:     2 RIVFMGTPDFSVPVLDALVEAGHDIAAVYCQPPRPAGRGKKDRPTPVHARAEALGFEVRHPVSLKDAQQQAEFAALNADVAVVVAYGLILPQAVLDAPRQGCLNIHASLLPRWRGAAPIHRAIMAGDAQTGVCIMQMEAGLDTGPVLMREATDIGAEETTAQLHDRLSEMGAELIVQALTQLTNLT--PVVQPDDGVTYAHKIEKAEARVDWTRPAVEVDQQIRGLSPFPGAWCEIDGQRVKLLA-----SRVVDGAGVAGRVLDDSLRIACGEGAVELLRLQRAGKGAQEREIFLRG 292
>gi|88705379|ref|ZP_01103090.1| Methionyl-tRNA formyltransferase [gamma proteobacterium KT 71] >gi|88700469|gb|EAQ97577.1| Methionyl-tRNA formyltransferase [Congregibacter litoralis KT71] (319 aa)
Score = 456, Expect = 1.6e-43, Identities = 94/300 (31%), Positives = 168/300 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           ++ F GTP+ A   L+AL+    D+ AV+ QPD+P GR K+   S VK LA   ++   QP  +++ E   E++ELN  A +  A+G  +P S+L +P  GC+N+H SLLP++RG API  A+  G+ E+GV +M     +D G +       I    +++ L++++  +   ++L  L+ +  L      Q++ +  +A  ISKD+  I++ + A  +   IR  +  PG Y F++ +++K++ A S  S S   PGTI   S+ GI +   D  ++++ +Q+ G    + +++L G+  +
  S:     5 RLAFAGTPDFAARHLDALIHSPHDLQAVLTQPDRPAGRGKKDRASPVKVLAETHDLPLLQPASLRDPEAVAEIQELNLDALIVVAYGLILPQSVLDLPRCGCLNVHGSLLPRWRGAAPIQRAIEAGDAESGVTIMLMDAGLDTGPMLAKGLCPITAHTSSADLYEELATIGPSLLLEVLDDLPALLSAATVQEDDEACYAAKISKDEALIDWTQPAAVVARRIRAFNPAPGCYSFLDGQRVKVWAAQSATSPSTVPPGTILKSSEHGIAVRCGDGAVILERLQMAGSKAMDARDLLRGHGAL 306
>gi|86141625|ref|ZP_01060171.1| methionyl-tRNA formyltransferase [Flavobacterium sp. MED217] >gi|85832184|gb|EAQ50639.1| methionyl-tRNA formyltransferase [Leeuwenhoekiella blandensis MED217] (321 aa)
Score = 456, Expect = 1.6e-43, Identities = 103/299 (34%), Positives = 179/299 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYP-PIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYC-FIN----DKKMKLFKAVSTNSKSNNAPGTIN----NISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++ +IVFMGTP+ A   L  L+E   +VV V+  PD+P GR ++I  S+VKK A+  ++   QP  +K  E  +ELK LN    +  AF + +P  +  +PEFG  N+HASLLP YRG API+WA+I G +ETGV      +++D G +    K+ I   +   +L  ++ +L  D++L  ++ +   E    ++  + ++  AY +++++ KI++ K    I N IRGLS  P A+  F N    ++++K++KA  T+++ +   G        +  + + ++T++  + + E+Q+ GK R  VK++LNG
  S:     2 RDLRIVFMGTPDFAVAGLQKLVENKLNVVGVITAPDRPAGRGQKIQQSAVKKFALAHDLPVLQPTNLKAEEFLSELKALNANLQIVVAF-RMLPQQVWQMPEFGTFNLHASLLPDYRGAAPINWAIIKGAQETGVTTFFIDEKIDTGAIIFQEKLKIAPDENAGSLHDRLMHLGSDLILKTVKAIEQGEVATTVQPKQEQLHTAYKLTRENTKIDWSKPVEAIYNHIRGLSPYPVAWTHFTNGDAKEQQLKVYKATITSAEQSQELGKEPIGKLKVFNDQLFVATENNWLRLDEIQLSGKKRMPVKDLLNG 311
>gi|114773490|ref|ZP_01450627.1| methionyl-tRNA formyltransferase [alpha proteobacterium HTCC2255] (329 aa)
Score = 456, Expect = 1.6e-43, Identities = 108/297 (36%), Positives = 170/297 (57%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNN-----LVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           IVF GTPE A   L ALL    ++V V  QPD+P GR K++  S+VK LAIE N+  FQP   ++   ++EL  LN    V  A+G  +P  +L  P  GCIN+H SLLP++RG API  A+  G+  TGV +M+    +D G +     + I  SDT+++L++K+       LV+  VL+D        + P  Q++   ++A  +SKD+  IN+   A ++   +R  +  P A+  + D++     +K++ A V T   S ++PGTI    K G+ I+T    +++ + QI GK    + +ILN  +
  S:     7 IVFAGTPEFAADHLAALLNTDHNIVGVYTQPDRPAGRGKKLTPSAVKCLAIEHNLPVFQPASFRDESTQSELAALNADLMVVVAYGLLLPQIVLDTPRLGCINVHGSLLPRWRGAAPIQRALWAGDSVTGVTIMQMDIGLDTGAMLYKTNLPILASDTSASLYQKLAKQGPEALVH--VLSDFSA-----FTPEAQNDDAANYAKKLSKDEAHINWYVPAEQLERNVRAFNPWPMAFFTVEDEQGKQQNVKVWTAHVDTTLSSAHSPGTIIKADKTGLYIATSQGALVITQCQIPGKKALPISDILNARA 309
>gi|15828516|ref|NP_325876.1| methionyl-tRNA formyltransferase [Mycoplasma pulmonis UAB CTIP] >gi|21542053|sp|Q98RG4|FMT_MYCPU Methionyl-tRNA formyltransferase >gi|14089458|emb|CAC13218.1| METHIONYL-TRNA FORMYLTRANSFERASE [Mycoplasma pulmonis] (289 aa)
Score = 455, Expect = 1.8e-43, Identities = 106/300 (35%), Positives = 177/300 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAV-EIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVK-NILNGNSEI 311
           K++  GTPE +      L++K F++VA++ QPDKP  R   +  S VKKLA + +IK + P KI  I +++K+L    F+T A+GQ+IP+ IL++P+   +N+H SLLPKYRG API  A++NG+ ETG+ L+   K+MDAG++    K+ +  ++    LF +M+ +    ++  LE+++  ++  I QDE KVS +  + K+D  +  +K +V + +N +R  S  PGAY   + K++K+F+A ++             + K   ++  +   I   E Q EGK R ++  N+L  NS I
  S:     2 KLLLAGTPEFSVPIFEELIKK-FEIVAIITQPDKPKNRGYSLEASPVKKLAQKYDIKVYDPEKISTIYDQIKDLEFDFFLTAAYGQYIPEKILNLPKIASLNVHGSLLPKYRGAAPIQHALLNGDDETGISLIYMTKKMDAGNILKIAKIKLNGNENADDLFLQMSKIASKNIVLWLEQIYQKDFSEIVQDEEKVSLSPKLLKEDALLEVDKLSVKDFINKVRAFSLNPGAYLIKDGKRVKIFRATTS-------------LVKNAFVVEVQGQKIYCYEYQFEGKKRVKLNFNLLFFNSVI 289
>gi|170719273|ref|YP_001746961.1| methionyl-tRNA formyltransferase [Pseudomonas putida W619] >gi|169757276|gb|ACA70592.1| methionyl-tRNA formyltransferase [Pseudomonas putida W619] (310 aa)
Score = 454, Expect = 2.2e-43, Identities = 99/299 (33%), Positives = 166/299 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTPE A   L ALL+  +++VAV  QPD+P GR ++++ S+VK LA+  +I  FQP  ++  + + EL  L P   V  A+G  +P  +L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  +L  ++  +    V+  +  + +       QD++  ++A+ ++KD+ +I++ + AVE+  LIR  +  P  +  ++ + +K+  A    S    APG I + SK+G++++  D  + +  +Q+ G       ++ N   E
  S:     2 RIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMPSAVKALAVAHDIPVFQPPTLRNEDAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISADDTGGSLHDRLAAMGPAAVVQAIAGLADGSLQGEVQDDALATYAHKLNKDEARIDWSRPAVELERLIRAFNPWPVCHSTLDGESVKVLAA--KLSTGEGAPGEILSASKDGLVVACGDQALSLTRLQLPGGKALAFTDLFNSRRE 300
>gi|91791392|ref|YP_561043.1| methionyl-tRNA formyltransferase [Shewanella denitrificans OS217] >gi|123061400|sp|Q12TA6|FMT_SHEDO Methionyl-tRNA formyltransferase >gi|91713394|gb|ABE53320.1| methionyl-tRNA formyltransferase [Shewanella denitrificans OS217] (319 aa)
Score = 454, Expect = 2.2e-43, Identities = 100/298 (33%), Positives = 173/298 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA-PGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           I+F GTP+ A   L ALL+   +V+AV  QPD+P GR K++  S VK+LA+  +I  FQP  ++ +E   EL  LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  A+  G+ ETGV +M+    +D GD+     + IE++DT+++L++K+       +L  L+ +   +     QD +  ++A  +SK++ ++++ K+A ++   IR  +  P +Y    D  +K+++A S N + N+A  G+I    K  I ++T +  + ++ +Q+  K    V +ILN  ++
  S:     6 IIFAGTPDFAARHLQALLDSEHNVIAVYSQPDRPAGRGKKLSASPVKELALSHDIPVFQPASLRAVEAQAELATLNADIMVVVAYGLILPQIVLDTPRLGCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDLGLDTGDMLLKTSLPIEDADTSASLYEKLAVQGPQALLEALDGLNAGKLKGEPQDPALANYAEKLSKEEARLDWNKSAKQLWQEIRAFNPWPVSYFEYQDSTIKVWQA-SYNPQPNSALAGSIIKADKHSIEVATAEGSLQLEIIQLPNKKPLAVADILNSRAD 305
>gi|88714206|ref|ZP_01108282.1| methionyl-tRNA formyltransferase [Flavobacteriales bacterium HTCC2170] >gi|88707469|gb|EAQ99713.1| methionyl-tRNA formyltransferase [Flavobacteriales bacterium HTCC2170] (322 aa)
Score = 454, Expect = 2.4e-43, Identities = 112/302 (37%), Positives = 174/302 (57%)
  Q:     6 NSCKNKK----IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDES-KVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINN---ISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           N+  NKK    IVFMGTPE A   L+ L++  +DVV V+  PDKP GR ++I  S+VKK A  K +   QP  +K  +   EL  LN    +  AF + +P ++  +P++G  N+HASLLP YRG API+WA+INGE ETGV       ++D G++    K+ I   D+   L  K+ +L  D+V+   +++ N      KQ  S ++  A  I K+  KI++ K   +I N IRGLS  PG++  + +   ++F  +   +K     G  N      K+ + ++ KD  I + E+Q+ GK R +++++LNG
  S:     2 NTSLNKKDKLRIVFMGTPEFAVTILDKLIQNDYDVVGVITSPDKPAGRGRKINKSAVKKYAESKGLNIIQPANLKAEDFLEELAALNANLQIVVAF-RMLPRAVWEMPKYGTFNLHASLLPDYRGAAPINWAIINGETETGVTTFFIDDKIDTGEMVLQEKIGIGADDSAGDLHDKLMHLGADLVMETAKQIQNGNVVRTKQTFSDELRSAPKIHKNTCKIDWGKPGSQIYNHIRGLSPYPGSWTTLTNDGEEIFIKIYKVTKEEEKHGYNNGQIIFGKKEMKVAVKDGFINLLEIQLPGKRRMDIRDVLNG 312
>gi|167772293|ref|ZP_02444346.1| hypothetical protein ANACOL_03670 [Anaerotruncus colihominis DSM 17241] >gi|167665396|gb|EDS09526.1| hypothetical protein ANACOL_03670 [Anaerotruncus colihominis DSM 17241] (306 aa)
Score = 454, Expect = 2.6e-43, Identities = 97/299 (32%), Positives = 165/299 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVFMGTPE A   L+ L+     V  V  QPDKP GR  +++   VK  A+E  +  +QP K+++ +    LKEL+P   V  A+G+ +P  IL +P  GC+N+H SLLPKYRG API W+V+NG++  GV  M   + +D GD+   R+  +   +T+  L+ ++  L    +   +  +     P + QD +  + A  ++K+  +I++ K A E+ NLIRG++  P A+  ++ + +K++++         APGT+      G +++     + + E+Q  GK R    + L G+ +
  S:     2 RIVFMGTPEFAVPCLSRLISDGHAVAGVFTQPDKPQGRGYKLMPPPVKVCALENGLSVYQPAKMRDGQALALLKELSPELIVVVAYGKILPPDILELPPLGCVNVHGSLLPKYRGAAPIQWSVLNGDRTAGVTTMYMAEGLDTGDMILKRETPLGPDETSGELYGRLAGLGAQALSETVRLIGEGCAPRVPQDGALATHAPMLTKELARIDWTKPAAEVHNLIRGMNPWPVAHTSLDGRPLKVYRS-RLAPDGTGAPGTL--AKSGGFVVACGQGAVELLEIQEAGKKRMAAADYLRGHPD 299
>gi|71905664|ref|YP_283251.1| methionyl-tRNA formyltransferase [Dechloromonas aromatica RCB] >gi|123747051|sp|Q47K50|FMT_DECAR Methionyl-tRNA formyltransferase >gi|71845285|gb|AAZ44781.1| methionyl-tRNA formyltransferase [Dechloromonas aromatica RCB] (307 aa)
Score = 453, Expect = 3.1e-43, Identities = 103/297 (34%), Positives = 159/297 (53%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           K++F GTPE A  AL  ++    +V  V+ QPD+P GR   +  S+VKK+A+   I+ FQP  +K+ E +  +  +     V  A+G  +P  +L +P FGCINIH SLLP++RG API  A++ G+ ETGVC+M+    +D G V       I  +DTT+TL  ++  L   +V+  L K   L  P   Q    V++A  I K +  I++ K+A E+   IR  +  PGA      + +KL++A     +     G I  + K  I+I+  +  + V E+Q  G  R  V+  L G+
  S:     2 KLIFAGTPEFAAQALQGIVNAGHEVALVLTQPDRPAGRGMALQPSAVKKVALTHGIEVFQPLTLKDAEAQARIAAVGAEIMVVAAYGLILPQVVLDMPRFGCINIHGSLLPRWRGAAPIQRALLAGDAETGVCIMQMEAGLDTGPVLLRGAFPIAATDTTATLHDRLAELGARLVVEALGK---LPLPAEPQPADGVTYAQKIEKAEAMIDWSKSAAELDRHIRAFNPFPGAQALFRGQTVKLWQASPVAGRGET--GAILAVDKNSIIIACGEGALAVTELQKAGGKRLPVQQFLAGH 295
>gi|154497981|ref|ZP_02036359.1| hypothetical protein BACCAP_01961 [Bacteroides capillosus ATCC 29799] >gi|150272971|gb|EDN00128.1| hypothetical protein BACCAP_01961 [Bacteroides capillosus ATCC 29799] (311 aa)
Score = 453, Expect = 3.6e-43, Identities = 98/297 (32%), Positives = 170/297 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGR-KKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYC-FINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNGN 308
           +I+FMGTPE A  +L AL+    +V  V  QPDKP+GR + ++  + +K+ A+  NI  FQP K+++     +++ L P   V  A+G+ +PD IL+ P  GCIN+H+SLLPKYRG API+WAVING+  +GV +M    ++DAGD+       I   +T   L+++++ L  D+++  +  +         Q+  + + A  + K+   +++ + A  +   +RGL   P A    +  + +K+++   T  K+   PGT+    K+GI ++  +  +L + E+Q  GK R +  + L G+
  S:     2 RILFMGTPEFAVPSLEALVAAGHEVCGVFSQPDKPVGRHQNKLQPTPIKECALAHNIPVFQPVKMRDGTALAQIQALVPELIVVAAYGRILPDDILACPPKGCINVHSSLLPKYRGAAPINWAVINGDTVSGVTIMHMATELDAGDIIAQESTEIGPDETAEELYRRLSILGADLLVQAVSAIEAGLAQRTPQNGEEATLAPMLGKELSPMDWSRTAHALHCQVRGLLPWPVASTDKLTGENIKVYRTEETGDKTQAQPGTVLAAGKQGIDVACGEGSVLRITELQAPGKKRMKAADYLRGH 303
>gi|152990973|ref|YP_001356695.1| methionyl-tRNA formyltransferase [Nitratiruptor sp. SB155-2] >gi|151422834|dbj|BAF70338.1| methionyl-tRNA formyltransferase [Nitratiruptor sp. SB155-2] (302 aa)
Score = 452, Expect = 3.8e-43, Identities = 120/306 (39%), Positives = 167/306 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKN--IKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +IVFMGTP+ AT  L  LLEK F+VV V  QPDKP+GRK+ +    VKK  IEKN  I  FQP+ +K  E+  +L  L P   V  A+GQ +P  IL +    CIN+HASLLPKYRG +PI  A++NG+  TGV  M   + +D GD+     ++I+ SD   TLF+K+++L  ++    L+   N+   PI Q +   S+   I K D +I F    V I N  R     PG +   N  K+K    V T+  + +  G I  IS  G+++  +   I +K VQ   K   E    L G   +K+G T 
  S:     2 RIVFMGTPDYATTILEGLLEK-FEVVGVFTQPDKPVGRKQVVTPPHVKKFLIEKNVDIPIFQPSTLKSEEVYEQLHTLAPDFIVVAAYGQILPKEILQLAP--CINLHASLLPKYRGASPIQHALLNGDTVTGVTAMLMDEGLDTGDILAYDVIDIQNSDNAITLFEKLSHLAKELTPKVLQSFENI--APIAQHDVDASYCKKIRKQDGQIRFSDAKV-IWNKYRAFIVWPGIF-LENGLKLKEIDLVETD--NTHEEGKILEISDAGVVVGCRRGSICIKSVQPPSKKAMEAVAYLRGK-RLKVGDTF 301
