>gi|26553503|ref|NP_757437.1| GTP-binding protein LepA [Mycoplasma penetrans HF-2] >gi|33112373|sp|Q8EWZ9|LEPA_MYCPE GTP-binding protein lepA >gi|26453509|dbj|BAC43841.1| GTP-binding membrane protein [Mycoplasma penetrans HF-2] (600 aa)
Score = 3061, Expect = 0.0e+00, Identities = 600/600 (100%), Positives = 600/600 (100%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE
  S:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
>gi|171920975|ref|ZP_02932107.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185179159|ref|ZP_02964870.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024144|ref|ZP_02996875.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039428|ref|ZP_02998194.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 8] >gi|188518615|ref|ZP_03004065.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524501|ref|ZP_03004499.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530889|ref|ZP_03005170.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568590|ref|ZP_03005385.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 2] >gi|195867666|ref|ZP_03079668.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903001|gb|EDT49290.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184208942|gb|EDU05985.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018770|gb|EDU56810.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188997803|gb|EDU66900.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659675|gb|EDX53055.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660723|gb|EDX53978.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (599 aa)
Score = 2300, Expect = 0.0e+00, Identities = 441/599 (73%), Positives = 514/599 (85%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSE 599
           MDKK+IRNFSI+AHIDHGKSTLSDRIIEFTNTL+ REM NQILDSMDIERERGITIKLNAVQ+ YH  +DN +Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTLSNVYLALENNLEIVP INKIDLPSAD DRVKK++ED IGLD S+ PL+SAKTGLNI  ++EAII+ +PPPLD++D+  LQAL+FDS+YD+YKG VCLVRIK G +KVG KIR M+NN+ +IVS LG+ TPKIVNK  LVAGEVGW+AA+IK +K I+VGDTIT   NPA   LPGYKKILPMVYCGLYPID++QY+  KEA+ KI LSD++LTYEYETSQALGFGIRCGFLGLLHMDVIRER+ REFNI LI TAPSVIYK+ L +   + IDS AK+P+ T  K I+EPF K  II PD+++G +MELCQ+ RG Y DL  +D TR+++ Y +PLAEIMYSFFD LKS +KGYAT+DYE++ Y+ + LVK+DI+LNGNKVDALS I HR+FA  +S+ IC KLKE IPKHQFEIPIQA IG KIIARET+ A+RK+V+AKCYGGD++RKKKLLEQQKEGKKRLKAIGNV VP D FVK+LSE
  S:     1 MDKKFIRNFSIIAHIDHGKSTLSDRIIEFTNTLSKREMTNQILDSMDIERERGITIKLNAVQIKYH-ARDNNEYLIHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLSNVYLALENNLEIVPTINKIDLPSADPDRVKKEIEDVIGLDTSDIPLISAKTGLNIQDVLEAIIKHVPPPLDANDDAKLQALIFDSFYDSYKGVVCLVRIKQGTIKVGDKIRMMANNKDYIVSELGIRTPKIVNKTELVAGEVGWVAAAIKTVKDINVGDTITHANNPADKPLPGYKKILPMVYCGLYPIDTSQYDDLKEAMAKISLSDAALTYEYETSQALGFGIRCGFLGLLHMDVIRERIAREFNIELILTAPSVIYKIELTNNQEISIDSPAKMPEPTNIKAIKEPFVKLAIITPDNYVGAIMELCQSRRGSYQDLEVIDGTRRRLIYKMPLAEIMYSFFDSLKSITKGYATMDYELIGYQAEKLVKIDIMLNGNKVDALSIIAHRDFAYGKSKIICEKLKEVIPKHQFEIPIQASIGSKIIARETIKAVRKDVIAKCYGGDVSRKKKLLEQQKEGKKRLKAIGNVDVPQDAFVKVLSE 598
>gi|188592400|ref|ZP_03005772.1| GTP-binding protein LepA [Ureaplasma urealyticum serovar 10] (599 aa)
Score = 2297, Expect = 0.0e+00, Identities = 439/599 (73%), Positives = 514/599 (85%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSE 599
           MDKK+IRNFSI+AHIDHGKSTLSDRIIEFTNTL+ REM NQILDSMDIERERGITIKLNAVQ+ YH  +DN +Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTLSNVYLALENNLEIVP INKIDLPSAD +RVKK++ED IGLD S+ PL+SAKTGLNI  ++EAII+ +PPPLD++D+  LQAL+FDS+YD+YKG VCLVRIK G +KVG KIR M+NN+ +IVS LG+ TPKIVNK  LVAGEVGW+AA+IK +K I+VGDTIT   NPA   LPGYKKILPMVYCGLYPID++QY+  KEA+ KI LSD++LTYEYETSQALGFGIRCGFLGLLHMDVIRER+ REFNI LI TAPSVIYK+ L +   + IDS AK+P+ T  K I+EPF K  II PD+++G +MELCQ+ RG Y DL  +D TR+++ Y +PLAEIMYSFFD LKS +KGYAT+DYE++ Y+ + LVK+DI+LNGNKVDALS I HR+FA  +S+ IC +LKE IPKHQFEIPIQA IG KIIARET+ A+RK+V+AKCYGGD++RKKKLLEQQKEGKKRLKAIGNV VP D FVK+LSE
  S:     1 MDKKFIRNFSIIAHIDHGKSTLSDRIIEFTNTLSKREMTNQILDSMDIERERGITIKLNAVQIKYH-ARDNNEYLIHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLSNVYLALENNLEIVPTINKIDLPSADPERVKKEIEDVIGLDTSDIPLISAKTGLNIQDVLEAIIKHVPPPLDANDDAKLQALIFDSFYDSYKGVVCLVRIKQGTIKVGDKIRMMANNKDYIVSELGIRTPKIVNKTELVAGEVGWVAAAIKTVKDINVGDTITHANNPADKPLPGYKKILPMVYCGLYPIDTSQYDDLKEAMAKISLSDAALTYEYETSQALGFGIRCGFLGLLHMDVIRERIAREFNIELILTAPSVIYKIELTNNQEISIDSPAKMPEPTNIKAIKEPFVKLAIITPDNYVGAIMELCQSRRGSYQDLEVIDGTRRRLIYKMPLAEIMYSFFDSLKSITKGYATMDYELIGYQAEKLVKIDIMLNGNKVDALSIIAHRDFAYGKSKIICERLKEVIPKHQFEIPIQASIGSKIIARETIKAVRKDVIAKCYGGDVSRKKKLLEQQKEGKKRLKAIGNVDVPQDAFVKVLSE 598
>gi|13357884|ref|NP_078158.1| GTP-binding protein LepA [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|167971839|ref|ZP_02554116.1| GTP-binding protein LepA [Ureaplasma parvum serovar 6 str. ATCC 27818] >gi|168282540|ref|ZP_02690207.1| GTP-binding protein LepA [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168308694|ref|ZP_02691369.1| GTP-binding protein LepA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|170762409|ref|YP_001752406.1| GTP-binding protein LepA [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|189046462|sp|B1AIW2|LEPA_UREP2 GTP-binding protein lepA >gi|24211966|sp|Q9PQG7|LEPA_UREPA GTP-binding protein lepA >gi|11277805|pir||F82906 GTP-binding membrane protein UU324 [imported] - Ureaplasma urealyticum >gi|6899301|gb|AAF30733.1|AE002129_9 GTP-binding membrane protein [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|168827986|gb|ACA33248.1| GTP-binding protein LepA [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902939|gb|EDT49228.1| GTP-binding protein LepA [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182675746|gb|EDT87651.1| GTP-binding protein LepA [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|186701024|gb|EDU19306.1| GTP-binding protein LepA [Ureaplasma parvum serovar 6 str. ATCC 27818] (599 aa)
Score = 2280, Expect = 0.0e+00, Identities = 438/599 (73%), Positives = 512/599 (85%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSE 599
           MDKK+IRNFSI+AHIDHGKSTLSDRIIEFTNTL+ REM NQILDSMDIERERGITIKLNAVQ+ YH  KD  +Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTLSNVYLALENNLEIVP INKIDLPSAD +RVKK++ED IGLD ++ PL+SAKTGLNI  ++EAII+ +PPPLD+ D+  LQAL+FDS+YD+YKG VCLVR+K G +KVG KIR M+NN+ +IVS LG+ TPKIVNK  LVAGEVGW+AA+IK +K I+VGDTIT   NPA   LPGYKKILPMVYCGLYPID++QY+  KEA+ KI LSD++LTYEYETSQALGFGIRCGFLGLLHMDVIRER+ REFNI LI TAPSVIYK+ L +   + IDS AK+P+ T  K I+EPF K  II PD+++G +MELCQ+ RG Y DL  +D TR+K+ Y +PLAEIMYSFFD LKS +KGYAT+DYE++ Y+ + LVK+DI+LNGNKVDALS I HR+FA  +S+ IC +LKE IPKHQFEIPIQA IG KIIARET+ A+RK+V+AKCYGGD++RKKKLLEQQKEGKKRLKAIGNV VP D FVK+LSE
  S:     1 MDKKFIRNFSIIAHIDHGKSTLSDRIIEFTNTLSKREMTNQILDSMDIERERGITIKLNAVQIKYH-AKDKHEYLIHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLSNVYLALENNLEIVPTINKIDLPSADPNRVKKEIEDVIGLDTADVPLISAKTGLNIQDVLEAIIKHVPPPLDAKDDAKLQALIFDSFYDSYKGVVCLVRVKQGTIKVGDKIRMMANNKDYIVSELGIRTPKIVNKTELVAGEVGWVAAAIKTVKDINVGDTITHTNNPADKPLPGYKKILPMVYCGLYPIDTSQYDDLKEAMAKISLSDAALTYEYETSQALGFGIRCGFLGLLHMDVIRERIAREFNIELILTAPSVIYKIELTNNQEISIDSPAKMPEPTSIKLIKEPFVKLAIITPDNYVGAIMELCQSRRGIYDDLEVIDGTRRKLIYKMPLAEIMYSFFDSLKSITKGYATMDYELIGYQAEKLVKIDIMLNGNKVDALSIIAHRDFAYGKSKIICERLKEVIPKHQFEIPIQASIGSKIIARETIKAVRKDVIAKCYGGDVSRKKKLLEQQKEGKKRLKAIGNVDVPQDAFVKVLSE 598
>gi|31544757|ref|NP_853335.1| GTP-binding protein LepA [Mycoplasma gallisepticum R] >gi|46396307|sp|Q7NAT2|LEPA_MYCGA GTP-binding protein lepA >gi|31541603|gb|AAP56903.1| LepA [Mycoplasma gallisepticum R] (602 aa)
Score = 2084, Expect = 0.0e+00, Identities = 390/600 (65%), Positives = 495/600 (82%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           MDKK IRNFSI+AHIDHGKSTLSDR+IE T T++ REMKNQ+LDSM++ERERGITIKLNAVQL +   ++NQDY FHLIDTPGHVDFTYEVSRSLAACE ALLVVDA+QGV+AQTLSNVYLALENNLEI+PVINK+DLPSAD++RVK+++E  IG+DCS+ PL+SAKTGLNI+Q+++ II+++P P +++DN PL+AL+FDSYYD +KG VC +RI +G++KVG +I FM+NN  +IV+ +G+  P + ++  L AGEVG++ ASIK I+ + VGDTIT+  NP    L GY+K+  MVY GLYP+D+  Y+  K A+EKI L+D++L YEYETS ALGFG+RCGFLGLLHMDVIRER+ RE+NI LI  APSV+YK  L DG  L++D+ A +P++   K + EP+ K  I  PD+F+G +MELCQN+RGEY++L  +DS+RK + Y IPLAEI+YSFFDKLKS +KGYA+LDYE++ YR  +LVKVDILLNG KVDALS I H +F   +++KI  KLK  IP+H FEIPIQA +G KII+RET+ AMRKNVLAKCYGGD++RKKKLLEQQKEGKKRLKAIG+V +P +TF K+L ++
  S:     4 MDKKNIRNFSIIAHIDHGKSTLSDRLIEITETVSKREMKNQLLDSMELERERGITIKLNAVQLKFK--RNNQDYTFHLIDTPGHVDFTYEVSRSLAACEAALLVVDATQGVQAQTLSNVYLALENNLEIIPVINKVDLPSADVERVKREIETKIGIDCSDVPLISAKTGLNIDQVLDVIIKKVPSPKNANDNDPLKALIFDSYYDPHKGVVCFIRIFDGKLKVGDEILFMANNVKYIVTEVGIKNPNMQSRAYLEAGEVGYVTASIKTIRDVHVGDTITNANNPCDKPLVGYRKVSSMVYAGLYPVDTADYQNLKVAMEKIVLTDAALEYEYETSNALGFGVRCGFLGLLHMDVIRERIVREYNIPLILLAPSVMYKCYLTDGQELKVDNPANMPERNRIKSMLEPYVKLSISTPDEFIGPIMELCQNFRGEYMELSEIDSSRKVLVYEIPLAEIIYSFFDKLKSVTKGYASLDYELIGYRDSNLVKVDILLNGQKVDALSFISHTQFVYQKAKKIVEKLKTLIPRHLFEIPIQAAVGSKIISRETIKAMRKNVLAKCYGGDVSRKKKLLEQQKEGKKRLKAIGSVQIPQETFSKLLQDD 601
>gi|110004561|emb|CAK98898.1| gtp-binding protein lepa [Spiroplasma citri] (600 aa)
Score = 1992, Expect = 0.0e+00, Identities = 389/597 (65%), Positives = 481/597 (80%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M+KK IRNFSI+AHIDHGKSTL+DRI+E T T+  REM+ Q+LDSMD+ERERGITIKLN+VQL Y   +D Q+Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++NNL I+PVINKIDLPSAD DRVK+++E+ IG+  +NAPL+SAKTGLNI Q++EAI++ IP PLD DDN PLQAL+FDSYYD Y+G +  +R+  G V+VG KI+ M+    + V+ LGV TPK V K  L AGEVGW+AASIK ++ + VGDTIT  ANPA   LPGYKK+ PMV+CGLYPIDS +Y+  KEALEKI LSD+SL YE ETSQALGFG RCGFLGLLHMDVI+ERL+RE+N+ LIATAPSVIY V L +  ++ ID+ ++LP       I+EPF KA I+ P  ++G++MELCQN RG Y++L  +D TR+ +TY +PL EI++ FFD+LKS SKGYA+LDY+ + YR   LVK+DILLN   +DALS I+HR+FA  R + +C KLKE I +  FE+PIQA I  K+IARE + AMRKNVLAKCYGGDITRKKKLLE+QKEGKKR+KAIG+V VP + F+ +L
  S:     1 MEKKLIRNFSIIAHIDHGKSTLADRILELTGTVEKREMQEQLLDSMDLERERGITIKLNSVQLKYR-AQDQQEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDNNLAIIPVINKIDLPSADPDRVKEEIENLIGIPTTNAPLISAKTGLNIEQVLEAIVKDIPAPLDGDDNNPLQALIFDSYYDKYRGVMVSIRVNQGIVRVGEKIKLMNTGAVYEVTELGVKTPKEVKKNQLGAGEVGWLAASIKMVRDVRVGDTITTVANPAQQPLPGYKKMNPMVFCGLYPIDSAKYKDLKEALEKIQLSDASLVYEPETSQALGFGFRCGFLGLLHMDVIQERLEREYNLELIATAPSVIYHVYLTNKEMISIDNPSELPAVQKIDRIEEPFVKATIMTPKQYIGSLMELCQNKRGTYVNLEYIDDTRRILTYEMPLNEIVFVFFDRLKSISKGYASLDYDFIGYRPNKLVKMDILLNNEIIDALSIIVHRDFAYGRGKALCAKLKEIILRQNFEVPIQAAINHKVIAREDIKAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKAIGSVEVPQEAFMAVL 596
>gi|169350456|ref|ZP_02867394.1| hypothetical protein CLOSPI_01224 [Clostridium spiroforme DSM 1552] >gi|169292776|gb|EDS74909.1| hypothetical protein CLOSPI_01224 [Clostridium spiroforme DSM 1552] (603 aa)
Score = 1984, Expect = 0.0e+00, Identities = 386/598 (64%), Positives = 477/598 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           +D+  IRNFSI+AHIDHGKSTL+DRI++ T  +  R+MK+Q+LDSMD+ERERGITIKLNAVQL Y   KD Q Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA QGVEAQTL+NVYLAL+NNLEI+PVINKIDLPSAD  RV K+VED IGL   +APL+SAKTGLNI +++E ++ + P P   D N P QAL+FDSYYD+Y+G +  VRIK G++KVG  ++F++ N  + V+ LGV TP+ V KE LV GEVGW  ASIK+I+ I VGDT+T     +   LPGY+++ PMVYCGLYPID+ +Y+  +EALEK+ LSDS+L +E ETSQALGFG RCGFLGLLHMDVI+ERL+REF++ LIATAPSVIY   L DG+ L ID+ A +P   +   I+EP+ KA I+ P +F+G +MELCQN RGEY+D+  +D TR+ V Y +PL+EI+Y FFDKLKS +KGYA+LDYE++ YR   L K+DILLNG+ VDALSTI+H++FA  R + IC KLKE IPK  FE+PIQA + GKIIAR T+ AMRKNVLAKCYGGDITRKKKLLE+QKEGKKR+KA+GNV +P + F+ ILS
  S:     3 IDQSKIRNFSIIAHIDHGKSTLADRILQLTGAVADRDMKSQLLDSMDLERERGITIKLNAVQLNY-TAKDGQTYLLHLIDTPGHVDFTYEVSRSLAACEGAILVVDAVQGVEAQTLANVYLALDNNLEILPVINKIDLPSADPSRVIKEVEDVIGLPADHAPLISAKTGLNIEEVLEKVVHEFPAP-SGDINNPTQALIFDSYYDSYRGVIVFVRIKEGKIKVGDTVKFLATNAIYEVTELGVRTPREVKKEELVVGEVGWFCASIKSIQDIHVGDTVTTLEQESNVQLPGYRQLNPMVYCGLYPIDNARYKDLREALEKMKLSDSALMFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFDLELIATAPSVIYHCYLTDGSELIIDNPAMMPAPQVIDHIEEPYVKASIMTPSEFVGAIMELCQNKRGEYVDIEYIDDTRRNVIYEVPLSEIVYDFFDKLKSSTKGYASLDYELIGYRTSKLQKMDILLNGDAVDALSTIVHKDFAYSRGKIICEKLKEIIPKQMFEVPIQAALQGKIIARTTIKAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKAVGNVEIPQEAFMAILS 598
>gi|187605296|ref|ZP_02991495.1| GTP-binding protein LepA [Exiguobacterium sp. AT1b] >gi|187482636|gb|EDU20641.1| GTP-binding protein LepA [Exiguobacterium sp. AT1b] (607 aa)
Score = 1968, Expect = 0.0e+00, Identities = 368/596 (61%), Positives = 482/596 (80%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT REMK Q LD+MD+ERERGITIKLNAV+L Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSAD++RV++++ED IGLD S+A   SAK G+ I +I+E I+E +PPP   D ++PLQAL+FDSYYDAY+G V  +RI NG VKVG K++ M+  +TF V+ LGV+TPK ++ + L  G+VG ++ASIK +  + VGDTIT   NPAT+ LPGY+K+ PMVYCGLYPID+ +Y   +EALEK+ LSD++L +E ETSQALGFG RCGFLG+LHM++I+ER++REFNI LI TAPSVIY V    G ++ +D+ +K+P++     I+EP+ KA ++ P+D++G +MELCQ  RG ++D+  +D+TR K+TY IPL+EI+Y FFD+LKS +KGYA+LDYE++ YR+  LVK+DILLN   VDALS I+HR+FA +R + I  KLK  IP+ QFE+P+QA +G KI+AR T+ A+RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V VP + F+ +LS
  S:    10 QKKIRNFSIIAHIDHGKSTLADRILEKTGALTAREMKEQTLDAMDLERERGITIKLNAVKLNY-TAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIIPVINKIDLPSADVERVRQEIEDVIGLDASDAVPTSAKAGIGIEEILEQIVELVPPP-TGDPSEPLQALIFDSYYDAYRGVVASIRIVNGSVKVGDKVQMMATGKTFEVTDLGVSTPKPISVKELNVGDVGTLSASIKTVGDVRVGDTITLAKNPATSQLPGYRKMNPMVYCGLYPIDAAKYNDLREALEKLQLSDAALEFEPETSQALGFGFRCGFLGMLHMEIIQERIEREFNIDLITTAPSVIYHVTTTSGEVIHVDNPSKMPEQQKVDSIEEPYVKAAVMTPNDYVGAIMELCQKKRGTFIDMQYIDTTRVKITYEIPLSEIVYDFFDQLKSSTKGYASLDYELIGYRQSRLVKMDILLNNEVVDALSFIVHRDFAYERGKVIVEKLKALIPRMQFEVPVQAAVGTKIVARSTIKALRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKMVGSVEVPQEAFMSVLS 603
>gi|60390027|sp|Q6MTR6|LEPA_MYCMS GTP-binding protein lepA (600 aa)
Score = 1963, Expect = 0.0e+00, Identities = 375/597 (62%), Positives = 482/597 (80%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK  IRNFSI+AHIDHGKSTL+DRI+E TNT+  REM++Q+LDSMDIERERGITIKLN+VQL YH+ KDNQDY F+LIDTPGHVDFTYEVSRSLAACEGA+LVVDASQGVEAQTL+NVYLA+++NLEI+PVINKIDLPSAD+D+VK ++E+ IGLDCS +PL+SAKTGLN+  +++AI+E+IP P D+ DN PL+AL+FDSYYD Y G V  +R+K G +KVG KI+ MS N  + V++LG+ TPKIV K+ L AGEVGW+AASIK IK ++VGDTIT   NPA   L GYKK+ PMVYCG+YPID+ +Y+ FKEALEKI LSDSSL YE ETSQALGFG RCGFLGLLHM+VI+ERL+RE+N+ LIATAPSV+YKV L +  ++E+D+ A LP+     +I+EPF + +I  P +++G++M LCQN  G Y ++  +D+ R+ + Y +PLAEI++ FF+KLKS SKGYA+ +YE++ Y++  LV++DI LNG  VDA S I++++FA  R   + LKLKE IP+  FE+P+QA IG K+I+RET+ A RK+V  K +  D +R+KKLLE+QKEGK ++K IG V VP + FV IL
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVEKREMQDQLLDSMDIERERGITIKLNSVQLKYHS-KDNQDYIFNLIDTPGHVDFTYEVSRSLAACEGAILVVDASQGVEAQTLANVYLAIDSNLEIIPVINKIDLPSADVDKVKHEIEEIIGLDCSKSPLISAKTGLNVEDVLQAIVEKIPSPSDAIDNAPLKALIFDSYYDKYLGVVMSIRLKQGMLKVGDKIKLMSTNAEYEVTSLGIKTPKIVKKDFLEAGEVGWVAASIKTIKDVNVGDTITSVLNPADEPLDGYKKLKPMVYCGIYPIDTNKYQDFKEALEKIELSDSSLVYEPETSQALGFGFRCGFLGLLHMEVIQERLEREYNLELIATAPSVVYKVHLTNKQVIELDNPALLPEAQKISKIEEPFVEIKIATPSEYIGDLMNLCQNKLGIYKNMEVIDNNRRILIYQMPLAEIIFDFFNKLKSISKGYASFEYELIGYKESKLVRMDIKLNGEMVDAFSMIVNQKFAYQRGSALTLKLKELIPRQNFEVPVQATIGNKVISRETIKAYRKDVTWKLHAADKSRRKKLLEKQKEGKIKMKEIGTVEVPQEAFVAIL 596
>gi|149182767|ref|ZP_01861231.1| GTP-binding protein LepA [Bacillus sp. SG-1] >gi|148849533|gb|EDL63719.1| GTP-binding protein LepA [Bacillus sp. SG-1] (611 aa)
Score = 1956, Expect = 0.0e+00, Identities = 370/595 (62%), Positives = 474/595 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T  LT REMK Q+LDSMD+ERERGITIKLN+VQL Y   KD ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLP+AD +RV+++VED IGLD S A L SAK G+ I  I+E I+E++P P + D +KPLQAL+FDS YD+Y+G V  +R+  G VKVG KI+ M+  + F V+ +GV TPK  + + L  G+VG++ A+IKN+    VGDTIT   NPA   LPGY+++ PMVYCGLYPIDS +Y   +EALE++ L+DS+L YE ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIY V L DG  L++D+ + +PD      ++EP+ KA ++VP+D++G VMELCQ  RG ++D+  +D TR  + Y IPLAEI+Y FFD+LKS +KGYA+ DYE++ Y++  LVK+DILLNG +VDALS I+HR+FA DR + I  KLKE IP+ QFE+PIQA IG KI+AR T+ A+RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V VP + F+ +L
  S:    10 QQRIRNFSIIAHIDHGKSTLADRILEKTKALTAREMKEQLLDSMDLERERGITIKLNSVQLKYQ-AKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPAADPERVRQEVEDVIGLDASEAVLASAKAGIGIEDILEQIVEKVPAP-EGDPDKPLQALIFDSLYDSYRGVVAYIRVVEGTVKVGDKIKMMATGKEFEVNDVGVFTPKATSTKELTVGDVGYLTAAIKNVGDTRVGDTITGAKNPAVKPLPGYRRLNPMVYCGLYPIDSAKYNDLREALERLELNDSALQYEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYNVHLTDGEELKVDNPSMMPDPQKVDRVEEPYVKATMMVPNDYVGAVMELCQGKRGNFIDMQYMDETRVNIVYEIPLAEIVYDFFDQLKSSTKGYASFDYELIGYKESKLVKMDILLNGEQVDALSFIVHRDFAYDRGKIIVDKLKELIPRQQFEVPIQAAIGQKIVARSTIKAIRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVL 602
>gi|121534796|ref|ZP_01666616.1| GTP-binding protein LepA [Thermosinus carboxydivorans Nor1] >gi|121306591|gb|EAX47513.1| GTP-binding protein LepA [Thermosinus carboxydivorans Nor1] (598 aa)
Score = 1954, Expect = 0.0e+00, Identities = 372/597 (62%), Positives = 481/597 (80%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M+  +IRNFSI+AHIDHGKSTL+DRIIE+T  L+ REM++Q+LD +++ERERGITIK  AV+L Y   +D Q Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQG+EAQTL+NVYLALE+NLEI+PVINKIDLP+AD ++VK+++ED IGLD S A LVSAK G+ I  ++EAII++IPPP  +D  KPL+AL+FDS++D+YKG +  VR+ +G++  G KI+ M+ ++ F V+ +GV  P + N + L  GEVG++AASIKN+K   VGDTITD  NPAT  LPGY+KI PMVYCGLYP+DS+ Y+  ++ALEK+ L+D+SL +E ETS ALGFG RCGFLGLLHMDVI+ERL+RE+N+ LI TAP+VIYKV   +G IL+ID+ A+LP       I+EP+ +A IIVP+D++G VMEL Q  RGE+ D+  +D TR  +TY +PL+EI+Y +FD+LKS ++GYA+LDYE++ YR  +LVK+DILLNG+ VDALS I+HR+ A  R R++  KLKE IP+  FEIPIQA IG K+IARETV A+RK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +G+V VP + F+ IL
  S:     1 MNTSHIRNFSIIAHIDHGKSTLADRIIEYTGALSEREMEDQVLDQLELERERGITIKAQAVRLNY-TARDGQTYMLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGIEAQTLANVYLALEHNLEIIPVINKIDLPNADPEKVKQEIEDVIGLDASEAVLVSAKAGIGIEDVLEAIIKKIPPP-RTDATKPLRALIFDSHFDSYKGVIAYVRVMDGKIVPGMKIKMMATDKKFEVTEVGVFRPYLANVDELGPGEVGFVAASIKNVKDTRVGDTITDADNPATEPLPGYRKITPMVYCGLYPVDSSDYDALRDALEKLKLNDASLVFEPETSVALGFGFRCGFLGLLHMDVIQERLEREYNLTLITTAPNVIYKVYKTNGEILDIDNPARLPTPQEIDHIEEPYVRASIIVPNDYVGAVMELSQEKRGEFKDMRYLDMTRVMLTYELPLSEIIYDYFDRLKSATRGYASLDYELIGYRASNLVKLDILLNGDPVDALSVIVHRDRAQARGRQLVEKLKEIIPRQMFEIPIQAAIGNKVIARETVRALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAIL 595
>gi|160915158|ref|ZP_02077371.1| hypothetical protein EUBDOL_01166 [Eubacterium dolichum DSM 3991] >gi|158432957|gb|EDP11246.1| hypothetical protein EUBDOL_01166 [Eubacterium dolichum DSM 3991] (602 aa)