>gi|16120579|ref|NP_403892.1| methionyl-tRNA formyltransferase [Yersinia pestis CO92] >gi|22127892|ref|NP_671315.1| methionyl-tRNA formyltransferase [Yersinia pestis KIM] >gi|45440099|ref|NP_991638.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|51597956|ref|YP_072147.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis IP 32953] >gi|108809223|ref|YP_653139.1| methionyl-tRNA formyltransferase [Yersinia pestis Antiqua] >gi|108813988|ref|YP_649755.1| methionyl-tRNA formyltransferase [Yersinia pestis Nepal516] >gi|145597482|ref|YP_001161557.1| methionyl-tRNA formyltransferase [Yersinia pestis Pestoides F] >gi|150260711|ref|ZP_01917439.1| methionyl-tRNA formyltransferase [Yersinia pestis CA88-4125] >gi|153948316|ref|YP_001402831.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis IP 31758] >gi|162419460|ref|YP_001605205.1| methionyl-tRNA formyltransferase [Yersinia pestis Angola] >gi|165927879|ref|ZP_02223711.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936425|ref|ZP_02224993.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Orientalis str. IP275] >gi|166010576|ref|ZP_02231474.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166213335|ref|ZP_02239370.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398510|ref|ZP_02304034.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167418935|ref|ZP_02310688.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167425625|ref|ZP_02317378.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167468245|ref|ZP_02332949.1| methionyl-tRNA formyltransferase [Yersinia pestis FV-1] >gi|170022576|ref|YP_001719081.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis YPIII] >gi|186897152|ref|YP_001874264.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis PB1/+] >gi|123072597|sp|Q1C2X8|FMT_YERPA Methionyl-tRNA formyltransferase >gi|123246111|sp|Q1CCX5|FMT_YERPN Methionyl-tRNA formyltransferase >gi|166215599|sp|A4TH22|FMT_YERPP Methionyl-tRNA formyltransferase >gi|166988372|sp|A7FNK3|FMT_YERP3 Methionyl-tRNA formyltransferase >gi|21542047|sp|Q8ZJ80|FMT_YERPE Methionyl-tRNA formyltransferase >gi|73919429|sp|Q664V3|FMT_YERPS Methionyl-tRNA formyltransferase >gi|21961029|gb|AAM87566.1|AE014004_4 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Yersinia pestis KIM] >gi|45434954|gb|AAS60515.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Microtus str. 91001] >gi|51591238|emb|CAH22904.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis IP 32953] >gi|108777636|gb|ABG20155.1| methionyl-tRNA formyltransferase [Yersinia pestis Nepal516] >gi|108781136|gb|ABG15194.1| methionyl-tRNA formyltransferase [Yersinia pestis Antiqua] >gi|115346058|emb|CAL18924.1| methionyl-tRNA formyltransferase [Yersinia pestis CO92] >gi|145209178|gb|ABP38585.1| methionyl-tRNA formyltransferase [Yersinia pestis Pestoides F] >gi|149290119|gb|EDM40196.1| methionyl-tRNA formyltransferase [Yersinia pestis CA88-4125] >gi|152959811|gb|ABS47272.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis IP 31758] >gi|162352275|gb|ABX86223.1| methionyl-tRNA formyltransferase [Yersinia pestis Angola] >gi|165915541|gb|EDR34150.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Orientalis str. IP275] >gi|165920155|gb|EDR37456.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165990666|gb|EDR42967.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166205633|gb|EDR50113.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166962929|gb|EDR58950.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051014|gb|EDR62422.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167055315|gb|EDR65109.1| methionyl-tRNA formyltransferase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749110|gb|ACA66628.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis YPIII] >gi|186700178|gb|ACC90807.1| methionyl-tRNA formyltransferase [Yersinia pseudotuberculosis PB1/+] (315 aa)
Score = 452, Expect = 3.8e-43, Identities = 95/299 (31%), Positives = 170/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L ALL     +V V  QPD+P GR  ++  S VK LA    I  FQP  ++  EN+  + +LN    V  A+G  +P ++L++P  GCIN+H SLLP++RG API  +V  G+++TG+ +M+    +D G +    +  I+  DT++TL+ K+  L    +L  L+++         Q+E++ ++A  +SK++ K+++  +A ++   IR  +  P +Y  ++++ +K+++A    +  +  PGTI +  K GI ++T D  + + ++Q  GK      ++LN   E
  S:     6 RIIFAGTPDFAARHLGALLSSQHKIVGVFTQPDRPAGRGNKLTPSPVKILAEHHGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPAAVLAMPRLGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIMQMDIGLDTGAMLHKIECAIQPEDTSATLYDKLAQLGPQGLLITLQQLAAGTALAEVQNETQATYAEKLSKEEAKLDWTLSATQLERCIRAFNPWPVSYFIVDEQPIKVWQAQVLPAGEDAEPGTIIHADKHGIQVATADGVLNITQLQPAGKKAMSAADLLNSRRE 306
>gi|163738222|ref|ZP_02145638.1| methionyl-tRNA formyltransferase [Phaeobacter gallaeciensis BS107] >gi|161388838|gb|EDQ13191.1| methionyl-tRNA formyltransferase [Phaeobacter gallaeciensis BS107] (301 aa)
Score = 452, Expect = 3.9e-43, Identities = 97/296 (32%), Positives = 166/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMGTP+ +   L+AL+E   D+ AV CQP +P GR K+   + V   A     +   P  +K+ +   E   LN    V  A+G  +P ++L  P  GC+NIHASLLP++RG APIH A++ G+ +TGVC+M+    +D G V      +I   +TT+ L  +++ +  ++++  L ++  L   P+ Q +  V++A+ I K + ++++ + AVE+   IRGLS  PGA+C I+ +++KL       S+  +  G    +  + + I+  +  + + ++Q  GK  QE +  L G
  S:     2 RIVFMGTPDFSVPVLDALVEAGHDIAAVYCQPPRPAGRGKKDRPTPVHARAEALGFEVRHPVSLKDAQQQAEFAALNADVAVVVAYGLILPQAVLDAPRQGCLNIHASLLPRWRGAAPIHRAIMAGDAQTGVCIMQMEAGLDTGPVLMREATDIGAEETTAQLHDRLSEMGAELIVQALTQLTKLT--PVVQPDDGVTYAHKIDKSEARVDWTRPAVEVDQQIRGLSPFPGAWCEIDGQRVKLLA-----SRVVDGAGAAGRVLDDSLRIACGEGAVELLKLQRAGKGAQEREIFLRG 292
>gi|163744869|ref|ZP_02152229.1| methionyl-tRNA formyltransferase [Oceanibulbus indolifex HEL-45] >gi|161381687|gb|EDQ06096.1| methionyl-tRNA formyltransferase [Oceanibulbus indolifex HEL-45] (304 aa)
Score = 452, Expect = 4.5e-43, Identities = 101/306 (33%), Positives = 173/306 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +++FMGTPE +   L+AL++   D+ AV CQP +P GR K+   S V++ A E  +    P  +K  E + E  EL+  A V  A+G  +P  IL  P+ GC+NIHASLLP++RG APIH A++ G+++TGVC+M+    +D G V    + +I  ++TT+ L  +++ +    +   L ++  L   P  Q E  V++A  I K + +I++ + AVE+  LIRGLS  PGA+  ++ +++K+  +V      +   G    +  + + ++  D  + +  +Q  GK  Q+V ++    ++I  G  L
  S:     2 RLIFMGTPEFSVPVLDALVQAGHDICAVYCQPPRPAGRGKKPRPSPVQQRAEEIGLLVRHPASLKHPEPQEEFSELDADAAVVVAYGLILPQVILDAPKQGCLNIHASLLPRWRGAAPIHRAIMAGDEKTGVCIMQMEAGLDTGPVLLCEETDIGAAETTAQLHDRLSAMGAVAINKALSQLLTLT--PQPQPEEGVTYAAKIDKAEARIDWARPAVEVDRLIRGLSPFPGAWFEVDGQRVKVLGSV-----LDEGTGAAGEVLSDDLRVACGDGAVRLTRLQRAGKGVQDV-DVFQRGAQIATGTNL 301
>gi|119896392|ref|YP_931605.1| methionyl-tRNA formyltransferase [Azoarcus sp. BH72] >gi|119668805|emb|CAL92718.1| Fmt protein [Azoarcus sp. BH72] (321 aa)
Score = 451, Expect = 5.1e-43, Identities = 99/296 (33%), Positives = 160/296 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++ F GTPE A  AL A+L+  + V  V+ QPD+P GR  ++  S VK+LA+ + +   QP K++  E    L    P   V  A+G  +P ++L +P +GCINIHASLLP++RG APIH AV  G+ ETG+ +M+  + +D GD+   R + I   DTT TL  K+  L  + ++  L  +         Q  + V++A  I +D+  I++ + A +I   +R  +  P A   + D  +K++ A V      + APGT+     EG++++     + ++E+Q  G  R      L G
  S:     6 RVAFAGTPEFAASALAAILDAGYSVPLVLTQPDRPAGRGMKLTPSPVKQLALARGLDVDQPEKLRTDEQRQRLAACEPDVLVVAAYGLILPAAVLQLPRYGCINIHASLLPRWRGAAPIHRAVEAGDAETGITIMQMDEGLDTGDMLLRRAIPIRPDDTTGTLHDKLAALGAECIVEALAALPGGTLSRTPQPAAGVTYANKIHRDEAAIDWTRPAADIERAVRAFNPFPVAVGSLRDTVIKVWAAEVVAVPAPDAAPGTVLAADAEGVVVACGAQALRLRELQRPGSRRFAAGEFLRG 304
>gi|169837911|ref|ZP_02871099.1| Methionyl-tRNA formyltransferase [candidate division TM7 single-cell isolate TM7a] (309 aa)
Score = 451, Expect = 5.7e-43, Identities = 112/294 (38%), Positives = 175/294 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK--KMKLFKAVSTNSKSNNAPGT-------INNISKEGILISTKDFDILVKEVQIEGKNRQEVKNIL 305
           K +FMGTPE A  +L  +  K+ D+  +  + DK   R  +IIFS VK+  I+ N++  QP K+K  E+ N++KE+NP   V  A+G+ +P  I+ IP++G IN+H+SLLPKYRG +PIH A++NG+ ETGV +M   + +D+GDV       I E DT  TL  K+  L  D +   L+ + N E    KQD+SK +    I+K+  +I++      I N IRGL+  P AY F N+K   +K++K+   + K  +  G        +  I+K+G ++   +  +L+ E + EGK  Q   +I+
  S:     2 KTIFMGTPEFAIPSLEVIF-KNTDLQLIFTKEDKRNARGNKIIFSPVKQFGIDNNVEIIQPRKMKDEEVINKIKEINPDLIVVVAYGKILPKEIIDIPKYGIINVHSSLLPKYRGASPIHSAILNGDAETGVSIMYIEEGLDSGDVILREYCEITEDDTLGTLHDKLKELGADGLTKALKLIENGEVQAEKQDDSKATLVKPITKEQARIDWNNTKEVIYNQIRGLNPFPAAYTF-NEKGENIKIYKSEKIDKKYEDENGNEMENGTVVEIINKKGPVVKVANGGLLILEAKFEGKKLQRGADII 304
>gi|186683788|ref|YP_001866984.1| methionyl-tRNA formyltransferase [Nostoc punctiforme PCC 73102] >gi|186466240|gb|ACC82041.1| methionyl-tRNA formyltransferase [Nostoc punctiforme PCC 73102] (343 aa)
Score = 451, Expect = 5.9e-43, Identities = 115/296 (38%), Positives = 169/296 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTN------------------------------SKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KIVF GTP+ A   L  LL  S FDV+AVV QPDK   R  ++  S VK +A   N+  +QP ++K   EI  +LKELN   FV  A+GQ +   IL +P+ GCIN+H S+LPKYRG API W + NGEKETG+  M     MD G +       I   D T  L +++  +  D+++  L K+   E  PI QD    ++A  I K++  +++ K+A+++ N IRG    P       +  +K+  +V                                 S  +N PG + NI+K  G ++ T +  +L++EVQ+ GK  Q   + +NG
  S:     2 KIVFFGTPQFAVPTLEKLLNHSKFDVLAVVTQPDKRRERGNKLTPSPVKAIATAHNLAVWQPERVKKDTEILTKLKELNADVFVVVAYGQILSSKILKMPKLGCINVHGSILPKYRGAAPIQWCLYNGEKETGITTMLMDVGMDTGPMLEIATTPIGLLDNTQDLAERLAAIGGDLLVETLLKLERQEIQPIPQDNLSATYAPLIQKENYGLDWSKSAMQLHNQIRGF--YPNCTATFRNNLLKIIASVPLASVGDVWRQAAPRLGNFPPELQELIDKLPDLSNVSNKPGVVVNITKGIGAIVQTGEGLLLLREVQLAGKRPQSGWDFVNG 330
>gi|196229641|ref|ZP_03128505.1| methionyl-tRNA formyltransferase [Chthoniobacter flavus Ellin428] >gi|196225967|gb|EDY20473.1| methionyl-tRNA formyltransferase [Chthoniobacter flavus Ellin428] (313 aa)
Score = 451, Expect = 6.4e-43, Identities = 99/298 (33%), Positives = 170/298 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           + +FMGT EI   AL  LL+   ++VVAVV QPDKP+GRK+E+   + K+LA+++ +   QP K++  E+  E+  L     V  A+GQ +P S+L  P   C+N+HASLLP++RG API  A+  G+  +GV +M   + +D GD+    +  I   DT  +L  ++ ++    +   L  V     P   QDE++ ++A  +S+++  I+++    +I   IR ++  P A+ F+      +++K+F   +  S  + A G +     +G+L+S +   +L+ E+Q+EGK R      L G+S
  S:     2 RAIFMGTGEIGVPALTWLLDSPEWEVVAVVTQPDKPVGRKQELHAPATKQLALQRGVPVLQPIKLRTPESVAEIVALQADVIVVMAYGQILPKSVLDAPRLACLNLHASLLPRWRGAAPIQAAIEAGDAASGVTVMYMAEGLDTGDILLMHETPISVQDTGGSLHDRLADVAAAAMAEALPLVAAGHAPRTPQDEARANYAPKLSRENGLIDWKATPAQIDLRIRAMNPWPAAHTFLPTPAGPRQLKVF-GCALQSGGSGASGEVLRADAQGLLVSAQGGTVLLNEIQLEGKRRMPAGEFLRGHS 305
>gi|86133085|ref|ZP_01051667.1| methionyl-tRNA formyltransferase [Tenacibaculum sp. MED152] >gi|85819948|gb|EAQ41095.1| methionyl-tRNA formyltransferase [Polaribacter dokdonensis MED152] (314 aa)
Score = 450, Expect = 6.5e-43, Identities = 109/299 (36%), Positives = 176/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAF---VTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K+ +IVFMGTP+ A   L  L++ ++++V V+   DKP GR +++  S+VKK A+ +N+K  QP  +K+ E+ L ELN       +  AF + +P S+  +P+FG  N+HASLLP+YRG APIHWA+INGE +TGV      +++D G++    ++NI E +T  TL  K+  L  D+V   +  +   +    KQ + +   A  +  ++ +I++ K+  EI N IRGL+  P A+  IN+     K KL+K      +     G I +   E  +   K F I++ E++I GK + + K++LNG
  S:     2 KDLRIVFMGTPDFAVTILKHLVDHNYNIVGVITAADKPAGRGRKLNESAVKKYALSENLKVLQPTNLKD-ESFLNELNSLEVDLQIVVAF-RMLPKSVWQLPKFGTFNLHASLLPEYRGAAPIHWAIINGESKTGVTTFFIDEKIDTGEIILQEEINITEDETVGTLHDKLMYLGADLVAKTVNAISEGDIKTKKQPDLEEKQAPKLFPENTRIDWSKSITEIYNQIRGLNPFPAAWTVINNNEEQLKTKLYKVRKVTEEHGFEFGKIISSKNELKVAVNKGF-IIIDEIKIAGKKKLDSKSLLNG 304
>gi|84514538|ref|ZP_01001902.1| methionyl-tRNA formyltransferase [Loktanella vestfoldensis SKA53] >gi|84511589|gb|EAQ08042.1| methionyl-tRNA formyltransferase [Loktanella vestfoldensis SKA53] (299 aa)
Score = 450, Expect = 6.7e-43, Identities = 99/298 (33%), Positives = 163/298 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           +I+FMGTPE +   L+AL+    D+V V  QP +P GR K+    +V   A+E  +    P  ++  + + E  +LN    V  A+G  +P ++L  P  GC+NIHASLLP++RG APIH A++ G+ +TGVC+M+    +D G V      +I   DTT  L  +++ +   +V+  L ++ +L   P  Q +  V++A  I K + ++++ + A  +   I GLS  PGA+C +  +++KL  A + +   N APGT+     +G  I+     + +   Q EGK      ++LNG S
  S:     2 RIIFMGTPEFSVPVLDALVAAGHDIVTVYTQPPRPAGRGKKDRPQAVHLRALELGLPVRHPVGLRNPQAQTEFADLNADIAVVVAYGLILPQAVLDAPRLGCLNIHASLLPRWRGAAPIHRAIMAGDAQTGVCIMQMEAGLDTGPVLLREATDIAADDTTGALHDRLSAMGARLVVEALRRLPDLTPEP--QPDEGVTYAAKIDKAEGRVDWAQPAATVARQINGLSPFPGAWCDVAGERVKLLGAETAD--GNAAPGTV----LDGFTIACATGAVTITTAQREGKRAMPAADVLNGLS 293
>gi|70733534|ref|YP_257173.1| methionyl-tRNA formyltransferase [Pseudomonas fluorescens Pf-5] >gi|123762267|sp|Q4KKR0|FMT_PSEF5 Methionyl-tRNA formyltransferase >gi|68347833|gb|AAY95439.1| methionyl-tRNA formyltransferase [Pseudomonas fluorescens Pf-5] (319 aa)
Score = 450, Expect = 6.9e-43, Identities = 101/306 (33%), Positives = 168/306 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKEL--NPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           +IVF GTPE A   L ALL+  + +VAV  QPD+P GR ++++ S VK+LA+E +I   QP  ++  E + +     P   V  A+G  +P ++L IP  GCIN HASLLP++RG API  AV  G+ ++GV +MR    +D G +       I   DT  +L  ++  +    VL  +E +         QD+S  ++A+ ++KD+ +I++ + AVE+  L+R  +  P  +  +N + +K+  A  T ++   APG I   SK+G++++  +  + +  +Q+ G       ++ N   E   IG  L
  S:     6 RIVFAGTPEFAAEHLKALLDSPYQIVAVYTQPDRPAGRGQKLMPSPVKQLALENDIPVLQPPTLRNAEAQAELAALKPDLMVVVAYGLILPQAVLDIPRLGCINSHASLLPRWRGAAPIQRAVQAGDAQSGVTVMRMEAGLDTGPMLLKVSTPISAEDTGGSLHDRLAEMGPPAVLQAIEGLAAGTLEGEVQDDSLATYAHKLNKDEARIDWSRPAVELERLVRAFNPWPICHSSLNGEALKVLAA--TLAEGKGAPGEILGASKDGLIVACGEQALCLTRLQLPGGKALNFSDLFNSRREKFAIGTVL 312
>gi|94971254|ref|YP_593302.1| methionyl-tRNA formyltransferase [Acidobacteria bacterium Ellin345] >gi|123256132|sp|Q1IIS2|FMT_ACIBL Methionyl-tRNA formyltransferase >gi|94553304|gb|ABF43228.1| methionyl-tRNA formyltransferase [Acidobacteria bacterium Ellin345] (312 aa)
Score = 450, Expect = 7.5e-43, Identities = 104/302 (34%), Positives = 166/302 (54%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG---NSEIKIG 314
           +VF GTP  A  +L  ++    DV  VV QPD+P GR   + FS VK  A+  N+   QP KIK   E   +L  + P A +   +G+ IP  ++ +P  G IN+HASLLPKYRG API WA+  GE  TGV  M+    +D GD+    ++ I   DT+ +L  ++  L  ++++  L ++       + Q+ ++ + A  + K+D +I+F ++A EI+N +RG +  PGA+     K   + +A +  +     PG +  I  E +L+       L + E+Q+EGK R   ++ +NG   NS  K+G
  S:     3 LVFCGTPRFAVPSLEHIVRAGHDVRLVVTQPDRPKGRGMGLAFSPVKDAALALNLPVTQPEKIKNNEEFRAQLSAIAPDAIIVVGYGRIIPQWMIDLPPLGNINVHASLLPKYRGAAPIQWAIAMGEAVTGVTTMKIDAGLDTGDMLLQAEMPIAPEDTSESLAPRLAELGAELLVETLARLEGGVIAAVPQNHAEHTLAPILKKEDGQIDFHRSAQEILNRLRGFTPWPGAFTQFRGKGFFIHQARAVAATLE--PGEL-RIEGENLLVGAGHNTALELLEIQLEGKKRMPARDFINGYRPNSADKLG 308
>gi|85711006|ref|ZP_01042067.1| Methionyl-tRNA formyltransferase [Idiomarina baltica OS145] >gi|85695410|gb|EAQ33347.1| Methionyl-tRNA formyltransferase [Idiomarina baltica OS145] (324 aa)
Score = 450, Expect = 8.1e-43, Identities = 103/306 (33%), Positives = 175/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEI--ENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI-----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG-NSEIKIGVTL 317
           +IVF GTPE A   L ALL    +VVAV  QPD+  GR K++  S+VK+LA+E  I   QP K+     + +L E  P   V  A+G  +P+ IL+ P++GCIN+H SLLP++RG API  ++  G++ +GV +M+  K +D G V    +  I+  +T+++L+KK+  L    ++  L+ + +       Q+    ++A  +SKD+ KI++  +A ++   +R  +  P A+  +       + +K+ +A  + +   +APGTI + S  GI ++     + +  +Q+ GK    V ++LNG  +   IGV L
  S:     8 RIVFAGTPEFAADHLAALLNSDHEVVAVYTQPDRKAGRGKKLQPSAVKQLALEHAIAVEQPEKLNTALAQQQLAEYRPDVMVVVAYGLLLPEPILTTPKYGCINVHGSLLPRWRGAAPIQRSIWAGDEASGVAVMQMEKGLDTGPVLHVERCAIDAQETSASLYKKLAQLGPRALVTTLDDIESYRERAEVQNHDAATYAKKLSKDEGKIDWS-DATQLERNVRAFNPWPFAWFELPGGKPGQRTVKVHQASVSQTDHRSAPGTIIDCSPAGITVACSQGALTLHSLQLPGKKPLPVSDLLNGYATTFAIGVNL 320
>gi|89092290|ref|ZP_01165244.1| Putative Methionyl-tRNA formyltransferase [Oceanospirillum sp. MED92] >gi|89083378|gb|EAR62596.1| Putative Methionyl-tRNA formyltransferase [Oceanospirillum sp. MED92] (314 aa)
Score = 449, Expect = 1.0e-42, Identities = 103/311 (33%), Positives = 174/311 (55%)
  Q:     7 SCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFA--FVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           S K  +I+F GTP+ A  +L ALL    +V+AV  QPDK   RK ++    VK LA+E NI  FQP+ +K+ + +L   N  A   V  A+G  +P +IL  P  GCIN+H S+LP++RG AP+  +++ G++ETGV +M+  + +D GD+       I ++DT ++LF+++  +  + ++  L ++ N    P KQD+S  ++A  + K++ +IN+++ A  I   IR LS        + D+ +KL      +      PG I    K+ I+++  +  I + ++Q+ GK   +   +LN   E    GV+L
  S:     2 STKPLRIIFAGTPDFAAESLRALLNTEHEVIAVYTQPDKKGKRKNQMAPRPVKDLAVENNIPVFQPHSLKDEDEQLALTNLKADIMVVVAYGMLLPKAILDTPRLGCINVHGSILPRWRGAAPVERSMLEGDQETGVTIMQMDEGLDTGDMLHKVFTPISQADTAASLFERLAVIGSEALVETLTQLQNGTAQPEKQDDSLATYAAKLRKEEGQINWQEPASRIDLQIRTLSPRVAVTFKLGDEAVKLLSCEPVDQSGQ--PGEILPSDKKSIVVACGEGAIKITQLQLPGKKAMDAAAVLNSKREQFSPGVSL 313
>gi|71737239|ref|YP_272334.1| methionyl-tRNA formyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|123747734|sp|Q48QI2|FMT_PSE14 Methionyl-tRNA formyltransferase >gi|71557792|gb|AAZ37003.1| methionyl-tRNA formyltransferase [Pseudomonas syringae pv. phaseolicola 1448A] (314 aa)
Score = 449, Expect = 1.1e-42, Identities = 101/306 (33%), Positives = 167/306 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           +IVF GTPE A   L ALL+  + +VAV  QPD+P GR ++++ S VK+LA++  I   QP  ++  E + EL  L P   V  A+G  +P  +L IP  GCIN HASLLP++RG API  AV  G+ E+GV +M+    +D G +       I   DT  TL  ++  L    VL  +  + +       QD+S  ++A+ ++KD+ ++++ + A E+  LIR  +  P  +  +N++ +K+  A    ++    PGT+ + SK+G++++     + +  +Q+ G       ++ N   E   IG  L
  S:     6 RIVFAGTPEFAAEHLKALLDSPYQIVAVYTQPDRPAGRGQKLMPSPVKQLALQHEIPVMQPPTLRAPEAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVMQMEAGLDTGPMLLKAVTPITAQDTGGTLHDRLAELGPPAVLQAIAGLADGSLVGEVQDDSLANYAHKLNKDEARLDWTRPADELERLIRAFNPWPICHSTLNEETLKVLAA--DLAEGQGVPGTVLSASKDGLIVACGQNALRLTRLQLPGGKPLNFADLFNSRREKFAIGTVL 312
>gi|86132757|ref|ZP_01051349.1| methionyl-tRNA formyltransferase [Cellulophaga sp. MED134] >gi|85816711|gb|EAQ37897.1| methionyl-tRNA formyltransferase [Dokdonia donghaensis MED134] (316 aa)
Score = 449, Expect = 1.1e-42, Identities = 101/299 (33%), Positives = 171/299 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESK-VSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++ +IVFMGTPE A   L+ LL++ ++VV V+  PD+P GR ++I  S VK  A  +N+   QP  +K      EL+ L     +  AF + +P+++  +P +G  N+HASLLP+YRG API+WA+INGE ETGV      +++D G++     + I++ +    L  ++     ++V+  ++ +   E     QD SK +  AY +  ++ +IN++    EI N IRGLS  P AY  +     ++++K++ A +   K    P        + + I+T +  I + E+Q+ GK +  VK++LNG
  S:     2 RDLRIVFMGTPEFAVTILHGLLDEGYNVVGVITAPDRPAGRGQKIRESDVKAFAKARNLNILQPTNLKSESFLEELEALKANLQIVVAF-RMLPEAVWKMPAYGTFNLHASLLPQYRGAAPINWAIINGETETGVTTFFIDEKIDTGEIILQESLAIDDKENAGHLHDRLMIAGKELVIKTVKAIERDEVKTHIQDSSKELKTAYKLHSENTRINWDAPLQEIYNHIRGLSPYPAAYTILENGGKEQRVKIYSAFAKADKEMLIPSGAVTQVDDHLAIATPEGYICITEMQLSGKKKMAVKDLLNG 306
>gi|172035865|ref|YP_001802366.1| methionyl-tRNA formyltransferase [Cyanothece sp. ATCC 51142] >gi|171697319|gb|ACB50300.1| methionyl-tRNA formyltransferase [Cyanothece sp. ATCC 51142] (338 aa)
Score = 448, Expect = 1.1e-42, Identities = 105/306 (34%), Positives = 178/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN---ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTN---------------------SKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           K++F GTP+ A   L  LL+   F+V+ VV QPDK  GR  +++ S+VK++A+  N+  +QP +IK+ ++   +LK      FV  A+GQ +   IL +P+ GCIN+H S+LP+YRG API W + NG+++TG+  M   + MD GD+      +I   D    + +K+ N   D+++  LEK+   E     Q++++ ++A  I KDD  I++ ++A+ I N +RG    P  +    D K+K+   +  N                      K+   PG + +I K  G +I T +  +L+ E+Q   K  Q   +++NG + +++G  L
  S:     9 KVIFFGTPQFAVPTLQQLLDHPQFNVIGVVTQPDKRRGRGTQLMPSAVKQVALNHNLSIWQPKRIKKDQDTLLQLKNSQADVFVVVAYGQILSSEILQMPKLGCINVHGSILPQYRGAAPIQWCLYNGDRQTGITTMLMDEGMDTGDMLLKAYTDISLFDNADEIAEKLANQGADLLIETLEKLEANEIEATPQNDNEATYASLIGKDDFIIDWNQSAIAIHNQVRGF--YPNCFTSFRDNKLKIMATIPINDNYLQALGEKYKRLKHQINLLDKTEGKPGKVVSIIKNFGPVIQTGEGLLLLSEIQRSAKRPQSGWDLVNG-TRLEVGELL 337
>gi|119503585|ref|ZP_01625668.1| methionyl-tRNA formyltransferase [marine gamma proteobacterium HTCC2080] >gi|119460647|gb|EAW41739.1| methionyl-tRNA formyltransferase [marine gamma proteobacterium HTCC2080] (321 aa)
Score = 448, Expect = 1.3e-42, Identities = 96/300 (32%), Positives = 170/300 (56%)
  Q:    10 NKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           ++++VF GTPE A   L+AL+    DV AV+ QPD+P GR K+I  S+VK+LA    I   QP  ++  E+   L+ LN    V  A+G  +P SIL+IP+ GC+N+HASLLP++RG API  A+  G+  TG+ +M+    +D G +  +  ++I  S+T+ TL  ++  +   ++L  LE + +       Q++    +A  I+K + ++++  +A  +   +R  + T   + ++ ++++K+++A +  +  N APG I     EGI+++     + +   Q  G     V ++LNG S
  S:     4 SRRVVFAGTPEFAAAHLDALVAAGHDVCAVLTQPDRPAGRGKQIQTSAVKRLAQTNEIPVLQPASLRTPESHALLEALNAEIMVVVAYGLILPQSILNIPKHGCLNVHASLLPRWRGAAPIQRAIEAGDAHTGITIMQMDAGLDTGAMVATGILDITASETSGTLHDRLIEVGPGLLLEVLEDLPHRLAQATPQEDGDAIYAAKITKQEAQLDWALDAKALSRKVRAFNPTSVCFSYLGNERLKIWQASALPTPHNRAPGHIIESGPEGIVVACGIGALNITVAQFPGAKALPVVDLLNGRS 305
>gi|150026048|ref|YP_001296874.1| methionyl-tRNA formyltransferase [Flavobacterium psychrophilum JIP02/86] >gi|149772589|emb|CAL44072.1| Methionyl-tRNA formyltransferase [Flavobacterium psychrophilum JIP02/86] (316 aa)
Score = 448, Expect = 1.4e-42, Identities = 112/299 (37%), Positives = 171/299 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLE-YPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL-FKAVSTNSKSNNAPGTINNI--SKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K  +IVFMGTPE A   L+A+ +++  ++V V+   DKP GR ++I +S+VK+ A++K +   QP  +K+      LK LN    +  AF + +P  + ++PE G  N+HASLLP YRG API+WA+INGE +TGV       ++D G +  S+++ I ES+    L  K+  L  D VL  L+K+ +      I++D S +  AY + +D+ KI+F KN  E+ NLIRGLS  P A+C   D   +   K   T  +      TI ++  +K+ I I+     I V  +Q  GK +     +LNG
  S:     2 KALRIVFMGTPEFAVGILDAIAKQNKHEIVGVITAADKPAGRGQKIKYSAVKEYALKKELTLLQPTNLKDESFLLALKSLNANLHIVVAF-RMLPKVVWAMPELGTFNLHASLLPNYRGAAPINWAIINGETKTGVTTFFIDDKIDTGAMILSKELEISESENLGDLHDKLMVLGCDAVLETLDKIAHGNVVTTIQEDTSDIKTAYKLDRDNCKIDFTKNITEVYNLIRGLSPYPSAWCNFRDADQEFSIKIYDTKQEVLLHDYTIGSVITTKKEIKIAVLGGFIQVLSLQFPGKKKMMAHELLNG 306
>gi|67925158|ref|ZP_00518530.1| Methionyl-tRNA formyltransferase [Crocosphaera watsonii WH 8501] >gi|67853005|gb|EAM48392.1| Methionyl-tRNA formyltransferase [Crocosphaera watsonii WH 8501] (331 aa)
Score = 447, Expect = 1.5e-42, Identities = 109/306 (35%), Positives = 180/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKEL---NPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTN---------------------SKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +++F GTP+ A   L  LL+ S F+V+ VV QPDK  GR K++I S+VKK+A+  NI  +QP +IK+ ++ L +L      AFV  A+GQ +   IL +P+ G IN+H S+LP+YRG API W + NG+++TG+  M   + MD GD+      +I   +    + +K+ N   D+++  LEK+ + E   + Q+  + ++A  I+KDD  +++ K+A+ I N IRG    P  +    D K+K+   +  +                      K+   PG +  + K  G +I T    +L+ E+Q  GK  Q   +++NG + +K+G  L
  S:     2 QVIFFGTPQFAVPTLQKLLDHSRFNVIGVVTQPDKRRGRGKQLIPSAVKKIALNHNIPIWQPKRIKKDQDTLSQLKNSQADAFVVVAYGQILSLEILQMPKVGAINVHGSILPQYRGAAPIQWCLYNGDRQTGITTMLMDEGMDTGDMLLKAYTDINLFENAYQIAEKLANQGADLLIETLEKLESNEIQAVPQNNEEATYASLINKDDFIVDWNKSAIAIHNQIRGF--YPNCFTSFRDDKLKIMATIPMDDDHLQSLDESYQELNNQLKSLDKTIGKPGEVIGLIKNFGPVIKTGKGLLLLSEIQRSGKRPQSGWDLVNG-THLKVGELL 330
>gi|189461483|ref|ZP_03010268.1| hypothetical protein BACCOP_02142 [Bacteroides coprocola DSM 17136] >gi|189431817|gb|EDV00802.1| hypothetical protein BACCOP_02142 [Bacteroides coprocola DSM 17136] (323 aa)
Score = 446, Expect = 2.2e-42, Identities = 103/299 (34%), Positives = 172/299 (57%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSS-VKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDE----SKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK-----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K+ +IV+MGTPE A  +L  L+E  +++V V+  PDKP+GR   ++  S VK+ A+ + +K  QP K+K  E   EL+ LN    +  AF + +P+ + S+P  G  N+HASLLP+YRG API+WAVING+ ETG+       ++D G++    +V I ++D    +++++  L  D+VL  ++ +       I Q+E     ++  A  I K+  +I++      I + +RGLS  P A+  +  +      +K+F+      + + APGTI    K    I++ D  + V  +Q+ GK R E+ + L G
  S:     4 KDLRIVYMGTPEFAVESLKRLVEGGYNIVGVITMPDKPMGRHGSVLQPSPVKQYAVSQGLKVLQPEKLKNEEFVAELRSLNADLQIVVAF-RMLPEVVWSMPRLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTFFLKHEIDTGEIIDQVRVPIADTDNVEVVYERLMRLGGDLVLKTVDAILEGSVKTIPQEELAQVGELRPAPKIFKETCRIDWTIGVKRIYDFVRGLSPYPAAWTELYQEGTDPVMLKIFETEKLFCEHSLAPGTIVTDCKTYFKIASSDGYVNVLSLQLAGKKRMEINDFLRG 313
>gi|160945219|ref|ZP_02092445.1| hypothetical protein FAEPRAM212_02738 [Faecalibacterium prausnitzii M21/2] >gi|158442950|gb|EDP19955.1| hypothetical protein FAEPRAM212_02738 [Faecalibacterium prausnitzii M21/2] (306 aa)
Score = 445, Expect = 2.5e-42, Identities = 95/285 (33%), Positives = 164/285 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIND--KKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGK 296
           +I+FMGTP+IA   L AL     D+ AV  + DKP+GRK+ +    VK++A+      FQP  +++   ++ ++ L P   V  A+G  +P S+L +P +GCIN+H SLLPKYRG AP+ W+V+NG+ ETGV +M+  + +D GDV   +K+ I+  +T+  LF ++  +  + +   + ++       + Q     + A  ++K+  + +    AV I N +RG++  PGA+ FI    KK+K+  +    +    APGT+  ++ + + ++  +  I + EV  EGK
  S:     2 RILFMGTPDIAAECLKALYAAGHDICAVYTRRDKPVGRKQVLTAPPVKEVALAHGTPVFQPRTLRDGSEDDTIRALAPELIVVVAYGCILPKSVLEMPRYGCINLHVSLLPKYRGSAPVQWSVLNGDAETGVSIMQMDEGLDTGDVLYCKKIVIDPEETSGELFDRVTAVGAEALCETIPQIAAGTLTAVPQQHENATLAPMLNKEMAEFHLTDTAVHIHNWVRGMNPWPGAW-FITSGGKKLKVMSS-RVAAAHGEAPGTV--LATKPLTVACGEGAIQLLEVVPEGK 286
>gi|149201580|ref|ZP_01878554.1| methionyl-tRNA formyltransferase [Roseovarius sp. TM1035] >gi|149144628|gb|EDM32657.1| methionyl-tRNA formyltransferase [Roseovarius sp. TM1035] (302 aa)
Score = 445, Expect = 2.6e-42, Identities = 99/296 (33%), Positives = 163/296 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEI--ENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +++FMGTP+ +   L AL+    +V AV CQP +P GR K+   S V+  A    +    P  +KE   + E   L     V  A+G  +P ++L  P  GC+NIHASLLP++RG APIH A++ G+ ETGVC+M+    +D G V     V I   +TT  L  +++ L   +++  LE++  L   P  Q E+ V++A  I K + ++++ + A E+  LIRGLS  PGA+C +  +++KL    S  ++++ APG    +  +G+ ++     + +  +Q  G+  Q+    L G
  S:     2 RVIFMGTPDFSVPVLEALVAAGHEVAAVYCQPPRPAGRGKKDRPSPVQARAEALGLPVHHPVSLKEATAQAEFAALKAEVAVVVAYGLILPQAVLDAPTRGCLNIHASLLPRWRGAAPIHRAIMAGDTETGVCIMQMEAGLDTGPVLLREPVAIGPQETTGELHDRLSALGARLIVAALERLDALTPEP--QPEAGVTYAAKIDKSEARVDWTRPATEVDRLIRGLSPFPGAWCEVGGERIKLL--CSAMAEAHGAPGV---VLADGLTVACGTGSVRLLRLQRAGRAAQDADEFLRG 292
>gi|85705031|ref|ZP_01036131.1| methionyl-tRNA formyltransferase [Roseovarius sp. 217] >gi|85670353|gb|EAQ25214.1| methionyl-tRNA formyltransferase [Roseovarius sp. 217] (302 aa)
Score = 445, Expect = 3.1e-42, Identities = 98/296 (33%), Positives = 163/296 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +++FMGTP+ +   L AL+    +V AV CQP +P GR K+   S V+  A    +    P  +K  E + E   L     V  A+G  +P ++L  P  GC+NIHASLLP++RG APIH A++ G+ ETG+C+M+    +D G V     + I   +TT  L  +++ L   +++  L ++ +L   P+ Q E+ V++A  I K + ++ + + A EI  LIRGLS  PGA+C +  +++KL    ST ++   APG + +   +G+ ++     + +  +Q  G+  Q+    L G
  S:     2 RVIFMGTPDFSVPVLEALVAAGHEVAAVYCQPPRPAGRGKKDRPSPVQARAEALGLPVRHPVSLKGAEAQAEFAALKADVAVVVAYGLILPQAVLDAPARGCLNIHASLLPRWRGAAPIHRAIMAGDVETGICIMQMEAGLDTGPVLLRGAMTIGPQETTGELHDRLSGLGARLIIEALGRLDDLR--PVPQSEAGVTYAAKIDKSEARVEWTRPAAEIDRLIRGLSPFPGAWCEVGGERIKLL--CSTVAEGQGAPGVVLD---DGLTVACGTGAVRLLRLQRAGRAAQDADEFLRG 292
>gi|196245273|ref|ZP_03143997.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 8802] >gi|196206802|gb|EDY01597.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 8802] (332 aa)
Score = 444, Expect = 3.3e-42, Identities = 106/303 (34%), Positives = 177/303 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRG----------------LSETPGAYCF---INDKKMKLFKAVSTNSKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           KI+F+GTP+ A   L  LL+   FDV+ VV QPDK  GR  ++I S++KK+A+E  +  +QP  +K+     ++LKE    AFV  A+GQ +   IL++P+ GCIN+H S+LP+YRG API W++ +G+KETG+  M   + MD G +       I+  D    L +K+     D+++  L+K+   +     QD  + ++A  I K D  +++ K A+ I N +R                 ++  P    +   ++++  KL +     S     PG + +I K  G +I T +  +L+KEVQ+ GK +Q   + +NG + +++G
  S:     2 KIIFLGTPQFAIPTLQKLLDHPDFDVIGVVTQPDKRRGRGNQLIPSAIKKIALEHGLTVWQPKNLKKARTTLSQLKEAQADAFVVVAYGQLLSSEILAMPKLGCINVHGSILPQYRGAAPIQWSIYHGDKETGITTMLMDEGMDTGAMLIKAYTPIQLLDNAHELAEKLAQQGADLLIETLQKLKLGDITATAQDNDQATYAPLIEKSDYIVDWTKPAIAIHNQVRAFYPNCVTTFRNQSLKIMATIPLGDTYWEQLSEEFQKLQQQTKMLSDVTGKPGEVVSIIKNFGAVIQTGEGLLLLKEVQLSGKRQQSGWDFVNG-TRLEVG 327
>gi|158522243|ref|YP_001530113.1| methionyl-tRNA formyltransferase [Desulfococcus oleovorans Hxd3] >gi|158511069|gb|ABW68036.1| methionyl-tRNA formyltransferase [Desulfococcus oleovorans Hxd3] (313 aa)
Score = 444, Expect = 3.3e-42, Identities = 93/301 (30%), Positives = 163/301 (54%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           ++ +IVFMGTP+ A   L AL +  +DV  VV QPDKP GR +++    VK  A    +   QP  ++  +    LK + P   V  A+G+ +P ++L +P  G +NIH SLLP+YRG +PI WA+   E ETGV  +   + MD+GD+  S +  I + DT + L  ++  L  D++++ L ++ +    P+ QD   V+FA  + K   +I++ + +  +   I  ++  PGA+     ++ K+  A     +   +PGT+     + ++++T D  ++V  +Q E     +V + L G++