Score = 1950, Expect = 0.0e+00, Identities = 372/598 (62%), Positives = 474/598 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           MD+K+IRNFSI+AHIDHGKSTL+DRI+E T T+  REMK Q+LDSMD+ERERGITIKLNAVQL Y    + +DY FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N LEIVPVINKIDLPSA  D V++++ED IGL+  + PL+SAK GLNI  ++EA++E++P P + D N PLQALVFDS YDAY+G V  VR+K G ++VG KIRFM+    + V  +G+  PK V K++L  GEVGW+ ASIK+I+ + VGDTIT  A PA   L GY+++ PMVYCGLYPIDS +Y   ++ALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDV++ER++RE++I LIATAPSV+Y V   DG +  I++ + +P+      I+EPF +A I+ P++++G +M+LCQ  RG Y D++ +D+ R  V Y +PL EI++ FFDKLKSC+KGYA+ DYE++ Y+   L K+DILLNG  VDALS I+HR+FA  R R IC KLK+ IPK QFEIPIQA I GKIIAR  + ++RKNVLAKCYGGDI+RKKKLLE+QKEGKKR+KA+G+V VP + F+ +LS
  S:     1 MDQKHIRNFSIIAHIDHGKSTLADRILEITETVEQREMKEQLLDSMDLERERGITIKLNAVQLKY-TALNGEDYIFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDNELEIVPVINKIDLPSAQPDVVRQEIEDVIGLEAEDCPLISAKNGLNIRDVLEAVVERVPAP-NGDINAPLQALVFDSLYDAYRGVVAFVRVKEGNIRVGDKIRFMATGAEYEVLEVGIRNPKEVKKDMLECGEVGWLCASIKSIRDVRVGDTITSAARPAQNPLVGYREMNPMVYCGLYPIDSAKYNDLRDALEKLQLNDASLQFEAETSQALGFGFRCGFLGLLHMDVVQERIEREYHIDLIATAPSVVYHVYTTDGNMQHIENPSMMPEVQKIDHIEEPFVRASIMTPNEYVGAIMDLCQRKRGNYKDMIYIDANRMNVVYELPLGEIVFDFFDKLKSCTKGYASFDYELIGYQTNKLSKMDILLNGEIVDALSAIVHRDFAYPRGRAICEKLKKLIPKQQFEIPIQAAINGKIIARADIKSLRKNVLAKCYGGDISRKKKLLEKQKEGKKRMKAVGSVEVPQEAFMAVLS 596
>gi|152976750|ref|YP_001376267.1| GTP-binding protein LepA [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|189046429|sp|A7GT14|LEPA_BACCN GTP-binding protein lepA >gi|152025502|gb|ABS23272.1| GTP-binding protein LepA [Bacillus cereus subsp. cytotoxis NVH 391-98] (608 aa)
Score = 1950, Expect = 0.0e+00, Identities = 368/592 (62%), Positives = 471/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P D D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   LPGY+K+ PMV+CGLYPID+ +Y   +EALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EP+ KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLNG +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG KI+AR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLTY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-DGDPEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLPGYRKLNPMVFCGLYPIDTARYNDLREALEKLQLNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVYLTNGEEIVVDNPSNMPDPQSIDRVEEPYVKASIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYQVSKLVKMDILLNGEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQAAIGNKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|52786478|ref|YP_092307.1| GTP-binding protein LepA [Bacillus licheniformis ATCC 14580] >gi|163119557|ref|YP_079891.2| GTP-binding protein LepA [Bacillus licheniformis ATCC 14580] >gi|81609042|sp|Q65H50|LEPA_BACLD GTP-binding protein lepA >gi|52348980|gb|AAU41614.1| LepA [Bacillus licheniformis DSM 13] >gi|145903066|gb|AAU24253.2| GTP-binding protein [Bacillus licheniformis ATCC 14580] (612 aa)
Score = 1949, Expect = 0.0e+00, Identities = 364/592 (61%), Positives = 470/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T  +T REMK Q+LDSMD+ERERGITIKLN+VQL Y   KD ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSA+ +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D   PLQAL+FDS YDAY+G V  +R+  G VK G KI+ M+  + F V+ +GV TPK V  + L  G+VG++ A+IKN+    VGDTIT   NPA  +LPGY+K+ PMVYCGLYPID+ +Y   +EALEK+ L+DS+L YE ETSQALGFG RCGFLG+LHM++I+ER++REFNI LI TAPSVIY V + DG  + +D+ + +PD      ++EPF KA ++VP+DF+G VMELCQ  RG+++D+  +D+ R  + Y IPLAEI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DI+LNG K+DALS I+HR++A +R + I  KLKE IP+ QFE+P+QA IG KI+AR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGK+R+K +G+V VP + F+ +L
  S:    14 IRNFSIIAHIDHGKSTLADRILEKTAAITQREMKEQLLDSMDLERERGITIKLNSVQLKYQ-AKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-SGDPEAPLQALIFDSLYDAYRGVVAYIRVVQGTVKAGQKIKMMATGKEFEVTEVGVFTPKAVPADELTVGDVGFLTAAIKNVGDTRVGDTITSAENPAPEALPGYRKLNPMVYCGLYPIDTAKYNDLREALEKLELNDSALQYEAETSQALGFGFRCGFLGMLHMEIIQERIEREFNIDLITTAPSVIYDVYMTDGEKIVVDNPSNMPDPQKIDRVEEPFVKATMMVPNDFVGAVMELCQGKRGQFIDMQYLDANRVSIVYEIPLAEIVYEFFDQLKSNTKGYASFDYELIGYKPSKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGTKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVL 603
>gi|167756927|ref|ZP_02429054.1| hypothetical protein CLORAM_02476 [Clostridium ramosum DSM 1402] >gi|167703102|gb|EDS17681.1| hypothetical protein CLORAM_02476 [Clostridium ramosum DSM 1402] (606 aa)
Score = 1948, Expect = 0.0e+00, Identities = 377/598 (63%), Positives = 476/598 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           +D+  IRNFSI+AHIDHGKSTL+DRI++ T  +  REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD Q Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVD+ QGVEAQTL+NVYLAL+NNLEI+PVINKIDLPSAD  RV ++VE+ IGL   +APL+SAK+GLN+ +++E ++++ P P   D N P QAL+FDSYYD+Y+G +  VR+K G + VG  ++FM+   T+ V+ LGV TP+ V KE LV GEVGW AASIK+I+ I VGDT+T   N +   LPGY+++ PMVYCGLYP+D+ +Y+  +EALEK+ LSDSSL ++ ETSQALGFG RCGFLGLLHMDVI+ERL+REF++ LIATAPSVIY   L D + + +D+ A +P+  +   I+EP+ KA I+ P++++G +MELCQ+ RGEY D+  +D TR+ V Y IPL+EI+Y FFDKLKS +KGYA+LDYE++ YR   L K+DILLNG  VDALSTI+H++FA  R + IC KLKE IPK  FE+PIQA + GKIIAR T+ AMRKNVLAKCYGGDI+RKKKLLE+QKEGKKR+KA+GNV +P + F+ ILS
  S:     7 IDQSKIRNFSIIAHIDHGKSTLADRILQITGAVADREMKAQLLDSMDLERERGITIKLNAVQLNY-TAKDGQTYLLHLIDTPGHVDFTYEVSRSLAACEGAILVVDSVQGVEAQTLANVYLALDNNLEILPVINKIDLPSADPQRVIREVEEVIGLPADHAPLISAKSGLNVEEVLEKVVQEFPAP-SGDVNNPTQALIFDSYYDSYRGVIVFVRVKEGTINVGDHVKFMATGATYEVTELGVRTPREVKKEQLVVGEVGWFAASIKSIQDIHVGDTVTTVENESNIQLPGYRQLNPMVYCGLYPVDNARYKDLREALEKMKLSDSSLMFDPETSQALGFGFRCGFLGLLHMDVIQERLEREFDLDLIATAPSVIYHCYLTDRSEVIVDNPAMMPEPQVIDHIEEPYVKASIMTPNEYVGVIMELCQSKRGEYQDIEYIDDTRRNVIYEIPLSEIVYDFFDKLKSGTKGYASLDYELIGYRTSKLQKMDILLNGEVVDALSTIVHKDFAYGRGKIICEKLKEIIPKQMFEVPIQAALQGKIIARTTIKAMRKNVLAKCYGGDISRKKKLLEKQKEGKKRMKAVGNVEIPQEAFMAILS 602
>gi|42783446|ref|NP_980693.1| GTP-binding protein LepA [Bacillus cereus ATCC 10987] >gi|60390049|sp|Q730L6|LEPA_BACC1 GTP-binding protein lepA >gi|42739375|gb|AAS43301.1| GTP-binding protein LepA [Bacillus cereus ATCC 10987] (607 aa)
Score = 1944, Expect = 0.0e+00, Identities = 366/592 (61%), Positives = 469/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   LPGY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLPGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVFLTNGEDMIVDNPSNMPDPQTIDRVEEPFVKAAIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNSEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|15613905|ref|NP_242208.1| GTP-binding protein LepA [Bacillus halodurans C-125] >gi|20138760|sp|Q9KD76|LEPA_BACHD GTP-binding protein lepA >gi|10173958|dbj|BAB05061.1| GTP-binding protein (elongation factor family) [Bacillus halodurans C-125] (609 aa)
Score = 1943, Expect = 0.0e+00, Identities = 365/592 (61%), Positives = 472/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T+ LT REMK+Q+LD+MD+ERERGITIKLNAVQL+Y    D  +Y FHLIDTPGHVDF+YEVSRSLAACEGALL+VDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSA+ +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YD+Y+G V  +RI  G VK G KI+ M+  + F V+ +GV TPK   +E L  G+VG++ ASIKN+    VGDTIT   NPA   LPGY+++ PMVYCGLYP+D+  Y   +EALE++ L+D+SL YE ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSV+Y V L +G + +ID+ + +PD+   +E++EP+ KA I+VP+DF+G VMELCQ  RG ++D+  +D  R ++ Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+  +LVK+DILLNG  VDALS I+HR+ A +R ++I  KLKE IP+ QFE+P+QA IG KIIAR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+KA+GNV VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTSALTQREMKDQMLDAMDLERERGITIKLNAVQLVY-KANDGNEYIFHLIDTPGHVDFSYEVSRSLAACEGALLIVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKNGIGIEEILEQIVEKVPAP-SGDPEGPLKALIFDSLYDSYRGVVAYIRIVEGSVKPGQKIKMMATGKEFEVTEVGVFTPKPEKREELTVGDVGFLTASIKNVGDTRVGDTITSANNPADEPLPGYRRMNPMVYCGLYPVDTNDYNDLREALERLELNDASLQYEPETSQALGFGFRCGFLGLLHMEIIQERIEREFGIDLITTAPSVVYSVQLTNGEVQQIDNPSNMPDRQKIEEVEEPYVKATIMVPNDFVGAVMELCQGKRGIFIDMQYLDENRVQIIYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSNLVKMDILLNGEVVDALSVIVHRDSAYERGKQIVEKLKELIPRQQFEVPVQASIGTKIIARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKAVGNVEVPQEAFMAVL 602
>gi|168140310|ref|ZP_02583539.1| GTP-binding protein LepA [Bacillus cereus G9842] (607 aa)
Score = 1939, Expect = 0.0e+00, Identities = 366/592 (61%), Positives = 470/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA  +LPGY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPA-GDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEALPGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVYLTNGEDVIVDNPSNMPDPQSIDRVEEPFVKASIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNNEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|50365290|ref|YP_053715.1| GTP-binding protein LepA [Mesoplasma florum L1] >gi|60389977|sp|Q6F0Z2|LEPA_MESFL GTP-binding protein lepA >gi|50363846|gb|AAT75831.1| GTP-binding membrane protein, elongation factor [Mesoplasma florum L1] (600 aa)
Score = 1938, Expect = 0.0e+00, Identities = 377/597 (63%), Positives = 479/597 (80%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK  IRNFSI+AHIDHGKSTL+DRI+E TNT+T REM+ Q+LDSMDIERERGITIKLN+VQL Y+  KD Q+Y FHLIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA+ENNLEI+PVINK+DLPSAD +RVK+++E+TIG+DCS+APL+SAKTGLN+  ++EAI+ +IP P D+DD KPL+AL+FDSYYD Y G V  +R++ G +KVG +I+ M+N  ++ V+ LGV  PKIV K+ L AGEVGW+AASIK IK I+VGDTIT   N A   L GYKK+ PMVYCG+YPID+ QY+ FKEALEK+ LSDSSL YE ETSQALGFG R GFLGLLHM+V++ERL+RE+N+ LIATAPSVIYK+ L DGT++EID+ AKLPD    K ++EPF   +I+ P + +G++M LCQN  G Y DL  VD  R  + Y +PLAEI++ FF+KLKS SKGYA+ +YE++ Y++  LVK+DILLNG+ VDA S I+++ FA  R   +  KLKE IP+  FE+P+QA IG K++ARET+ A RK+V  K +  D +R+KKLL +QKEGKK++K IG+V VP + F+ +L
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVTKREMQEQLLDSMDIERERGITIKLNSVQL-YYKAKDGQEYTFHLIDTPGHVDFAYEVSRSLAACEGAILVVDATQGIEAQTLANVYLAIENNLEIIPVINKVDLPSADAERVKEEIENTIGIDCSDAPLISAKTGLNVEDVLEAIVNKIPAPYDADDAKPLRALIFDSYYDKYLGVVMSIRVREGSIKVGDRIKLMANGSSYEVTELGVKNPKIVKKDQLSAGEVGWVAASIKTIKDINVGDTITTVTNSALHPLDGYKKLKPMVYCGIYPIDTNQYQDFKEALEKMELSDSSLVYEPETSQALGFGFRVGFLGLLHMEVVQERLEREYNLNLIATAPSVIYKIHLTDGTMIEIDNPAKLPDPQKIKFMEEPFVNVKIMTPKESVGDLMSLCQNKLGTYKDLQVVDDNRMMLVYDMPLAEIIFDFFNKLKSISKGYASFEYEMIGYQESQLVKMDILLNGDMVDAFSMIVNKHFAYQRGAALTKKLKELIPRQNFEVPVQATIGNKVLARETIKAYRKDVTWKLHAADKSRRKKLLNKQKEGKKKMKEIGSVEVPQEAFIAVL 596
>gi|49481363|ref|YP_038374.1| GTP-binding protein LepA [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|52141184|ref|YP_085645.1| GTP-binding protein LepA [Bacillus cereus E33L] >gi|118479486|ref|YP_896637.1| GTP-binding protein LepA [Bacillus thuringiensis str. Al Hakam] >gi|196039360|ref|ZP_03106666.1| GTP-binding protein LepA [Bacillus cereus NVH0597-99] >gi|196044925|ref|ZP_03112159.1| GTP-binding protein LepA [Bacillus cereus 03BB108] >gi|166223169|sp|A0RIT7|LEPA_BACAH GTP-binding protein lepA >gi|60389926|sp|Q634M2|LEPA_BACCZ GTP-binding protein lepA >gi|60390014|sp|Q6HDK2|LEPA_BACHK GTP-binding protein lepA >gi|49332919|gb|AAT63565.1| GTP-binding protein LepA [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|51974653|gb|AAU16203.1| GTP-binding protein [Bacillus cereus E33L] >gi|118418711|gb|ABK87130.1| GTP-binding protein LepA [Bacillus thuringiensis str. Al Hakam] >gi|196024413|gb|EDX63086.1| GTP-binding protein LepA [Bacillus cereus 03BB108] >gi|196029987|gb|EDX68588.1| GTP-binding protein LepA [Bacillus cereus NVH0597-99] (607 aa)
Score = 1936, Expect = 0.0e+00, Identities = 365/592 (61%), Positives = 469/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD  +   ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVFLTNGEDMIVDNPSNMPDPQIIDRVEEPFVKAAIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNSEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|195978305|ref|YP_002123549.1| GTP-binding protein LepA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975010|gb|ACG62536.1| GTP-binding protein LepA [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (610 aa)
Score = 1936, Expect = 0.0e+00, Identities = 369/593 (62%), Positives = 474/593 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   K+ QDY FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV++++ED IGLD S A L SAK+G+ I  I+E I+E++P P   D +KPLQAL+FDS YDAY+G +  VR+ NG VK G  I+ MSN +TF V+ +G+ TPK + ++ L  G+VG+IAASIK +    VGDT+T   NPA   L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   DG +LE+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YR+  LVK+DILLNG+KVDALS I+HREFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-KAKNGQDYIFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRQEIEDVIGLDASEAVLASAKSGIGIEAILEQIVEKVPAP-SGDVDKPLQALIFDSVYDAYRGVILQVRVVNGMVKPGDTIQMMSNGKTFDVTEVGIFTPKAIGRDFLATGDVGYIAASIKTVADTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGDMLEVSNPSEFPDPTKVDSIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYHIPLAEIVFDFFDKLKSSTRGYASFDYEIAEYRRSQLVKMDILLNGDKVDALSFIVHREFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|69246682|ref|ZP_00604072.1| Small GTP-binding protein domain:GTP-binding protein LepA [Enterococcus faecium DO] >gi|68195156|gb|EAN09614.1| Small GTP-binding protein domain:GTP-binding protein LepA [Enterococcus faecium DO] (611 aa)
Score = 1935, Expect = 0.0e+00, Identities = 368/595 (61%), Positives = 479/595 (80%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T+T+T+REM++Q+LDSMD+ERERGITIKLNAV+L Y   K+ + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV++++ED IG+D S A L SAK+G+ I  I+E I+E +P P   D + PL+AL+FDS YD+Y+G V  VRI +G VK G KI+ MSN +TF V+ +GV +PK V ++ L+ G+VG+I ASIK ++   VGDT+T   NPA  +LPGY+K+ PMVYCGLYPID+++Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHMDV++ERL+REFN+ LI TAPSVIY V   DGT   +D+ A  P+    ++++EPF KA+I+VP+DF+G VMEL Q  RGE++ +  +D  R  V Y IPL+EI++ FFDKLKS +KGYA+LDYE+  Y+K  LVK+DILLNG KVDALS I+HR+FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ +L
  S:    10 QEQIRNFSIIAHIDHGKSTLADRILEMTHTVTSREMQDQLLDSMDLERERGITIKLNAVELNY-TAKNGETYIFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRQEIEDVIGIDASEAVLASAKSGIGIEDILEQIVEYVPAP-SGDLDAPLKALIFDSIYDSYRGVVLNVRITDGMVKPGDKIKLMSNGKTFDVTEVGVFSPKAVARDFLMVGDVGYITASIKTVQDTRVGDTVTLADNPAAEALPGYRKMNPMVYCGLYPIDTSRYNDLREALEKLQLNDAALQFEPETSQALGFGFRCGFLGLLHMDVVQERLEREFNLELITTAPSVIYHVNKTDGTTATVDNPADFPEPVTIQDVEEPFVKAQIMVPNDFVGAVMELSQRKRGEFITMDYLDDYRVNVVYNIPLSEIVFDFFDKLKSSTKGYASLDYEMSGYQKSKLVKMDILLNGEKVDALSFIVHRDFAYERGKAIVEKLKKLIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVL 602
>gi|166983253|ref|ZP_02254671.1| GTP-binding protein LepA [Bacillus cereus AH187] >gi|166995903|ref|ZP_02262363.1| GTP-binding protein LepA [Bacillus cereus AH820] >gi|168161098|ref|ZP_02596331.1| GTP-binding protein LepA [Bacillus cereus H3081.97] >gi|196034391|ref|ZP_03101800.1| GTP-binding protein LepA [Bacillus cereus W] >gi|195992933|gb|EDX56892.1| GTP-binding protein LepA [Bacillus cereus W] (607 aa)
Score = 1935, Expect = 0.0e+00, Identities = 365/592 (61%), Positives = 468/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVFLTNGEDMIVDNPSNMPDPQTIDRVEEPFVKAAIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNSEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|49187214|ref|YP_030466.1| GTP-binding protein LepA [Bacillus anthracis str. Sterne] >gi|165872104|ref|ZP_02216744.1| GTP-binding protein LepA [Bacillus anthracis str. A0488] >gi|167634498|ref|ZP_02392818.1| GTP-binding protein LepA [Bacillus anthracis str. A0442] >gi|167638593|ref|ZP_02396869.1| GTP-binding protein LepA [Bacillus anthracis str. A0193] >gi|170687450|ref|ZP_02878667.1| GTP-binding protein LepA [Bacillus anthracis str. A0465] >gi|170707378|ref|ZP_02897832.1| GTP-binding protein LepA [Bacillus anthracis str. A0389] >gi|177653251|ref|ZP_02935503.1| GTP-binding protein LepA [Bacillus anthracis str. A0174] >gi|190567068|ref|ZP_03019984.1| GTP-binding protein LepA [Bacillus anthracis Tsiankovskii-I] >gi|49181141|gb|AAT56517.1| GTP-binding protein LepA [Bacillus anthracis str. Sterne] >gi|164712235|gb|EDR17772.1| GTP-binding protein LepA [Bacillus anthracis str. A0488] >gi|167513441|gb|EDR88811.1| GTP-binding protein LepA [Bacillus anthracis str. A0193] >gi|167529950|gb|EDR92685.1| GTP-binding protein LepA [Bacillus anthracis str. A0442] >gi|170127622|gb|EDS96495.1| GTP-binding protein LepA [Bacillus anthracis str. A0389] >gi|170668645|gb|EDT19391.1| GTP-binding protein LepA [Bacillus anthracis str. A0465] >gi|172081533|gb|EDT66605.1| GTP-binding protein LepA [Bacillus anthracis str. A0174] >gi|190562059|gb|EDV16028.1| GTP-binding protein LepA [Bacillus anthracis Tsiankovskii-I] (607 aa)
Score = 1935, Expect = 0.0e+00, Identities = 364/592 (61%), Positives = 468/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++++ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEILQERIEREFKIDLITTAPSVIYKVFLTNGEDMIVDNPSNMPDPQTIDRVEEPFVKAAIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNSEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|172056815|ref|YP_001813275.1| GTP-binding protein LepA [Exiguobacterium sibiricum 255-15] >gi|171989336|gb|ACB60258.1| GTP-binding protein LepA [Exiguobacterium sibiricum 255-15] (607 aa)
Score = 1935, Expect = 0.0e+00, Identities = 362/596 (60%), Positives = 477/596 (80%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT+REMK+Q LD+MD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLPSAD++RV++++ED IGLD S A   SAK G+ I +I+E I+ ++P P   D   PL+AL+FDSYYDAY+G V  +R+ NG VKVG KIR MS  + F V  L V+TPK + ++ L  G+VG ++ASIK +  + VGDTIT    PA  +LPGY+K+ PMVYCGLYPID+ +Y   +EALE++ LSD++L +E ETSQALGFG RCGFLG+LHM++I+ER++REFNI +I TAPSVIY V    G +L +D+ +K+P++   + I+EP+ KA ++ P+D++G +MELCQ  RG ++D+  +D+TR K+TY +PL+EI+Y FFD+LKS +KGYA+LDYE++ Y++  LVK+DILLN   VDALS I+HR+FA +R + I  KLKE IP+ QFE+PIQA +G KI+AR T+ A+RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V VP + F+ +LS
  S:    10 QKSIRNFSIIAHIDHGKSTLADRILEKTGALTSREMKDQTLDAMDLERERGITIKLNAVQLKY-TAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDNDLEILPIINKIDLPSADVERVRQEIEDVIGLDASEAVPTSAKAGIGIEEILEQIVAKVPAP-TGDPEAPLEALIFDSYYDAYRGVVASIRVVNGTVKVGDKIRMMSTGKDFEVLELAVSTPKPLRQKELTVGDVGTLSASIKTVGDVRVGDTITLAKQPAQEALPGYRKMNPMVYCGLYPIDAARYNDLREALERLQLSDAALEFEPETSQALGFGFRCGFLGMLHMEIIQERIEREFNIDMITTAPSVIYHVTTTAGEVLHVDNPSKMPEQQKVEFIEEPYVKAAVMTPNDYVGAIMELCQKKRGTFIDMEYIDTTRVKITYELPLSEIVYDFFDQLKSSTKGYASLDYELIGYQQSRLVKMDILLNNENVDALSFIVHRDFAYERGKVIVDKLKELIPRMQFEVPIQAAVGTKIVARSTIKALRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKMVGSVEVPQEAFMSVLS 603
>gi|30264390|ref|NP_846767.1| GTP-binding protein LepA [Bacillus anthracis str. Ames] >gi|47529841|ref|YP_021190.1| GTP-binding protein LepA [Bacillus anthracis str. 'Ames Ancestor'] >gi|65321692|ref|ZP_00394651.1| COG0481: Membrane GTPase LepA [Bacillus anthracis str. A2012] >gi|33112353|sp|Q81LR7|LEPA_BACAN GTP-binding protein lepA >gi|30259048|gb|AAP28253.1| GTP-binding protein LepA [Bacillus anthracis str. Ames] >gi|47504989|gb|AAT33665.1| GTP-binding protein LepA [Bacillus anthracis str. 'Ames Ancestor'] (607 aa)
Score = 1933, Expect = 0.0e+00, Identities = 363/592 (61%), Positives = 468/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNA+QL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++++ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAIQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEILQERIEREFKIDLITTAPSVIYKVFLTNGEDMIVDNPSNMPDPQTIDRVEEPFVKAAIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNSEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|56963420|ref|YP_175151.1| GTP-binding protein LepA [Bacillus clausii KSM-K16] >gi|60389909|sp|Q5WHG5|LEPA_BACSK GTP-binding protein lepA >gi|56909663|dbj|BAD64190.1| GTP-binding protein LepA [Bacillus clausii KSM-K16] (607 aa)
Score = 1931, Expect = 0.0e+00, Identities = 365/592 (61%), Positives = 466/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T  LT REMK Q LD+MD+ERERGITIKLNAVQL Y   KD  +Y FHLIDTPGHVDFTYEVSRSLAACEGALL+VD++QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSA+ +RVKK+VED IGLD S+A L SAK G+ I  I+E ++E++P P   D   PL+AL+FDS YD Y+G +  +RI  G V+ G KIR M   + F V+ +GV TPK V  E L  G+VG++ A+IKN+    VGDTIT   NPA  +LPGY+++ PMVYCGLYPID+  Y   +EALE++ L+D+SL YE ETSQALGFG RCGFLGLLHM++I+ER++REF I+LI TAPSVIY V L DG  ++ID+   +PD      ++EP+ K+ ++VP+D++G VMELCQ+ RG ++D+  +D  R ++ Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ YR+  LVK+DILLNG KVDALS I+HR+ A +R + I  KLKE IP+ QFE+P+QA IG KIIAR T+ A+RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+KA+GNV +P + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILERTGALTDREMKEQALDAMDLERERGITIKLNAVQLKY-KAKDGNEYIFHLIDTPGHVDFTYEVSRSLAACEGALLIVDSAQGIEAQTLANVYLALDNDLEILPVINKIDLPSAEPERVKKEVEDVIGLDASDAVLASAKNGIGIEDILEQVVEKVPAPA-GDPTAPLKALIFDSLYDPYRGVIAYIRIVEGTVRPGEKIRMMQTGKEFEVNEVGVFTPKAVKCEELTVGDVGFLTAAIKNVSDSRVGDTITSAVNPAQEALPGYRRMNPMVYCGLYPIDTNDYNDLREALERLELNDASLQYEPETSQALGFGFRCGFLGLLHMEIIQERIEREFGISLITTAPSVIYHVTLTDGNTIQIDNPTNMPDPQKMDHVEEPYVKSTVMVPNDYVGAVMELCQSKRGIFVDMQYLDENRVQIIYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYRQSKLVKMDILLNGEKVDALSVIVHRDSAYERGKVIVEKLKELIPRQQFEVPVQASIGTKIIARSTIKAIRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKAVGNVEIPQEAFMAVL 602
>gi|16079605|ref|NP_390429.1| GTP-binding protein LepA [Bacillus subtilis subsp. subtilis str. 168] >gi|1708794|sp|P37949|LEPA_BACSU GTP-binding protein lepA >gi|1122398|emb|CAA62842.1| lepA [Bacillus subtilis] >gi|1303804|dbj|BAA12460.1| YqeQ [Bacillus subtilis] >gi|2634997|emb|CAB14493.1| GTP-binding protein [Bacillus subtilis subsp. subtilis str. 168] (612 aa)
Score = 1930, Expect = 0.0e+00, Identities = 362/592 (61%), Positives = 470/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T+ +T REMK Q+LDSMD+ERERGITIKLN+VQL Y   KD ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSA+ +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G V  +R+  G VK G KI+ M+  + F V+ +GV TPK      L  G+VG++ ASIKN+    VGDTIT  ANPA  +LPGY+K+ PMVYCGLYPID+ +Y   +EALEK+ L+DSSL YE ETSQALGFG RCGFLG+LHM++I+ER++REFNI LI TAPSVIY V + DG  + +D+ + +PD    + ++EP+ KA ++VP+D++G VMELCQ  RG ++D+  +D+ R  + Y +PLAEI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DI+LNG K+DALS I+HR++A +R + I  KLKE IP+ QFE+P+QA IG KI+AR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGK+R+K +G+V VP + F+ +L
  S:    14 IRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQLKY-KAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDPEAPLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGKEFEVTEVGVFTPKATPTNELTVGDVGFLTASIKNVGDTRVGDTITSAANPAEEALPGYRKLNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIEREFNIDLITTAPSVIYDVYMTDGEKVVVDNPSNMPDPQKIERVEEPYVKATMMVPNDYVGAVMELCQGKRGNFIDMQYLDANRVSIIYDMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKPSKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVL 603
>gi|167938598|ref|ZP_02525673.1| GTP-binding protein LepA [Bacillus cereus AH1134] (607 aa)
Score = 1930, Expect = 0.0e+00, Identities = 365/592 (61%), Positives = 468/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-SGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVYLTNGEDVIVDNPSNMPDPQSIDRVEEPFVKASIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNNEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|168135740|ref|ZP_02578969.1| GTP-binding protein LepA [Bacillus cereus B4264] (607 aa)
Score = 1929, Expect = 0.0e+00, Identities = 365/592 (61%), Positives = 468/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPA-GDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVYLTNGEDVIVDNPSNMPDPQSIDRVEEPFVKASIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNNEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|188159609|ref|ZP_02998772.1| GTP-binding protein LepA [Mycoplasma mycoides subsp. mycoides LC str. GM12] (600 aa)
Score = 1927, Expect = 0.0e+00, Identities = 378/597 (63%), Positives = 484/597 (81%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK  IRNFSI+AHIDHGKSTL+DRI+E TNT+  REM++Q+LDSMDIERERGITIKLN+VQL YH+ KDNQDY F+LIDTPGHVDFTYEVSRSLAACEGA+LVVDASQGVEAQTL+NVYLA+++NLEI+PVINKIDLPSAD+D+VK+++E+ IGLDCSNAPL+SAKTGLN+  +++AI+E+IP P D+ DN PL+AL+FDSYYD Y G V  +R+K G ++VG KI+ MS N  + V+ LG+ TPKIV K+ L AGEVGW+AASIK IK ++VGDTIT   NPA   L GYKK+ PMVYCG+YPID+ +Y+ FKEALEKI LSDSSL YE ETSQALGFG RCGFLGLLHM+VI+ERL+RE+N+ LIATAPSV+YKV L +  I+E+D+ A LP+     +I+EPF + +I  P +++G++M LCQN  G Y ++  +D+ R+ + Y +PLAEI++ FF+KLKS SKGYA+ +YE++ Y++  LV++DI LNG  VDA S I++++FA  R   + LKLKE IP+  FE+P+QA IG K+I+RET+ A RK+V  K +  D +R+KKLLE+QKEGKK++K IG V VP + FV IL
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVEKREMQDQLLDSMDIERERGITIKLNSVQLKYHS-KDNQDYIFNLIDTPGHVDFTYEVSRSLAACEGAILVVDASQGVEAQTLANVYLAIDSNLEIIPVINKIDLPSADVDKVKQEIEEIIGLDCSNAPLISAKTGLNVEDVLQAIVERIPSPSDAIDNAPLKALIFDSYYDKYLGVVMSIRLKQGMLRVGDKIKLMSTNAEYEVTYLGIKTPKIVKKDFLEAGEVGWVAASIKTIKDVNVGDTITSVLNPADEPLEGYKKLKPMVYCGIYPIDTNKYQDFKEALEKIELSDSSLVYEPETSQALGFGFRCGFLGLLHMEVIQERLEREYNLELIATAPSVVYKVHLTNKQIIELDNPALLPEAQKIAKIEEPFVEIKIATPSEYIGDLMNLCQNKLGIYKNMEVIDNNRRILIYQMPLAEIIFDFFNKLKSISKGYASFEYELIGYKESKLVRMDIKLNGEMVDAFSMIVNQKFAYQRGSALTLKLKELIPRQNFEVPVQATIGNKVISRETIKAYRKDVTWKLHAADKSRRKKLLEKQKEGKKKMKEIGTVEVPQEAFVAIL 596
>gi|83319434|ref|YP_424306.1| GTP-binding protein LepA [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|119371368|sp|Q2SSF7|LEPA_MYCCT GTP-binding protein lepA >gi|83283320|gb|ABC01252.1| GTP-binding protein LepA [Mycoplasma capricolum subsp. capricolum ATCC 27343] (600 aa)
Score = 1927, Expect = 0.0e+00, Identities = 376/597 (62%), Positives = 486/597 (81%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK  IRNFSI+AHIDHGKSTL+DRI+E TNT+  REM++Q+LDSMDIERERGITIKLN+VQL YH+ KD++DY F+LIDTPGHVDFTYEVSRSLAACEGA+LVVDASQGVEAQTL+NVYLA+++NLEI+PVINKIDLPSAD+D+VK+++E+ IGLDCSNAPL+SAKTGLN+  +++AI+++IPPP D+ DN PL+AL+FDSYYD Y G V  +R+K G +KVG KI+ MS N  + V++LG+ TPKIV K+ L AGEVGW+AASIK IK ++VGDTIT   NPA   L GYKK+ PMVYCG+YPID+ +Y+ FKEALEKI LSDSSL YE ETSQALGFG RCGFLGLLHM+VI+ERL+RE+N+ LIATAPSV+YKV L +  ++E+D+ A LP+     +I+EPF + +I  P +++G++M LCQN  G Y ++  +D+ R+ + Y +PLAEI++ FF+KLKS SKGYA+ +YE++ Y++  LV++DI LNG  VDA S I++++FA  R   + LKLKE IP+  FE+P+QA IG K+I+RET+ A RK+V  K +  D +R+KKLLE+QKEGKK++K IG V VP + FV IL
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVEKREMQDQLLDSMDIERERGITIKLNSVQLKYHS-KDDKDYIFNLIDTPGHVDFTYEVSRSLAACEGAILVVDASQGVEAQTLANVYLAIDSNLEIIPVINKIDLPSADVDKVKQEIEEIIGLDCSNAPLISAKTGLNVQDVLQAIVDKIPPPSDAIDNAPLKALIFDSYYDKYLGVVMSIRLKQGMLKVGDKIKLMSTNAEYEVTSLGIKTPKIVKKDFLEAGEVGWVAASIKTIKDVNVGDTITSVLNPAKEPLDGYKKLKPMVYCGIYPIDTNKYQDFKEALEKIELSDSSLVYEPETSQALGFGFRCGFLGLLHMEVIQERLEREYNLELIATAPSVVYKVHLTNKQVIELDNPALLPEAQKISKIEEPFVEIKIATPSEYIGDLMNLCQNKLGIYKNMEVIDNNRRILIYQMPLAEIIFDFFNKLKSISKGYASFEYELIGYKESKLVRMDIKLNGEMVDAFSMIVNQKFAYQRGSALTLKLKELIPRQNFEVPVQATIGNKVISRETIKAYRKDVTWKLHAADKSRRKKLLEKQKEGKKKMKEIGTVEVPQEAFVAIL 596
>gi|22537069|ref|NP_687920.1| GTP-binding protein LepA [Streptococcus agalactiae 2603V/R] >gi|25010971|ref|NP_735366.1| GTP-binding protein LepA [Streptococcus agalactiae NEM316] >gi|76788416|ref|YP_329644.1| GTP-binding protein LepA [Streptococcus agalactiae A909] >gi|76799334|ref|ZP_00781496.1| GTP-binding protein LepA [Streptococcus agalactiae 18RS21] >gi|77405730|ref|ZP_00782816.1| GTP-binding protein LepA [Streptococcus agalactiae H36B] >gi|77411013|ref|ZP_00787368.1| GTP-binding protein LepA [Streptococcus agalactiae CJB111] >gi|77413151|ref|ZP_00789350.1| GTP-binding protein LepA [Streptococcus agalactiae 515] >gi|54037725|sp|P65274|LEPA_STRA5 GTP-binding protein lepA >gi|54041427|sp|P65273|LEPA_STRA3 GTP-binding protein lepA >gi|90185212|sp|Q3K1F9|LEPA_STRA1 GTP-binding protein lepA >gi|22533928|gb|AAM99792.1|AE014233_9 GTP-binding protein LepA [Streptococcus agalactiae 2603V/R] >gi|23095371|emb|CAD46576.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563473|gb|ABA46057.1| GTP-binding protein LepA [Streptococcus agalactiae A909] >gi|76585308|gb|EAO61904.1| GTP-binding protein LepA [Streptococcus agalactiae 18RS21] >gi|77160769|gb|EAO71881.1| GTP-binding protein LepA [Streptococcus agalactiae 515] >gi|77162937|gb|EAO73893.1| GTP-binding protein LepA [Streptococcus agalactiae CJB111] >gi|77175652|gb|EAO78435.1| GTP-binding protein LepA [Streptococcus agalactiae H36B] (610 aa)
Score = 1926, Expect = 0.0e+00, Identities = 372/596 (62%), Positives = 473/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P    D  PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG+IAASIK +    VGDTIT   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   DG +LE+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPTGEVD-APLQALIFDSVYDAYRGVILQVRIVNGMVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVADTRVGDTITLANNPAIEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTRVDSIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|77409570|ref|ZP_00786251.1| GTP-binding protein LepA [Streptococcus agalactiae COH1] >gi|77171819|gb|EAO75007.1| GTP-binding protein LepA [Streptococcus agalactiae COH1] (610 aa)
Score = 1926, Expect = 0.0e+00, Identities = 372/596 (62%), Positives = 473/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P    D  PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG+IAASIK +    VGDTIT   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   DG +LE+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPTGEVD-APLQALIFDSVYDAYRGVILQVRIVNGMVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVADTRVGDTITLANNPAIDPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTRVDSIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|47569315|ref|ZP_00239999.1| GTP-binding protein LepA [Bacillus cereus G9241] >gi|47553986|gb|EAL12353.1| GTP-binding protein LepA [Bacillus cereus G9241] (607 aa)
Score = 1925, Expect = 0.0e+00, Identities = 364/592 (61%), Positives = 468/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLK+ IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVYLTNGEDVIVDNPSNMPDPQSIDRVEEPFVKASIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNNEQVDALSFIVHRDSAYDRGKVIVEKLKDLIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|167630494|ref|YP_001680993.1| GTP-binding protein LepA [Heliobacterium modesticaldum Ice1] >gi|167593234|gb|ABZ84982.1| GTP-binding protein lepa [Heliobacterium modesticaldum Ice1] (601 aa)
Score = 1925, Expect = 0.0e+00, Identities = 364/593 (61%), Positives = 472/593 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNF I+AHIDHGKSTL+DRI+EFT  LT REM++Q+LDSMD+ERERGITIKL AV+L Y   KD Q Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDA+QG+EAQTL+NVYLALEN+LEI+PV+NKIDLPSA+ DRVK+++ED IGLD S+A LVSAK G+ I + +EAI+ +IPPP + D   PLQ ++FDS+YDAYKGA+  VR+  G VK GTKI+ MS  +TF V+ +GV TP     E L +GEVG+I ASIKN+K   VGDTITD  +PA   LPGY+++ PMVYCGLYP++   YE  ++AL+K+ L+D++L YE ETS ALGFG RCGFLGLLHM++++ERL+REF++ LI TAP+VIYKV   DG ++ +D+  KLP     + I+EP+ KA ++VP DF+G VMELCQ  RG ++++  + + R  + Y +PLAEI++ FFD+LKS +KGYA+LDYE++ YR  +LVK+DILLNG+ +DA S I+HR+ A +R R +  KLK+ IP+  FE+PIQAVIG K+IARET+ A+RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P + F+ +LS
  S:     8 IRNFCIIAHIDHGKSTLADRILEFTGALTEREMEDQVLDSMDLERERGITIKLQAVRLQY-KAKDGQVYTLNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALENDLEIIPVVNKIDLPSAEPDRVKQEIEDVIGLDASDAILVSAKAGIGIEETLEAIVAKIPPP-EGDPTAPLQCMIFDSFYDAYKGAISYVRVVEGTVKKGTKIKMMSTGKTFEVTEVGVFTPAPRQVEKLSSGEVGFIVASIKNVKDTRVGDTITDADHPAKEPLPGYRQVTPMVYCGLYPVEGAGYEDLRDALDKLRLNDAALIYEPETSVALGFGFRCGFLGLLHMEIVQERLEREFDLDLITTAPNVIYKVNQTDGQVVFVDNPTKLPPNQKIETIEEPYVKASVMVPSDFVGAVMELCQEKRGVFINMDYIAAQRVMLIYELPLAEIIFDFFDQLKSRTKGYASLDYELIGYRVSELVKLDILLNGDLIDAFSIIVHRDRAYNRGRALADKLKDLIPRQMFEVPIQAVIGNKVIARETIKAIRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQEAFMAVLS 598
>gi|30022398|ref|NP_834029.1| GTP-binding protein LepA [Bacillus cereus ATCC 14579] >gi|33112352|sp|Q818E4|LEPA_BACCR GTP-binding protein lepA >gi|29897956|gb|AAP11230.1| GTP-binding protein lepA [Bacillus cereus ATCC 14579] (607 aa)
Score = 1922, Expect = 0.0e+00, Identities = 364/592 (61%), Positives = 467/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN LT REMK Q+LDSMD+ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I +I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G  + +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLKE IP+ QFE+PIQA IG K++AR T+ AMRKNVLAKCYGGDI+RK+KLL++QKE KKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALTQREMKAQLLDSMDLERERGITIKLNAVQLNY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPA-GDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLAGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVYLTNGEDVIVDNPSNMPDPQSIDRVEEPFVKASIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNNEQVDALSFIVHRDSAYDRGKVIVEKLKELIPRQQFEVPIQATIGNKVVARSTIKAMRKNVLAKCYGGDISRKRKLLDKQKESKKRMKSVGSVEVPQEAFMAVL 602
>gi|169829283|ref|YP_001699441.1| GTP-binding protein [Lysinibacillus sphaericus C3-41] >gi|168993771|gb|ACA41311.1| GTP-binding protein [Lysinibacillus sphaericus C3-41] (611 aa)
Score = 1922, Expect = 0.0e+00, Identities = 365/592 (61%), Positives = 472/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T +LT+REMK Q+LDSMD+ERERGITIKLNAVQL Y   K+ + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+++VED IGLD S A L SAK G+ I  I+E I+E++P P   D + PLQAL+FDS YDAYKG +  +R+ NG VK G KIR M+    F V  +GV+TPK+V +  L  G+VG++ ASIKN+    VGDT+T    PAT  L GY+++ PMVYCGLYPID+ +Y   +EALEK+ L+DS+L YE ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY+V + DG+ +++D+ + +PD      ++EP+ KA I+VP+D++G VMELCQ  RG ++ +  +D+TR  + Y +PL+EI+Y FFD LKS +KGYA+ DYE++ Y++  LVK+DILLNG +VDALS I+HR+FA DR + I  KLKE IP+ QFE+PIQA +G KI+AR T+ A+RKNVLAKCYGGDI+RK+KLL++QKEGKKR+K +G+V VP + F+ +L
  S:    16 IRNFSIIAHIDHGKSTLADRILEQTKSLTSREMKAQLLDSMDLERERGITIKLNAVQLKYE-AKNGEVYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRQEVEDVIGLDASEAVLASAKAGIGIEDILEQIVEKVPAP-TGDPDAPLQALIFDSIYDAYKGVIISIRVINGTVKPGDKIRMMATGAEFEVIEVGVHTPKVVPQTELTVGDVGYLTASIKNVGDTRVGDTVTFANRPATEPLAGYRRLNPMVYCGLYPIDTAKYNDLREALEKLELNDSALQYEPETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYEVHMTDGSSIKVDNPSFMPDPQKIDRVEEPYVKATIMVPNDYVGAVMELCQMKRGNFMTMDYIDTTRVSIIYEMPLSEIVYDFFDYLKSNTKGYASFDYELIGYQQSKLVKMDILLNGEQVDALSFIVHRDFAYDRGKIIVEKLKELIPRQQFEVPIQAAVGQKIVARSTIKAIRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKQVGSVEVPQEAFMAVL 605
>gi|157693051|ref|YP_001487513.1| GTP-binding protein LepA [Bacillus pumilus SAFR-032] >gi|166987748|sp|A8FFD6|LEPA_BACP2 GTP-binding protein lepA >gi|157681809|gb|ABV62953.1| membrane GTPase LepA [Bacillus pumilus SAFR-032] (612 aa)
Score = 1920, Expect = 0.0e+00, Identities = 363/592 (61%), Positives = 465/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T  +T REMK Q+LDSMD+ERERGITIKLN+VQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+P+INKIDLPSA+ +RV+ ++ED IGLD S A L SAK G+ I  I+E I+E++P P   D   PLQAL+FDS YDAY+G +  +RI  G VK G KI+ M+  + F V  +GV TPK +  + L  G+VG++ A+IKN+    VGDTIT   NPA  +LPGY+K+ PMVYCGLYPID+ +Y   +EALEK+ L+DSSL YE ETSQALGFG RCGFLG+LHM++I+ER++REF I LI TAPSVIY V + DG  + +D+ + LPD    + I+EP+ KA ++VP+D++G+VMELCQ  RG ++D+  +D+ R  + Y IPLAEI+Y FFD+LKS +KGYA+ DYE++ YR   LVK+DI+LNG K+DALS I+HR++A +R + I  KLKE IP+  FE+PIQA IG KI+AR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V VP + F+ +L
  S:    14 IRNFSIIAHIDHGKSTLADRILEKTAAITQREMKEQLLDSMDLERERGITIKLNSVQLKY-KAKDGEEYIMHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPIINKIDLPSAEPERVRGEIEDVIGLDASEAVLTSAKAGIGIEDILEQIVEKVPAPA-GDPEAPLQALIFDSLYDAYRGVIAYIRIVEGTVKPGQKIKMMATGKEFEVLEVGVFTPKAMPTDELTVGDVGYLTAAIKNVGDTRVGDTITSAVNPAQEALPGYRKLNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIEREFKIDLITTAPSVIYDVYMTDGEKIVVDNPSNLPDPQKIERIEEPYVKATMMVPNDYVGSVMELCQGKRGHFIDMQYLDANRVSIVYEIPLAEIVYEFFDQLKSNTKGYASFDYELIGYRPSTLVKMDIMLNGEKIDALSFIVHRDYAYERGKIIVDKLKELIPRQHFEVPIQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVL 603
>gi|171779974|ref|ZP_02920878.1| hypothetical protein STRINF_01761 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171281322|gb|EDT46757.1| hypothetical protein STRINF_01761 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (611 aa)
Score = 1919, Expect = 0.0e+00, Identities = 369/596 (61%), Positives = 472/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV++++ED IGLD S A L SAK G+ I +I+E I+E +P P+  D   PLQAL+FDS YDAY+G +  VRI NG VK G  I+ MSN +TF V+ +G+ TPK V ++ L  G+VG+IAASIK +    VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   DG +LE+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YRK  LVK+DILLNG+KVDALS I+H EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRQEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEYVPAPV-GDVEAPLQALIFDSVYDAYRGVILQVRIVNGMVKPGDTIQLMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVADTRVGDTVTLANNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTKVASIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDENRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRKSKLVKMDILLNGDKVDALSFIVHNEFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|194017732|ref|ZP_03056342.1| GTP-binding protein LepA [Bacillus pumilus ATCC 7061] >gi|194010632|gb|EDW20204.1| GTP-binding protein LepA [Bacillus pumilus ATCC 7061] (612 aa)