  S:     3 RDLRIVFMGTPDYAVPCLKALADNGYDVPLVVTQPDKPKGRGRKMAPPPVKVAAEALGLAVAQPASVRTDDFIRTLKNIAPDLLVVVAYGKILPRAVLELPALGAVNIHPSLLPRYRGPSPIQWAIAGMEAETGVTSIFMDEGMDSGDMILSARAPISDEDTAADLHDRLAVLGADVLIDTLARIESGTATPVPQDPEAVTFAPLLKKTHGRIDWNQPSARLRRFINAMTPWPGAFTETGTRRYKILAARPVTLEKKASPGTVVTRFPDELVVATADGGLVVTRIQGEAGKPMDVADFLRGHA 305
>gi|194291226|ref|YP_002007133.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Cupriavidus taiwanensis] >gi|193225061|emb|CAQ71072.1| 10-formyltetrahydrofolate:L-methionyl-tRNA(fMet) N-formyltransferase [Cupriavidus taiwanensis] (337 aa)
Score = 443, Expect = 4.5e-42, Identities = 103/296 (34%), Positives = 161/296 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIK-FFQPNKIKE----------IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKV-FNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSN--NAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           ++ F GTPE A  AL A+    F VVAV+ QPD+P GR  ++  S VK+ A+   +    QP  ++             + L  + P   V  A+G  +P  +L++P  GC+NIH SLLP++RG APIH A+  G+ ETG+ LM+  + +D GD+     V I   DTT TL   +  L   ++++ L ++      P   Q E  V++A  I+KD+  ++  + A E+ N +R  +  PGA   + D  +K ++AV   + S+  + PGT+      GILI+  +   L V E+Q  G  RQ  +  L  
  S:     8 RVAFAGTPEFARVALEAIHAAGFPVVAVLTQPDRPAGRGMQLQASPVKQFAVANGLAPVLQPRSLRRQGKYPEEAAAAIDTLAGIAPDVMVVAAYGLILPAEVLALPRLGCLNIHGSLLPRWRGAAPIHRAIEAGDAETGITLMQMDEGLDTGDMLTREAVPIGADDTTGTLHDTLAALGARMIVDALRQLDTGRPLPATPQPEQGVTYAEKIAKDEAPLDLRRPAAELANQVRAFNPFPGATVQVGDTVIKCWQAVPLAAASSLPHPPGTVLAADAAGILIACGEGSALQVTELQKPGGRRQPAQQFLQA 318
>gi|167752152|ref|ZP_02424279.1| hypothetical protein ALIPUT_00394 [Alistipes putredinis DSM 17216] >gi|167660393|gb|EDS04523.1| hypothetical protein ALIPUT_00394 [Alistipes putredinis DSM 17216] (320 aa)
Score = 443, Expect = 5.1e-42, Identities = 103/301 (34%), Positives = 169/301 (56%)
  Q:     7 SCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSF--AYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI-----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           + K+ +IVFMGTPE A  +L AL+   ++VV VV  PDKP GR +++  S VK  A E  +   QP K+++    + ++EL P   +  AF + +P+ + ++P  G  N+HASLLP+YRG API+WA+INGE +TGV       ++D G +    ++ I+  D   TL+ ++  +  D+V+  +E++   E  P+ Q +   S   A  I K+D  I++ ++   I++ IRGLS  P A+  +          K+F+A           GTI+  +++ + I   D  I V  +Q+ GK R   + +L G
  S:     2 NAKDLRIVFMGTPEFAVPSLRALVRSGYNVVGVVTTPDKPAGRGQKLHESDVKIAARELGLPILQPEKLRDPAFVSTMEELRPDLGIVIAF-RMLPEVVWAMPRLGTFNLHASLLPQYRGAAPINWAIINGESKTGVTTFLLNHEIDKGAILGQVEMPIQPEDNVGTLYDRLMTVGADLVVQTVERIAAGEITPVVQSDEDTSLRPAPKIFKNDCLIDWTQSGKRIIDFIRGLSPYPAAWTRLLREEQEANSAKIFEARFEAGGPEAPCGTIDTDNRKYLRIRCADGWIDVLSLQLSGKKRMAAQELLLG 310
>gi|146328824|ref|YP_001209087.1| methionyl-tRNA formyltransferase [Dichelobacter nodosus VCS1703A] >gi|146232294|gb|ABQ13272.1| methionyl-tRNA formyltransferase [Dichelobacter nodosus VCS1703A] (314 aa)
Score = 442, Expect = 6.9e-42, Identities = 100/296 (33%), Positives = 162/296 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKEL-NPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAP-GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I F GTPE AT AL+AL+ K   V  V+ QPD+P GR +++  S+VK  A    +   QP +++E       L  P   V  A+G  +P   L  P  GCINIHASLLP++RG API  A+  G++ETG+ +M+    +D G V+  +++ I E  + S L   +  L  + +++ L  +      PI Q  S   +A+ +SK + +IN++ +A  IV  IR     P AY +++D  ++ +  ++ +  + +AP GT+   ++EGI I      + +K +Q+ GKN      + NG
  S:     5 QIWFAGTPEFATAALDALV-KHVSVAGVLTQPDRPAGRGRKLKASAVKARAEHYQLPIAQPERLQESAPPFAHLPRPDIVVVVAYGLLLPQWFLDYPRLGCINIHASLLPRWRGAAPIQRAIEAGDEETGISIMQMDAGLDTGAVWLEKRLPIGEQ-SASQLHDALMQLGAEALIDVLPDILAQARAPIPQPSSGACYAHKLSKAEAEINWQDDAANIVRKIRAFDLFPVAYSYLDDAPVRFYDGIALSEHTESAPAGTVIEHNQEGIDIVCGSGILRIKRLQLAGKNVVSAAALANG 300
>gi|163812386|ref|ZP_02204059.1| methionyl-tRNA formyltransferase [Dehalococcoides sp. VS] >gi|157403952|gb|EDO69999.1| methionyl-tRNA formyltransferase [Dehalococcoides sp. VS] (322 aa)
Score = 441, Expect = 7.6e-42, Identities = 93/296 (31%), Positives = 156/296 (52%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IVFMG+PE A   L  LL + +D+  V  QPD+P GR +E+    VK LA+E  +  +QP  +K+ E +  L  L P      A+G  +P ++L IP +G +NIH SLLP+YRG  P+   ++ G++  GV LM+    +D G VY    + +   DTT  L  K+  +   ++L  L ++ +L  P + QD +K ++   ++KD  ++N++  A EI   +R  S  PG +   N K +K+ +A          P  +     + I++ +   ++ +  +Q+EGK      + L G
  S:    15 RIVFMGSPEFALTPLKMLLAEGYDICGVYTQPDRPAGRGRELCPPPVKALALEHGLAVYQPQSLKKPEEQAVLSGLKPDVIAVAAYGLILPQAVLDIPIYGVLNIHPSLLPRYRGATPVAATLLGGDEWAGVSLMKLEAGLDTGPVYSRAAIPVRPEDTTPLLADKLAFIGGCLLLELLSRIPSLPQPEL-QDNAKATYFGMVTKDMGQVNWQTPAAEIERRVRAFSPWPGVFTLYNQKTLKILEASPQKLGLGLQPSQVRVYEGDRIMVGSASGELEIIRLQLEGKAACSAADFLRG 311
>gi|118602766|ref|YP_903981.1| methionyl-tRNA formyltransferase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567705|gb|ABL02510.1| methionyl-tRNA formyltransferase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (320 aa)
Score = 440, Expect = 1.0e-41, Identities = 98/295 (33%), Positives = 168/295 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILN 306
           +IVF GTPE +   L  L+    D+V V CQPD+P GR + +    VK+ A+E N+  FQP  +K  +I+  L +LN    V  A+GQ +P  IL+  ++GC+NIH+SLLP++RG API  A++ G+K TG+ +M+  + +D GD+   +  +I   DT  +L  K+  L    ++  L+ + NL   P  Q E+ +++A  + KD+  I++ ++A++I   IR  +  P A  + +  K     +++  A    +  N  PG+I   +K+   ++T    + +K +Q+ GK    +K+  N
  S:    11 RIVFAGTPEFSAGILKTLINTKHDIVGVFCQPDRPKGRGRVLTTCPVKEKALEHNLNIFQPENLKNDKIQQILTKLNADIMVVAAYGQILPAKILNTLKYGCLNIHSSLLPRWRGAAPIQRAILAGDKITGINIMQMNEDLDTGDILLEKTCSITLIDTAQSLHDKLAKLSSSAIIEVLDNLDNL--LPTAQRENNITYAAKLKKDEAWIDWTQSAIQINRQIRAFNPYPIAQTYASSNKFDTKVLRILSASVVMTNGNYNPGSIIKHNKKACTVATGGGALNLKTLQLSGKKALNIKDFSN 310
>gi|154249589|ref|YP_001410414.1| methionyl-tRNA formyltransferase [Fervidobacterium nodosum Rt17-B1] >gi|171769350|sp|A7HLH4|FMT_FERNB Methionyl-tRNA formyltransferase >gi|154153525|gb|ABS60757.1| methionyl-tRNA formyltransferase [Fervidobacterium nodosum Rt17-B1] (310 aa)
Score = 440, Expect = 1.1e-41, Identities = 111/296 (37%), Positives = 175/296 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKE-LNPFAFVTCAFGQFIPDSIL-SIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VSTNSKSNNAPGTINNISKEG--ILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+FMGTPE A   L+ L++K F+VVAV+ Q DKP GR ++++ + VK++A +  I  FQP+K+ E   E+ E   P   +  A+G+ +    L +IP +   N+H SLLPKYRG AP+  A+ NGE+ TGV + +  + MD GD+   R   +EE +   ++++K      ++ L +  + + +   P  QD SK ++A  I K D  ++F K AVE+ N IR    TPG   F+ND ++KL+ A  + +NS+ N  PGT+  I K+    +I T D  + +K +Q  GKN+    +  NG
  S:     2 RILFMGTPEFAASYLDFLIQKKFNVVAVISQKDKPRGRGQKLLPTPVKEVAQKYGIPVFQPSKLNEEGLEIIENYRPDIGIVVAYGRLLRKPFLDAIPLY---NVHTSLLPKYRGPAPMQRAIENGERVTGVTIFKISEGMDEGDIALQRAFELEECEPFGSVYEKFIKYGTEL-LQEFLRNYPVTLTP--QDHSKATYAPKIEKKDLYVDFSKPAVEVRNKIRAYDPTPGVRTFLNDIEVKLYGACEIESNSQENIEPGTVVRIEKQSGDGVIKTIDGLLHIKYIQFPGKNKITFLSAKNG 297
>gi|170718225|ref|YP_001785247.1| methionyl-tRNA formyltransferase [Haemophilus somnus 2336] >gi|189044516|sp|B0UWZ4|FMT_HAES2 Methionyl-tRNA formyltransferase >gi|168826354|gb|ACA31725.1| methionyl-tRNA formyltransferase [Haemophilus somnus 2336] (317 aa)
Score = 440, Expect = 1.1e-41, Identities = 101/305 (33%), Positives = 177/305 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           I+F GTP+ A   L ALL+   +V+AV  QPDKP GR + +  S+VK LA + +I  +QP  ++  E++  L +LN    V  A+G  +P ++L     GC+N+H SLLP++RG API  A+  G+K+TGV +M+  + +D GD+      +I  ++T+++L+ K+ N+    +L  L+ +    +    QDES  ++A  +SK++ K+++  +A ++   IR  +  P +Y    D +     +K+++A S     N   GTI    K GI ++T +  + ++++Q  GK     +++LN  ++  KIG  L
  S:     6 IIFAGTPDFAAQHLQALLQSQHNVLAVYTQPDKPAGRGQTLRASAVKILAEKHHIPVYQPKSLRKVEVQEHLSKLNADVMVVVAYGLILPLAVLQTFPLGCLNVHGSLLPRWRGAAPIQRAIWAGDKKTGVTIMQMNEGLDTGDMLHKVCCDITPTETSTSLYTKLANIAPKALLEVLDGLEQGLFKAEVQDESLSNYAEKLSKEEAKLDWSLSAEQLERCIRAFNPWPMSYFVTQDSQGTLQTLKVYQA-SVLPHQNKPCGTILAADKRGIQVATANGVLNLEQLQPAGKKPMSARDLLNSRADWFKIGQVL 317
>gi|163756384|ref|ZP_02163498.1| methionyl-tRNA formyltransferase [Kordia algicida OT-1] >gi|161323736|gb|EDP95071.1| methionyl-tRNA formyltransferase [Kordia algicida OT-1] (315 aa)
Score = 440, Expect = 1.2e-41, Identities = 104/299 (34%), Positives = 174/299 (58%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEY-PPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDK----KMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++ +IVFMGTP+ A   L ALL+ +++VV V+  PDKP GR +++  S+VKK A+  N+   QP  +K      ELK LN    +  AF + +P  +  +PE+G  N+HASLLP YRG API+WA+INGE +TGV      +++D G +    ++ IE ++   +L  K+ N+  D+V+  ++ +   E    I+ +   V  AY I K+  KI++      I N IRGLS  P ++  +++      +K+++        ++  G + + SK+ + I+ K+  I++K +Q+ GK   E+  +LNG
  S:     2 RDLRIVFMGTPDFAVATLKALLDANYNVVGVITAPDKPAGRGRKMHQSAVKKFALANNLNVLQPTNLKRTSFVEELKALNANLQIVVAF-RMLPKVVWQMPEYGTFNLHASLLPNYRGAAPINWAIINGETKTGVTTFFIDEKIDTGAMIFQEEIAIEPTENAGSLHDKLMNIGSDLVVKTVQHIEKDEVTTTIQPNSDDVKTAYKIHKETCKIDWTDTIDNIYNKIRGLSPYPASWTTLHNGDDTYNIKIYEVEKVLEAHSHTVGIVLS-SKKEVKIAVKEGYIILKILQLPGKRSMEIGALLNG 305
>gi|88805388|ref|ZP_01120907.1| methionyl-tRNA formyltransferase [Robiginitalea biformata HTCC2501] >gi|88784206|gb|EAR15376.1| methionyl-tRNA formyltransferase [Robiginitalea biformata HTCC2501] (315 aa)
Score = 439, Expect = 1.2e-41, Identities = 104/304 (34%), Positives = 171/304 (56%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAF---VTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFN---LEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIN----DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIK 312
           K+  I FMGTPE A  +L+AL+   F +  V+  PD+P GR +++  S+VK  A+EK +   QP  +K+  + +++L  F     V  AF + +P  +   PE G  N+HASLLP YRG API+WAVINGE+ TG       +Q+D G V     + I   +    L  ++  L   +V+  + ++       +P  + +  K+  A  + +DD +I+++  A +I NLIRGLS  P A+  +         K++ A   ++ SN +PG ++ + ++ + + T D  + + E+Q EGK R  V + LNG +E+K
  S:     2 KDLNIAFMGTPEFAVASLDALIRADFKIAVVITAPDRPAGRGRKLRASAVKSYAVEKGLPVLQPTNLKD-PDFVEQLASFGVNLQVVVAF-RMLPRQVWEFPEHGTFNLHASLLPDYRGAAPINWAVINGERTTGATTFFIDEQIDTGHVILQESLEIGPRENAGQLHDRLMALGAGLVVETVRQIQAGTVTTHPQPEPEPDKI--APKLFRDDCRIDWKAPAAQIDNLIRGLSPYPTAWTQLETGSGTTTCKIYAARPADTPSNGSPGDLHGMDRK-LFVDTSDSQLEILELQPEGKRRMPVSDWLNG-TELK 309
>gi|85060225|ref|YP_455927.1| methionyl-tRNA formyltransferase [Sodalis glossinidius str. 'morsitans'] >gi|123766384|sp|Q2NQQ3|FMT_SODGM Methionyl-tRNA formyltransferase >gi|84780745|dbj|BAE75522.1| methionyl-tRNA formyltransferase [Sodalis glossinidius str. 'morsitans'] (316 aa)
Score = 439, Expect = 1.3e-41, Identities = 96/299 (32%), Positives = 168/299 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +I+F GTP+ A   L+AL++    VV V  QPD+P GR   +  S VK+LA   ++  FQP  +++ E +  + ELN    V  A+G  +P ++L +P  GCIN+H SLLP++RG API  A+  G+  TGV +M+    +D G +       I+  DT+++L+ K+  +  + +L+ L ++         QD +  ++A  +SK++ ++++   A ++   IR  +  P +Y  + ++ +K++ A V     S++APGTI    K GI I+T    + + ++Q  GK    V+++LN   E
  S:     6 RIIFAGTPDFAARHLDALIDAKQQVVGVFTQPDRPAGRGNRLTPSPVKELAERHDLPVFQPASLRKPEGQRSVAELNADIMVVVAYGLILPQAVLDLPLLGCINVHGSLLPRWRGAAPIQRALWAGDDRTGVTIMQMDAGLDTGAMLHKAVCAIQHDDTSASLYDKLAQIGPNALLSTLTQIAAGRAVAESQDNALATYADKLSKEEARLDWRLPAAQLERCIRAFNPWPISYFSLAEQPIKVWAAGVDDGQTSSHAPGTILAADKAGIHIATGAGVLTLTQLQPAGKKAMSVQDLLNSRRE 307
>gi|148324106|gb|EDK89356.1| methionyl-tRNA formyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] (310 aa)
Score = 438, Expect = 1.7e-41, Identities = 98/306 (32%), Positives = 181/306 (59%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAP--GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +I+FMGTP  A  +L  +  K  ++++V  + DKP  R K+I FS +K+ A+  ++K +QP   K+  +  E++ +     V  A+G+ +P  I+ IP++G IN+H+SLLP++RG API+ A+ING+ ++GV +M   +++DAGD+    +  I + DT  +L  ++ ++  D++L  +E +   +    KQDE  V+F     K+D +I++ K + EI N IRG++  P A+  +N+  +K+++    +   NNA     +  +  +GI++ T D  +++   + E K +    +++NG   +KIG  L
  S:     2 RIIFMGTPRFALPSLEKIY-KEHEIISVFTKVDKPNARGKKINFSPIKEFALANDLKIYQPENFKDSSLIEEIRNMQADLIVVVAYGKILPKEIIDIPKYGVINLHSSLLPRFRGAAPINAAIINGDNKSGVSIMYVEEELDAGDIILQEETEITDEDTFLSLHDRLKDIGADLLLKAIELIEKGQVKAQKQDEKLVTFVKPFRKEDCRIDWTKTSREIFNFIRGMNPVPTAFSNLNETIIKIYETKINDKVYNNATCGEVVEYLKGKGIVVKTGDGSLIISSAKPENKKQMSGVDLINGKF-LKIGEKL 309
>gi|146305095|ref|YP_001185560.1| methionyl-tRNA formyltransferase [Pseudomonas mendocina ymp] >gi|166215500|sp|A4XNB2|FMT_PSEMY Methionyl-tRNA formyltransferase >gi|145573296|gb|ABP82828.1| methionyl-tRNA formyltransferase [Pseudomonas mendocina ymp] (314 aa)
Score = 438, Expect = 1.9e-41, Identities = 99/299 (33%), Positives = 159/299 (53%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +IVF GTPE A   L ALL    +V+AV  QPD+P GR ++++ S VK+LA+E  I   QP  ++  E + EL  L P   V  A+G  +P  +L  P  GCIN HASLLP++RG API  AV  G+ E+GV +M+    +D G +       I   DT  +L  ++  L    VL  ++ +         QD+++ ++A+ ++KD+ +++F + AVE+  LIR     P  +  +N   +K+  A     + + APGTI    K G+ ++  +  + +  +Q+ G       ++ N   E
  S:     6 RIVFAGTPEFAAEHLKALLASQHEVIAVYTQPDRPAGRGQKLMPSPVKQLAVEHGIPVHQPASLRNEEAQAELAALKPDLMVVVAYGLILPQVVLDTPRLGCINSHASLLPRWRGAAPIQRAVQAGDLESGVTVMQMEAGLDTGPMLLKVSTPISAEDTGGSLHDRLARLGPQAVLQAIDGLAAGTLIGELQDDAQANYAHKLNKDEARLDFSRPAVELERLIRAFHPWPICHTTLNGDALKVHAA--ELGEGSGAPGTILAADKNGLTVACGEGALRLTRLQLPGGKPLAFSDLYNSRRE 304
>gi|126728527|ref|ZP_01744343.1| methionyl-tRNA formyltransferase [Sagittula stellata E-37] >gi|126711492|gb|EBA10542.1| methionyl-tRNA formyltransferase [Sagittula stellata E-37] (303 aa)