Score = 1919, Expect = 0.0e+00, Identities = 362/592 (61%), Positives = 466/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T+ +T REMK Q+LDSMD+ERERGITIKLN+VQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+P+INKIDLPSA+ +RV+ ++ED IGLD S A L SAK G+ I  I+E I+E++P P   D   PLQAL+FDS YDAY+G +  +RI  G VK G KI+ M+  + F V  +GV TPK +  + L  G+VG++ A+IKN+    VGDTIT   NPA  +LPGY+K+ PMVYCGLYPID+ +Y   +EALEK+ L+DSSL YE ETSQALGFG RCGFLG+LHM++I+ER++REF I LI TAPSVIY V + DG  + +D+ + LPD    ++I+EP+ KA ++VP+D++G+VMELCQ  RG ++D+  +D+ R  + Y IPLAEI+Y FFD LKS +KGYA+ DYE++ YR   LVK+DI+LNG K+DALS I+HR++A +R + I  KLKE IP+  FE+P+QA IG KI+AR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V VP + F+ +L
  S:    14 IRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQLKY-KAKDGEEYIMHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPIINKIDLPSAEPERVRGEIEDVIGLDASEAVLTSAKAGIGIEDILEQIVEKVPAPA-GDPEAPLQALIFDSLYDAYRGVIAYIRIVEGTVKPGQKIKMMATGKEFEVLEVGVFTPKAMPTDELTVGDVGYLTAAIKNVGDTRVGDTITSAVNPAKEALPGYRKLNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIEREFKIDLITTAPSVIYDVYMTDGEKIIVDNPSNLPDPQKIEKIEEPYVKATMMVPNDYVGSVMELCQGKRGHFIDMQYLDANRVSIVYEIPLAEIVYEFFDMLKSNTKGYASFDYELIGYRPSTLVKMDIMLNGEKIDALSFIVHRDYAYERGKIIVEKLKELIPRQHFEVPVQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVL 603
>gi|127763383|ref|NP_975328.2| GTP-binding protein LepA [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|126252005|emb|CAE76970.2| GTP-binding protein elongation factor LepA [Mycoplasma mycoides subsp. mycoides SC str. PG1] (600 aa)
Score = 1919, Expect = 0.0e+00, Identities = 376/597 (62%), Positives = 483/597 (80%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK  IRNFSI+AHIDHGKSTL+DRI+E TNT+  REM++Q+LDSMDIERERGITIKLN+VQL YH+ KDNQDY F+LIDTPGHVDFTYEVSRSLAACEGA+LVVDASQGVEAQTL+NVYLA+++NLEI+PVINKIDLPSAD+D+VK ++E+ IGLDCS +PL+SAKTGLN+  +++AI+E+IP P D+ DN PL+AL+FDSYYD Y G V  +R+K G +KVG KI+ MS N  + V++LG+ TPKIV K+ L AGEVGW+AASIK IK ++VGDTIT   NPA   L GYKK+ PMVYCG+YPID+ +Y+ FKEALEKI LSDSSL YE ETSQALGFG RCGFLGLLHM+VI+ERL+RE+N+ LIATAPSV+YKV L +  ++E+D+ A LP+     +I+EPF + +I  P +++G++M LCQN  G Y ++  +D+ R+ + Y +PLAEI++ FF+KLKS SKGYA+ +YE++ Y++  LV++DI LNG  VDA S I++++FA  R   + LKLKE IP+  FE+P+QA IG K+I+RET+ A RK+V  K +  D +R+KKLLE+QKEGKK++K IG V VP + FV IL
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVEKREMQDQLLDSMDIERERGITIKLNSVQLKYHS-KDNQDYIFNLIDTPGHVDFTYEVSRSLAACEGAILVVDASQGVEAQTLANVYLAIDSNLEIIPVINKIDLPSADVDKVKHEIEEIIGLDCSKSPLISAKTGLNVEDVLQAIVEKIPSPSDAIDNAPLKALIFDSYYDKYLGVVMSIRLKQGMLKVGDKIKLMSTNAEYEVTSLGIKTPKIVKKDFLEAGEVGWVAASIKTIKDVNVGDTITSVLNPADEPLDGYKKLKPMVYCGIYPIDTNKYQDFKEALEKIELSDSSLVYEPETSQALGFGFRCGFLGLLHMEVIQERLEREYNLELIATAPSVVYKVHLTNKQVIELDNPALLPEAQKISKIEEPFVEIKIATPSEYIGDLMNLCQNKLGIYKNMEVIDNNRRILIYQMPLAEIIFDFFNKLKSISKGYASFEYELIGYKESKLVRMDIKLNGEMVDAFSMIVNQKFAYQRGSALTLKLKELIPRQNFEVPVQATIGNKVISRETIKAYRKDVTWKLHAADKSRRKKLLEKQKEGKKKMKEIGTVEVPQEAFVAIL 596
>gi|169188777|ref|ZP_02848821.1| GTP-binding protein LepA [Paenibacillus sp. JDR-2] >gi|169004500|gb|EDS51358.1| GTP-binding protein LepA [Paenibacillus sp. JDR-2] (605 aa)
Score = 1918, Expect = 0.0e+00, Identities = 355/595 (59%), Positives = 473/595 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DRI+EFT  L++REM+ Q+LD MD+ERERGITIKL AV+L Y    D ++Y  +LIDTPGHVDFTYEVSRS+AACEGALLVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSA+ +RVK+++ED IGLD S+A L SAK G+ I +I+E +++++P P  + D +PL+AL+FDS+YD YKG +  VR+ +G ++ G KIRFM+    F V  +G   P++   + L  G+VG++ A IKN+K   VGDT+T+   PA  +LPGY+KI PMVYCGLYPI++  Y   +EALEK+ L+D+SL YE ETS ALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY+V L +GT++EID+ +  P+    + ++EP+ KA +IVP+D++G +MELCQ  RGE++++  +D+ R  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE+  YR+ +LVK+DI+LN  +VDALS I+HR+ A  R R IC K+KE IP+  FE+P+QA IG K+IARETV AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K +G+V VP + F+ +L
  S:     8 QKKIRNFSIIAHIDHGKSTLADRILEFTGALSSREMQEQVLDQMDLERERGITIKLQAVRLTY-KADDGEEYLLNLIDTPGHVDFTYEVSRSMAACEGALLVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSAEPERVKQEIEDVIGLDASDAVLASAKAGIGIKEILEQVVQKVPAPTGNPD-EPLKALIFDSHYDPYKGVIVYVRVIDGSIQAGKKIRFMATGAEFEVIEVGAFKPRMGIVDELAVGDVGFVVAGIKNVKDTRVGDTVTEAKRPAPEALPGYRKINPMVYCGLYPIETQDYNDLREALEKLELNDASLRYEPETSTALGFGFRCGFLGLLHMEIIQERIEREFNIPLITTAPSVIYRVTLTNGTVMEIDNPSNYPEAGKLEFVEEPYVKASVIVPNDYVGAIMELCQGKRGEFVNMEYLDTNRVTLTYEIPLSEIVYDFFDQLKSSTKGYASFDYELSGYRRSNLVKMDIMLNNEQVDALSVIVHRDRAYQRGRVICQKMKELIPRQMFEVPVQASIGTKVIARETVKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKQVGSVEVPQEAFMAVL 600
>gi|55820950|ref|YP_139392.1| GTP-binding protein LepA [Streptococcus thermophilus LMG 18311] >gi|81676718|sp|Q5M4M2|LEPA_STRT2 GTP-binding protein lepA >gi|55736935|gb|AAV60577.1| GTP-binding protein [Streptococcus thermophilus LMG 18311] (610 aa)
Score = 1918, Expect = 0.0e+00, Identities = 367/596 (61%), Positives = 472/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PLQAL+FDS YDAY+G +  VR+ NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   DG +LE+ + ++ PD T    I+EP+ KA+I+VP +++G VMEL Q  RG++  +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR+  LVK+DILLNG+KVDALS I+HREFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    11 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-QGDVEAPLQALIFDSVYDAYRGVILQVRVVNGMVKTGDKIQMMSNGKTFDVTEVGIFTPKAVGRDYLATGDVGYVAASIKTVADTRVGDTVTLADNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTRIDTIEEPYVKAQIMVPQEYVGAVMELAQRKRGDFETMEYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRRSQLVKMDILLNGDKVDALSFIVHREFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 604
>gi|55822871|ref|YP_141312.1| GTP-binding protein LepA [Streptococcus thermophilus CNRZ1066] >gi|116627732|ref|YP_820351.1| GTP-binding protein LepA [Streptococcus thermophilus LMD-9] >gi|122267671|sp|Q03KW7|LEPA_STRTD GTP-binding protein lepA >gi|81676568|sp|Q5M008|LEPA_STRT1 GTP-binding protein lepA >gi|55738856|gb|AAV62497.1| GTP-binding protein [Streptococcus thermophilus CNRZ1066] >gi|116101009|gb|ABJ66155.1| GTP-binding protein LepA [Streptococcus thermophilus LMD-9] (610 aa)
Score = 1918, Expect = 0.0e+00, Identities = 367/596 (61%), Positives = 472/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PLQAL+FDS YDAY+G +  VR+ NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   DG +LE+ + ++ PD T    I+EP+ KA+I+VP +++G VMEL Q  RG++  +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR+  LVK+DILLNG+KVDALS I+HREFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    11 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-QGDVEAPLQALIFDSVYDAYRGVILQVRVVNGMVKTGDKIQMMSNGKTFDVTEVGIFTPKAVGRDYLATGDVGYVAASIKTVADTRVGDTVTLADNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDGEMLEVSNPSEFPDPTRIDAIEEPYVKAQIMVPQEYVGAVMELAQRKRGDFETMEYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRRSQLVKMDILLNGDKVDALSFIVHREFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 604
>gi|89101069|ref|ZP_01173908.1| GTP-binding protein LepA [Bacillus sp. NRRL B-14911] >gi|89084212|gb|EAR63374.1| GTP-binding protein LepA [Bacillus sp. NRRL B-14911] (611 aa)
Score = 1915, Expect = 0.0e+00, Identities = 361/591 (61%), Positives = 468/591 (79%)
  Q:     7 RNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           RNFSI+AHIDHGKSTL+DRI+E TN LT REMK+Q+LDSMD+ERERGITIKLN+VQL Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++N+LEIVPVINKIDLPSAD +RV+ ++ED IGLD S A L SAK G+ I +I+E ++E++P P   D + PL+AL+FDS YDAY+G V  +R+  G VKVG K++ M+  + F V+ +GV TPK      L  G+VG++ A+IKN+    VGDTIT   N A   LPGY+K+ PMVYCGLYPIDS ++   +EALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIY V++ DGT+L++D+ + +PD      ++EP+ KA ++ P+D++G +MELCQ  RG ++D+  +D TR  + Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y++  LVK+DILLN  KVDALS I+HR+FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V VP + F+ +L
  S:    14 RNFSIIAHIDHGKSTLADRILERTNALTAREMKDQLLDSMDLERERGITIKLNSVQLKY-KAKDGEIYTFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLAIDNDLEIVPVINKIDLPSADPERVRGEIEDVIGLDASEAVLASAKAGIGIEEILEQVVEKVPAP-QGDPDAPLKALIFDSLYDAYRGVVAYIRVVEGTVKVGDKVKMMATGKEFEVTEVGVFTPKSTPLPELSVGDVGFLTAAIKNVGDTRVGDTITSAKNGAAEPLPGYRKLNPMVYCGLYPIDSARFNDLREALEKLELNDSALQFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYDVVMTDGTLLKVDNPSDMPDAQKIDRVEEPYVKATMMAPNDYVGAIMELCQEKRGIFIDMQYMDETRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKESKLVKMDILLNAEKVDALSFIVHRDFAYERGKVIVEKLKDLIPRQQFEVPIQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVL 602
>gi|126652874|ref|ZP_01725019.1| GTP-binding protein LepA [Bacillus sp. B14905] >gi|126590410|gb|EAZ84530.1| GTP-binding protein LepA [Bacillus sp. B14905] (608 aa)
Score = 1915, Expect = 0.0e+00, Identities = 363/592 (61%), Positives = 471/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR++E T +LT+REMK Q+LDSMD+ERERGITIKLNAVQL Y   K+ + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+++VED IGLD S A L SAK G+ I  I+E I+E++P P   D + PLQAL+FDS YDAYKG +  +R+ NG VK G KIR M+    F V  +GV+TPK+V +  L  G+VG++ ASIKN+    VGDT+T    PAT  L GY+++ PMVYCGLYPID+ +Y   +EALEK+ L+DS+L YE ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY+V + DG+ +++D+ + +PD      ++EP+ KA I+VP+D++G VMELCQ  RG ++ +  +D+TR  + Y +PL+EI+Y FFD LKS +KGYA+ DYE++ Y++  LVK+DILLN  +VDALS I+HR+FA DR + I  KLKE IP+ QFE+PIQA +G KI+AR T+ A+RKNVLAKCYGGDI+RK+KLL++QKEGKKR+K +G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRLLEQTKSLTSREMKAQLLDSMDLERERGITIKLNAVQLKYE-AKNGEVYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRQEVEDVIGLDASEAVLASAKAGIGIEDILEQIVEKVPAP-TGDPDAPLQALIFDSIYDAYKGVIISIRVINGTVKPGDKIRMMATGAEFEVIEVGVHTPKVVPQSELTVGDVGYLTASIKNVGDTRVGDTVTYANRPATEPLAGYRRLNPMVYCGLYPIDTAKYNDLREALEKLELNDSALQYEPETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYEVHMTDGSSIKVDNPSFMPDPQKIDRVEEPYVKATIMVPNDYVGAVMELCQMKRGNFMTMDYIDTTRVSIIYEMPLSEIVYDFFDYLKSNTKGYASFDYELIGYKQSKLVKMDILLNAEQVDALSFIVHRDFAYDRGKIIVEKLKELIPRQQFEVPIQAAVGQKIVARSTIKAIRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKQVGSVEVPQEAFMAVL 602
>gi|47095432|ref|ZP_00233042.1| GTP-binding protein LepA [Listeria monocytogenes str. 1/2a F6854] >gi|153179529|ref|ZP_01932748.1| GTP-binding protein LepA [Listeria monocytogenes F6900] >gi|153183834|ref|ZP_01934651.1| GTP-binding protein LepA [Listeria monocytogenes J0161] >gi|153190922|ref|ZP_01938233.1| GTP-binding protein LepA [Listeria monocytogenes J2818] >gi|153196258|ref|ZP_01940666.1| GTP-binding protein LepA [Listeria monocytogenes 10403S] >gi|47016253|gb|EAL07176.1| GTP-binding protein LepA [Listeria monocytogenes str. 1/2a F6854] >gi|126943486|gb|EBA21207.1| GTP-binding protein LepA [Listeria monocytogenes J0161] >gi|127634540|gb|EBA23926.1| GTP-binding protein LepA [Listeria monocytogenes 10403S] >gi|127765490|gb|EBA25838.1| GTP-binding protein LepA [Listeria monocytogenes J2818] >gi|133733014|gb|EBA34712.1| GTP-binding protein LepA [Listeria monocytogenes F6900] (608 aa)
Score = 1915, Expect = 0.0e+00, Identities = 364/595 (61%), Positives = 477/595 (80%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT REMKNQ+LDSMD+ERERGITIKLNAVQL Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV++++ED IGLD S+A L SAK+G+ I  I+E I+E++P P   D NKPL+AL+FDS +DAY+G +  +RI +G VK G +I+ MSN + F V+ +GV +PK   ++ L+ G+VG++ A+IKN+    VGDTIT   NPA  +L GY+K+ PMVYCGLYPIDS++Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY V L DG+ + +D+ A++P+  + + ++EP+ KA ++VP+D++G VMEL QN RG ++ +  +D  R  + Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  KVDALS I+HR+FA +R + I  KLKE IP+ QFE+PIQA I  KI++R T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ IL
  S:    10 QKKIRNFSIIAHIDHGKSTLADRILEQTGALTHREMKNQLLDSMDLERERGITIKLNAVQLKY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVREEIEDVIGLDASDAVLASAKSGIGIEDILEQIVEKVPEP-SGDVNKPLKALIFDSVFDAYRGVIANIRIMDGVVKTGDRIKMMSNGKEFEVTEVGVFSPKATPRDELLVGDVGYLTAAIKNVGDTRVGDTITLANNPAEEALDGYRKLNPMVYCGLYPIDSSKYNDLRDALEKLELNDSALQFEAETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYHVNLTDGSNIVVDNPAEMPEPGVIESVEEPYVKATVMVPNDYVGAVMELAQNKRGNFITMEYLDDIRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKASKLVKMDILLNAEKVDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAIL 602
>gi|16803519|ref|NP_465004.1| GTP-binding protein LepA [Listeria monocytogenes EGD-e] >gi|46907707|ref|YP_014096.1| GTP-binding protein LepA [Listeria monocytogenes str. 4b F2365] >gi|47094093|ref|ZP_00231818.1| GTP-binding protein LepA [Listeria monocytogenes str. 4b H7858] >gi|153174606|ref|ZP_01930107.1| GTP-binding protein LepA [Listeria monocytogenes FSL N3-165] >gi|153202407|ref|ZP_01943943.1| GTP-binding protein LepA [Listeria monocytogenes HPB2262] >gi|167014724|ref|ZP_02277257.1| GTP-binding protein LepA [Listeria monocytogenes FSL J1-194] >gi|24211914|sp|Q8Y742|LEPA_LISMO GTP-binding protein lepA >gi|60390037|sp|Q71ZJ1|LEPA_LISMF GTP-binding protein lepA >gi|16410908|emb|CAC99557.1| lepA [Listeria monocytogenes] >gi|46880976|gb|AAT04273.1| GTP-binding protein LepA [Listeria monocytogenes str. 4b F2365] >gi|47017523|gb|EAL08331.1| GTP-binding protein LepA [Listeria monocytogenes str. 4b H7858] >gi|133730210|gb|EBA31908.1| GTP-binding protein LepA [Listeria monocytogenes FSL N3-165] >gi|133735182|gb|EBA36880.1| GTP-binding protein LepA [Listeria monocytogenes HPB2262] (608 aa)
Score = 1915, Expect = 0.0e+00, Identities = 364/595 (61%), Positives = 477/595 (80%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT REMKNQ+LDSMD+ERERGITIKLNAVQL Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV++++ED IGLD S+A L SAK+G+ I  I+E I+E++P P   D NKPL+AL+FDS +DAY+G +  +RI +G VK G +I+ MSN + F V+ +GV +PK   ++ L+ G+VG++ A+IKN+    VGDTIT   NPA  +L GY+K+ PMVYCGLYPIDS++Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY V L DG+ + +D+ A++P+  + + ++EP+ KA ++VP+D++G VMEL QN RG ++ +  +D  R  + Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  KVDALS I+HR+FA +R + I  KLKE IP+ QFE+PIQA I  KI++R T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ IL
  S:    10 QKKIRNFSIIAHIDHGKSTLADRILEQTGALTHREMKNQLLDSMDLERERGITIKLNAVQLKY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVREEIEDVIGLDASDAVLASAKSGIGIEDILEQIVEKVPEP-SGDVNKPLKALIFDSVFDAYRGVIANIRIMDGVVKAGDRIKMMSNGKEFEVTEVGVFSPKATPRDELLVGDVGYLTAAIKNVGDTRVGDTITLANNPAEEALDGYRKLNPMVYCGLYPIDSSKYNDLRDALEKLELNDSALQFEAETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYHVNLTDGSNIVVDNPAEMPEPGVIESVEEPYVKATVMVPNDYVGAVMELAQNKRGNFITMEYLDDIRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKASKLVKMDILLNAEKVDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAIL 602
>gi|171323251|ref|ZP_02911771.1| GTP-binding protein LepA [Geobacillus sp. WCH70] >gi|171090445|gb|EDT36738.1| GTP-binding protein LepA [Geobacillus sp. WCH70] (610 aa)
Score = 1915, Expect = 0.0e+00, Identities = 362/592 (61%), Positives = 469/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T  L+ REM+ Q LDSM++ERERGITIKLNAVQL Y   K+ ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV++++E+ IGLD S A L SAK G+ I +I+E I+E+IP P   D + PL+AL+FDS YD+Y+G V  +R+ +G VK G KI+ MS  + F V+ +GV TPK    + L  G+VG++ ASIKN+    VGDTITD  NPA   LPGY+K+ PMV+CG+YPID+ +Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSV+YKV L DGT +++D+ + +PD      ++EP+ KA I+VP+D++G VMELCQ  RG ++D+  +D  R  + Y IPL+EI+Y FFD LKS +KGYA+ DYE++ Y+   LVK+DILLNG K+DALS I+HR+ A +R + I  KLK+ IP+ QFE+P+QA IG KIIAR T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ IL
  S:    14 IRNFSIIAHIDHGKSTLADRILEKTGALSEREMREQTLDSMELERERGITIKLNAVQLKY-KAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEIEEVIGLDASEAVLASAKVGIGIEEILEQIVEKIPAP-SGDPDAPLKALIFDSMYDSYRGVVAYIRVMDGTVKPGQKIKMMSTGKEFEVAEVGVFTPKPKLVDELTVGDVGFLTASIKNVSDTRVGDTITDAENPAAEPLPGYRKLNPMVFCGMYPIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVVYKVYLTDGTEVQVDNPSNMPDPQKIDHVEEPYVKATIMVPNDYVGPVMELCQGKRGNFVDMQYLDEKRVTLIYEIPLSEIVYDFFDTLKSSTKGYASFDYELIGYKPSKLVKMDILLNGEKIDALSFIVHRDSAYERGKVIVEKLKDVIPRQQFEVPVQAAIGNKIIARSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAIL 603
>gi|116872908|ref|YP_849689.1| GTP-binding protein LepA [Listeria welshimeri serovar 6b str. SLCC5334] >gi|123458478|sp|A0AIS8|LEPA_LISW6 GTP-binding protein lepA >gi|116741786|emb|CAK20910.1| lepA [Listeria welshimeri serovar 6b str. SLCC5334] (608 aa)
Score = 1915, Expect = 0.0e+00, Identities = 364/595 (61%), Positives = 475/595 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT REMKNQ+LDSMD+ERERGITIKLNAVQL Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S+A L SAK+G+ I  I+E I+E++P P   D NKPL+AL+FDS +DAY+G +  +RI +G VK G +I+ MSN + F V+ +GV +PK   ++ L+ G+VG++ A+IKN+    VGDTIT   NPA  +L GY+K+ PMVYCGLYPIDS++Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY V L DG+ + +D+ A +P+  + + ++EP+ KA ++VP+D++G VMEL QN RG ++ +  +D  R  + Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  KVDALS I+HR+FA +R + I  KLKE IP+ QFE+PIQA I  KI++R T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ IL
  S:    10 QKKIRNFSIIAHIDHGKSTLADRILEQTGALTHREMKNQLLDSMDLERERGITIKLNAVQLKY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEIEDVIGLDASDAVLASAKSGIGIEDILEQIVEKVPEP-SGDVNKPLKALIFDSVFDAYRGVIANIRIMDGVVKAGDRIKMMSNGKEFEVTEVGVFSPKATPRDELLVGDVGYLTAAIKNVGDTRVGDTITLANNPAEEALDGYRKLNPMVYCGLYPIDSSKYNDLRDALEKLELNDSALQFEAETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYHVNLTDGSNIVVDNPADMPEPGVIESVEEPYVKATVMVPNDYVGAVMELAQNKRGNFITMEYLDDIRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKASKLVKMDILLNAEKVDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAIL 602
>gi|163942075|ref|YP_001646959.1| GTP-binding protein LepA [Bacillus weihenstephanensis KBAB4] >gi|163864272|gb|ABY45331.1| GTP-binding protein LepA [Bacillus weihenstephanensis KBAB4] (607 aa)
Score = 1913, Expect = 0.0e+00, Identities = 361/592 (60%), Positives = 465/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E TN L  REMK Q+LDSM++ERERGITIKLNAVQL Y   KD ++Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RV+++VED IGLD S A L SAK G+ I  I+E I+E++P P   D  +PLQ ++FDS YD Y+G +  +R+ NG VKVG K+R M+  + F V+ +GV TPK   ++ L  G+VG++AASIKN+    VGDTIT    PA   L GY+K+ PMV+CGLYPIDS +Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVIYKV L +G    +D+ + +PD      ++EPF KA I+VP+D++G VME+CQ  RG ++D+  +D TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  +VDALS I+HR+ A DR + I  KLK+ IP+ QFE+PIQA IG K+++R T+ AMRKNVLAKCYGGDI+RK+KLL++QKEGKKR+K++G+V VP + F+ +L