Score = 437, Expect = 2.1e-41, Identities = 100/296 (33%), Positives = 158/296 (53%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGT--INNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++VFMGTPE +   L+AL+E   DVV V CQP +P GR K+   + V   A+E  +    P  +K  E +    EL     V  A+G  +P ++L  PE GC+NIHASLLP++RG APIH A++ G+ +TGVC+M+    +D G V   +   I   +T   L  +++ +   +++  L+++   E  P+ Q E  V++A  I K +  I++  +A  IV  I GLS  PGA+  +N  ++KL  A+        APG         +   ++     + V E Q  G++ Q+ +  L G
  S:     2 RLVFMGTPEFSVPVLDALVEAGHDVVGVYCQPPRPAGRGKKDRPTPVHARAVELGLPVRHPVSLKSAEAQEAFAELGAEVAVVVAYGLILPQAVLDAPERGCLNIHASLLPRWRGAAPIHRAILAGDADTGVCIMQMEAGLDTGPVLLRKATPIASGETAGQLHDRLSLIGSALIVEALDRL--PELVPVPQPEEGVTYASKIDKAEAAIDWSGDAASIVRQINGLSPFPGAWTTLNGDRVKLLAALP-------APGQAPAGTTLDDRFTVACGTGALRVTEAQRAGRSAQDAETFLRG 292
>gi|19704821|ref|NP_604383.1| methionyl-tRNA formyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] >gi|19715167|gb|AAL95683.1| Methionyl-tRNA formyltransferase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] (317 aa)
Score = 437, Expect = 2.1e-41, Identities = 99/306 (32%), Positives = 180/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAP--GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP  A  +L  +  K  ++++V  + DKP  R K+I +S +K+ A+  N+K +QP   K+  +  E++ +     V  A+G+ +P  ++ IP++G IN+H+SLLP++RG API+ A+ING+ ++G+ +M   +++DAGDV    +  I + DT  +L  ++ ++  D++L  +E +   E    KQD+  V+F     K+D KI++ K + EI N IRG++  P A+  +N   +K+++    +   NNA     +  +  +GI++ T D  +++   + E K +    +++NG   +KIG  L
  S:     9 KIIFMGTPTFAVPSLEKIY-KEHEIISVFTKVDKPNARGKKINYSPIKEFALANNLKIYQPENFKDNTLIEEIRNMQADLIVVVAYGKILPKEVIDIPKYGVINLHSSLLPRFRGAAPINAAIINGDTKSGISIMYVEEELDAGDVILQEETEISDEDTFLSLHDRLKDMGADLLLKAIELIKKGEVKAQKQDKKLVTFVKPFRKEDCKIDWTKTSREIFNFIRGMNPIPTAFSNLNGTIIKIYETKINDKVYNNATCGEVVEYLKGKGIVVKTSDGSLIISSAKPENKKQMSGVDLINGKF-LKIGEKL 316
>gi|33518620|sp|Q8RDM3|FMT_FUSNN Methionyl-tRNA formyltransferase (310 aa)
Score = 437, Expect = 2.4e-41, Identities = 99/306 (32%), Positives = 180/306 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAP--GTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KI+FMGTP  A  +L  +  K  ++++V  + DKP  R K+I +S +K+ A+  N+K +QP   K+  +  E++ +     V  A+G+ +P  ++ IP++G IN+H+SLLP++RG API+ A+ING+ ++G+ +M   +++DAGDV    +  I + DT  +L  ++ ++  D++L  +E +   E    KQD+  V+F     K+D KI++ K + EI N IRG++  P A+  +N   +K+++    +   NNA     +  +  +GI++ T D  +++   + E K +    +++NG   +KIG  L
  S:     2 KIIFMGTPTFAVPSLEKIY-KEHEIISVFTKVDKPNARGKKINYSPIKEFALANNLKIYQPENFKDNTLIEEIRNMQADLIVVVAYGKILPKEVIDIPKYGVINLHSSLLPRFRGAAPINAAIINGDTKSGISIMYVEEELDAGDVILQEETEISDEDTFLSLHDRLKDMGADLLLKAIELIKKGEVKAQKQDKKLVTFVKPFRKEDCKIDWTKTSREIFNFIRGMNPIPTAFSNLNGTIIKIYETKINDKVYNNATCGEVVEYLKGKGIVVKTSDGSLIISSAKPENKKQMSGVDLINGKF-LKIGEKL 309
>gi|15607077|ref|NP_214459.1| methionyl-tRNA formyltransferase [Aquifex aeolicus VF5] >gi|6016036|sp|O67890|FMT_AQUAE Methionyl-tRNA formyltransferase >gi|2984330|gb|AAC07851.1| methionyl-tRNA formyltransferase [Aquifex aeolicus VF5] (303 aa)
Score = 436, Expect = 2.8e-41, Identities = 101/277 (36%), Positives = 157/277 (56%)
  Q:    11 KKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDIL 287
           K+I+FMGTP+ A  +L     K+F V+ VV QPDKP GR K++     K LA +  I  +QP K KE+   ++EL P   V  A+G+ +P  +L +P +  IN+HASLLPKYRG API  A++ GEKETG  +M   ++MDAGD+    K+ IEE D   TL +K+      +++N L   F  +  P+ Q+  + ++A  + K++ +I ++ +A  + + IRGL   P AY      ++K+ KA   + +    PG I +  +  +    K  +IL
  S:     2 KRILFMGTPQFAVPSLEEF-AKNFKVIGVVAQPDKPAGRGKKLTPPPTKVLAQKLGIPIYQPEKKKELIPLVEELKPDCIVVVAYGKILPKEVLDLPPYKTINLHASLLPKYRGAAPIQRAIMAGEKETGNTVMLVNEEMDAGDILAQEKIPIEEEDNFLTLSEKLAKSGAKLLVNTLRLWFEGKVKPVPQNHEEATYAPPVQKEEYRICWKASAESVRDRIRGL--YPNAYTTFRGNRIKILKARVVDLEG--YPGEIQDTKRLIVACGEKSLEIL 273
>gi|113460189|ref|YP_718246.1| methionyl-tRNA formyltransferase [Haemophilus somnus 129PT] >gi|123131909|sp|Q0I182|FMT_HAES1 Methionyl-tRNA formyltransferase >gi|112822232|gb|ABI24321.1| methionyl-tRNA formyltransferase [Haemophilus somnus 129PT] (317 aa)
Score = 436, Expect = 2.9e-41, Identities = 100/305 (32%), Positives = 177/305 (58%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           I+F GTP+ A   L ALL+   +V+AV  QPDKP GR + +  S+VK LA + +I  +QP  ++  E++  L +LN    V  A+G  +P ++L     GC+N+H SLLP++RG API  A+  G+K+TGV +M+  + +D GD+      +I  ++T+++L+ K+ N+    +L  L+ +    +    QDES  ++A  +SK++ K+++  +A ++   IR  +  P +Y    D +     +K+++A S     +   GTI    K GI ++T +  + ++++Q  GK     +++LN  ++  KIG  L
  S:     6 IIFAGTPDFAAQHLQALLQSQHNVLAVYTQPDKPAGRGQTLRASAVKILAEKHHIPVYQPKSLRKVEVQENLSKLNADVMVVVAYGLILPLAVLQTFPLGCLNVHGSLLPRWRGAAPIQRAIWAGDKKTGVTIMQMNEGLDTGDMLHKVCCDITPTETSTSLYTKLANIAPKALLEVLDGLEQSLFKAEVQDESLSNYAEKLSKEEAKLDWSLSAEQLERCIRAFNPWPMSYFVTQDSQGTLQTLKVYQA-SVLPHQDKPCGTILAADKRGIQVATANGVLNLEQLQPAGKKPMSARDLLNSRADWFKIGQVL 317
>gi|119483419|ref|ZP_01618833.1| methionyl-tRNA formyltransferase [Lyngbya sp. PCC 8106] >gi|119458186|gb|EAW39308.1| methionyl-tRNA formyltransferase [Lyngbya sp. PCC 8106] (327 aa)
Score = 436, Expect = 2.9e-41, Identities = 108/296 (36%), Positives = 165/296 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAV-----------------STNSKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KI+F GTP  A  +L  LL    F+V+AVV QPDK  GR  ++  S VK LA+E  I  +QP +IK   E  + LK+    AFV  A+GQ +   IL +P  GCIN H S+LP+YRG API W + NGEK TG+  M     MD G +   +   I   D    L ++++++  D+++  L K    E  P  QD+S+ ++A  I  +D ++++ K+A+ + N +RG    P       ++ +K+   +                  T S  +  PG I +I K  G +I T D  +L+++V++ GK  Q   +  NG
  S:     2 KIIFFGTPLFAVPSLEKLLHHPEFEVLAVVTQPDKRRGRGSKLTPSPVKSLAVEHQIPVWQPKRIKKHPETLSRLKQAQADAFVVVAYGQILSPEILQMPRLGCINGHGSILPEYRGAAPIQWCLYNGEKSTGITTMLMDAGMDTGPMLLKQSTPIGLFDHAINLAERLSSITADLLVETLIKFNRGEIQPTPQDDSQATYASLIKPEDYRLDWSKSALALHNQVRGF--FPNCVTSFREQALKISGTIPLGIKLPSELQELEQQWPTLSPLSGKPGEILHIVKRFGPVIQTGDGLLLLQDVKLAGKRTQSGWDFANG 317
>gi|190576006|ref|YP_001973851.1| putative methionyl-tRNA formyltransferase [Stenotrophomonas maltophilia K279a] >gi|190013928|emb|CAQ47568.1| putative methionyl-tRNA formyltransferase [Stenotrophomonas maltophilia K279a] (307 aa)
Score = 436, Expect = 3.4e-41, Identities = 98/303 (32%), Positives = 169/303 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEI--ENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIK--QDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           +IVF GTPE A  +L A   +  +VVAV  QPD+P GR + +  S VK  A+ + I  +QP  +K+   + +L++L P   V  A+G  +P ++L+IP  GC N+HASLLP++RG API  A+  G+ +TGVCLM+    +D G V   +++ I  +DT   L  K+  L    VL+D   +      PI   Q E  V++A+ + K + ++++ ++A  +   +R  +  P A   +  +++++  AV+  +    APGT+    ++GI I+     + ++ +Q EG       + LN   ++++G
  S:     2 RIVFAGTPEFAVSSLRAA-ARHHEVVAVYTQPDRPAGRGRGLAPSPVKLEAVARGIPVYQPESLKDAAAQQQLRDLQPDLMVVVAYGLILPKAVLAIPTHGCWNVHASLLPRWRGAAPIQRAIQAGDAKTGVCLMQMEAGLDTGPVLLHQELPIASTDTGGQLHDKLAELGAQ-VLSDGLGLLRAGIKPIARPQPEQGVTYAHKLDKAEARLDWAQDADALARTVRAFNPWPIAEATLAGERVRIHGAVALEADHGQAPGTVLAAGRDGIDIACGQGALRLRVLQREGGKAITAADYLNARRDLRVG 306
>gi|150020141|ref|YP_001305495.1| methionyl-tRNA formyltransferase [Thermosipho melanesiensis BI429] >gi|166215524|sp|A6LJK9|FMT_THEM4 Methionyl-tRNA formyltransferase >gi|149792662|gb|ABR30110.1| methionyl-tRNA formyltransferase [Thermosipho melanesiensis BI429] (303 aa)
Score = 436, Expect = 3.4e-41, Identities = 110/296 (37%), Positives = 167/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKI-KEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+F+GTP+ A+  L  L++  FDVVAV+ QPDKP GR K+I+ + VK++A++ NI  FQP K+ KE    ++ L P   +  A+G+ +    L+  EF   N+HASLLP YRG API   + NGEK TG+ + +  + MD G +   ++V + E +T   L++K+ +L    ++  L   + +E  P    E KVSFA  I+K+D K++F K+   + N IR     PG       K +KLF   S    S+   G I +I KEG LIS ++  + V+ +Q  GK +       NG
  S:     2 RILFLGTPDFASVHLEFLMKNGFDVVAVISQPDKPKGRGKKILPTPVKEVALKYNIPVFQPKKLNKEGLKIIENLKPDIGIVVAYGKLLKPPFLNTLEF--YNVHASLLPSYRGAAPIQRVLENGEKRTGITIFKIGEGMDDGPIALKKEVEVGEFETFGELYEKLLDLGKKALIEFLNN-YPIELIP---QEGKVSFAPKITKEDLKLDFSKDVTFVKNKIRAYDPLPGVRVLFKRKIVKLFGVFSVLENSSREIGKIISIDKEGALISCENGSVKVRYIQFPGKRKMTFFEAKNG 292
>gi|28199633|ref|NP_779947.1| methionyl-tRNA formyltransferase [Xylella fastidiosa Temecula1] >gi|182682378|ref|YP_001830538.1| methionyl-tRNA formyltransferase [Xylella fastidiosa M23] >gi|32129528|sp|Q87AR0|FMT_XYLFT Methionyl-tRNA formyltransferase >gi|28057748|gb|AAO29596.1| methionyl-tRNA formyltransferase [Xylella fastidiosa Temecula1] >gi|182632488|gb|ACB93264.1| methionyl-tRNA formyltransferase [Xylella fastidiosa M23] (307 aa)
Score = 435, Expect = 3.5e-41, Identities = 95/302 (31%), Positives = 175/302 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDE--SKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKI 313
           +IVF GTP+ A  +L ++ +++ DVVAV  QPD+P GR +E++ S VK  A+ + +  +QP  ++  E+  +L+ L P   V  A+G  +P+++L+IP+ GC N+HASLLP++RG API  A+  G+ ETGVCLM+    +D G V  S K  I   +T+  L  ++  +   + L+D   +      P+ Q +    V++A+ + K + ++++E+ A  +   +R     P A   ++ +++++ +A++ +   +  PGT+   SKEGI ++     + +  +Q EG     V + LN   ++++
  S:     2 RIVFAGTPDFAVPSLRSVTQRA-DVVAVYTQPDRPAGRGRELMPSPVKLEAVARGLPVYQPQTLRSPEVLEQLRALRPDLIVVVAYGVILPEAVLTIPDDGCWNVHASLLPRWRGAAPIQRAIEAGDTETGVCLMQMEAGLDTGPVLMSLKTPINAHETSGQLHDRLAEMGAQL-LSDGLGLLRAGLRPVPQPQLAVGVTYAHKLGKVESRLDWEQPAERLACRVRAFQPWPVAEVVLSGERVRIHEALALDLDHSQPPGTVLAASKEGIDVACVQGALRLCRLQREGGKAITVADYLNARRDLQV 305
>gi|167729015|emb|CAO79926.1| methionyl-tRNA formyltransferase [Candidatus Cloacamonas acidaminovorans] (314 aa)
Score = 435, Expect = 3.7e-41, Identities = 102/296 (34%), Positives = 162/296 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLE-YPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           + +F+G+ +    ALN L +  ++   ++ QP KP GR   +  + + + AIE+ +  F P  I   E+  ++ E      VT AFG+FI   I ++  FG +N+H SLLPKYRG +PI  A++NGE ETG  +     +MDAG +    K++I E++T S L +++     D++L   +K+   +     KQDESK ++ Y I+    +I++ K   EI N IR  S TPGA+      K+K+  +  T   +N  PG I  I K+ G  ++  DF +L+ +VQ  GK   E    +NG
  S:     2 RYLFIGSSDYGLPALNKLRQNGYEPSLIISQPAKPAGRNLHLTPTPISQYAIEQKLPLFTPMDINSAESITKMAEQKADIIVTAAFGEFINKKIRNLCPFGAVNLHPSLLPKYRGASPIQSAILNGETETGTTISLVSAKMDAGPILAQTKLSIAENETYSELKERLAEQAGDLLLQFWKKLITEKSLCGTKQDESKATYCYKITNKTCQIDWNKRTEEIHNQIRAFSLTPGAWTLFRYNKLKILCSEKTVEPANGEPGLICKIDKKRGFFVNCLDFKLLITKVQPAGKKVMEAVAFING 301
>gi|186899985|ref|ZP_02972945.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 7424] >gi|186692921|gb|EDU17537.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 7424] (334 aa)
Score = 435, Expect = 4.2e-41, Identities = 107/296 (36%), Positives = 171/296 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAV----------------------STNSKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           K+VF GTP+ A  +L  LLE S  DVVAVV QPDKP GR K++I S +KK+A++  I  +QP ++K   +   +L+E N  AF   A+GQ +   IL +P+  CIN+H S+LPKYRG API W++ +GE +TG+  M   + MD G +       I+  D    +   + N   D+++  L K+   E  P  Q+    ++A  I K+D  IN+ ++A++I N +RG    P  +    ++ +K+                          +T S   ++PG + N+ K  G ++ T +  +L+ +VQ+ GK  Q   + +NG
  S:     2 KVVFFGTPQFAVPSLERLLEHSDIDVVAVVTQPDKPRGRGKQLIPSPIKKVALDHQIPIWQPKRVKKNAQTLTKLRETNADAFAVVAYGQILSAEILQMPKLACINVHGSILPKYRGAAPIQWSIYHGETQTGITTMLMDEGMDTGAMLLKAYTPIQLLDNADKIATTLANQGADLLIETLLKLEQGELNPESQNSELATYAPLIQKEDYLINWTRHALQIHNQVRGF--YPNCFTTFREQPLKILATAPLGEAYWEHLPSNIAQKIQPQWTTLSSLTSSPGEVVNLIKNLGPIVQTGEGLLLLLQVQLSGKRPQSGWDFVNG 322
>gi|42782958|ref|NP_980205.1| methionyl-tRNA formyltransferase [Bacillus cereus ATCC 10987] >gi|42738885|gb|AAS42813.1| methionyl-tRNA formyltransferase, putative [Bacillus cereus ATCC 10987] (255 aa)
Score = 435, Expect = 4.2e-41, Identities = 94/248 (37%), Positives = 151/248 (60%)
  Q:    70 FQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILIST-KDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
            QP +I+E +   K   L P   VT AFGQ +P+ IL  P++GCIN+HASLLP+ RGGAPIH+A++ G+++TG+ +M  ++++DAGD+    +V IEE +TT +LF K++     ++   +  +   +  PIKQ E +V+FAYNI ++ EKI++ K   E+ N IRGL+  P AY  +  + +K++         +   GTI  I ++G +++T  +  + V E+Q  GK R      L G ++ +IG  L
  S:     2 LQPLRIREKDEYEKVLALEPDLIVTAAFGQIVPNEILEAPKYGCINVHASLLPELRGGAPIHYAIMEGKEKTGITIMYMVEKLDAGDIXTQVEVEIEERETTGSLFDKLSEAGAHLLSKTVPLLIQGKLEPIKQSEEEVTFAYNIKREQEKIDWTKTGEEVYNHIRGLNPWPVAYTTLAGQVVKVWWGEKVPVTKSAEAGTIVAIEEDGFVVATGNETGVKVTELQPSGKKRMSCSQFLRG-TKPEIGTKL 251
>gi|114770093|ref|ZP_01447631.1| methionyl-tRNA formyltransferase [alpha proteobacterium HTCC2255] >gi|114548930|gb|EAU51813.1| methionyl-tRNA formyltransferase [alpha proteobacterium HTCC2255] (300 aa)
Score = 435, Expect = 4.3e-41, Identities = 102/296 (34%), Positives = 168/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPN--KIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +I+FMG+PE +   L++++    DVVAV CQP +P GR K+   + V   A+E  +    P   K KE  ++   L     V  A+G  +P  IL   + GC+NIHASLLP++RG APIH A+I+G+  TG+C+M+    +D GDV   ++  I  SDTT+ L  ++ ++    +++ L+K   LE  P  Q +  + +A  I K++ KI++ K+A+EI   IRGLS  PGA+    ++++K+   +S   + +  PG I + +     I+ +   + +  +Q  GK   ++KN L G
  S:     2 RIIFMGSPEFSVPILSSIISAGHDVVAVYCQPPRPAGRGKKERLTPVHSHALELGLDVRHPVNFKSKEAVSDFAALKADIAVVVAYGLILPQEILDSVDKGCLNIHASLLPRWRGAAPIHRAIISGDASTGICIMQMDAGLDTGDVLYHKETEILPSDTTAVLHDRLAHIGSQCIVDVLKKYAFLEAVP--QSDIGIIYASKIDKNESKIDWNKSAIEIDRQIRGLSPFPGAWFDDGEQRVKVL--MSEVVEGSGFPGEILDHAT----IACQSGALKLTRLQRAGKGAMDIKNFLLG 291
>gi|30249918|ref|NP_841988.1| Formyl transferase N-terminus:methionyl-tRNA formyltransferase [Nitrosomonas europaea ATCC 19718] >gi|33516851|sp|Q820J7|FMT_NITEU Methionyl-tRNA formyltransferase >gi|30180955|emb|CAD85882.1| Formyl transferase N-terminus:Methionyl-tRNA formyltransferase [Nitrosomonas europaea ATCC 19718] (324 aa)
Score = 435, Expect = 4.5e-41, Identities = 99/297 (33%), Positives = 162/297 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VS-TNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           +I+F GTP+ A  AL  L +   D+V  + QPD+P GR  ++  S VK LA + +I   QP  +K  +I+ +L    P   +  A+G  +P+++L IP  GCINIHASLLP++RG API  A++ G+ ETG+ +M+  + +D G V   R + IE  DTT+TL  K+ +L    ++  L  +         Q+E    +A  I K + +I++  +A  I  +IR     PGA+  +    +KL++A  VS  N  S++  G I  +  +GI+++     + +  +Q  G  +      L G+
  S:     2 RIIFAGTPDFAARALEELQKAGLDIVLTLTQPDRPAGRGMKMQASPVKILAQQYDIPLLQPETLKSSDIQAQLATFKPDVMIVAAYGLLLPEAVLRIPRHGCINIHASLLPRWRGAAPIQRALLEGDTETGISIMQMNQGLDTGAVLLKRSLPIEPYDTTATLHDKLADLGGKCIVEALTLLDQGRLISEPQNEVDACYAAKIRKIEAEIDWTCDAAYIDRMIRTFDPHPGAFTHLQGNTIKLWQARIVSHVNHNSSHQAGKIITVDPDGIVVACGRDALSIDILQKAGGKKLTAAQFLAGH 303
>gi|90019669|ref|YP_525496.1| methionyl-tRNA formyltransferase [Saccharophagus degradans 2-40] >gi|89949269|gb|ABD79284.1| methionyl-tRNA formyltransferase [Saccharophagus degradans 2-40] (322 aa)
Score = 434, Expect = 5.4e-41, Identities = 100/295 (33%), Positives = 157/295 (53%)
  Q:    13 IVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           IVF GTPE A   L ALL+   ++VA   QPD+P GR K++  S VK +A    +  +QP   K  E++  L  L P   V  A+G  +P  +L  P  GCIN+H SLLP++RG API   +  G+ ETG+ +M+    +D GD+      +I+  +T +TL  K+  +    +L+ L  + +    P  QD S  ++A+ + K +  IN++ +A EI   IR  +  P     +         +K+++A   N K   APG I N +K GI ++     I++  +Q+ GK   +  + LNG
  S:     9 IVFAGTPEFAARHLEALLQSPHNIVAAYTQPDRPKGRGKKLTASPVKDVAQAAGVPVYQPINFKSEEDQAALAALKPDIMVVVAYGLLLPQVVLDTPTLGCINVHGSLLPRWRGAAPIQRCIEAGDTETGITIMQMDAGLDTGDMLLKTVCDIKADETAATLHDKLAEMGPPALLSALHMLASDTAEPEAQDNSLATYAHKLLKPEAAINWQIDASEIHRRIRAFNPFPICNSELQPADAEPMVVKIYQAQLANGKG--APGAILNANKAGIEVACGSGSIVITSLQLPGKKPMDAASFLNG 308
>gi|46446038|ref|YP_007403.1| methionyl-tRNA formyltransferase [Candidatus Protochlamydia amoebophila UWE25] >gi|73919411|sp|Q6ME71|FMT_PARUW Methionyl-tRNA formyltransferase >gi|46399679|emb|CAF23128.1| probable methionyl-tRNA formyltransferase [Candidatus Protochlamydia amoebophila UWE25] (318 aa)
Score = 434, Expect = 5.7e-41, Identities = 104/302 (34%), Positives = 168/302 (55%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFIN----DKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           +  K++F GTP  A   L  LL+   +VVAV+ +PD+P GR    + + VK +A   ++  +QP  +  ++    LK      FV  A+G+ I   +L +P+  CIN+HASLLPKYRG API  ++I GEKETGV +M  +K+MDAGD+     V I    T   L + +  +    +L  +++    E     QD    +FA  I  +D ++++ ++A  + +L+RG++  PGA+C++      K++K+ +       S N PGTI + SK  + I T D  + + EVQ+EGK     +  + G S+
  S:     4 RKMKVIFFGTPLFAAQVLEFLLQNQVEVVAVISKPDRPKGRSSIPVPTPVKLIAQSYHLPLYQPEVVSSLDFAPVLKNYEADLFVVVAYGEIIKQHLLDMPKRACINLHASLLPKYRGAAPIQRSIIEGEKETGVTIMHMVKKMDAGDMIKKVSVQITSEMTYGELEQALCQIGKHALLEVIKQFDRGEPSRQIQDSHLATFAPKIELEDCELDWNQSAQHLHDLVRGVNPYPGAWCYVKVNGEQKRLKISRTRVIPYPS-NCPGTILDSSKGNLKILTGDQALELVEVQLEGKKTMTSEQWIRGMSK 310
>gi|177666103|ref|ZP_02941899.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 8801] >gi|172074787|gb|EDT60204.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 8801] (332 aa)
Score = 434, Expect = 5.8e-41, Identities = 106/303 (34%), Positives = 173/303 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE---NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAV-------------------STNSKSN--NAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           KI+F+GTP+ A   L  LL+   FDV+ VV QPDK  GR  ++I S +KK+A+E  +  +QP  +K+     ++LKE    AFV  A+GQ +   IL++P+ GCIN+H S+LP+YRG API W++ +G+KETG+  M   + MD G +       I   D    L +K+     D+++  L+K+   +     QD  + ++A  I K D  +++ K+A+ I N IR     P       ++ +K+   +                    T   +N     G + +I K  G +I T +  +L+KEVQ+ GK +Q   + +NG + +++G
  S:     2 KIIFLGTPQFAIPTLQKLLDHPDFDVIGVVTQPDKRRGRGNQLIPSPIKKIALEHGLTVWQPKNLKKARTTLSQLKEAQADAFVVVAYGQLLSSEILAMPKLGCINVHGSILPQYRGAAPIQWSIYHGDKETGITTMLMDEGMDTGAMLIKAYTPIHLLDNAHELAEKLAEQGADLLIETLQKLKLGDITATAQDNDQATYAPLIEKSDYVVDWTKSAIAIHNQIRAF--YPNCVATFRNQSLKIMATIPLGDTYWEQLPEEFQKLQQQTTMLANIKGKTGEVVSIIKNFGAVIQTGEGLLLLKEVQLSGKRQQSGWDFVNG-TRLEVG 327
>gi|196181920|gb|EDX76907.1| methionyl-tRNA formyltransferase [Microcoleus chthonoplastes PCC 7420] (335 aa)
Score = 434, Expect = 5.9e-41, Identities = 105/295 (35%), Positives = 165/295 (55%)
  Q:    13 IVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL----------FKAVSTNSK-----------SNNAPGTINNISK-EGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++F GTP+ A   L  L+  S F+V+ VV QPDK  GR  ++  S +K LA+   +  +QP ++K   E  ++LK+     FV  A+GQ +   IL +P  GC+N+H SLLPKYRG API W +  GE ETG+  M     MD G +       I   D    L  ++++L  D+++  L K+   +  PI QD S+ ++A  I K D  +++ ++A+EI N IRG    P       D+ +K+          F  + T+ K           ++  PG + +I K  G +I T +  +L++EV++ GK  Q   +  NG
  S:     3 VIFFGTPQFAVPTLERLINHSEFNVLGVVTQPDKRRGRGNKLSPSPIKTLALTHQLHVWQPKRVKKHTETLSQLKQAEADVFVVVAYGQILSQEILDMPRLGCVNVHGSLLPKYRGAAPIQWCLYQGETETGITTMLMDAGMDTGPMLLKAHTPIGLLDDAHQLAVRLSDLGADLLIETLLKLNQGDVQPIAQDNSQATYAPLIQKSDYAVDWSQSAIEIHNQIRGF--IPNCVASFRDQSLKILATAPLGEAYFPQLPTDFKISEQQWLSVKEASGHPGEVVSIIKGMGPIIQTGEGLLLLREVKLAGKRAQSAWDFANG 321
>gi|189463823|ref|ZP_03012608.1| hypothetical protein BACINT_00156 [Bacteroides intestinalis DSM 17393] >gi|189438773|gb|EDV07758.1| hypothetical protein BACINT_00156 [Bacteroides intestinalis DSM 17393] (323 aa)
Score = 433, Expect = 6.7e-41, Identities = 101/296 (34%), Positives = 164/296 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDE----SKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IV+MGTP+ A  +L  L+E  ++VV V+  PDKP GR  ++ FS VK+ A+E+N+   QP K+K+      L+E      +  AF + +P+ + ++P  G  N+HASLLP+YRG API+WAVING+ ETG+       ++D G+V    ++ I ++D    +  K+  L   +V   ++ + N    PI Q+E     ++  A  I KD  +I++ +    I + IRGLS  P A+  +         +K+F+          APGT+    K  I ++  D  I +  +Q+ GK R +   +L G
  S:     8 RIVYMGTPDFAVESLRCLVEGGYNVVGVITMPDKPAGRGHKLQFSPVKQYALEQNLPLLQPEKLKDEVFVEALREWKADLQIVVAF-RMLPEVVWNMPRLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTFFLRHEIDTGEVIQQVRIPIADTDNVGIVHDKLMMLGGKLVTETVDAILNDAVKPIPQEEMAIVGELRPAPKIFKDTCRIDWNQPVKRIYDFIRGLSPYPTAWSELVQSDGEAVVVKIFETKKILKSHELAPGTLLTDGKTYIHVAAADGFIDIHALQLPGKKRLKTDELLRG 313
>gi|145300987|ref|YP_001143828.1| methionyl-tRNA formyltransferase [Aeromonas salmonicida subsp. salmonicida A449] >gi|172044481|sp|A4ST58|FMT_AERS4 Methionyl-tRNA formyltransferase >gi|142853759|gb|ABO92080.1| methionyl-tRNA formyltransferase [Aeromonas salmonicida subsp. salmonicida A449] (314 aa)
Score = 433, Expect = 7.4e-41, Identities = 96/299 (32%), Positives = 164/299 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE 310
           K++F GTP+ A   L ALL    +VVAV  QPDKP GR +++  S VK+LA+  N+  +QP  ++  E + EL  L     V  A+G  +P  +L  P  GCIN+H SLLP++RG API  ++  G+ ETGV +M+    +D G +       I  ++T+++L+ K+  L    +++ +  +   E    +QD++  ++A  +SK++ +I++   AV I   IR  +  P ++  +  + +K+++A   NS      GT+    K+GI I+T    + +  +Q  GK    V ++LN   +
  S:     5 KLIFAGTPDFAARHLAALLSSDHEVVAVYTQPDKPAGRGQKLTASPVKELALTHNLPVYQPASLRKEEAQAELASLGADLMVVVAYGLILPKVVLDTPRLGCINVHGSLLPRWRGAAPIQRSIWAGDTETGVTIMQMDVGLDTGAMIRKVTCPIAANETSTSLYDKLAELGPQALVDTINAMAAGETAAEEQDDALANYAEKLSKEEARIDWSMEAVAIDRCIRAFNPWPISWFEVAGQTIKVWQAEVINSDHGQPTGTLLKADKQGIDIATGLGVLRLLTLQPPGKKAMSVSDLLNSRRD 305
>gi|57233688|ref|YP_182335.1| methionyl-tRNA formyltransferase [Dehalococcoides ethenogenes 195] >gi|57224136|gb|AAW39193.1| methionyl-tRNA formyltransferase [Dehalococcoides ethenogenes 195] (312 aa)
Score = 433, Expect = 7.7e-41, Identities = 95/306 (31%), Positives = 159/306 (51%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +IVFMG+PE A   L  LL + + +  V  QPD+P GR +E+    VK LA+E+ +  +QP  +K+ E +  L  L P   V  A+G  +P ++L IP +G +NIH SLLP+YRG  P+   ++ G++  GV LM+    +D G VY    + +   DTT  L  K+  +   ++L  L ++ +L  P + QD +K ++   ++KD  ++N++  A EI   +R     PG +   N K +K+ +A          P  +     + I++ +   ++ +  +Q+EGK      + L G      GV L
  S:     5 RIVFMGSPEFALTPLKMLLAEGYAICGVYTQPDRPAGRGRELCPPPVKALALERGLAVYQPQSLKKPEEQAVLSGLKPDVIVVAAYGLILPQAVLDIPAYGVLNIHPSLLPRYRGATPVAATLLGGDEWAGVSLMKLEAGLDTGPVYSRAAIPVRPEDTTPLLADKLAFIGGCLLLELLSRIPSLPQPEL-QDNAKATYFGMVTKDMGQVNWQTPAAEIERRVRAFFPWPGVFTSYNQKTLKILEARPQKLGLGLQPSQVRVYEGDRIMVGSASGELEIIRLQLEGKAACSAADFLRGQRHFD-GVNL 310
>gi|157363556|ref|YP_001470323.1| methionyl-tRNA formyltransferase [Thermotoga lettingae TMO] >gi|166988371|sp|A8F525|FMT_THELT Methionyl-tRNA formyltransferase >gi|157314160|gb|ABV33259.1| methionyl-tRNA formyltransferase [Thermotoga lettingae TMO] (302 aa)
Score = 432, Expect = 8.3e-41, Identities = 103/296 (34%), Positives = 161/296 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KI+F+GTP  A+  L ALL     V+ V+ QPDKP GR   ++ S VK LA++  I  F+  K    +     L P   +  A+G  I    L +  FG  NIH SLLPKYRG API+ A+ NGEK TGV L +  +++DAG +    +++++  +T  +L  +M      I+ + L+   + E    +QD S+ S+A  I+  D  ++F K++  + N IR     PGA  F + +++KLF AV+     +  PGTI +I  +G  ++T D  I++ ++Q   K +    + LNG
  S:     2 KILFLGTPLYASRHLEALLSAGHMVIGVITQPDKPAGRGLRMVHSPVKDLALKNKIPVFESLK----DFPFDRLTPDIGIVVAYGGLIKKKFLDLIPFGYYNIHPSLLPKYRGAAPINRALENGEKMTGVSLFKLTEKLDAGPIVLQVEISVDCFETFDSLENRMIEAGKKILCDFLKNPESFELR--EQDHSQASYAPKITPADLFVDFRKDSEAVKNKIRAYDSRPGARTFFHGEQVKLFGAVAIEKCHSGEPGTIVHIDDKGAYVTTSDGIIVISQIQFPSKKKMSFLSALNG 291
>gi|56751991|ref|YP_172692.1| methionyl-tRNA formyltransferase [Synechococcus elongatus PCC 6301] >gi|81300919|ref|YP_401127.1| methionyl-tRNA formyltransferase [Synechococcus elongatus PCC 7942] >gi|123728141|sp|Q31LC9|FMT_SYNP7 Methionyl-tRNA formyltransferase >gi|73919422|sp|Q5N0J8|FMT_SYNP6 Methionyl-tRNA formyltransferase >gi|56686950|dbj|BAD80172.1| methionyl-tRNA formyltransferase [Synechococcus elongatus PCC 6301] >gi|81169800|gb|ABB58140.1| methionyl-tRNA formyltransferase [Synechococcus elongatus PCC 7942] (327 aa)
Score = 432, Expect = 8.3e-41, Identities = 97/285 (34%), Positives = 172/285 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEK-SFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNA----------------PGTINNISKE-GILISTKDFDILVKEVQIEGK 296
           ++VF GTP+ A   L  LL+    +V+AVV QPD+  GR  ++  S VK LAI  ++  +QP +++   E+ ++L++    AFV  A+GQ +P  +L++P  GCIN+H SLLP YRG API W++ING++ETG+  M+    MD G +       I   D + TL  ++     +++L  L ++       I Q+E++ ++A  + K+D +++++++A+E+ N IRGL   PGA   +   ++K+  ++        +                PGT+  I+K  G +++T++  +L+ +VQ  G+
  S:     2 RVVFFGTPQFAVPTLQQLLDAPDVEVMAVVSQPDRRRGRGNQVSASPVKALAIAYDLPVWQPERLRRDPEVLSQLQQTQADAFVVVAYGQLLPAEVLAMPRLGCINVHGSLLPAYRGAAPIQWSLINGDRETGIVTMQMDVGMDTGPMLLRWTTPIALDDNSQTLGDRLATAGAELLLQTLRQLDQGHLTAISQNEAEATYARLLQKEDFQLSWDQSALELHNRIRGL--YPGASLPVQGDRLKVLASLPLGLGLLLSAAYADWQDWQPDPAAQPGTVLAIAKSLGPIVATREGALLLLQVQPAGR 305
>gi|68171442|ref|ZP_00544831.1| Methionyl-tRNA formyltransferase [Ehrlichia chaffeensis str. Sapulpa] >gi|67999143|gb|EAM85804.1| Methionyl-tRNA formyltransferase [Ehrlichia chaffeensis str. Sapulpa] (307 aa)
Score = 432, Expect = 8.5e-41, Identities = 110/298 (36%), Positives = 178/298 (59%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSS-VKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           KI+FMG+PE +  AL ALLE K  +V+AV  +  KP GR+ +++  + +  +A + NI+   P  +K    + K   LNP   V  A+G  IP+++LSIP++GCINIH SLLP++RG APIH+A+++G+++TGV +M+  +  D GD+   R + I+E D   TL +K++NL   +++  L  + +L   PIKQ+ +  ++   I   D  I+  + A  I   IR L   P A+ F NDK++++ KA     +   N  PGT+ N     + I  K+  ++   VQ+EGKN   + + ++G S
  S:     6 KIIFMGSPEFSVPALCALLEEKDHEVIAVYTRLPKPAGRRGKVLTKTPIHIIAEQNNIEVNTPKSLKHDYEQEKIFALNPDVIVVVAYGLIIPEAVLSIPKYGCINIHPSLLPRWRGAAPIHYAILSGDEQTGVTIMQMNELWDEGDILLQRDIPIDEQDNIDTLSQKLSNLGSSMLIEVLNNIDHL--VPIKQNANDATYTNKII--DFHIDCNEEAQVICRKIRAL--YPKAFLFFNDKRLRILKANYCPDSDLQNLKPGTVIN---SHMHIKCKNGVLIPLIVQLEGKNPCSINDFIHGYS 300
>gi|88658426|ref|YP_507692.1| methionyl-tRNA formyltransferase [Ehrlichia chaffeensis str. Arkansas] >gi|123736380|sp|Q2GFU1|FMT_EHRCR Methionyl-tRNA formyltransferase >gi|88599883|gb|ABD45352.1| methionyl-tRNA formyltransferase [Ehrlichia chaffeensis str. Arkansas] (303 aa)
Score = 432, Expect = 9.1e-41, Identities = 110/298 (36%), Positives = 178/298 (59%)
  Q:    12 KIVFMGTPEIATYALNALLE-KSFDVVAVVCQPDKPIGRKKEIIFSS-VKKLAIEKNIKFFQPNKIKEIENELK--ELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           KI+FMG+PE +  AL ALLE K  +V+AV  +  KP GR+ +++  + +  +A + NI+   P  +K    + K   LNP   V  A+G  IP+++LSIP++GCINIH SLLP++RG APIH+A+++G+++TGV +M+  +  D GD+   R + I+E D   TL +K++NL   +++  L  + +L   PIKQ+ +  ++   I   D  I+  + A  I   IR L   P A+ F NDK++++ KA     +   N  PGT+ N     + I  K+  ++   VQ+EGKN   + + ++G S
  S:     2 KIIFMGSPEFSVPALCALLEEKDHEVIAVYTRLPKPAGRRGKVLTKTPIHIIAEQNNIEVNTPKSLKHDYEQEKIFALNPDVIVVVAYGLIIPEAVLSIPKYGCINIHPSLLPRWRGAAPIHYAILSGDEQTGVTIMQMNELWDEGDILLQRDIPIDEQDNIDTLSQKLSNLGSSMLIEVLNNIDHL--VPIKQNANDATYTNKII--DFHIDCNEEAQVICRKIRAL--YPKAFLFFNDKRLRILKANYCPDSDLQNLKPGTVIN---SHMHIKCKNGVLIPLIVQLEGKNPCSINDFIHGYS 296
>gi|71898894|ref|ZP_00681061.1| Methionyl-tRNA formyltransferase [Xylella fastidiosa Ann-1] >gi|71731306|gb|EAO33370.1| Methionyl-tRNA formyltransferase [Xylella fastidiosa Ann-1] (307 aa)
Score = 432, Expect = 9.9e-41, Identities = 95/302 (31%), Positives = 176/302 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDE--SKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKI 313
           +IVF GTP+ A  +L ++ +++ DVVAV  QPD+P GR +E++ S VK  A+ + +  +QP  ++  E+  +L+ L P   V  A+G  +P+++L+IP+ GC N+HASLLP++RG API  A+  G+ ETGVCLM+    +D G V  S K  I   +T+  L  ++  +   + L+D   + +    P+ Q +    V++A+ + K + ++++E+ A  +   +R     P A   ++ +++++ +A++ +   +  PGT+   SKEGI ++     + +  +Q EG     V + LN   ++++