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTNALAQREMKAQLLDSMELERERGITIKLNAVQLTY-KAKDGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVRQEVEDVIGLDASEAVLASAKAGIGIEDILEQIVEKVPAP-TGDSEEPLQCMIFDSLYDPYRGVIAYIRVVNGTVKVGDKVRMMATGKEFEVTEVGVFTPKTTQRDELTVGDVGFLAASIKNVGDTRVGDTITHAKRPAAEPLKGYRKLNPMVFCGLYPIDSARYNDLRDALEKLELNDSALEFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFKIDLITTAPSVIYKVYLTNGEDFIVDNPSNMPDPQTIDRVEEPFVKAAIMVPNDYVGAVMEICQGKRGTFIDMQYLDETRVTLTYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKPSKLVKMDILLNNEQVDALSFIVHRDSAYDRGKVIVEKLKKLIPRQQFEVPIQATIGNKVVSRSTIKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKSVGSVEVPQEAFMAVL 602
>gi|94992347|ref|YP_600446.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS2096] >gi|119371402|sp|Q1JC06|LEPA_STRPB GTP-binding protein lepA >gi|94545855|gb|ABF35902.1| GTP-binding protein lepA [Streptococcus pyogenes MGAS2096] (635 aa)
Score = 1913, Expect = 0.0e+00, Identities = 365/596 (61%), Positives = 474/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P   D + PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA  +L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   D  ++E+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DY++ +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRHEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYVAASIKTVADTRVGDTVTLANNPAKEALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTTDEDMIEVSNPSEFPDPTRVAFIEEPYVKAQIMVPQEFVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|72080415|ref|YP_287473.1| GTP-binding protein LepA [Mycoplasma hyopneumoniae 7448] >gi|90185159|sp|Q4A8T9|LEPA_MYCH7 GTP-binding protein lepA >gi|71913539|gb|AAZ53450.1| GTP-binding protein LepA [Mycoplasma hyopneumoniae 7448] (598 aa)
Score = 1910, Expect = 0.0e+00, Identities = 354/597 (59%), Positives = 473/597 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD K IRNF+I+AHIDHGKSTL+DRI+EFTNT++ R++K Q LDSMD+E+ERGITIKLNAVQ+ Y++      Y FHLIDTPGHVDFTYEVSRSLAA EGALL+VDASQG++AQTL+NVYLALENNLEI+P+INKIDLPSA++D+VK ++E+TIG+   NA L+SAK G+ I +++EAI+  IPPP  SD+  PL+ALVFDSY+D Y+G +  +R+  G++ VG   +FM+NN  F V  LG+++P  V KE L AGEVGW+AASI+N K + VGDTIT   NPA + LPGYKK++P++Y G YP+DS QY L K++LEKI LSDSS+ YE E+S+ALGFG R GFLGLLHM++++ERL+REFN+++IATAPSV +++   +G +  I + +  P+     EI+EPF  A+I +P++FLG +M LCQ+ RG Y+DL  +D  R+++ Y +PL E+++ FFD+LKS SKGYA+ +YE++DY+   L K+DILLNG K+DALS I+H++FA  ++R +  KLKE IP+H FE+P+QAVIG K+IARET+ A RK+V AK YGGD+TR+KKLLE+QK GKKR+K+ G V VP + F+ IL
  S:     1 MDNKKIRNFAIIAHIDHGKSTLADRILEFTNTVSKRDLKEQHLDSMDLEKERGITIKLNAVQIRYNS------YIFHLIDTPGHVDFTYEVSRSLAATEGALLLVDASQGIQAQTLANVYLALENNLEIIPIINKIDLPSANVDKVKAEIENTIGISAENAILISAKNGIGIEKVLEAIVNLIPPPQASDEKDPLKALVFDSYFDIYRGVIIFIRVVTGKISVGDTFKFMANNLKFSVIELGISSPNQVKKEALFAGEVGWVAASIRNAKDVEVGDTITLVENPAKSPLPGYKKLVPVMYTGFYPVDSQQYNLLKDSLEKISLSDSSIIYEPESSKALGFGFRIGFLGLLHMEILQERLEREFNLSIIATAPSVEFQITRTNGQVQIISNPSLFPEPNFISEIREPFILAKIFLPEEFLGQIMGLCQDKRGIYVDLEYIDDFRRRLIYKLPLVEVIFDFFDRLKSLSKGYASFEYEVIDYQVSKLQKLDILLNGQKIDALSMIVHKDFAYPKARDLTQKLKEIIPRHSFEVPVQAVIGSKVIARETIKAYRKDVTAKLYGGDVTRRKKLLEKQKAGKKRMKSFGVVDVPQEAFLAIL 591
>gi|125718134|ref|YP_001035267.1| GTP-binding protein LepA [Streptococcus sanguinis SK36] >gi|125498051|gb|ABN44717.1| GTP-binding protein lepA, putative [Streptococcus sanguinis SK36] (610 aa)
Score = 1910, Expect = 0.0e+00, Identities = 366/596 (61%), Positives = 474/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   +   PL+AL+FDS YDAY+G +  VR+ +G VK G  I+ MSN +TF V+ +G+ TPK + ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV + DGT L++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YR   LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    13 QEKIRNFSIIAHIDHGKSTLADRILEATETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGNVEAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDIIQLMSNGKTFDVTEVGIFTPKAIGRDFLATGDVGYIAASIKTVQDTRVGDTVTLADNPAAEPLAGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNMTDGTSLDVSNPSEFPDPTKIDSIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRSSKLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 606
>gi|157151567|ref|YP_001450123.1| GTP-binding protein LepA [Streptococcus gordonii str. Challis substr. CH1] >gi|189046461|sp|A8AWG3|LEPA_STRGC GTP-binding protein lepA >gi|157076361|gb|ABV11044.1| GTP-binding protein LepA [Streptococcus gordonii str. Challis substr. CH1] (607 aa)
Score = 1908, Expect = 0.0e+00, Identities = 366/596 (61%), Positives = 473/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I  I+E I+E++P P   +   PL+AL+FDS YDAY+G +  VR+ +G VK G  I+ MSN +TF V+ +G+ TPK + ++ L  G+VG+IAASIK ++   VGDT+T   NPAT  L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YR   LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEATETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEIEDVIGLDASEAVLASAKAGIGIEDILEQIVEKVPAP-TGNVEAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDTIQLMSNGKTFDVTEVGIFTPKAIGRDFLATGDVGYIAASIKTVQDTRVGDTVTLADNPATEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGEAIDVSNPSEFPDPTKIDSIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRSSKLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGQKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|149008197|ref|ZP_01831702.1| GTP-binding protein LepA [Streptococcus pneumoniae SP18-BS74] >gi|147760378|gb|EDK67358.1| GTP-binding protein LepA [Streptococcus pneumoniae SP18-BS74] (607 aa)
Score = 1907, Expect = 0.0e+00, Identities = 364/596 (61%), Positives = 475/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    10 QRKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|15903125|ref|NP_358675.1| GTP-binding protein LepA [Streptococcus pneumoniae R6] >gi|116516228|ref|YP_816531.1| GTP-binding protein LepA [Streptococcus pneumoniae D39] >gi|148985094|ref|ZP_01818333.1| GTP-binding protein LepA [Streptococcus pneumoniae SP3-BS71] >gi|122278583|sp|Q04KB7|LEPA_STRP2 GTP-binding protein lepA >gi|33112369|sp|Q8DPN5|LEPA_STRR6 GTP-binding protein lepA >gi|15458705|gb|AAK99885.1| GTP-binding protein LepA [Streptococcus pneumoniae R6] >gi|116076804|gb|ABJ54524.1| GTP-binding protein LepA [Streptococcus pneumoniae D39] >gi|147922539|gb|EDK73657.1| GTP-binding protein LepA [Streptococcus pneumoniae SP3-BS71] (607 aa)
Score = 1906, Expect = 0.0e+00, Identities = 364/593 (61%), Positives = 473/593 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|169833928|ref|YP_001694637.1| GTP-binding protein LepA [Streptococcus pneumoniae Hungary19A-6] >gi|168996430|gb|ACA37042.1| GTP-binding protein LepA [Streptococcus pneumoniae Hungary19A-6] (607 aa)
Score = 1906, Expect = 0.0e+00, Identities = 365/596 (61%), Positives = 474/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPVINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|148989219|ref|ZP_01820599.1| GTP-binding protein LepA [Streptococcus pneumoniae SP6-BS73] >gi|168486523|ref|ZP_02711031.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC1087-00] >gi|194398543|ref|YP_002037804.1| GTP-binding protein LepA [Streptococcus pneumoniae G54] >gi|147925197|gb|EDK76276.1| GTP-binding protein LepA [Streptococcus pneumoniae SP6-BS73] >gi|183570472|gb|EDT91000.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC1087-00] >gi|194358210|gb|ACF56658.1| GTP-binding protein LepA [Streptococcus pneumoniae G54] (607 aa)
Score = 1906, Expect = 0.0e+00, Identities = 364/596 (61%), Positives = 475/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|54020027|ref|YP_115593.1| GTP-binding protein LepA [Mycoplasma hyopneumoniae 232] >gi|56405391|sp|Q9ZHZ8|LEPA_MYCH2 GTP-binding protein lepA >gi|53987200|gb|AAV27401.1| GTP-binding membrane protein [Mycoplasma hyopneumoniae 232] (598 aa)
Score = 1906, Expect = 0.0e+00, Identities = 353/597 (59%), Positives = 473/597 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD K IRNF+I+AHIDHGKSTL+DRI+EFTNT++ R++K Q LDSMD+E+ERGITIKLNAVQ+ Y++      Y FHLIDTPGHVDFTYEVSRSLAA EGALL+VDASQG++AQTL+NVYLALENNLEI+P+INKIDLPSA++D+VK ++E+TIG+   NA L+SAK G+ I +++EAI+  IPPP  SD+  PL+ALVFDSY+D Y+G +  +R+  G++ VG   +FM+NN  F V  LG+++P  V KE L AGEVGW+AASI+N K + VGDTIT   NPA + LPGYKK++P++Y G YP+DS QY L K++LEKI LSDSS+ YE E+S+ALGFG R GFLGLLHM++++ERL+REFN+++IATAPSV +++   +G +  I + +  P+     EI+EP+  A+I +P++FLG +M LCQ+ RG Y+DL  +D  R+++ Y +PL E+++ FFD+LKS SKGYA+ +YE++DY+   L K+DILLNG K+DALS I+H++FA  ++R +  KLKE IP+H FE+P+QAVIG K+IARET+ A RK+V AK YGGD+TR+KKLLE+QK GKKR+K+ G V VP + F+ IL
  S:     1 MDNKKIRNFAIIAHIDHGKSTLADRILEFTNTVSKRDLKEQHLDSMDLEKERGITIKLNAVQIRYNS------YIFHLIDTPGHVDFTYEVSRSLAATEGALLLVDASQGIQAQTLANVYLALENNLEIIPIINKIDLPSANVDKVKAEIENTIGISAENAILISAKNGIGIEKVLEAIVNLIPPPQASDEKDPLKALVFDSYFDIYRGVIIFIRVVTGKISVGDTFKFMANNLKFSVIELGISSPNQVKKEALFAGEVGWVAASIRNAKDVEVGDTITLVENPAKSPLPGYKKLVPVMYTGFYPVDSQQYNLLKDSLEKISLSDSSIIYEPESSKALGFGFRIGFLGLLHMEILQERLEREFNLSIIATAPSVEFQITRTNGQVQIISNPSLFPEPNFISEIREPYILAKIFLPEEFLGQIMGLCQDKRGIYVDLEYIDDFRRRLIYKLPLVEVIFDFFDRLKSLSKGYASFEYEVIDYQVSKLQKLDILLNGQKIDALSMIVHKDFAYPKARDLTQKLKEIIPRHSFEVPVQAVIGSKVIARETIKAYRKDVTAKLYGGDVTRRKKLLEKQKAGKKRMKSFGVVDVPQEAFLAIL 591
>gi|71893428|ref|YP_278874.1| GTP-binding protein LepA [Mycoplasma hyopneumoniae J] >gi|90185160|sp|Q4AAQ8|LEPA_MYCHJ GTP-binding protein lepA >gi|71851555|gb|AAZ44163.1| GTP-binding protein LepA [Mycoplasma hyopneumoniae J] (598 aa)
Score = 1906, Expect = 0.0e+00, Identities = 353/597 (59%), Positives = 473/597 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD K IRNF+I+AHIDHGKSTL+DRI+EFTNT++ R++K Q LDSMD+E+ERGITIKLNAVQ+ Y++      Y FHLIDTPGHVDFTYEVSRSLAA EGALL+VDASQG++AQTL+NVYLALENNLEI+P+INKIDLPSA++D+VK ++E+TIG+   NA L+SAK G+ I +++EAI+  IPPP  SD+  PL+ALVFDSY+D Y+G +  +R+  G++ VG   +FM+NN  F V  LG+++P  V KE L AGEVGW+AASI+N K + VGDTIT   NPA + LPGYKK++P++Y G YP+DS QY L K++LEKI LSDSS+ YE E+S+ALGFG R GFLGLLHM++++ERL+REFN+++IATAPSV +++   +G +  I + +  P+     EI+EP+  A+I +P++FLG +M LCQ+ RG Y+DL  +D  R+++ Y +PL E+++ FFD+LKS SKGYA+ +YE++DY+   L K+DILLNG K+DALS I+H++FA  ++R +  KLKE IP+H FE+P+QAVIG K+IARET+ A RK+V AK YGGD+TR+KKLLE+QK GKKR+K+ G V VP + F+ IL
  S:     1 MDNKKIRNFAIIAHIDHGKSTLADRILEFTNTVSKRDLKEQHLDSMDLEKERGITIKLNAVQIRYNS------YIFHLIDTPGHVDFTYEVSRSLAATEGALLLVDASQGIQAQTLANVYLALENNLEIIPIINKIDLPSANVDKVKAEIENTIGISAENAILISAKNGIGIEKVLEAIVNLIPPPQASDEKDPLKALVFDSYFDIYRGVIIFIRVVTGKISVGDTFKFMANNLKFSVIELGISSPNQVKKEALFAGEVGWVAASIRNAKDVEVGDTITLVENPAKSPLPGYKKLVPVMYTGFYPVDSQQYNLLKDSLEKISLSDSSIIYEPESSKALGFGFRIGFLGLLHMEILQERLEREFNLSIIATAPSVEFQITRTNGQVQIISNPSLFPEPNFISEIREPYILAKIFLPEEFLGQIMGLCQDKRGIYVDLEYIDDFRRRLIYKLPLVEVIFDFFDRLKSLSKGYASFEYEVIDYQVSKLQKLDILLNGQKIDALSMIVHKDFAYPKARDLTQKLKEIIPRHSFEVPVQAVIGSKVIARETIKAYRKDVTAKLYGGDVTRRKKLLEKQKAGKKRMKSFGVVDVPQEAFLAIL 591
>gi|154686811|ref|YP_001421972.1| GTP-binding protein LepA [Bacillus amyloliquefaciens FZB42] >gi|166223168|sp|A7Z6W5|LEPA_BACA2 GTP-binding protein lepA >gi|154352662|gb|ABS74741.1| LepA [Bacillus amyloliquefaciens FZB42] (611 aa)
Score = 1905, Expect = 0.0e+00, Identities = 358/592 (60%), Positives = 466/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E T+ +T REMK Q+LDSMD+ERERGITIKLN+VQL Y   KD ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSA+ +RV+++VED IGLD S+A L SAK G+ I  I+E I+E++P P   D   PL+AL+FDS YDAY+G V  +R+  G VK G KI+ M+  + F V  +GV TPK    + L  G+VG++ A+IKN+    VGDTIT    PA  +LPGY+K+ PMVYCGLYPID+ +Y   +EALEK+ L+DSSL YE ETSQALGFG RCGFLG+LHM++I+ER++REF I LI TAPSVIY V + DG  + +D+ + +PD    + ++EP+ KA ++VP+D++G VMELCQ  RG ++D+  +D+ R  + Y +PLAEI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DI+LNG K+DALS I+HR++A +R + I  KLKE IP+  FE+PIQA IG KI+AR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGK+R+K +G+V VP + F+ +L
  S:    14 IRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQLKY-KAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASDAVLASAKAGIGIEDILEQIVEKVPAPA-GDPEAPLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGKEFEVIEVGVFTPKAQPADELTVGDVGYLTAAIKNVGDTRVGDTITSAVKPAAEALPGYRKLNPMVYCGLYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIEREFKIDLITTAPSVIYDVYMTDGEKIIVDNPSNMPDPQKIERVEEPYVKATMMVPNDYVGAVMELCQGKRGNFIDMQYLDANRVSIVYEMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKPSKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQHFEVPIQAAIGQKIVARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVL 603
>gi|94990401|ref|YP_598501.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS10270] >gi|119371404|sp|Q1JH37|LEPA_STRPD GTP-binding protein lepA >gi|94543909|gb|ABF33957.1| GTP-binding protein lepA [Streptococcus pyogenes MGAS10270] (610 aa)
Score = 1905, Expect = 0.0e+00, Identities = 365/596 (61%), Positives = 474/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P   D + PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA  +L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   D  ++E+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DY++ +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRHEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKSGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYVAASIKTVADTRVGDTVTLANNPAKEALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTTDEDMIEVSNPSEFPDPTRVAFIEEPYVKAQIMVPQEFVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|15675045|ref|NP_269219.1| GTP-binding protein LepA [Streptococcus pyogenes M1 GAS] >gi|71910589|ref|YP_282139.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS5005] >gi|24211937|sp|Q99ZV8|LEPA_STRP1 GTP-binding protein lepA >gi|13622198|gb|AAK33940.1| GTP-binding protein [Streptococcus pyogenes M1 GAS] >gi|71853371|gb|AAZ51394.1| GTP-binding protein [Streptococcus pyogenes MGAS5005] (610 aa)
Score = 1904, Expect = 0.0e+00, Identities = 365/596 (61%), Positives = 474/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P   D + PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA  +L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   D  ++E+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DY++ +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRHEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYVAASIKTVADTRVGDTVTLANNPAKEALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTTDEDMIEVSNPSEFPDPTRVAFIEEPYVKAQIMVPQEFVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|71903418|ref|YP_280221.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS6180] >gi|94988524|ref|YP_596625.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS9429] >gi|90185213|sp|Q48TU0|LEPA_STRPM GTP-binding protein lepA >gi|119371403|sp|Q1JLY8|LEPA_STRPC GTP-binding protein lepA >gi|71802513|gb|AAX71866.1| GTP-binding protein [Streptococcus pyogenes MGAS6180] >gi|94542032|gb|ABF32081.1| GTP-binding protein [Streptococcus pyogenes MGAS9429] (610 aa)
Score = 1904, Expect = 0.0e+00, Identities = 365/596 (61%), Positives = 474/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P   D + PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA  +L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   D  ++E+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DY++ +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRHEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYVAASIKTVADTRVGDTVTLANNPAKEALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTTDEDMIEVSNPSEFPDPTRVAFIEEPYVKAQIMVPQEFVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|125624271|ref|YP_001032754.1| GTP-binding protein LepA [Lactococcus lactis subsp. cremoris MG1363] >gi|166223205|sp|A2RL76|LEPA_LACLM GTP-binding protein lepA >gi|124493079|emb|CAL98043.1| GTP-binding protein lepA [Lactococcus lactis subsp. cremoris MG1363] (607 aa)
Score = 1903, Expect = 0.0e+00, Identities = 363/596 (60%), Positives = 476/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           K+ IRNFSI+AHIDHGKSTL+DRI+E T T++ REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD + V++++ED IGLD S A L SAK G+ I +I+E I+E++P P    D  PL+AL+FDS YDAY+G +  +R+ +G VKVG +I+ MSN + F V+ +G+ TPK V+++ L+AG+VG++AA+IK +    VGDT+T  +NPAT +L GYK++ PMV+ G+YPI+S ++   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REF I LI TAPSV+Y +   DG  LE+ + ++ PD T  + I+EPF KA+I+VP+DF+G VMEL Q  RG +L +  +D+ R  + Y IPL+EI++ FFDKLKS +KGYA+ DYEI DYR  +LVK+DILLN  KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGDI+RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 KEKIRNFSIIAHIDHGKSTLADRILEQTETVSKREMQAQLLDSMDLERERGITIKLNAIELNY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPEMVRQEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPQGEVD-APLKALIFDSVYDAYRGVILQIRVIDGSVKVGDRIQLMSNGKEFDVTEVGIFTPKAVSRDFLMAGDVGYVAAAIKTVADTRVGDTVTLASNPATEALEGYKEMNPMVFAGIYPIESNKFNDLREALEKLQLNDASLRFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFGIDLIMTAPSVVYHINTTDGETLEVANPSEFPDPTRIENIEEPFVKAQIMVPNDFVGPVMELAQRKRGIFLTMDYLDANRVNIIYHIPLSEIVFDFFDKLKSSTKGYASFDYEISDYRPSNLVKMDILLNAEKVDALSFIVHKDFAFERGKVIVEKLKKLIPRQQFEVPIQATIGNKIVARSDIKALRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|16800582|ref|NP_470850.1| GTP-binding protein LepA [Listeria innocua Clip11262] >gi|24211923|sp|Q92BN4|LEPA_LISIN GTP-binding protein lepA >gi|16413987|emb|CAC96745.1| lepA [Listeria innocua] (608 aa)
Score = 1903, Expect = 0.0e+00, Identities = 362/595 (60%), Positives = 474/595 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT REMKNQ+LDSMD+ERERGITIKLNAVQL Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S+  L SAK+G+ I  I+E I+E++P P   D +KPL+AL+FDS +DAY+G +  +RI +G VK G +I+ MSN + F V+ +GV +PK   ++ L+ G+VG++ A+IKN+    VGDTIT   NPA  +L GY+K+ PMVYCGLYPIDS++Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY V L DG+ + +D+ A +P+  + + ++EP+ KA ++VP+D++G VMEL QN RG ++ +  +D  R  + Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  KVDALS I+HR+FA +R + I  KLKE IP+ QFE+PIQA I  KI++R T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ IL
  S:    10 QKKIRNFSIIAHIDHGKSTLADRILEQTGALTHREMKNQLLDSMDLERERGITIKLNAVQLKY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEIEDVIGLDASDTVLASAKSGIGIEDILEQIVEKVPEP-SGDVDKPLKALIFDSVFDAYRGVIANIRIMDGVVKAGDRIKMMSNGKEFEVTEVGVFSPKATPRDELLVGDVGYLTAAIKNVGDTRVGDTITLANNPAEEALDGYRKLNPMVYCGLYPIDSSKYNDLRDALEKLELNDSALQFEAETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYHVNLTDGSNIVVDNPADMPEPGVIESVEEPYVKATVMVPNDYVGAVMELAQNKRGNFITMEYLDDIRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKASKLVKMDILLNAEKVDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAIL 602