  S:     2 RIVFAGTPDFAVPSLRSVTQRA-DVVAVYTQPDRPAGRGRELMPSPVKLEAVARGLPVYQPQTLRSPEVLEQLRALRPDLIVVVAYGVILPEAVLTIPDDGCWNVHASLLPRWRGAAPIQRAIEAGDTETGVCLMQMEAGLDTGPVLMSLKTPINAHETSRQLHDRLAEMGAQL-LSDGLGLLHAGLRPVPQPQLAVGVTYAHKLGKVEARLDWEQPAERLACRVRAFQPWPVAEVVLSGERVRIHEALALDLDHSQPPGTVLAASKEGIDVACVQGALRLCRLQREGGKAITVADYLNVRRDLQV 305
>gi|32491244|ref|NP_871498.1| hypothetical protein WGLp495 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] >gi|31340071|sp|Q8D259|FMT_WIGBR Methionyl-tRNA formyltransferase >gi|25166451|dbj|BAC24641.1| fmt [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] (319 aa)
Score = 431, Expect = 1.1e-40, Identities = 107/300 (35%), Positives = 180/300 (60%)
  Q:     6 NSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNK---IKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKV----FNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNIL 305
           NS K+ +IVF GT + +   L ALLE    VV ++  PD+  GR  +I FS VKKLA   NIK  QP+    +  +EN+LK++     +  ++   +   ILS+P  GCIN+H+SLLP++RG APIH A+ +G+K TG+ +++   ++D G +   R  +I+++DTT TL  K++ +    ++  L ++    +NL+Y    Q+ S  ++A  I+K + KIN+   A+ I   IR  +  P +Y +I+ K ++ +KA +  N+   + PG I N++ +GI + T    ++++ +Q+ GK R  VK  L
  S:     2 NSSKSLRIVFAGTSQFSYEFLYALLESRHVVVGILANPDRFSGRGHKIKFSPVKKLAKYYNIKILQPDSTESLDNLENDLKKMRCDIIIVVSYSIILSKKILSLPRLGCINLHSSLLPRWRGAAPIHRALQSGDKTTGITIIKMNDEIDTGPILYKRVCSIQDTDTTETLLNKLSIIGKAAIIQLLHQISIGKYNLQY----QNNSIATYAKKINKKEAKINWNLPAINIDRNIRAFNPWPVSYFWISGKYIRAWKAKIDINNIFISDPGKILNVNSDGIHVGTGKGILILEVLQLSGKKRSFVKESL 305
>gi|196235321|ref|ZP_03134124.1| methionyl-tRNA formyltransferase [Thermus aquaticus Y51MC23] >gi|196220583|gb|EDY15199.1| methionyl-tRNA formyltransferase [Thermus aquaticus Y51MC23] (304 aa)
Score = 431, Expect = 1.2e-40, Identities = 96/285 (33%), Positives = 161/285 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGK 296
           ++ F GTP  A   L+AL  +   VV VV QPDKP GR  +   S V + A+E  +   +P ++K   E     +  +P   VT A+G+ +P  +L +P +G +N+H SLLPKYRG AP+ WA+I GEKETGV +M+T + +D G +Y   +  I   +    L +++ +   +++L  L+ + +L   P    E + S+A  ++K++ +I F ++A  I N  RG+   PG++ F   +++K+ K      +    PG +  + +EG+L+ T +  I + EVQ EG+
  S:     2 RVAFFGTPSWAVPVLDAL-NRYHQVVLVVTQPDKPKGRGLKPAPSPVAQYALEHGLPLLKPERLKGNEEFLETFRAASPEVAVTAAYGKILPKEVLEVPPYGFLNLHPSLLPKYRGPAPVPWALIRGEKETGVAIMKTEEGLDTGPLYALWRTEILPEEDAVALSERLRDKGIELLLKVLQDLPHLTPTP---QEGEASYAPLLTKEEGRIRFGESAEAIYNRHRGVQPWPGSHFFHEGRRVKVLKMRPEPGQGE--PGVVQAVGREGVLVGTGEGLIRLLEVQPEGR 283
>gi|83951628|ref|ZP_00960360.1| methionyl-tRNA formyltransferase [Roseovarius nubinhibens ISM] >gi|83836634|gb|EAP75931.1| methionyl-tRNA formyltransferase [Roseovarius nubinhibens ISM] (302 aa)
Score = 431, Expect = 1.3e-40, Identities = 97/296 (32%), Positives = 164/296 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           ++VFMGTP+ +   L AL +   ++ AV CQP +P GR K++  S V+  A E  +    P  +K  E ++E   L     V  A+G  +P +IL  P  GC+NIHASLLP++RG APIH A++ G+ ETG+C+M+  + +D G V   R   I   +TT  L  +++ +  +++++ L ++  L   P  Q E+ V++A  I K + +I++   A E+   IRGLS  PGA+  +  +++KL    S  ++   APG + +   +G+ ++     + +  +Q  G+  Q+    L G
  S:     2 RVVFMGTPDFSVPVLQALQDAGHEIAAVYCQPPRPAGRGKKLRPSPVQARAEELGLLVRHPESLKTPEAQDEFAALGADVAVVVAYGLLLPRAILDAPAKGCLNIHASLLPRWRGAAPIHRAIMAGDAETGICIMQMEEGLDTGPVLLRRATPIGPRETTGQLHDRLSVMGAELIIDALGQLDELTPEP--QPEAGVTYAAKIDKAEARIDWGWRAAEVDRTIRGLSPFPGAWVEVAGERIKLL--ASEQAEGCGAPGEVLD---DGLRVACGQGAVRLLRLQRAGRGAQDAPEFLRG 292
>gi|89052960|ref|YP_508411.1| methionyl-tRNA formyltransferase [Jannaschia sp. CCS1] >gi|123094406|sp|Q28V76|FMT_JANSC Methionyl-tRNA formyltransferase >gi|88862509|gb|ABD53386.1| methionyl-tRNA formyltransferase [Jannaschia sp. CCS1] (301 aa)
Score = 430, Expect = 1.4e-40, Identities = 104/307 (33%), Positives = 164/307 (53%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           +I+FMGTP+ +   L+AL+    +VVAV  QP +P GR K    S V+  A    +    P  +K  E +  L +LN    V  A+G  +P ++L  P  GC+NIHASLLP++RG APIH A++ G+  TGVC+M+    +D G V   R+ +I   DTT TL  +++ +    +++ L ++   E  P  Q +  V++A  I K + K+++   A  I   I GLS  PGA+     K++KL +     S+  N  G +  +   G+ ++  D  + +  VQ EGK   + K+ L G + I  G  L+
  S:     2 RIIFMGTPDFSVPVLDALVAAEHEVVAVYSQPPRPAGRGKRDRPSPVQARAETLGLTVRNPVSLKSTEEQSALADLNADVAVVVAYGLILPQAVLDAPARGCLNIHASLLPRWRGAAPIHRAIMAGDTMTGVCIMQMEAGLDTGPVLLRRETSIGAEDTTGTLHDRLSAIGAKAIVDALSQLD--ELTPKPQPDDGVTYATKIDKSEAKVDWTAPAPHINRQILGLSPFPGAWTMAGGKRLKLLQ-----SRVANGTGALGEV-LHGLTVACGDGAVEISRVQPEGKGAMDAKDWLLG-ARIAPGTVLE 301
>gi|160883233|ref|ZP_02064236.1| hypothetical protein BACOVA_01202 [Bacteroides ovatus ATCC 8483] >gi|156111458|gb|EDO13203.1| hypothetical protein BACOVA_01202 [Bacteroides ovatus ATCC 8483] (336 aa)
Score = 430, Expect = 1.5e-40, Identities = 102/296 (34%), Positives = 168/296 (56%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKV----SFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYC-FINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IV+MGTP+ A  AL  L+E  ++VV V+  PDKP GR  +I +S VK+ A+E+N+   QP ++K+      L+E      +  AF + +P+ + ++P  G  N+HASLLP+YRG API+WAVING+ ETG+       ++D G+V     V I ++D    +  K+  L   +VL  ++ + N    PI Q+E  V      A  I K+  +I++ +   +I + IRGLS  P A+   I  ++     +K+F++         A GTI    K+ + ++  D  + +  +Q+ GK R ++  +L G
  S:    20 RIVYMGTPDFAVEALRQLVEGGYNVVGVITMPDKPAGRGHKIQYSPVKQYALEQNLPLLQPERLKDEVFVEALREWKADLQIVVAF-RMLPEVVWNMPRLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTFFLKHEIDTGEVIQQVHVPIADTDNVEVVHDKLMVLGGKLVLETVDAILNGTVKPIPQEEMAVVGELRPAPKIFKETCRIDWNQPVKKIYDFIRGLSPYPAAWSELITSEEGAAVVVKIFESEKIYESHQLATGTIVTDGKKFMKVAVPDGFVSILSLQLPGKKRLKIDELLRG 326
>gi|104161992|emb|CAJ75701.1| methionyl-tRNA formyltransferase [uncultured Thermotogales bacterium] (310 aa)
Score = 430, Expect = 1.6e-40, Identities = 106/296 (35%), Positives = 161/296 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIE--NELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFN--LEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA-VSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KIVFMGTPE A   L  ++E    V  V  QPD+P GR +++  + VK +A    I  FQP KI   E   +L EL+P   V  AFG+ +   ++++P  GC N+HASLLPKYRG API  A+ NGE +TG+ + +  + MD G +   R++ I  SD+  +L+ K+  L    +++ LE+V    LE  P    +   SFA  I  +D  I+   +A ++VN IR     PGA   +  +  K+F A +   ++     G I  I   G+++S    ++++  VQ  GK     K+ L+G
  S:     2 KIVFMGTPEFAAAHLKEIVESGNKVAGVFSQPDRPKGRGQKVEPTPVKTVATNYGIPVFQPEKINSDEGFEKLSELSPDIIVVVAFGKLLKSGVINLPTIGCFNVHASLLPKYRGAAPIQRAIENGETKTGITIFKIDEGMDTGAIALKRELEIHPSDSFGSLYLKLAELGKKTLVHFLERVKEGRLELAP---QDGIPSFAPKIQPEDLVISDLSDAAKVVNKIRAYDPQPGARVSVEGRISKVFGASLKCRNEGKGIVGEIVKIDDRGMIVSCGAENVIISLVQFPGKKPMRPKDALSG 299
>gi|47459240|ref|YP_016102.1| methionyl-tRNA formyltransferase [Mycoplasma mobile 163K] >gi|47458569|gb|AAT27891.1| methionyl-tRNA formyltransferase [Mycoplasma mobile 163K] (278 aa)
Score = 430, Expect = 1.6e-40, Identities = 106/285 (37%), Positives = 167/285 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAV-EIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGK 296
           KI+  GTP+ +      +++K ++VVA++ QPDK   R  +   S V  LA +  IK F+P KI +I +EL++L+   F+T AFGQ+IP +IL +P+   +NIH SLLPKYRG API  A++NG+ +TG+ L+   K+MDAG++  + +  I ++D   ++F KM+ +    +   LE +   ++  I QDE   + A  + K+D KI+ EK    EI N +R  S  PG+Y F+N K++K+F+   TN              K+G+ I  K+  +   + QIEGK
  S:     2 KIILAGTPDFSVPIFEEIIKK-YEVVAIITQPDKQANRGLKTQESPVSFLANKYKIKLFKPEKISQIFHELEKLDFDFFLTAAFGQYIPTNILELPKKASLNIHGSLLPKYRGAAPIQHAILNGDLKTGISLIYMTKKMDAGNILKTEEFEIYDNDDADSIFLKMSLIASKKINFWLESIMKNDFEEIVQDEFFATQAPKLLKEDAKIDLEKMTFEEIKNKVRAFSSNPGSYIFLNKKRVKIFRVSLTN--------------KKGLEIKYKNGLLYATKYQIEGK 272
>gi|21233176|ref|NP_639093.1| methionyl-tRNA formyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66770116|ref|YP_244878.1| methionyl-tRNA formyltransferase [Xanthomonas campestris pv. campestris str. 8004] >gi|81303932|sp|Q4UQ15|FMT_XANC8 Methionyl-tRNA formyltransferase >gi|23821554|sp|Q8P4G0|FMT_XANCP Methionyl-tRNA formyltransferase >gi|21115025|gb|AAM43005.1| 10-Formyltetrahydrofolate:L-methionyl-tRNA N-formyltransferase [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|66575448|gb|AAY50858.1| 10-Formyltetrahydrofolate:L-methionyl-tRNA N-formyltransferase [Xanthomonas campestris pv. campestris str. 8004] (307 aa)
Score = 430, Expect = 1.7e-40, Identities = 102/300 (34%), Positives = 164/300 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIEN--ELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESK--VSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           +IVF GTP+ A  +L A  ++  +VVAV  QPD+P GR + +  S VK  AI + I  FQP  ++  E    L+ L P   V  A+G  +P ++L+ P  GC N+HASLLP++RG API  A+  G+ ETGVCLM+    +D G V  S++V I E +T   L  ++  L    VL+D   +      P+ Q +    V++A+ + K   ++++ + A E+   +R  +  P A   +  ++++L  AV+ +     APGT+   SK+GI I+     + V+ +Q EG       + LN   ++
  S:     2 RIVFAGTPDFAVASLRAAAQRH-EVVAVYTQPDRPAGRGRGLTPSPVKLDAIARGIPVFQPQTLRSPEALATLRALQPDLMVVVAYGLILPKAVLAAPTHGCWNVHASLLPRWRGAAPIQRAIEAGDTETGVCLMQMEAGLDTGPVLLSQRVEIGEQETGGQLHDRLAALGAQ-VLSDGLGLLRAGIRPVAQPQPAEGVTYAHKLDKAQARLDWAQPAEELARRVRAFNPWPVAEAILAGERVRLHGAVALDLAHQQAPGTLLAASKQGIDIACGQGALRVRVLQREGGKAITAADYLNARRDL 303
>gi|194367356|ref|YP_002029966.1| methionyl-tRNA formyltransferase [Stenotrophomonas maltophilia R551-3] >gi|194350160|gb|ACF53283.1| methionyl-tRNA formyltransferase [Stenotrophomonas maltophilia R551-3] (307 aa)
Score = 430, Expect = 1.7e-40, Identities = 98/303 (32%), Positives = 169/303 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIK--QDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIG 314
           +IVF GTPE A  +L A   +  +VVAV  QPD+P GR + +  S VK  A+ + I  +QP  +K+   + +L++L P   V  A+G  +P ++L+IP  GC N+HASLLP++RG API  A+  G+ +TGVCLM+    +D G V   +++ I  +DT   L  K+  L    VL+D   +      P+   Q E  V++A+ + K + ++++  +A  +   +R  +  P A   +  +++++  AV+ +     APGT+   S++GI I+     + ++ +Q EG       + LN   ++++G
  S:     2 RIVFAGTPEFAVSSLRAA-ARHHEVVAVYTQPDRPAGRGRGLAPSPVKLEAVARGIPVYQPESLKDEAAQQQLRDLQPDLMVVVAYGLILPKAVLAIPTHGCWNVHASLLPRWRGAAPIQRAIQAGDTKTGVCLMQMEAGLDTGPVLLHQELPIATTDTGGQLHDKLAELGAQ-VLSDGLGLLRAGIKPVARPQPEQGVTYAHKLDKAEARLDWVLDAGALARTVRAFNPWPIAEASLAGERVRIHGAVALDLAHGQAPGTVLAASRDGIDIACGQGALRLRVLQREGGKAITAADYLNARRDLRVG 306
>gi|149372185|ref|ZP_01891455.1| methionyl-tRNA formyltransferase [unidentified eubacterium SCB49] >gi|149354952|gb|EDM43514.1| methionyl-tRNA formyltransferase [unidentified eubacterium SCB49] (316 aa)
Score = 429, Expect = 1.9e-40, Identities = 102/300 (34%), Positives = 179/300 (59%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVF--NLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYC-FINDKKMKLFKAVSTNSKSNNAPGTINNI--SKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           K+ +IVF+GTP+ A   L +L+E    +V V+  PD+P GR +++  S+VK+ A+ + +   QP  +K  +    LK L     +  AF + +P  + S+PE G  N+HASLLP+YRG API+WA+INGEKETGV      +++D G +     V I+E++T  +L   + +L  ++VL  ++ +   N+E  P +  E  +  A  ++ ++ KI++ +   +IV LIRGLS  P A+C    D +    K  +   ++++    I +I  +K+ + ++  +  +L+KE+Q+ GK + ++ ++LNGN
  S:     3 KDLRIVFLGTPDFAVGILKSLIEAKHTIVGVITAPDRPAGRGRKLKHSAVKEYALSQGLPVLQPTNLKNEDFLASLKALQANLQIIVAF-RMLPKVVWSMPEHGTFNLHASLLPQYRGAAPINWAIINGEKETGVTTFFIDEKIDTGAILLKSSVAIKENETVGSLHDTLMDLGSELVLKTVDTIAQGNVETFP-QPLEGVLKDAPKLTPENMKIDWSQPGEKIVALIRGLSPYPVAWCQLTQDDQTNKVKIYAAEFEADSHKQNIGHIFTTKKTMKVAVINGYVLIKEMQLPGKRKMDIVSLLNGN 307
>gi|153807336|ref|ZP_01960004.1| hypothetical protein BACCAC_01614 [Bacteroides caccae ATCC 43185] >gi|149129698|gb|EDM20910.1| hypothetical protein BACCAC_01614 [Bacteroides caccae ATCC 43185] (322 aa)
Score = 429, Expect = 1.9e-40, Identities = 100/296 (33%), Positives = 169/296 (57%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDE----SKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IV+MGTP+ A  AL  L+E  ++VV V+  PDKP GR  +I +S VK+ A+E+N+   QP K+K+      L+E      +  AF + +P+ + S+P  G  N+HASLLP+YRG API+WAVING+ ETG+       ++D G+V    +V I ++D    +  K+  L   +V+  ++ + N    P+ Q+E     ++  A  I K+  +I++ +   ++ + IRGLS  P A+  +   +     +K+F++   +     + GTI    K+ I ++  D  + V  +Q+ GK R +   +L G
  S:     7 RIVYMGTPDFAVEALRQLVEGGYNVVGVITMPDKPAGRGHKIQYSPVKQYALEQNLPLLQPEKLKDEAFVQALREWKADLQIVVAF-RMLPEVVWSMPRLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTFFLKHEIDTGEVIQQVRVPIADTDNVEIVHDKLMMLGGKLVVETVDAILNGVVKPVPQEEMAIVGELRPAPKIFKETCRIDWNQPVKKVYDFIRGLSPYPAAWSELVSPEGEVVVVKIFESEKVSEAHQLSAGTIVTDGKKYIKVAVPDGFVSVLSLQLPGKKRLKTDELLRG 312
>gi|94312495|ref|YP_585705.1| methionyl-tRNA formyltransferase [Ralstonia metallidurans CH34] >gi|93356347|gb|ABF10436.1| methionyl-tRNA formyltransferase [Ralstonia metallidurans CH34] (344 aa)
Score = 429, Expect = 2.0e-40, Identities = 102/296 (34%), Positives = 164/296 (55%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNI-KFFQPNKIKE----------IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFN---LEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSN--NAPGTINNISKEGILISTKDFDIL-VKEVQIEGKNRQEVKNILNG 307
           ++ F GTPE A  AL A+    F VVAV+ QPD+P GR  ++  S VK+ A+E  +    QP  ++             + L E+ P   V  A+G  +P  +L +P  GC+NIHASLLP++RG APIH A+  G+ ETG+ LM+  + +D G +       I   D+T TL   +  L   ++++ L ++     L   P  Q E+ V++A  I+KD+  ++  + A+E+ N IR  +  PGA   + D  +K ++A+   + ++  + PGTI      G++I+  +   L V E+Q  G  RQ  +  L  
  S:    20 RVAFAGTPEFARVALEAIHAAGFPVVAVLTQPDRPAGRGMQLQASPVKQFAVEAGLGPVLQPRSLRRQGKYPEEAGAAVDTLAEIAPDVMVVAAYGLILPTEVLELPRHGCLNIHASLLPRWRGAAPIHRAIEAGDPETGITLMQMDEGLDTGAMLSRESTPIGPQDSTGTLHDTLAALGGRMIVDALRQLAAGQPLTATP--QPEAGVTYAEKIAKDEAPLDLTRPAIELANQIRAFNPFPGATVQVGDTIIKCWQALPLAAATSLPHPPGTILAADTAGVIIACGNGSALQVTELQKPGGRRQPAQQFLQA 330
>gi|16331503|ref|NP_442231.1| methionyl-tRNA formyltransferase [Synechocystis sp. PCC 6803] >gi|6016038|sp|Q55163|FMT_SYNY3 Methionyl-tRNA formyltransferase >gi|1001159|dbj|BAA10301.1| methionyl-tRNA formyltransferase [Synechocystis sp. PCC 6803] (330 aa)
Score = 429, Expect = 2.3e-40, Identities = 109/297 (36%), Positives = 165/297 (55%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFA---FVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRG----------------LSETP-GAYCF--INDKKMKLFKAVSTNSKSNNAPGT-INNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGN 308
           K VF GTP+ A   L ALL     DV+AVV QPD+  GR  ++I S VK++A++  I  +QP ++K  +  L +L       FV  A+GQ +   IL +P  GC+N+H SLLPKYRG AP+ WA+ NGE ETGV  M   + MD G +       I   D  + +  ++     ++++  L+ +   +  PI Q E++ ++A  + K D  IN+ ++A+EI N +RG                +S  P GA  F  + +K   L  A    S     PG  I  I   G ++ T +  +L+++VQ  GK  Q   + +NGN
  S:     3 KTVFFGTPDFAVPTLEALLGHPDIDVLAVVSQPDRRRGRGSKLIPSPVKEVAVQAGIPVWQPERVKRCQETLAKLKNCQADFFVVVAYGQLLSPEILVMPRLGCVNVHGSLLPKYRGAAPLQWAIANGETETGVTTMLMDEGMDTGAMLLKTTTPIGLMDNLTAIGDRLARSGAELLVQTLKDLDAGQLQPIPQTETEATYAPLLKKGDFVINWHRSALEIHNQVRGFAPACHTAWGEQILKIISTVPLGAEFFPLLPEKYQDLATAYLNYSLEAGEPGNIIGTIKNWGPVLETGNGHLLLEQVQPPGKKPQSGWDFINGN 323
>gi|160890846|ref|ZP_02071849.1| hypothetical protein BACUNI_03291 [Bacteroides uniformis ATCC 8492] >gi|156859845|gb|EDO53276.1| hypothetical protein BACUNI_03291 [Bacteroides uniformis ATCC 8492] (323 aa)
Score = 428, Expect = 2.4e-40, Identities = 101/299 (33%), Positives = 162/299 (54%)
  Q:     9 KNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKV----SFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFI-----NDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           KN +IV+MGTP+ A  AL  L+E  ++VV V+  PDKP GR  ++ FS VK+ A+E N+   QP K+K+      L+       +  AF + +P+ + ++P  G  N+HASLLP+YRG API+WAVING+ ETG+       ++D G+V    +V I ++D    +  K+  L   +V+  ++ +       I Q+E  V      A  I KD  +I++ +    I + IRGLS  P A+  +         +K+F+           PGT+    K  I ++ +D  + +  +Q+ GK R +   +L G
  S:     5 KNLRIVYMGTPDFAVEALRCLVEGGYNVVGVITMPDKPAGRGHKLQFSPVKQYALEHNLPLLQPEKLKDEAFVEALRAWKADLQIVVAF-RMLPEVVWNMPRLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTFFLKHEIDTGEVIQQVRVPIADTDNVGIVHDKLMLLGGRLVVETVDAILAGTVKSIPQEEMAVVGELRPAPKIFKDTCRIDWNRPVKRIYDFIRGLSPYPAAWTELVQPGGESVVVKIFETEKIGESHQLTPGTLQTDGKTYIRVAAEDGFVGICSLQLPGKKRLKTDELLRG 313
>gi|167765262|ref|ZP_02437375.1| hypothetical protein BACSTE_03650 [Bacteroides stercoris ATCC 43183] >gi|167696890|gb|EDS13469.1| hypothetical protein BACSTE_03650 [Bacteroides stercoris ATCC 43183] (324 aa)
Score = 428, Expect = 2.4e-40, Identities = 100/296 (33%), Positives = 161/296 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKV----SFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKK-----MKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNG 307
           +IV+MGTPE A   L  L+E  +++V V+  PDKP GR  ++ FS VK+ A+E ++   QP ++K+      L+  N    +  AF + +P+ + ++P  G  N+HASLLP+YRG API+WAVING+ ETG+       ++D G+V    +V I ++D    +  K+  L   +V   ++ +       + Q+E  V      A  I KD  +I++ +    I + IRGLS  P A+  +         +K+F+         +APGT+    K  I I+  D  I V+ +Q+ GK R +   +L G
  S:     9 RIVYMGTPEFAVEPLRCLVEGGYNIVGVITMPDKPAGRGHKVQFSPVKQYALEHDLPLLQPERLKDEAFVEALRAWNADLQIVVAF-RMLPEVVWNMPRLGTFNLHASLLPQYRGAAPINWAVINGDTETGITTFFLKHEIDTGEVIQQVRVPIADTDNVGIVHDKLMMLGGRLVTETVDAILADTVKSVPQEEMAVVGELRPAPKIFKDTCRIDWNQPVKRIYDFIRGLSPYPAAWTELVQSDGTAVVLKIFETEKIEHLHESAPGTLQTDGKTYIRIAGTDGWIGVRALQLPGKKRLKTDELLRG 314
>gi|148978498|ref|ZP_01814972.1| methionyl-tRNA formyltransferase [Vibrionales bacterium SWAT-3] >gi|145962405|gb|EDK27685.1| methionyl-tRNA formyltransferase [Vibrionales bacterium SWAT-3] (230 aa)
Score = 428, Expect = 2.5e-40, Identities = 84/223 (37%), Positives = 134/223 (60%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIK--EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRG 234
           +IVF GTP+ A   L ALL    +V+AV  QPD+P GR K++  S VK +A+E NI  +QP   K  E + EL +LN    V  A+G  +P  +L  P  GCIN+H S+LP++RG API  ++  G+KETGV +M+    +D GD+     + IE +DT++++++K+  L  D ++  L  + + +    KQD+   ++A  +SK++ +IN+  +A  I   +R 
  S:     6 RIVFAGTPDFAARHLAALLSSEHEVIAVYTQPDRPAGRGKKLTASPVKNIALENNIPVYQPENFKSDEAKQELADLNADIMVVVAYGLLLPQVVLDTPRLGCINVHGSILPRWRGAAPIQRSIWAGDKETGVTIMQMDIGLDTGDMLSIATLPIEATDTSASMYEKLAGLGPDALVECLADIASGKAVAEKQDDELANYAKKLSKEEARINWSDDAAHIERCVRA 230
>gi|58616927|ref|YP_196126.1| methionyl-tRNA formyltransferase [Ehrlichia ruminantium str. Gardel] >gi|73919390|sp|Q5FFG4|FMT_EHRRG Methionyl-tRNA formyltransferase >gi|58416539|emb|CAI27652.1| Methionyl-tRNA formyltransferase [Ehrlichia ruminantium str. Gardel] (303 aa)
Score = 428, Expect = 2.8e-40, Identities = 106/296 (35%), Positives = 173/296 (58%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKA--VSTNSKSNNAPGTINNISKEGILISTKDFDILVK-EVQIEGKNRQEVKNILNG 307
           +I+FMG+PE +  AL+++L  +   +V+V  +  KP GR K +  + +  +A    +  + P  +K IE +  +KELNP   V  A+G  IP  +LSIP++GCINIH SLLP++RG APIH+A+++G+ +TGV +M+  +  D GD+   +K++I+E D   TL  K++NL   +++  L  + NL   P+ Q+E   ++   I  +D  I+  + A      IR L   P A+ F N K++++ +A     +S S+  P +I N    G+ I  K   ILV   VQ+EGK    +K+ + G
  S:     2 RIIFMGSPEFSVVALSSILNNTEHKIVSVYTRVPKPAGRGKVLTKTPIHTVAEMHGLTVYTPKSLKRIEEQDRIKELNPDVIVVVAYGLIIPKEVLSIPKYGCINIHPSLLPRWRGAAPIHYAILHGDSQTGVTIMQMNEGWDEGDILLQKKLSIDEQDNIETLSNKLSNLGGAMLVEVLNNIDNL--VPVAQNEDNATYTNKI--EDFHIDINETAEVACRRIRAL--YPRAFVFFNGKRLRILQASYYYDDSISSLKPSSILN---SGMHIKCKGNTILVPLVVQMEGKTLCSIKDFVCG 294
>gi|17230952|ref|NP_487500.1| methionyl-tRNA formyltransferase [Nostoc sp. PCC 7120] >gi|21542045|sp|Q8YRI6|FMT_ANASP Methionyl-tRNA formyltransferase >gi|17132593|dbj|BAB75159.1| methionyl-tRNA formyltransferase [Nostoc sp. PCC 7120] (342 aa)
Score = 428, Expect = 2.8e-40, Identities = 111/306 (36%), Positives = 175/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLA--------IEKNIKFFQPNKIK---EIENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKM---------------------KLFKAVSTNSKSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVF GTPE A   L  LL    FDV+AV+ QPDK   R  ++  S VK +A        I  ++  +QP +IK   E  N LKEL+  AFV  A+GQ +P  IL+IP+ G +N+H S+LP+YRG API W + NGE ETG+  M     MD G +       I   D    + +K++ +  D+++  L K+   E  PI QD +  ++A  I K D  +++ ++A+++ N IRG    P       ++ +                     K+ + +   S+ + +PG + +I+K  G +  T +  +L++EVQ+ GK  Q   + +NG + + +G  L
  S:     2 KIVFFGTPEFAVPTLEKLLINPEFDVLAVITQPDKRRERGNKLTPSPVKNVAMSYSQWENIAHDLPVWQPERIKKDTETLNRLKELDVDAFVVVAYGQILPQKILNIPKLGSVNVHGSILPQYRGAAPIQWCLYNGETETGITTMLMDVGMDTGAMLLKATTPIGLLDNADDVAQKLSVIGGDLLIETLHKLQQKEIQPIPQDNAAATYASLIQKQDYGLDWSRSALQLHNQIRGF--YPNCITTFRNQPLKITASFPLGAAYREELPPELQKMLQKLPDLSQISGSPGEVVSITKGVGAIAQTGEGLLLLREVQLPGKRPQSGWDFVNG-TRLTVGEVL 338
>gi|90415407|ref|ZP_01223341.1| methionyl-tRNA formyltransferase [marine gamma proteobacterium HTCC2207] >gi|90332730|gb|EAS47900.1| methionyl-tRNA formyltransferase [marine gamma proteobacterium HTCC2207] (294 aa)
Score = 428, Expect = 3.0e-40, Identities = 90/276 (32%), Positives = 155/276 (56%)
  Q:    36 VVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEI 311
           V+ V  QPD+  GR K++  S VKKLA+E  +  FQP  +KE E +  L EL     V  A+G  +P ++L  P  GCIN+HAS+LP++RG API  A+  G+  TGV +M+    +D G +    +  I+ S+T+++L +K+  L    +L+ L  + N     ++QD+    +A  I+K +  +++ + A  +   IR  +  P AY  + + ++K+++A  T + +   PG I +    G+L+S  +  +L+ E+Q+ GK+R  V  +L    E+
  S:     9 VIGVYSQPDRSAGRGKKLTASPVKKLAVEYQLPVFQPQSLKEPEQQRILSELQADIMVVVAYGLILPQAVLDAPRLGCINVHASILPRWRGAAPIQRAIEAGDSGTGVTIMQMDAGLDTGAMLSVSRCEIDSSETSASLHQKLEQLGAPALLHTLAALSNGLAVAVEQDDQLSCYAAKITKQEALVDWSQPAQLLDRQIRAFNPFPAAYTTLGELRIKIWQAEPTKA-TGLTPGQIISTDNAGLLVSCGEQSLLLTEIQLPGKSRMAVSEVLKSRGEL 285
>gi|66043289|ref|YP_233130.1| methionyl-tRNA formyltransferase [Pseudomonas syringae pv. syringae B728a] >gi|75504062|sp|Q500T0|FMT_PSEU2 Methionyl-tRNA formyltransferase >gi|63253996|gb|AAY35092.1| Methionyl-tRNA formyltransferase [Pseudomonas syringae pv. syringae B728a] (314 aa)
Score = 427, Expect = 3.1e-40, Identities = 101/306 (33%), Positives = 167/306 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSE-IKIGVTL 317
           +IVF GTPE A   L ALL+    +VAV  QPD+P GR ++++ S VK+LA++ ++   QP  +++   + EL  L P   V  A+G  +P  +L IP  GCIN HASLLP++RG API  AV  G+ E+GV +MR    +D G +       I   DT  TL  ++  L    VL  +  + +       QD+S  ++A+ ++KD+ ++++ + A E+  L+R  +  P  +  +N++ +K+  A    ++   APGTI   SK+G++++     + +  +Q+ G       ++ N   E   IG  L
  S:     6 RIVFAGTPEFAAEHLKALLDSPHQIVAVYTQPDRPAGRGQKLMPSPVKQLALQHDVPVMQPPTLRDPAAQAELAALQPDLMVVVAYGLILPQVVLDIPRLGCINSHASLLPRWRGAAPIQRAVQAGDAESGVTVMRMEAGLDTGPMLLKAVTPITAQDTGGTLHDRLAELGPPAVLQAIAGLADGTLVGEVQDDSLANYAHKLNKDEARLDWTRPADELERLVRAFNPWPICHSTLNEETLKVLAA--DLAEGQGAPGTILGASKDGLIVACGQNALRLTRLQLPGGKPLNFTDLFNSRREKFAIGTVL 312
>gi|196238805|ref|ZP_03137579.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 7425] >gi|196216839|gb|EDY11484.1| methionyl-tRNA formyltransferase [Cyanothece sp. PCC 7425] (334 aa)
Score = 427, Expect = 3.2e-40, Identities = 110/306 (35%), Positives = 177/306 (57%)
  Q:    12 KIVFMGTPEIATYALNALL-EKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPFA---FVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKMKL-----------------FKAVS---TNSK--SNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           KIVF GTP  A  +L  LL E   +V+ VV QPDK  GR  ++   +VKK+A+  N+  +QP ++K+    L +L   A   FV  A+GQ +   IL++P  GCIN HASLLP+YRG API W++ NGE ETG+  M     MD G +   R + +   +    + +++  L  D+V+  L +    +  PI QD S+ ++A  I K+D  +++ K+A+ + N IRG    P     +  + +K+                 F+A++   T+ +   N+ PG++  ++K  G +I T    +L+ +VQ  GK  Q   + +NG + ++IG  L
  S:     2 KIVFWGTPSFAVPSLERLLREPDCEVLGVVTQPDKRRGRGNQLQPEAVKKVALAHNLPLWQPQRVKKDAATLADLRSLAADFFVVVAYGQILSPEILAMPRLGCINNHASLLPRYRGAAPIQWSLYNGETETGITTMLMDAGMDTGAMLLQRTLVVGLLENAEQVSQRLAELGADLVVETLRQQVVGQLQPIPQDNSQATYAPLIKKEDYGLDWHKSAIALQNQIRGF--YPDCQTSLRGQPLKVSATLPLGSAYWSALPPEFQALAPQWTDERFAENHPPGSVIGLAKNLGPIIQTGAGGLLLLQVQPAGKRIQSGWDFVNG-ARLQIGEQL 331
>gi|196192028|gb|EDX86992.1| methionyl-tRNA formyltransferase [Synechococcus sp. PCC 7335] (333 aa)
Score = 427, Expect = 3.3e-40, Identities = 114/306 (37%), Positives = 167/306 (54%)
  Q:    12 KIVFMGTPEIATYALNALLEKS-FDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENELKELNPF---AFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYCFINDKKM-------------------KLFKAVSTNS-KSNNAPGTINNISKE-GILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTL 317
           +IVF GTP+ A  +L  LL  S F+VVA+V QPDK  GR  ++  S VK  A+      +QP +IK+    L  LN     AFV  A+GQ +   IL +P  GCIN H S+LP YRG API W + NGE ETGV  M     MD G +     + IE +D    L +K++ L  D++++ L+K+      P  QD  + ++A  I K+D  +++  +A  I + +RG           ND K+                   ++     +N+ K N APGT+ +I K  G ++ T    +L+ EV+  GK     ++  NG S I+IG  L
  S:     2 RIVFFGTPQFAVPSLTRLLNHSDFEVVAIVTQPDKRRGRGGKVSPSPVKAAALRAECPIWQPGRIKKDTETLARLNALNADAFVVIAYGQILSQEILDMPSLGCINAHGSILPAYRGAAPIQWCLHNGEIETGVTTMLMDAGMDTGPMLLKETLPIELTDNAWQLAQKLSELSADLLVSTLQKLNQQLIRPTAQDGGRATYAPLIKKEDYLLDWSASAKAIHDKVRGFYPNCTTQFRENDLKVMTTLPLGSAYQSQFPAELSRIHSLYESNAIKENAAPGTVISILKNYGPVVQTGSGPLLLLEVKPVGKKALAGRDFANG-SRIEIGEVL 331
>gi|148244857|ref|YP_001219551.1| methionyl-tRNA formyltransferase [Candidatus Vesicomyosocius okutanii HA] >gi|146326684|dbj|BAF61827.1| methionyl-tRNA formyltransferase [Candidatus Vesicomyosocius okutanii HA] (322 aa)
Score = 427, Expect = 3.4e-40, Identities = 98/318 (30%), Positives = 183/318 (57%)
  Q:     1 MGEKRNSCKNKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKEIENE--LKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRG-----LSETPGAYCFINDKKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNSEIKIGVTLK 318
           M  K  S K + I F GT + +   L  L+   +D+V V CQPD+P GR + +    VK+ A+E N+K FQP  ++  + +  L +LN    +  ++GQ +P+ IL++ ++GC+NIH+SLLP++RG API  A++ G+K TG+ +++  K +D GD+   +   I  +DTT +L  K+  L  + ++  L  + NL   P +Q ++ +++A  + K++  I++ ++A++I   IR      +++T  +      K +++F A    +  N +PG I   +K+  +++T D  + ++ VQ+ GK    +K+  N     K+ +T +
  S:     1 MHSKSTSFKTR-IAFAGTTKFSVAILEILINAKYDIVGVYCQPDRPKGRGRILTACPVKEKALEYNLKIFQPENLQSTKTQQALAKLNADVMIVVSYGQILPERILNMLKYGCLNIHSSLLPRWRGAAPIQRAILAGDKITGISIIQMNKILDTGDILLEKNCTITLNDTTQSLHNKLVKLGSNAIVEVLNNLDNLS--PTEQSKNNITYAKKLKKNEAWIDWTQSAIQIHQKIRAFNPYPITQTHASSNRFATKILRIFSASIVVTNDNYSPGNIIKHNKKICIVATGDGALSLETVQLSGKKVLNIKDFSNAYKLTKLFITCR 322
>gi|15835431|ref|NP_297190.1| methionyl-tRNA formyltransferase [Chlamydia muridarum Nigg] >gi|13626746|sp|Q9PJL2|FMT_CHLMU Methionyl-tRNA formyltransferase >gi|7190845|gb|AAF39619.1| methionyl-tRNA formyltransferase [Chlamydia muridarum Nigg] (316 aa)
Score = 427, Expect = 3.6e-40, Identities = 98/300 (32%), Positives = 164/300 (54%)
  Q:    10 NKKIVFMGTPEIATYALNALLEKSFDVVAVVCQPDKPIGRKKEIIFSSVKKLAIEKNIKFFQPNKIKE--IENELKELNPFAFVTCAFGQFIPDSILSIPEFGCINIHASLLPKYRGGAPIHWAVINGEKETGVCLMRTIKQMDAGDVYCSRKVNIEESDTTSTLFKKMNNLVYDIVLNDLEKVFNLEYPPIKQDESKVSFAYNISKDDEKINFEKNAVEIVNLIRGLSETPGAYC-FIND----KKMKLFKAVSTNSKSNNAPGTINNISKEGILISTKDFDILVKEVQIEGKNRQEVKNILNGNS 309
           N ++V++GTP+ A   L  L++    VV VV + DKP  R  + I S VK+LA+ KNI   QP K  +     +L+E     FV  A+G  +   +L IP++GC N+HA LLP YRG API   +I GE  +G  ++R    MD GD+     V I E  T   L + +     +++L  L+++       I QD +K + A  ++K++  + ++  A ++   IRG+S  PGA+  F++     +++ +  A   +S  +++PG +  +S E +L++ +   + +  VQ EGK   + K+  NG S
  S:     3 NLRVVYLGTPQFAATVLETLVDARIHVVGVVTRADKPQKRSSKPIASPVKQLALSKNIPLLQPTKTTDPAFLAQLREWQADVFVVVAYGVILKQELLDIPKYGCYNLHAGLLPAYRGAAPIQRCIIAGETLSGNTVIRMDAGMDTGDIANVNHVAIGEDMTAGELAEALAGSGGELILKTLQEIEAGTVRHIPQDSAKATLAPKLTKEEGLVKWDAPASQVYAHIRGVSPAPGAWTRFLSQGKEPRRLGILSARMESSSGSHSPGEVLGVSGEDLLVACRQGVLRLCIVQPEGKVFMKAKDFFNGQS 309