>gi|194272086|ref|ZP_03056841.1| GTP-binding membrane protein LepA [Enterococcus faecalis OG1RF] >gi|194268264|gb|EDX18736.1| GTP-binding membrane protein LepA [Enterococcus faecalis OG1RF] (611 aa)
Score = 1903, Expect = 0.0e+00, Identities = 359/595 (60%), Positives = 475/595 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E TNT+++REM++Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IG+D S A L SAK G+ I  I+E ++E +P P   D   PL+AL+FDS YD+Y+G V  +R+ +G V+ G KI+ MSN +TF V+ +GV +PK + ++ L+ G+VG+I ASIK ++   VGDT+T   NPA  +LPGY+K+ PMVYCGLYPID+++Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHMDV++ERL+REFN+ LI TAPSVIY V   DGT + +D+ A+ P+    + ++EP+ KA+I+VP+D++G VMEL Q  RGE++ +  +D  R  V Y IPL+EI++ FFDKLKS +KGYA+LDYE+  YR   LVK+DILLN  KVDALS I+HR+FA +R + I  KLK+ IP+ QFE+P+QA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ +L
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTNTVSSREMQDQLLDSMDLERERGITIKLNAIELNY-TAKDGETYTFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRTEIEDVIGIDASEAVLASAKAGIGIEDILEQVVEYVPAP-SGDIEAPLKALIFDSIYDSYRGVVLNIRVIDGVVRPGDKIQMMSNGKTFDVTEVGVFSPKPIARDYLMVGDVGYITASIKTVQDTRVGDTVTLADNPAAEALPGYRKMNPMVYCGLYPIDTSRYNDLREALEKLQLNDAALQFEPETSQALGFGFRCGFLGLLHMDVVQERLEREFNLELITTAPSVIYHVNKTDGTTVVVDNPAEFPEPVTIESVEEPYVKAQIMVPNDYVGAVMELSQRKRGEFITMDYLDDYRVNVVYEIPLSEIVFDFFDKLKSSTKGYASLDYEMAGYRTSRLVKMDILLNAEKVDALSFIVHRDFAFERGKAIVEKLKKLIPRQQFEVPVQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVL 602
>gi|56421043|ref|YP_148361.1| GTP-binding protein LepA [Geobacillus kaustophilus HTA426] >gi|81557830|sp|Q5KWZ3|LEPA_GEOKA GTP-binding protein lepA >gi|56380885|dbj|BAD76793.1| GTP-binding protein [Geobacillus kaustophilus HTA426] (609 aa)
Score = 1903, Expect = 0.0e+00, Identities = 359/595 (60%), Positives = 471/595 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T  L+ RE++ Q LD+M++ERERGITIKLNAVQL Y   K+ ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++NNLEI+PVINKIDLPSA+ +RV++++ED IGLD S+A L SAK G+ I +I+E I+E+IP P   D + PL+AL+FDS YD Y+G V  VR+ +G VK G +I+ MS  + F V+ +GV TPK    + L  G+VG++ ASIKN+K   VGDTITD   PA   LPGY+K+ PMV+CG+YPID+ +Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHM++I+ERL+REF+I LI TAPSV+YKV L DGT +++D+   +PD      I+EP+ KA I+VP+D++G VMELCQ  RG ++D+  +D  R  + Y IPL+EI+Y FFD LKS +KGYA+ DYE++ YR  +LVK+DILLNG K+DALS I+HR+ A +R + I  KLK+ IP+ QFE+P+QA IG K+IAR T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ +L
  S:    10 QERIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDTMELERERGITIKLNAVQLTY-KAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDNNLEILPVINKIDLPSAEPERVRQEIEDVIGLDASDAVLASAKVGIGIEEILEKIVEKIPAP-SGDPDAPLKALIFDSLYDPYRGVVAYVRVVDGTVKPGQRIKMMSTGKEFEVTEVGVFTPKQKVVDELTVGDVGYLTASIKNVKDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMYPIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERLEREFHIDLITTAPSVVYKVHLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVMELCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSNLVKMDILLNGEKIDALSFIVHRDSAYERGKAIVEKLKDLIPRQQFEVPVQAAIGNKVIARSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVL 602
>gi|116511948|ref|YP_809164.1| GTP-binding protein LepA [Lactococcus lactis subsp. cremoris SK11] >gi|123025418|sp|Q02Z80|LEPA_LACLS GTP-binding protein lepA >gi|116107602|gb|ABJ72742.1| GTP-binding protein LepA [Lactococcus lactis subsp. cremoris SK11] (607 aa)
Score = 1902, Expect = 0.0e+00, Identities = 363/596 (60%), Positives = 475/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           K+ IRNFSI+AHIDHGKSTL+DRI+E T T++ REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD + V++++ED IGLD S A L SAK G+ I +I+E I+E++P P    D  PL+AL+FDS YDAY+G +  +R+ +G VKVG +I+ MSN + F V+ +G+ TPK V ++ L+AG+VG++AA+IK +    VGDT+T  +NPAT +L GYK++ PMV+ G+YPI+S ++   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REF I LI TAPSV+Y +   DG  LE+ + ++ PD T  + I+EPF KA+I+VP+DF+G VMEL Q  RG +L +  +D+ R  + Y IPL+EI++ FFDKLKS +KGYA+ DYEI DYR  +LVK+DILLN  KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGDI+RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 KEKIRNFSIIAHIDHGKSTLADRILEQTETVSKREMQAQLLDSMDLERERGITIKLNAIELNY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPEMVRQEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAPQGEVD-APLKALIFDSVYDAYRGVILQIRVIDGSVKVGDRIQLMSNGKEFDVTEVGIFTPKAVARDFLMAGDVGYVAAAIKTVADTRVGDTVTLASNPATEALEGYKEMNPMVFAGIYPIESNKFNDLREALEKLQLNDASLRFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFGIDLIMTAPSVVYHINTTDGETLEVANPSEFPDPTRIENIEEPFVKAQIMVPNDFVGPVMELAQRKRGIFLTMDYLDANRVNIIYHIPLSEIVFDFFDKLKSSTKGYASFDYEISDYRPSNLVKMDILLNAEKVDALSFIVHKDFAFERGKVIVEKLKKLIPRQQFEVPIQATIGNKIVARSDIKALRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|149002566|ref|ZP_01827498.1| GTP-binding protein LepA [Streptococcus pneumoniae SP14-BS69] >gi|147759177|gb|EDK66170.1| GTP-binding protein LepA [Streptococcus pneumoniae SP14-BS69] (607 aa)
Score = 1902, Expect = 0.0e+00, Identities = 363/596 (60%), Positives = 475/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSM++ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMELERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADSERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|15673090|ref|NP_267264.1| GTP-binding protein LepA [Lactococcus lactis subsp. lactis Il1403] >gi|13878578|sp|Q9CGI8|LEPA_LACLA GTP-binding protein lepA >gi|12724067|gb|AAK05206.1|AE006343_2 GTP-binding protein LepA [Lactococcus lactis subsp. lactis Il1403] (607 aa)
Score = 1902, Expect = 0.0e+00, Identities = 363/596 (60%), Positives = 476/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           K+ IRNFSI+AHIDHGKSTL+DRI+E T T++ REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD + V++++ED IGLD S A L SAK G+ I +I+E I+E++P P    D  PL+AL+FDS YDAY+G +  +R+ +G +KVG +I+ MSN + F V+ +G+ TPK V+++ L+AG+VG++AASIK +    VGDT+T  +NPAT +L GYK++ PMV+ G+YPI+S ++   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REF I LI TAPSV+Y +   DG  LE+ + ++ PD T  + I+EPF KA+I+VP+DF+G VMEL Q  RG +L +  +D+ R  + Y IPL+EI++ FFDKLKS +KGYA+ DYEI DYR  +LVK+DILLN  KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGDI+RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 KEKIRNFSIIAHIDHGKSTLADRILEQTETVSKREMQAQLLDSMDLERERGITIKLNAIELNY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPEMVRQEIEDVIGLDASEAILASAKAGIGIEEILEQIVEKVPAPQGEVD-APLKALIFDSVYDAYRGVILQIRVIDGSLKVGDRIQLMSNGKEFDVTEVGIFTPKAVSRDFLMAGDVGYVAASIKTVADTRVGDTVTLASNPATEALKGYKEMNPMVFAGIYPIESNKFNDLREALEKLQLNDASLRFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFGIDLIMTAPSVVYHINTTDGETLEVANPSEFPDPTRIENIEEPFVKAQIMVPNDFVGPVMELAQRKRGIFLTMDYLDANRVNIIYNIPLSEIVFDFFDKLKSSTKGYASFDYEISDYRPSNLVKMDILLNAEKVDALSFIVHKDFAFERGKVIVEKLKKLIPRQQFEVPIQATIGNKIVARSDIKALRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|148998630|ref|ZP_01826069.1| GTP-binding protein LepA [Streptococcus pneumoniae SP11-BS70] >gi|147755467|gb|EDK62515.1| GTP-binding protein LepA [Streptococcus pneumoniae SP11-BS70] (607 aa)
Score = 1901, Expect = 0.0e+00, Identities = 363/596 (60%), Positives = 475/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSM++ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMELERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVTEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|182684070|ref|YP_001835817.1| GTP-binding protein LepA [Streptococcus pneumoniae CGSP14] >gi|182629404|gb|ACB90352.1| GTP-binding protein LepA [Streptococcus pneumoniae CGSP14] (628 aa)
Score = 1901, Expect = 0.0e+00, Identities = 363/596 (60%), Positives = 475/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSM++ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    31 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMELERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 624
>gi|15901063|ref|NP_345667.1| GTP-binding protein LepA [Streptococcus pneumoniae TIGR4] >gi|111657824|ref|ZP_01408541.1| hypothetical protein SpneT_02001006 [Streptococcus pneumoniae TIGR4] >gi|148993810|ref|ZP_01823212.1| GTP-binding protein LepA [Streptococcus pneumoniae SP9-BS68] >gi|149012251|ref|ZP_01833320.1| GTP-binding protein LepA [Streptococcus pneumoniae SP19-BS75] >gi|168484952|ref|ZP_02709897.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC1873-00] >gi|168489028|ref|ZP_02713227.1| GTP-binding protein LepA [Streptococcus pneumoniae SP195] >gi|168491121|ref|ZP_02715264.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC0288-04] >gi|24211930|sp|Q97QK5|LEPA_STRPN GTP-binding protein lepA >gi|14972680|gb|AAK75307.1| GTP-binding protein LepA [Streptococcus pneumoniae TIGR4] >gi|147763577|gb|EDK70512.1| GTP-binding protein LepA [Streptococcus pneumoniae SP19-BS75] >gi|147927635|gb|EDK78660.1| GTP-binding protein LepA [Streptococcus pneumoniae SP9-BS68] >gi|172041906|gb|EDT49952.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC1873-00] >gi|183572538|gb|EDT93066.1| GTP-binding protein LepA [Streptococcus pneumoniae SP195] >gi|183574489|gb|EDT95017.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC0288-04] (607 aa)
Score = 1901, Expect = 0.0e+00, Identities = 363/596 (60%), Positives = 475/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSM++ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMELERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|29376853|ref|NP_816007.1| GTP-binding protein LepA [Enterococcus faecalis V583] >gi|33112357|sp|Q831Z0|LEPA_ENTFA GTP-binding protein lepA >gi|29344318|gb|AAO82077.1| GTP-binding protein LepA [Enterococcus faecalis V583] (611 aa)
Score = 1900, Expect = 0.0e+00, Identities = 359/595 (60%), Positives = 475/595 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E TNT+++REM++Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IG+D S A L SAK G+ I  I+E ++E +P P   D   PL+AL+FDS YD+Y+G V  +R+ +G V+ G KI+ MSN +TF V+ +GV +PK + ++ L+ G+VG+I ASIK ++   VGDT+T   NPA  +LPGY+K+ PMVYCGLYPID+++Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHMDV++ERL+REFN+ LI TAPSVIY V   DGT + +D+ A+ P+    + ++EP+ KA+I+VP+D++G VMEL Q  RGE++ +  +D  R  V Y IPL+EI++ FFDKLKS +KGYA+LDYE+  YR   LVK+DILLN  KVDALS I+HR+FA +R + I  KLK+ IP+ QFE+P+QA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ +L
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTNTVSSREMQDQLLDSMDLERERGITIKLNAIELNY-TAKDGEIYTFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRTEIEDVIGIDASEAVLASAKAGIGIEDILEQVVEYVPAP-SGDIEAPLKALIFDSIYDSYRGVVLNIRVIDGVVRPGDKIQMMSNGKTFDVTEVGVFSPKPIARDYLMVGDVGYITASIKTVQDTRVGDTVTLADNPAAEALPGYRKMNPMVYCGLYPIDTSRYNDLREALEKLQLNDAALQFEPETSQALGFGFRCGFLGLLHMDVVQERLEREFNLELITTAPSVIYHVNKTDGTTVVVDNPAEFPEPVTIESVEEPYVKAQIMVPNDYVGAVMELSQRKRGEFITMDYLDDYRVNVVYEIPLSEIVFDFFDKLKSSTKGYASLDYEMAGYRTSRLVKMDILLNAEKVDALSFIVHRDFAFERGKAIVEKLKKLIPRQQFEVPVQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVL 602
>gi|168493122|ref|ZP_02717265.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC3059-06] >gi|183576498|gb|EDT97026.1| GTP-binding protein LepA [Streptococcus pneumoniae CDC3059-06] (607 aa)
Score = 1899, Expect = 0.0e+00, Identities = 363/593 (61%), Positives = 472/593 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD + V+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ TPK V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPESVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTPKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|21910273|ref|NP_664541.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS315] >gi|28895850|ref|NP_802200.1| GTP-binding protein LepA [Streptococcus pyogenes SSI-1] >gi|25008700|sp|Q8K7M8|LEPA_STRP3 GTP-binding protein lepA >gi|21904468|gb|AAM79344.1| putative GTP-binding protein LepA [Streptococcus pyogenes MGAS315] >gi|28811099|dbj|BAC64033.1| putative GTP binding protein [Streptococcus pyogenes SSI-1] (610 aa)
Score = 1898, Expect = 0.0e+00, Identities = 364/596 (61%), Positives = 473/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   +D + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV  +VED IGLD S A L SAK G+ I +I+E I+E++P P   D + PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA  +L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   D  ++E+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DY++ +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TARDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVCHEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYVAASIKTVADTRVGDTVTLANNPAKEALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTTDEDMIEVSNPSEFPDPTRVAFIEEPYVKAQIMVPQEFVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|192812019|ref|ZP_03040688.1| GTP-binding protein LepA [Geobacillus sp. Y412MC10] >gi|192799166|gb|EDV75677.1| GTP-binding protein LepA [Geobacillus sp. Y412MC10] (605 aa)
Score = 1898, Expect = 0.0e+00, Identities = 354/595 (59%), Positives = 470/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNF I+AHIDHGKSTL+DRI+EFT  LT+REM+ Q+LD MD+ERERGITIKL AV+L Y    D ++Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDA+QG+EAQTL+NVYLAL+NNLEI+PVINKIDLPSAD +RVK++VED IGLD S+A L SAK G+ I +I+E +++++P P   +  +PL+AL+FDS+YD YKG +  VR+ +G +K G+KI+ M+  +TF V  +G   P++   + L  G+VG+I A IK++    VGDT+TD   P    LPGY+KI PMV+CGLYPI+++ Y   +EALEK+ L+D+SL++E ETS ALGFG RCGFLGLLHMDVI+ER++REFNI LI TAPSVIY++   +G  ++ID+ +  P+      ++EP+ KA IIVP+D++G +MELCQN RGE++++  +D+TR  +TY IPL+EI+Y FFD+LKS +KGYA+ DYE+  YR+ +LVK+DILLN  +VDALS I+H++ A  R R IC KL+E IP+  FE+PIQA +G K++ARETV AMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V VP + F+ +L
  S:     8 QQKIRNFCIIAHIDHGKSTLADRILEFTGALTSREMQEQVLDQMDLERERGITIKLQAVRLNY-KADDGEEYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALDNNLEILPVINKIDLPSADPERVKQEVEDVIGLDASDAVLASAKAGIGIKEILEQVVQKVPAP-TGNSEEPLKALIFDSHYDPYKGVIVYVRVIDGSIKAGSKIKMMATGKTFEVIEVGAFKPRMSIVDELNVGDVGFIVAGIKSVGDTQVGDTVTDAKRPTAEPLPGYRKINPMVFCGLYPIETSDYNDLREALEKLQLNDASLSFEPETSSALGFGFRCGFLGLLHMDVIQERIEREFNIPLITTAPSVIYRITQTNGEQIQIDNPSHYPEVGKVDYVEEPYVKAAIIVPNDYVGAIMELCQNKRGEFVNMEYLDTTRVTITYEIPLSEIVYDFFDQLKSSTKGYASFDYELSGYRRSNLVKMDILLNAEQVDALSFIVHKDRAYHRGRAICEKLRELIPRQMFEVPIQASVGTKVVARETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVL 600
>gi|24379799|ref|NP_721754.1| GTP-binding protein LepA [Streptococcus mutans UA159] >gi|33112370|sp|Q8DTF3|LEPA_STRMU GTP-binding protein lepA >gi|24377766|gb|AAN59060.1|AE014972_9 putative GTP-binding protein [Streptococcus mutans UA159] (611 aa)
Score = 1897, Expect = 0.0e+00, Identities = 362/596 (60%), Positives = 473/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   K+ + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  +R+ +G VK G KI  MSN +TF V+ +G+ TPK VN++ L  G+VG++AASIK +    VGDT+T    PA   L GYK++ PMV+ G+YPIDS++Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   DG  LE+ + ++ PD T    I+EP+ KA+I+VP +++G VMEL Q  RG+++ +  +D+ R  V Y IPLAEI++ FFDKLKS ++GYA+ DY+I +YRK  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEQTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-KAKNGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-KGDVEAPLKALIFDSVYDAYRGVILQIRVMDGMVKPGDKIELMSNGKTFDVTEVGIFTPKAVNRDFLATGDVGYLAASIKTVADTRVGDTVTLADCPAEAPLHGYKQLNPMVFAGIYPIDSSKYNDMREALEKLQLNDASLHFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVYTTDGERLEVSNPSEFPDPTKVDSIEEPYVKAQIMVPQEYVGAVMELSQRKRGDFVTMDYIDNNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDISEYRKSKLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|50914142|ref|YP_060114.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS10394] >gi|60389914|sp|Q5XCD2|LEPA_STRP6 GTP-binding protein lepA >gi|50903216|gb|AAT86931.1| GTP-binding protein lepA [Streptococcus pyogenes MGAS10394] (610 aa)
Score = 1897, Expect = 0.0e+00, Identities = 364/596 (61%), Positives = 473/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P   D + PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA  +L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   D  ++E+ + ++ P  T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DY++ +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRHEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYVAASIKTVADTRVGDTVTLANNPAKEALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTTDEDMIEVSNPSEFPAPTRVAFIEEPYVKAQIMVPQEFVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|118444759|ref|YP_878570.1| GTP-binding protein LepA [Clostridium novyi NT] >gi|166223190|sp|A0Q1R8|LEPA_CLONN GTP-binding protein lepA >gi|118135215|gb|ABK62259.1| GTP-binding protein LepA [Clostridium novyi NT] (601 aa)
Score = 1896, Expect = 0.0e+00, Identities = 363/595 (61%), Positives = 470/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           KK+ RNFSIVAHIDHGKSTL+DR++E T TLT REM+NQ+LD M++E+ERGITIK  A +L+Y    D ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+++LEIVPVINKIDLPSA  D VK+++ED IG++  +APLVSAKTGLNI  ++EAI+E++P P D D+  PL+AL+FDSYYD+YKG VC VRIK+G VK GTKI+FM+ N+ + V+  G+ TP     + L AG+VG+I ASIKN++   VGDTIT+ + PA   L GY+  +PMVY G+YP+D  +YE  KEALEK+ L+D++L+YE ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIY +   DG +L+I +   +PD T  ++++EP  KA II P DF+G VMELCQN RG ++D+  +++TR  V Y IPL EI+Y FFD LKS +KGYA+LDYE+  Y++  LVK+D+LLNG+ VDALS I+  E A ++ R I  KLKE IP+  FEIPIQA +G KIIARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ IG+V VP + F+ IL
  S:     6 KKHTRNFSIVAHIDHGKSTLADRLLEATGTLTQREMENQVLDKMELEKERGITIKSQAARLVYKR-DDGEEYILNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDHDLEIVPVINKIDLPSARPDEVKEEIEDVIGIEAHDAPLVSAKTGLNIKDVLEAIVEKVPVP-DGDEEAPLKALIFDSYYDSYKGVVCYVRIKDGVVKPGTKIKFMATNKEYEVTETGIFTPNFFPMKELRAGDVGYITASIKNLRDAGVGDTITEASRPAKEPLEGYRPAIPMVYSGIYPVDGAKYEELKEALEKLKLNDAALSYEPETSIALGFGFRCGFLGLLHMEIIQERIEREFNLDIITTAPSVIYNIYKRDGEMLKITNPTNMPDPTEIEKMEEPVVKASIITPSDFVGAVMELCQNKRGTFIDMEYIETTRVVVNYYIPLNEIIYDFFDMLKSKTKGYASLDYELNGYKQAKLVKLDMLLNGDVVDALSMIVPEERAYNKGRAIAEKLKEVIPRQMFEIPIQAAVGAKIIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQIGSVEVPQEAFMSIL 598
>gi|149019192|ref|ZP_01834554.1| GTP-binding protein LepA [Streptococcus pneumoniae SP23-BS72] >gi|147931062|gb|EDK82041.1| GTP-binding protein LepA [Streptococcus pneumoniae SP23-BS72] (607 aa)
Score = 1895, Expect = 0.0e+00, Identities = 363/593 (61%), Positives = 472/593 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV+ ++ED IGLD S A L SAK G+ I +I+E I+E++P P   D   PL+AL+FDS YDAY+G +  VR+ +G VK G KI+ MSN++TF V+ +G+ T K V ++ L  G+VG+IAASIK ++   VGDT+T   NPA   L GYK++ PMV+ GLYPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSVIYKV L DG  +++ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYE+ +YR   LVK+DILLNG+KVDALS I+H++FA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+K+IG+V VP + F+ +LS
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIMPIINKIDLPAADPERVRTEIEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVTAPLKALIFDSVYDAYRGVILQVRVMDGVVKPGDKIQLMSNSKTFDVAEVGIFTLKAVGRDFLATGDVGYIAASIKTVQDTRVGDTVTLATNPAAEPLHGYKQMNPMVFAGLYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVIYKVNLTDGESMDVSNPSEFPDPTKIATIEEPYVKAQIMVPQEFVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYELSEYRPSKLVKMDILLNGDKVDALSFIVHKDFAYERGKLIVDKLKKIIPRQQFEVPIQAAIGHKIVARTDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLS 603
>gi|134300340|ref|YP_001113836.1| GTP-binding protein LepA [Desulfotomaculum reducens MI-1] >gi|172044333|sp|A4J7F8|LEPA_DESRM GTP-binding protein lepA >gi|134053040|gb|ABO51011.1| GTP-binding protein LepA [Desulfotomaculum reducens MI-1] (601 aa)
Score = 1894, Expect = 0.0e+00, Identities = 356/595 (59%), Positives = 462/595 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNF I+AHIDHGKSTL+DRI+E T  L+ REM  Q+LD MD+ERERGITIKL AV+L +H  +D Q+Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQG+EAQTL+NVYLALEN+LEI+PVINKIDLPSA+ +RVK+++ED IGLD S A L SAKTG  I +I+E ++ +I PP   D   PLQAL+FDS+YDAY+G +  +R+  G +K G +IR M+  + F V+ +GV TP +   + L  GEVG +AAS+KN++ + VGDTIT   NPA   LPGY+K+ PMV+CGLYP+D+  YE  ++AL+K+ L+D+SL YE ETS ALGFG RCGFLGLLHM++I+ERL+RE+ ++LI TAPSV+Y+V    G ++EID+ A LP     + I+EPF KA ++VP DF+G VM+LCQ  RG + ++  +   R  +TY IPL+EI+Y FFD+LKS +KGYA+LDYE++ YR+ +LVK+DI+LNG  +DALS I+H E A  R R +  KL+  IP+  FEIP+QA IG KIIARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGK+R+K +GNV +P + F+ +LS E
  S:     8 IRNFCIIAHIDHGKSTLADRILEETGALSQREMTEQVLDKMDLERERGITIKLQAVRL-FHRAEDGQEYQLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGIEAQTLANVYLALENDLEIIPVINKIDLPSAEPERVKQEIEDVIGLDTSEAVLASAKTGAGIKEILEQVVTKIAPP-KGDSEAPLQALIFDSHYDAYRGVIAYIRVVQGTLKPGMRIRMMATKKEFEVTEVGVFTPHMTFVDELKTGEVGLVAASMKNVQDVRVGDTITAAQNPAPAPLPGYRKVTPMVFCGLYPVDTVDYEDLRDALDKLKLNDASLIYEPETSDALGFGFRCGFLGLLHMEIIQERLEREYGLSLITTAPSVVYRVTTTKGEVMEIDNPANLPQVNKIEIIEEPFVKATVMVPKDFVGTVMDLCQGKRGIFSNMEYLGINRVMLTYEIPLSEIIYDFFDQLKSRTKGYASLDYEMIGYRQSELVKMDIMLNGEVLDALSCIVHSERAYTRGRALVEKLRSLIPRQMFEIPVQAAIGNKIIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGNVEIPQEAFMAVLSIE 600
>gi|83589445|ref|YP_429454.1| GTP-binding protein LepA [Moorella thermoacetica ATCC 39073] >gi|119371367|sp|Q2RKX8|LEPA_MOOTA GTP-binding protein lepA >gi|83572359|gb|ABC18911.1| GTP-binding protein LepA [Moorella thermoacetica ATCC 39073] (602 aa)
Score = 1893, Expect = 0.0e+00, Identities = 348/597 (58%), Positives = 466/597 (78%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +++KYIRNF I+AHIDHGKSTL+DR++E+T  L+ REM +Q+LD+MD+ERERGITIKL AV+L Y   +D Q+Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDA+QG+EAQTL+NVYLALE+NLEI+PVINKIDLPSA+ +RV++++ED IGLD S A L SAKTG+   +I+EAII ++PPP   D   PLQAL+FDS +D+Y+GA+   R+  G+V+ G +IRFM+    F V+ +GV TP     E L AGEVG+++ASIKN+K   VGDTIT    PA   LPGY+K++PMVYCGL+P++S +Y+  ++ALEK+ L+D+SLT+E ETS ALGFG RCGFLGLLHM++I+ERL+RE+ + LI TAPSV+Y+V+  +G+++ +D+   LP   L   I+EPF +A I+ P DF+G VMELCQ  RG +L++  +   R  + Y +PLAEI+Y FFD+LKS ++GYA+LDY +  YR  +LVK+DIL+N   VDALS I HR+ A  R R +  +L++ IP+  F++PIQA IG ++IARET+ A+RKNVLAKCYGGD+TRK+KLLE+QKEGKKR+K +G V +P + F+ +L
  S:     3 VEQKYIRNFCIIAHIDHGKSTLADRLLEYTGALSKREMVDQVLDTMDLERERGITIKLQAVRLHY-KARDGQEYVLNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALEHNLEIIPVINKIDLPSAEPERVRREIEDVIGLDASEAILASAKTGVGTEEILEAIIRRVPPP-RGDGEAPLQALIFDSIFDSYRGAIPYFRVVQGRVRKGDRIRFMATGAEFEVNEVGVFTPAPRPVESLAAGEVGFLSASIKNVKDTRVGDTITSAERPAPAPLPGYRKVMPMVYCGLFPVESERYDDLRDALEKLQLNDASLTFETETSVALGFGFRCGFLGLLHMEIIQERLEREYGLELITTAPSVVYRVVGTNGSVIMVDNPTALPAPNLIDHIEEPFVEATIMTPKDFVGPVMELCQEKRGSFLNMDYLSEKRVALKYDLPLAEIIYDFFDQLKSRTRGYASLDYSLKGYRPSELVKMDILVNNEVVDALSLITHRDQAYQRGRALVERLRQLIPRQLFDVPIQAAIGSRVIARETIPALRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKQVGTVDIPQEAFMAVL 597
>gi|196248975|ref|ZP_03147675.1| GTP-binding protein LepA [Geobacillus sp. G11MC16] >gi|196211851|gb|EDY06610.1| GTP-binding protein LepA [Geobacillus sp. G11MC16] (609 aa)
Score = 1892, Expect = 0.0e+00, Identities = 358/595 (60%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T  L+ RE++ Q LD M++ERERGITIKLNAVQL Y   K+ ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++NNLEI+PVINKIDLPSA+ +RV++++ED IGLD S A L SAK G+ +  I+E I+E+IP P   D + PL+AL+FDS YD Y+G V  VRI +G VK G +I+ MS  + F V+ +GV TPK    + L+ G+VG++ ASIKN++   VGDTITD   PA   LPGY+K+ PMV+CG+YPID+ +Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHM++I+ER++REF+I LI TAPSV+YKV L DGT +++D+   +PD      I+EP+ KA I+VP+D++G VMELCQ  RG ++D+  +D  R  + Y IPL+EI+Y FFD LKS +KGYA+ DYE++ YR  +LVK+DILLNG K+DALS I+HR+ A +R + I  KLK+ IP+ QFE+P+QA IG KIIAR T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ +L
  S:    10 QERIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDMMELERERGITIKLNAVQLTY-KAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDNNLEILPVINKIDLPSAEPERVRQEIEDVIGLDASEAVLASAKVGIGVEDILEQIVEKIPAP-SGDPDAPLKALIFDSLYDPYRGVVAYVRIVDGTVKPGQRIKMMSTGKEFEVTEVGVFTPKPKVVDELMVGDVGYLTASIKNVQDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMYPIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFHIDLITTAPSVVYKVYLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVMELCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSNLVKMDILLNGEKIDALSFIVHRDSAYERGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIARSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVL 602
>gi|89895883|ref|YP_519370.1| GTP-binding protein LepA [Desulfitobacterium hafniense Y51] >gi|109646206|ref|ZP_01370126.1| small GTP-binding protein [Desulfitobacterium hafniense DCB-2] >gi|119371345|sp|Q24SR6|LEPA_DESHY GTP-binding protein lepA >gi|89335331|dbj|BAE84926.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109644155|gb|EAT53708.1| small GTP-binding protein [Desulfitobacterium hafniense DCB-2] (601 aa)
Score = 1892, Expect = 0.0e+00, Identities = 361/592 (60%), Positives = 468/592 (79%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+IE+T  L+ REM+ Q+LD+MD+ERERGITIKL  V+L Y   KD Q Y  +LIDTPGHVDFTYEVSRSLAACEGALL+VDA+QG+EAQTL+NVYLALENNLEI+PVINKIDLPSA+ +RVK+++ED IGLD S A L SAKTG+ I  I+EA++ ++PPP   DDN PL+AL+FDSY+DAYKGA+  VR+  G+V  GT+I+ MS+ + F V+ +G+ TP +   + + AG+VG+IAASIKN++   VGDTITD  N A   LPGY+K  PMV+CGLYP+DS+ Y   K+ALEK++L+DSSL +E ETS ALGFG RCGFLGLLHMDVI+ERL+RE+++ LI TAPSV+YKV   DG +L ID+ + LP     + I+EP  KA I+VP DF+G +MEL Q  RG +L++  + + R  + Y +PL+EI+Y +FD+LKS +KGYA+LDYE+  Y+   LVK+D+LLNG  VDALS I+H+E +  R R++  KL+  IP+  FE+PIQAVIG K++ARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P D F+ +L
  S:     8 IRNFSIIAHIDHGKSTLADRLIEYTGALSKREMEAQVLDNMDLERERGITIKLQTVRLQY-PAKDGQTYELNLIDTPGHVDFTYEVSRSLAACEGALLIVDAAQGIEAQTLANVYLALENNLEIIPVINKIDLPSAEPERVKQEIEDVIGLDASEAILASAKTGIGIEDILEAVVAKVPPP-QGDDNTPLKALIFDSYFDAYKGAISYVRVMEGRVAKGTQIKMMSSGKVFDVTEVGMFTPALRIVDEIKAGQVGYIAASIKNVRDTQVGDTITDAENAALYPLPGYRKATPMVFCGLYPVDSSDYGRLKDALEKLHLNDSSLVFEPETSSALGFGYRCGFLGLLHMDVIQERLEREYDLNLITTAPSVVYKVNKTDGEVLSIDNPSNLPKVDEIETIEEPIVKANIMVPSDFVGAIMELNQEKRGNFLNMDYLSANRVTLHYELPLSEIVYDYFDQLKSRTKGYASLDYELAGYKAASLVKLDVLLNGELVDALSFIVHKEKSYARGRRLVEKLRGIIPRQMFEVPIQAVIGQKVVARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQDAFMAVL 597
>gi|81096808|ref|ZP_00875138.1| Small GTP-binding protein domain:GTP-binding protein LepA [Streptococcus suis 89/1591] >gi|80977160|gb|EAP40713.1| Small GTP-binding protein domain:GTP-binding protein LepA [Streptococcus suis 89/1591] (610 aa)
Score = 1890, Expect = 0.0e+00, Identities = 361/596 (60%), Positives = 472/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV++++ED IGLD S A   SAK G+ I +I+E I+E++P P   D   PLQAL+FDS YD Y+G +  VRI NG VK G  I+ MSN +TF V+ +G+ TPK + ++ L  G+VG+IAASIK +    VGDT+T   NPA+  L GYK++ PMV+ G+YPIDS +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ER++REFNI LI TAPSV+Y V + DG ++++ + ++ PD T    I+EP+ KA+I+VP +++G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YR   LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPIINKIDLPAADPERVRQEIEDVIGLDASEAVPTSAKAGIGIEEILEQIVEKVPAP-TGDVEAPLQALIFDSVYDPYRGVILQVRIVNGVVKPGDTIQMMSNGKTFDVTEVGIFTPKAIGRDYLATGDVGYIAASIKTVADTRVGDTVTLAKNPASEPLAGYKQMNPMVFAGIYPIDSNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERIEREFNIDLIMTAPSVVYHVNMTDGEMIDVANPSEFPDPTKIATIEEPYVKAQIMVPQEYVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRSSKLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|146318495|ref|YP_001198207.1| GTP-binding protein LepA [Streptococcus suis 05ZYH33] >gi|146320688|ref|YP_001200399.1| GTP-binding protein LepA [Streptococcus suis 98HAH33] >gi|166224530|sp|A4W0W0|LEPA_STRS2 GTP-binding protein lepA >gi|166224531|sp|A4VUL8|LEPA_STRSY GTP-binding protein lepA >gi|145689301|gb|ABP89807.1| Membrane GTPase LepA [Streptococcus suis 05ZYH33] >gi|145691494|gb|ABP91999.1| Membrane GTPase LepA [Streptococcus suis 98HAH33] (610 aa)
Score = 1890, Expect = 0.0e+00, Identities = 361/596 (60%), Positives = 472/596 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+P+INKIDLP+AD +RV++++ED IGLD S A   SAK G+ I +I+E I+E++P P   D   PLQAL+FDS YD Y+G +  VRI NG VK G  I+ MSN +TF V+ +G+ TPK + ++ L  G+VG+IAASIK +    VGDT+T   NPA+  L GYK++ PMV+ G+YPIDS +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ER++REFNI LI TAPSV+Y V + DG ++++ + ++ PD T    I+EP+ KA+I+VP +++G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DYEI +YR   LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR+KAIG+V VP + F+ +LS
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPIINKIDLPAADPERVRQEIEDVIGLDASEAVPTSAKAGIGIEEILEQIVEKVPAP-TGDVEAPLQALIFDSVYDPYRGVILQVRIVNGVVKPGDTIQMMSNGKTFDVTEVGIFTPKAIGRDYLATGDVGYIAASIKTVADTRVGDTVTLAENPASEPLAGYKQMNPMVFAGIYPIDSNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERIEREFNIDLIMTAPSVVYHVNMTDGEMIDVANPSEFPDPTKIATIEEPYVKAQIMVPQEYVGAVMELAQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRSSKLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVDKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKAIGSVEVPQEAFLSVLS 603
>gi|138896081|ref|YP_001126534.1| GTP-binding protein LepA [Geobacillus thermodenitrificans NG80-2] >gi|166223198|sp|A4IR35|LEPA_GEOTN GTP-binding protein lepA >gi|134267594|gb|ABO67789.1| GTP-binding protein LepA [Geobacillus thermodenitrificans NG80-2] (609 aa)
Score = 1888, Expect = 0.0e+00, Identities = 357/595 (60%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T  L+ RE++ Q LD M++ERERGITIKLNAVQL Y   K+ ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++NNLEI+PVINKIDLPSA+ +RV++++ED IGLD S A L SAK G+ +  I++ I+E+IP P   D + PL+AL+FDS YD Y+G V  VRI +G VK G +I+ MS  + F V+ +GV TPK    + L+ G+VG++ ASIKN++   VGDTITD   PA   LPGY+K+ PMV+CG+YPID+ +Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHM++I+ER++REF+I LI TAPSV+YKV L DGT +++D+   +PD      I+EP+ KA I+VP+D++G VMELCQ  RG ++D+  +D  R  + Y IPL+EI+Y FFD LKS +KGYA+ DYE++ YR  +LVK+DILLNG K+DALS I+HR+ A +R + I  KLK+ IP+ QFE+P+QA IG KIIAR T+ A+RKNVLAKCYGGD++RK+KLLE+QKEGKKR+K IG+V VP + F+ +L
  S:    10 QERIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDMMELERERGITIKLNAVQLTY-KAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDNNLEILPVINKIDLPSAEPERVRQEIEDVIGLDASEAVLASAKVGIGVEDILKQIVEKIPAP-SGDPDAPLKALIFDSLYDPYRGVVAYVRIVDGTVKPGQRIKMMSTGKEFEVTEVGVFTPKPKVVDELMVGDVGYLTASIKNVQDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMYPIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFHIDLITTAPSVVYKVYLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVMELCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSNLVKMDILLNGEKIDALSFIVHRDSAYERGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIARSTIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVL 602
>gi|81428901|ref|YP_395901.1| GTP-binding protein LepA [Lactobacillus sakei subsp. sakei 23K] >gi|90185157|sp|Q38W39|LEPA_LACSS GTP-binding protein lepA >gi|78610543|emb|CAI55594.1| GTPase LepA [Lactobacillus sakei subsp. sakei 23K] (612 aa)
Score = 1874, Expect = 0.0e+00, Identities = 361/595 (60%), Positives = 468/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNFSI+AHIDHGKSTL+DRI+E T+T+  R+M+ Q+LD M++ERERGITIKLNAV+L YH  KD + Y FHLIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQTL+NVYLA++++LEIVPVINKIDLPSA  D VK ++E+ IGLD S A L SAK+G+ I +I+E ++  +P P   D   PL+AL+FDS YD+Y+G V  +R+ +G VKVG KIR M++ + F V+ +GV +PK V ++ L+ G+VG+I ASIK I+   VGDT+T   NPA   L GY+ I PMVY G+YP+D+ ++   +EALEK+ L+D++L +E E+SQALGFG RCGFLGLLHMDV++ERL+REFN+ LI TAPSV Y V L DGT   ID+ +++P+ +   E++EP+ KA I+VP+D++G VMEL Q  RGE++ +  +D+ R  V Y +PL+EI++ FFD LKS +KGYA+ DYE+  YR  DLVK+DILLNG  VDALS I+HR+FA +RSR I  KLKE IP+ QFE+PIQA IG KIIAR TV A RKNVLAKCYGGDITRK+KLLE+QK GKKR+K++G+V VP + F+ IL
  S:    10 QKHIRNFSIIAHIDHGKSTLADRILEMTDTIAKRDMQAQVLDDMELERERGITIKLNAVELHYH-AKDGETYIFHLIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLAVDDDLEIVPVINKIDLPSAQPDVVKAEIEEMIGLDASEAVLASAKSGIGIEEILEKLVTDVPAP-TGDLEAPLKALIFDSNYDSYRGVVLNIRVVDGTVKVGDKIRLMNSGKEFEVTEVGVMSPKAVKRDFLMVGDVGYITASIKTIQDTRVGDTVTLADNPADAPLDGYRHIQPMVYSGMYPVDNAKFNDLREALEKLQLNDAALEFEPESSQALGFGFRCGFLGLLHMDVVQERLEREFNLDLIMTAPSVDYHVALTDGTEEVIDNPSEMPETSNISEVKEPYVKASIMVPNDYVGAVMELAQRKRGEFVTMDYLDTYRVNVIYNMPLSEIIFDFFDDLKSNTKGYASFDYEVTGYRASDLVKIDILLNGEAVDALSFIVHRDFAFERSRVIVGKLKETIPRQQFEVPIQAAIGNKIIARSTVKAFRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKSVGSVEVPQEAFMSIL 602
>gi|20141577|sp|P75498|LEPA_MYCPN GTP-binding protein lepA (598 aa)
Score = 1873, Expect = 0.0e+00, Identities = 362/600 (60%), Positives = 466/600 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           M+++ IRNFSI+AHIDHGKSTLSDR+IE +     R ++ Q+LD+M IERERGITIKLNAVQL     + NQ Y FHL+DTPGHVDFTYEVSRSLAACEG LL+VDA+QG++AQT+SN YLALENNLEI+PVINK+D+ SAD+++ K+     +G+D +  PLVSAKTGL I+Q++  IIE++PPP   D++KPL+AL+FDSYYD YKG VC +RI  G +K+  KIRF  +N  + +  LG+  P    ++VL AGE+GW +A IK ++ ++VGDTI    +  T  LPGYKK+LPM+YCGLYPID+  Y+  K A+EKI LSD +L YEYETSQALGFG+RCGFLGLLHMDVI+ERL+RE+N+ LI+  PSV YKVLL +G  LE+D+ + LP+++  K I EPF +  I +PD +LG V++LCQN+RG+Y  L  +D  RK++ YL+PL EI+YSFFDKLKS +KGYA+L+YE   Y+   L KV+I+LN  KVDALS I H +FA  R++K C+KLKE IPKH FEIPIQA IG K+IARET+ A+RK+V AK YGGD+TRKKKLLE+QKEGKKRLKAIG+V +P + F  +L +E
  S:     1 MEQQKIRNFSIIAHIDHGKSTLSDRLIERSIGFEKRLLQAQMLDTMAIERERGITIKLNAVQL--KMAQGNQQYLFHLVDTPGHVDFTYEVSRSLAACEGVLLLVDATQGIQAQTISNTYLALENNLEIIPVINKVDMESADVEKTKQAFHQLLGVDPNTIPLVSAKTGLGIDQLITTIIEKVPPP-KGDESKPLKALLFDSYYDPYKGVVCFIRIFEGSLKLNDKIRFARSNSVYQIVELGIKNPFFEKQDVLKAGEIGWFSAGIKKLRDVTVGDTIVHAEDTTTPPLPGYKKVLPMIYCGLYPIDNNDYQNLKMAMEKIILSDVALEYEYETSQALGFGVRCGFLGLLHMDVIKERLEREYNLKLISAPPSVRYKVLLTNGEELELDNPSLLPERSRIKSISEPFVRVYIDLPDHYLGTVIDLCQNFRGQYEKLEEIDIDRKRLVYLMPLGEIIYSFFDKLKSITKGYASLNYEFDQYQVSQLAKVEIMLNKQKVDALSFIAHHDFAFQRAKKFCVKLKELIPKHLFEIPIQATIGSKVIARETIKAVRKDVTAKLYGGDVTRKKKLLEKQKEGKKRLKAIGSVELPQELFSHLLKDE 597
>gi|116495044|ref|YP_806778.1| GTP-binding protein LepA [Lactobacillus casei ATCC 334] >gi|191638548|ref|YP_001987714.1| GTP-binding protein lepA [Lactobacillus casei] >gi|122263539|sp|Q038N6|LEPA_LACC3 GTP-binding protein lepA >gi|116105194|gb|ABJ70336.1| GTP-binding protein LepA [Lactobacillus casei ATCC 334] >gi|190712850|emb|CAQ66856.1| GTP-binding protein lepA [Lactobacillus casei BL23] (612 aa)
Score = 1871, Expect = 0.0e+00, Identities = 360/595 (60%), Positives = 470/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNFSI+AHIDHGKSTL+DRI+E T+T+  R+M+ Q+LD M +ERERGITIKLNAV+L Y   K+ + Y FHLIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQTL+NVYLA++++LEI+PVINK+DLPSA  D VK+++E+ IGLD S+A L S KTGL + +I+E I+  +P P   D N PLQAL+FDS YD Y+G V  VR+K GQVKVG  I+ MSN + F V+ +GV +PK V ++ L+ G+VG+I A+IK I+   VGDT+T    PA   L GY+KI PMVY GL+P+D+ ++   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHMDV++ERL+R++++ LI TAPSV Y++++ DGT   ID+ A +P+ +  KEI+EP+ KA I+VP+D++G VMEL Q  RGE++ +  +D  R  V Y +PL+EI+Y FFD LKS +KGYA+LDYEI  YR+ DLVK+DILLNG+ VDALSTI+H++FA +R + I  +LK  IP+ QFEIPIQA IG K+IAR TV A RKNVLAKCYGGDITRK+KLLE+QK GKKR+K++G+V VP + F+ IL
  S:    10 QKHIRNFSIIAHIDHGKSTLADRILELTDTIAKRDMQAQVLDDMALERERGITIKLNAVELHY-KAKNGETYIFHLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTLANVYLAIDDDLEIIPVINKVDLPSAQPDVVKEEIEEMIGLDASDAILASGKTGLGVPEILERIVTDVPAP-SGDLNAPLQALIFDSVYDDYRGVVLDVRVKEGQVKVGDTIQLMSNGKQFQVTEVGVMSPKAVKRDFLMVGDVGYITAAIKTIQDTRVGDTVTLADRPAEKPLKGYRKITPMVYSGLFPVDNAKFNDLREALEKLQLNDAALEFEPETSQALGFGFRCGFLGLLHMDVVQERLERDYDLDLIMTAPSVDYEIIMTDGTEKTIDNPADMPEVSEIKEIREPYVKASIMVPNDYVGPVMELSQRKRGEFVTMDYLDKYRVNVIYNLPLSEIIYDFFDDLKSSTKGYASLDYEITGYRQSDLVKMDILLNGDPVDALSTIVHKDFAYERGKAIVARLKTTIPRQQFEIPIQAAIGNKVIARSTVKAYRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKSVGSVEVPQEAFMSIL 602
>gi|163762990|ref|ZP_02170054.1| metal dependent phosphohydrolase [Bacillus selenitireducens MLS10] >gi|160356923|gb|EDP83572.1| metal dependent phosphohydrolase [Bacillus selenitireducens MLS10] (608 aa)
Score = 1870, Expect = 0.0e+00, Identities = 352/593 (59%), Positives = 461/593 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNFSI+AHIDHGKSTL+DRI+E T+ LT REMK+Q+LD+MD+ERERGITIKLNAVQL Y    D ++Y FHLIDTPGHVDF YEVSRSLAACEGALL+VDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLPSA+ +RVK +VE+ IGL   +  L SAK G+ I++I+E+I++ +P P   D   PL+A++FDS YD Y+G +  +R+  G VK G KI+ M+  + F    +GV TPK   KE L  G+VG++ ASIKN+    VGDT+T         +PGY+K+ PMV+CGLYP+D+ +Y   +EALEK+ L+D+SL +E E+SQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY++ L DG  L ID+ + +PD      + EPF KAE++VP++++G VME+CQ  RGEY D+  +D+ R  + Y IPL+EI+Y FFD LKS +KGYA+ DYE++ Y++  LVK+DILLNG  +DALS I+HR+ A +R + I  KLKE IP+ QFE+P+QA IG KIIAR T+ AMRKNVLAKCYGGDI+RK+KLLE+QKEGK+R+K++GNV VP + F+ +LS
  S:    13 IRNFSIIAHIDHGKSTLADRILEKTSALTQREMKDQMLDAMDLERERGITIKLNAVQLTY-TANDGEEYIFHLIDTPGHVDFAYEVSRSLAACEGALLIVDAAQGIEAQTLANVYLALDNDLEIIPVINKIDLPSAEPERVKAEVEEVIGLPMDDCILASAKDGVGIDEILESIVKHVPAPA-GDPEAPLKAMIFDSLYDPYRGVIVYMRVMEGTVKPGDKIKMMATGKEFEAQEIGVFTPKPTEKEELTVGDVGYMIASIKNVADSRVGDTVTHAKRQTAEPMPGYRKLNPMVFCGLYPLDTNKYNDLREALEKLELNDASLQFEAESSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYEINLTDGEQLIIDNPSNMPDSQQIDYVSEPFVKAEVMVPNEYVGPVMEICQKKRGEYQDMKYLDANRVNIVYEIPLSEIVYDFFDTLKSSTKGYASFDYEMIGYKESRLVKMDILLNGESIDALSVIVHRDSAYERGKIIVEKLKELIPRQQFEVPVQASIGNKIIARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKSVGNVEVPQEAFMSVLS 603
>gi|168187879|ref|ZP_02622514.1| GTP-binding protein LepA [Clostridium botulinum C str. Eklund] >gi|169294262|gb|EDS76395.1| GTP-binding protein LepA [Clostridium botulinum C str. Eklund] (601 aa)
Score = 1869, Expect = 0.0e+00, Identities = 361/595 (60%), Positives = 466/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDN-QDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           KK+ RNFSIVAHIDHGKSTL+DR++E T TLT REM+NQ+LD M++E+ERGITIK  A +L+Y   +DN ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+++LEIVPVINKIDL SA  D VK+++ED IG++  +APLVSAKTGLNI  ++EAI+E++P P D D+   L+AL+FDSYYD+YKG VC VR+K+G VK GTKI+FM+ N+ + V+  G+ TP     + L AG+VG+I ASIKN++   VGDTIT+   PAT  L GY+  +PMVY G+YP+D  +YE  KEALEK+ L+D++L YE ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIY +   DG +++I +   +PD T  + ++EP  KA II P DF+G VMELCQN RG ++D+  +++TR  V Y IPL EI+Y FFD LKS +KGYA+LDYE+  Y+   LVK+D+LLNG+ VDALS I+  E A  + R I  KLKE IP+  FEIPIQA +G KIIARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ IG+V VP + F+ IL
  S:     6 KKHTRNFSIVAHIDHGKSTLADRLLEATGTLTQREMENQVLDKMELEKERGITIKSQAARLVYK--RDNGEEYILNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDHDLEIVPVINKIDLHSARPDEVKEEIEDVIGIEAHDAPLVSAKTGLNIKDVLEAIVEKVPAP-DGDEEASLKALIFDSYYDSYKGVVCYVRVKDGVVKPGTKIKFMATNKEYEVTETGIFTPNFFPMKELRAGDVGYITASIKNLRDAGVGDTITEAGRPATEPLEGYRPAIPMVYSGIYPVDGAKYEELKEALEKLKLNDAALAYEPETSIALGFGFRCGFLGLLHMEIIQERIEREFNLDIITTAPSVIYNIYKRDGEMMKITNPTNMPDPTEIEIMEEPVVKASIITPSDFVGAVMELCQNKRGTFIDMEYIETTRVVVNYYIPLNEIIYDFFDMLKSKTKGYASLDYELNGYKAAKLVKLDMLLNGDIVDALSMIVPEERAYHKGRAIAEKLKEVIPRQMFEIPIQAAVGAKIIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQIGSVEVPQEAFMSIL 598
>gi|147677208|ref|YP_001211423.1| GTP-binding protein LepA [Pelotomaculum thermopropionicum SI] >gi|189046448|sp|A5D3X6|LEPA_PELTS GTP-binding protein lepA >gi|146273305|dbj|BAF59054.1| membrane GTPase LepA [Pelotomaculum thermopropionicum SI] (602 aa)
Score = 1866, Expect = 0.0e+00, Identities = 348/597 (58%), Positives = 455/597 (76%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           DK  IRNF I+AHIDHGKSTL+DR++E+T  LT REM  Q+LD MD+ERERGITIK+ AV+L Y   +D +DY  +LIDTPGHVDF+YEVSRSLAACEGALLVVDA+QG+EAQTL+NVYLALE+NLEI+PVINKIDLPSAD +RVKK++ED IGLD S A L SAK+G  + +I+E I+ +IPPP       PL+AL+FDS+YD YKG VC VR+ +G V  G +I+ M+    F VS +G+  P + +   L  GEVG+I A IKN+K   VGDTIT+   PA   LPGY+K  PMV+CGLYP+++ +YE  K+AL K+ L+D+SLTYE ETS+ALGFG RCGFLGLLHM++I+ERL+RE+ + LI TAP+V+Y+V    G  +EI++ +KLP     + I+EPF +A I+ P D++G VMELCQ  RG + ++  +   R  + Y +PL+EI+Y FFD+LKS +KGYA+LDYE+  YR+ DLVK+D+L+ G  +DALS I+HR+ A  R R +  KL+  IP+H FEIPIQA +G +IIARETV A+RK+VLAKCYGGD+TRK+KLLE+QK GKKR+K +G V +P + F+ +LS
  S:     4 DKDRIRNFCIIAHIDHGKSTLADRLLEYTGALTGREMTEQVLDQMDLERERGITIKMQAVRLNYR-ARDGRDYQLNLIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALEHNLEIIPVINKIDLPSADPERVKKEIEDVIGLDASEAVLASAKSGAGVEEILERIVTRIPPP-GGQTGAPLRALIFDSHYDPYKGVVCYVRVVDGSVSNGMQIKMMATGREFEVSEVGIFKPYLASVGELRTGEVGFITAGIKNVKDSRVGDTITEAGRPAPVPLPGYRKATPMVFCGLYPVEAGEYEALKDALAKLKLNDASLTYEPETSEALGFGFRCGFLGLLHMEIIQERLEREYGLNLITTAPNVVYRVKTTAGETIEIENPSKLPPPGKIEFIEEPFVRAVIMAPKDYIGPVMELCQERRGVFTNMEYISVNRVMLNYALPLSEIIYDFFDQLKSRTKGYASLDYELDGYRQSDLVKLDVLIAGEVLDALSVIVHRDKAYQRGRHLVEKLRGLIPRHLFEIPIQAAVGNRIIARETVKAIRKDVLAKCYGGDVTRKRKLLEKQKAGKKRMKQVGRVEIPQEAFMAVLS 598
>gi|94994323|ref|YP_602421.1| GTP-binding protein LepA [Streptococcus pyogenes MGAS10750] >gi|119371405|sp|Q1J6V6|LEPA_STRPF GTP-binding protein lepA >gi|94547831|gb|ABF37877.1| GTP-binding protein lepA [Streptococcus pyogenes MGAS10750] (605 aa)
Score = 1863, Expect = 0.0e+00, Identities = 355/577 (61%), Positives = 459/577 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKR 579
           ++ IRNFSI+AHIDHGKSTL+DRI+E T T+++REM+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ +VED IGLD S A L SAK G+ I +I+E I+E++P P   D + PLQAL+FDS YDAY+G +  VRI NG VK G KI+ MSN +TF V+ +G+ TPK V ++ L  G+VG++AASIK +    VGDT+T   NPA  +L GYK++ PMV+ G+YPI+S +Y   +EALEK+ L+D+SL +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFNI LI TAPSV+Y V   D  ++E+ + ++ PD T    I+EP+ KA+I+VP +F+G VMEL Q  RG+++ +  +D  R  V Y IPLAEI++ FFDKLKS ++GYA+ DY++ +YR+  LVK+DILLNG+KVDALS I+H+EFA +R + I  KLK+ IP+ QFE+PIQA IG KI+AR  + A+RKNVLAKCYGGD++RK+KLLE+QK GKKR
  S:    10 QEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRHEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVPAP-TGDVDAPLQALIFDSVYDAYRGVILQVRIVNGIVKPGDKIQMMSNGKTFDVTEVGIFTPKAVGRDFLATGDVGYVAASIKTVADTRVGDTVTLANNPAKEALHGYKQMNPMVFAGIYPIESNKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVHTTDEDMIEVSNPSEFPDPTRVAFIEEPYVKAQIMVPQEFVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYDMSEYRRSQLVKMDILLNGDKVDALSFIVHKEFAYERGKIIVEKLKKIIPRQQFEVPIQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKR 584
>gi|20807432|ref|NP_622603.1| GTP-binding protein LepA [Thermoanaerobacter tengcongensis MB4] >gi|24211904|sp|Q8RB72|LEPA_THETN GTP-binding protein lepA >gi|20515955|gb|AAM24207.1| Membrane GTPase LepA [Thermoanaerobacter tengcongensis MB4] (603 aa)
Score = 1862, Expect = 0.0e+00, Identities = 366/594 (61%), Positives = 470/594 (79%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           KYIRNF I+AHIDHGKSTL+DR+IE T  L+ REM  QILD++++ERERGITIKL  V++IY   KD  +Y  +LIDTPGHVDFTYEVSRS+AACEGALLVVDASQG+EAQTL+NVYLALE++LEI+PVINKIDLPSAD +RVK+++ED IG+D S A L SAK G+ I +++EAI+++IPPP   D++KPL+AL+FDS+YD YKGA+  VRI +G+VK G +I+  S  + F V+ +G   P +   E L AGEVG+IAA+IKN+K   VGDTITD  NPA + LPGYK+++PMV+CG+YP D   YE  KEALEK+ L+D+SL +E +TS ALGFG RCGFLGLLHM++++ERL+RE+N+ L+ TAPSVIYKV   +G +LE+D+  K+P  T    I+EP  +A I+VP D++G VMELCQ  RG YL +  ++ TR  + Y +PL EI+Y FFD LKS ++GYA+LDYE   Y+K DLVK+DIL+NG  VDALS I+H++ A ++ RKI  KLKE+IP+H FEIPIQA IG +IIARETV A+RKNVLAKCYGGD+TRKKKLLE+QKEGKKR++ IG V +P + F+ IL
  S:     6 KYIRNFCIIAHIDHGKSTLADRLIEKTGFLSEREMDKQILDNLELERERGITIKLKPVRMIY-KAKDGNEYELNLIDTPGHVDFTYEVSRSIAACEGALLVVDASQGIEAQTLANVYLALEHDLEIIPVINKIDLPSADPERVKREIEDIIGIDASEALLTSAKEGIGIEEVLEAIVKRIPPP-QGDEDKPLKALIFDSFYDNYKGAISFVRIVDGKVKRGMRIKMFSTGKVFEVTEVGSFRPDLYPVEELKAGEVGYIAANIKNVKDTRVGDTITDADNPADSPLPGYKEVVPMVFCGIYPADGEDYENLKEALEKLQLNDASLVFEPDTSAALGFGFRCGFLGLLHMEIVQERLEREYNLNLVTTAPSVIYKVYKTNGEVLELDNPTKMPPPTQIDHIEEPIVEATIMVPTDYVGPVMELCQERRGVYLGMEYIEKTRVLLKYEMPLNEIIYDFFDALKSRTRGYASLDYEFKGYKKSDLVKLDILVNGEVVDALSMIVHKDKAYEKGRKIVEKLKENIPRHLFEIPIQAAIGSRIIARETVKALRKNVLAKCYGGDVTRKKKLLEKQKEGKKRMRQIGTVEIPQEAFMSIL 597
>gi|86605298|ref|YP_474061.1| GTP-binding protein LepA [Synechococcus sp. JA-3-3Ab] >gi|119371407|sp|Q2JWR1|LEPA_SYNJA GTP-binding protein lepA >gi|86553840|gb|ABC98798.1| GTP-binding protein LepA [Synechococcus sp. JA-3-3Ab] (603 aa)
Score = 1861, Expect = 0.0e+00, Identities = 346/592 (58%), Positives = 466/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR++E T T++ REMK Q+LD+M++ERERGITIKL A ++ Y   +D QDY  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PVINKIDLP A+ +RV  ++E  IGLDCS A L SAK G+ I +I+EAI++++PPP D+  + PL+AL+FDSYYD+Y+G +  VRI +G+VK G KI FM++   + ++ LGV  P   +   L AGEVG+IAA+IK+++   VGDTIT     A+  LPGYK+  PMV+CGL+P +S QY   KEALEK+ L+D++L +E E S A+GFG RCGFLGLLHM+V++ERL+RE+N+ L+ TAP+V+Y+V LNDG+++ +D+ +KLP       I+EP  + E+I+P++F+G VMELC+  RG + D+  +   R  + Y +PLAE++  FFD+LKS ++GYA++DY+++ YR  DLV++DIL+NG+ VD+LSTI+HR+ A    R +  KL+E IP+HQFE+PIQA IG ++IARET+ A+RKNVLAKCYGGD+TRK+KLLE+QKEGKKR+KA+G V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLEATGTVSAREMKPQLLDNMELERERGITIKLQAARMNYR-AQDGQDYVLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVINKIDLPGAEPERVIAEIEQVIGLDCSGAILASAKMGIGIPEILEAIVQRVPPPRDTVAD-PLRALIFDSYYDSYRGVIVYVRIMDGEVKTGDKICFMASGREYEITELGVMRPHQESVASLHAGEVGYIAAAIKSVEHARVGDTITLVHRKASEPLPGYKEAKPMVFCGLFPSNSDQYAELKEALEKLKLNDAALYFEPEVSPAMGFGFRCGFLGLLHMEVVQERLEREYNLDLVITAPTVVYQVTLNDGSVIRVDNPSKLPPPNERTSIEEPIVRVEVILPEEFVGTVMELCETKRGTFKDMKYLAQGRTTLVYELPLAEVVTDFFDQLKSRTRGYASMDYQMVGYRADDLVRLDILINGDVVDSLSTIVHRDKAFYVGRSLVAKLRELIPRHQFEVPIQAAIGSRVIARETIPALRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKAVGTVEVPQEAFMAVL 598
>gi|47459238|ref|YP_016100.1| GTP-binding protein LepA [Mycoplasma mobile 163K] >gi|60390017|sp|Q6KHP1|LEPA_MYCMO GTP-binding protein lepA >gi|47458567|gb|AAT27889.1| membrane/cytoplasmic GTPase [Mycoplasma mobile 163K] (598 aa)
Score = 1859, Expect = 0.0e+00, Identities = 355/600 (59%), Positives = 470/600 (78%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           MDK  IRNFSI+AHIDHGKSTL+DRI+E T T+  R++K Q LDSMD+E+ERGITIKLNAVQ+ Y      +DY FHLIDTPGHVDFTYEVSRSLAA EGA+L+VDA+QG+EAQTL+NVYLA++N LEI+PVINKIDLPS+D + VKK++E+ IG+D S+A L+SAKTG NI  +++A+IE+IP P ++DDNKPL+ALVFDSYYD Y+G V L+RI  G++KVG +  FM +   F  + LGV  P  + K+ L AGEVGW++ASI+N K +SVGDTIT   NP    L GYKK+ P+VY G +PIDS  Y+  KE+L KI LSDSS+++E ETS+ALGFG R GFLG+LHM++++ERL REFNI LIATAPSV + V   +G +L I + + LP+K   ++I+EP+ KA II+P +++G VME+CQ  RG Y DL  +D  R+++ Y +PL+EI++ FFD+LKS +KGYA+ DYEI+ Y + DL+KVD+LLNG K+DAL+ I+H++FA  R R + +KLKE IP+  FEIP+QA IG K+IARET+ A RK+V AK YGGD+TR++KLL++QK GKKR+K+IG+V +P + F+ IL  +
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILELTETVEKRDLKAQHLDSMDLEKERGITIKLNAVQIKY------KDYVFHLIDTPGHVDFTYEVSRSLAASEGAILLVDATQGIEAQTLANVYLAMDNGLEIIPVINKIDLPSSDPEAVKKEIEEVIGIDASDAILISAKTGKNIEDVLKAVIEKIPAPKNADDNKPLKALVFDSYYDQYRGVVLLIRIFEGKIKVGDEFFFMQSKNKFHATELGVRKPVELKKDSLEAGEVGWLSASIRNAKDVSVGDTITLYNNPTEKPLQGYKKLKPVVYTGFFPIDSQDYDDLKESLIKISLSDSSISFEPETSKALGFGFRVGFLGMLHMEILQERLSREFNIDLIATAPSVEFHVTTTNGEMLSISNPSLLPEKNYIQKIEEPYIKASIILPKEYVGAVMEMCQGKRGVYQDLEFLDENRRRLVYNLPLSEIVFDFFDRLKSLTKGYASFDYEIIGYLESDLIKVDVLLNGEKIDALAIIVHKDFAYSRGRDLTVKLKEVIPRQNFEIPVQAAIGAKVIARETIKAYRKDVTAKLYGGDVTRRQKLLKKQKAGKKRMKSIGSVEIPQEAFLAILETD 594
>gi|15894560|ref|NP_347909.1| GTP-binding protein LepA [Clostridium acetobutylicum ATCC 824] >gi|24211929|sp|Q97JJ6|LEPA_CLOAB GTP-binding protein lepA >gi|15024206|gb|AAK79249.1|AE007640_4 Membrane GTPase lepA [Clostridium acetobutylicum ATCC 824] (602 aa)
Score = 1858, Expect = 0.0e+00, Identities = 350/598 (58%), Positives = 468/598 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K+IRNF IVAHIDHGKSTL+DR++E T TLT REM+ Q+LD+M+IERERGITIK  A +LIY  P+D Q+Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N Y+A+++ LE+VPVINKIDLPSA  D +K ++ED IG++ S+APL+SAKTGLNI  ++EA+++++P P   D+  PL+AL+FDSYYD+YKG VC +RIK+G VK GT+I+ M+ N+ + V  +GV  P  +  E L AG+VG+I ASIKN++   VGDTIT+  NPA   L GY+  + MVY G+YPIDS++YE  KEALEK+ ++D++L +E ETS ALGFG RCGFLGLLHM++++ER+++EFN+ +I TAPSVIYKV   DGT++EI +   LP+ T    ++EP  KA+II P DF+G VMELCQN RG ++D+  +++TR  + Y +PL EI+Y FFD LKS +KGYA+ DYE+  Y + +LVK+DI+LN   VDALS I+ ++ A  + R +  KLKE IP+  FEIPIQA +G KIIARETV A+RK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G+V VP + F+ IL  +
  S:     6 QKHIRNFCIVAHIDHGKSTLADRLLEHTGTLTHREMEEQVLDNMEIERERGITIKSQAARLIYKRPEDGQEYILNLIDTPGHVDFNYEVSRSLAACEGAVLVVDATQGIQAQTLANCYMAVDHGLEVVPVINKIDLPSARPDEIKNEIEDVIGIESSDAPLISAKTGLNIEDVLEAVVQKVPAP-SGDEKGPLKALIFDSYYDSYKGVVCHIRIKDGTVKAGTRIKLMAANKEYEVIEVGVFVPNYLKVEELKAGDVGYITASIKNVRDARVGDTITEVNNPAKEPLLGYRPAISMVYSGIYPIDSSKYEELKEALEKLQVNDAALNFEPETSIALGFGFRCGFLGLLHMEIMQERIEKEFNLDVIMTAPSVIYKVKKTDGTLIEITNPTNLPEPTEIDYMEEPVVKAQIITPSDFVGAVMELCQNKRGTFIDMEYIETTRVMLNYRVPLNEIIYDFFDSLKSRTKGYASFDYELDGYMRTELVKLDIILNSEVVDALSMIVPKDRAYAKGRTMAEKLKEIIPRQLFEIPIQAAVGSKIIARETVKALRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEVPQEAFMSILKND 602
>gi|125973841|ref|YP_001037751.1| GTP-binding protein LepA [Clostridium thermocellum ATCC 27405] >gi|196253038|ref|ZP_03151681.1| GTP-binding protein LepA [Clostridium thermocellum DSM 4150] >gi|166223191|sp|A3DF29|LEPA_CLOTH GTP-binding protein lepA >gi|125714066|gb|ABN52558.1| GTP-binding protein LepA [Clostridium thermocellum ATCC 27405] >gi|196197534|gb|EDX92388.1| GTP-binding protein LepA [Clostridium thermocellum DSM 4150] (603 aa)
Score = 1857, Expect = 0.0e+00, Identities = 363/595 (61%), Positives = 465/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPK-IVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNF I+AHIDHGKSTL+DR++E T  LT REM++Q+LD+M+IERERGITIK  AV+++Y   KD ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+++LEI+PVINKIDLPSA  D VKK++ED IGLD S APL+SAK G+NI  ++E++++ +PPP + D+N PL+AL+FDSYYD+YKG +  +R+K G +K+G K+R M  N+ F V+ +G   P  +V    L AGEVG+ AASIKN+K   VGDT+T   NPA   LPGYKK+ PMV+CG+YP D ++Y   ++ALEK+ L+D+SLT+E E+S ALGFG RCGFLGLLHM++I+ERL+REF+  L+ TAPSVIYKV   +G  L ID+   LP     K ++EP  KA I+ P +++GN+MEL Q  RG Y D+  +D  R  +TY +PL EI+Y FFD LKS +KGYA+LDYE+L YR+ DLVK+DI+LNG  VDALS I+HRE A  R R+I  KLKE IP+ QFE+PIQA IGGKIIARETV A RK+VLAKCYGGDITRKKKLLE+QKEGKKR++ IG V VP + F+ +L
  S:     6 QKKIRNFCIIAHIDHGKSTLADRLLEMTGVLTEREMEDQVLDTMEIERERGITIKAQAVRMVY-KAKDGEEYILNLIDTPGHVDFNYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDHDLEILPVINKIDLPSAQPDVVKKEIEDVIGLDASEAPLISAKNGINIEAVLESVVKNVPPP-EGDENAPLRALIFDSYYDSYKGVIVYIRVKEGTLKLGDKVRMMYTNKEFTVTEIGYMKPGGLVPGTQLSAGEVGYFAASIKNVKDTRVGDTVTTADNPAKEPLPGYKKVNPMVFCGIYPADGSKYGDLRDALEKLQLNDASLTFEPESSVALGFGFRCGFLGLLHMEIIQERLEREFDFDLVTTAPSVIYKVTKTNGETLYIDNPTNLPPPAEIKTMEEPIVKATIMTPTEYVGNIMELAQERRGIYKDMTYIDEGRVMLTYELPLNEIIYDFFDALKSRTKGYASLDYEMLGYRESDLVKLDIMLNGEIVDALSFIVHREKAYARGRRIAEKLKEAIPRQQFEVPIQACIGGKIIARETVKAYRKDVLAKCYGGDITRKKKLLEKQKEGKKRMRQIGTVEVPQEAFMSVL 599
>gi|15828718|ref|NP_326078.1| GTP-binding protein LepA [Mycoplasma pulmonis UAB CTIP] >gi|14089660|emb|CAC13420.1| GTP-BINDING PROTEIN LEPA [Mycoplasma pulmonis] (611 aa)
Score = 1856, Expect = 0.0e+00, Identities = 359/597 (60%), Positives = 472/597 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M+K  IRNFSI+AHIDHGKSTL+DRI+E T T++TRE+K Q LDSMD+E+ERGITIKLNAVQ+ Y      +DY FHLIDTPGHVDFTYEVSRSLAA EGALL+VDA+QG+EAQTL+N YLALENNL+I+P+INKIDLPSAD +R+K ++E+ IG+   +  L+SAK+GLN+ +++E I+++I  P+D+DD+KPL+ALVFDSY+DAY+G + LVRI  G++ V  + +F+S N+ F V  LGV TP  V K  L +GEVGWIAASI++ K +SVGDT+T   NP   +LPGYKK+  +V+ G YPID   Y + KE+LEKI LSDSS+T+E E+S+ALGFG R GFLG+LHM+V++ERL REFNI +IATAPSV YKV L +  +  + + + LPD+   K I+EPF ++ I+V ++F+G +MELCQ+ RG Y+++  +D  R K+ Y +PL+EI+  FFDKLKS SKGYA+ DYE ++YR  DLVKVDILLN  KVDA S I HRE A +RS+++ LKLK+ IPK  FEIPIQA+IG K+IARET+ A RK+V AK YGGD+TR++KLL++QKEGKKR+K+IG+V VP + F+ +L
  S:    15 MNKSKIRNFSIIAHIDHGKSTLADRILEITQTVSTRELKAQHLDSMDLEQERGITIKLNAVQIKY------KDYIFHLIDTPGHVDFTYEVSRSLAASEGALLLVDATQGIEAQTLANAYLALENNLKIIPIINKIDLPSADPERIKGEIEEVIGISAKDTILISAKSGLNVEKVLEEIVDKISYPIDADDDKPLKALVFDSYFDAYRGVILLVRIFEGKIAVNDQFKFISTNKQFHVIELGVRTPTEVKKPFLESGEVGWIAASIRDAKDVSVGDTLTLVKNPTKEALPGYKKVKAVVFTGFYPIDGKDYPVLKESLEKISLSDSSITWELESSKALGFGFRVGFLGMLHMEVLQERLKREFNIDIIATAPSVEYKVYLTNNKVEIVSNPSDLPDRNYIKNIKEPFIRSFILVTEEFIGGIMELCQSKRGVYVNIEYIDK-RVKIIYELPLSEIILDFFDKLKSISKGYASFDYEFIEYRDADLVKVDILLNKEKVDAFSFISHRENAYERSKELALKLKDVIPKQSFEIPIQAIIGAKVIARETIKAYRKDVTAKLYGGDVTRRQKLLKKQKEGKKRMKSIGSVEVPQEAFLSVL 604
>gi|86607566|ref|YP_476328.1| GTP-binding protein LepA [Synechococcus sp. JA-2-3B'a(2-13)] >gi|119371408|sp|Q2JQ51|LEPA_SYNJB GTP-binding protein lepA >gi|86556108|gb|ABD01065.1| GTP-binding protein LepA [Synechococcus sp. JA-2-3B'a(2-13)] (603 aa)
Score = 1855, Expect = 0.0e+00, Identities = 344/592 (58%), Positives = 464/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T++ REM+ Q+LDSM++ERERGITIKL A ++ Y   +D QDY  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PVINKIDLP A+ +RV  ++E  IGLDCS A L SAK G+ I +I+EA+++++PPP D+   +PL+AL+FDSYYDAY+G +  VRI +G+VK G KI FM++   + ++ LGV  P     + L AGEVG++AA+IK+++   VGDTIT     A   LPGYK+  PMV+CGL+P  S QY   KEALEK+ L+D++L +E E S A+GFG RCGFLGLLHM+V++ERL+RE+N+ L+ TAP+V+Y+V LN+G+++ +D+ +KLP       I+EP  + E+I+P++F+G VMELC+  RG + D+  +   R  + Y +PLAE++  FFD+LKS ++GYA++DY+++ YR  DLV++DIL+NG+ VD+LSTI+HR+ A    R +  KL+E IP+HQFE+PIQA IG K+IARET+ A+RKNVLAKCYGGD+TRK+KLLE+QKEGKKR+KA+G V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQETGTVSAREMRPQLLDSMELERERGITIKLQAARMNYR-AQDGQDYVLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVINKIDLPGAEPERVIAEIEQVIGLDCSGAILASAKVGIGIQEILEAVVQRVPPPRDTV-AEPLRALIFDSYYDAYRGVIVYVRIMDGEVKTGDKICFMASGREYEITELGVMRPNQEPVDALHAGEVGYMAAAIKSVEHARVGDTITLVNRKAPEPLPGYKEAKPMVFCGLFPSSSDQYAELKEALEKLKLNDAALYFEPEISSAMGFGFRCGFLGLLHMEVVQERLEREYNLDLVITAPTVVYQVTLNNGSVIRVDNPSKLPPPNERTSIEEPIVRVEVILPEEFVGTVMELCETKRGTFKDMKYLAQGRTTLVYELPLAEVVTDFFDQLKSRTRGYASMDYQMIGYRADDLVRLDILINGDVVDSLSTIVHRDKAFYVGRSLVAKLRELIPRHQFEVPIQAAIGSKVIARETIPALRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKAVGTVDVPQEAFMAVL 598
>gi|116333928|ref|YP_795455.1| GTP-binding protein LepA [Lactobacillus brevis ATCC 367] >gi|122269388|sp|Q03QU8|LEPA_LACBA GTP-binding protein lepA >gi|116099275|gb|ABJ64424.1| GTP-binding protein LepA [Lactobacillus brevis ATCC 367] (610 aa)
Score = 1855, Expect = 0.0e+00, Identities = 353/598 (59%), Positives = 466/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +KYIRNFSIVAHIDHGKSTL+DRI+E T+T++ R+M++Q+LD MD+ERERGITIKLNAV+L YH  KD  DY FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+NVYLAL+++LEIVPVINKIDLP+AD D+VK ++E+ IGLD S+A L SAK G+ I +++E I+ +IP P   D   PL+ALVFDS YD Y+G V  +R+  G VK G KIR M++   + V+ +GVN+PK + ++ L+AG+VG+I ASIK+I    VGDT+T    PA  +LPGY+++ PMVY GLYP D+ +    +EALEK+ L+D++L +E E+SQALGFG RCGFLG+LHMDVI+ERL+REFN+ LI TAPSV Y   L DGT+ E+++ A++P+ +  K I+EP  KA I+ P+D++G VM+LCQ+ RG++L +  +D  R  + Y +PL+EI++ FFDKLKS ++GYA+LDYE+  Y+  DLVK+DILLNG+KVDALS I HR FA  R R+I  +LK+ IP+  FEIP+QA IG KIIAR T+ A RK+V A  YGGD TR+ KLLE+QK GKKR+KA+G V +P + F+ +L  +
  S:    10 QKYIRNFSIVAHIDHGKSTLADRILELTDTISKRDMQDQVLDDMDLERERGITIKLNAVELTYH-AKDGHDYEFHLIDTPGHVDFSYEVSRSLAACEGAVLVVDAAQGVEAQTLANVYLALDDDLEIVPVINKIDLPAADPDKVKNEIEEVIGLDASDAVLASAKQGIGIPELLEQIVTKIPAPA-GDLAAPLKALVFDSVYDDYRGVVLSIRLFEGTVKPGDKIRLMNSGSEYEVTEVGVNSPKPIARDYLIAGDVGYITASIKDITDTRVGDTVTSADQPADKALPGYREMSPMVYAGLYPTDNAKLNDLREALEKLQLNDAALEFEPESSQALGFGFRCGFLGMLHMDVIQERLEREFNLDLITTAPSVTYHAYLTDGTMKEVENPAEMPEASAIKRIEEPIVKATIMAPNDYVGAVMDLCQHRRGQFLTMEYLDDYRVNIIYNMPLSEIIFDFFDKLKSNTRGYASLDYEMNGYQGADLVKIDILLNGDKVDALSFIAHRTFAPARGREIASRLKKIIPRQNFEIPVQAAIGAKIIARTTIKAYRKDVTAHLYGGDRTRRMKLLEKQKAGKKRMKAVGKVDIPQEAFMAVLQTD 605
>gi|46397878|sp|Q98QW3|LEPA_MYCPU GTP-binding protein lepA (597 aa)
Score = 1854, Expect = 0.0e+00, Identities = 359/597 (60%), Positives = 472/597 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M+K  IRNFSI+AHIDHGKSTL+DRI+E T T++TRE+K Q LDSMD+E+ERGITIKLNAVQ+ Y      +DY FHLIDTPGHVDFTYEVSRSLAA EGALL+VDA+QG+EAQTL+N YLALENNL+I+P+INKIDLPSAD +R+K ++E+ IG+   +  L+SAK+GLN+ +++E I+++I  P+D+DD+KPL+ALVFDSY+DAY+G + LVRI  G++ V  + +F+S N+ F V  LGV TP  V K  L +GEVGWIAASI++ K +SVGDT+T   NP   +LPGYKK+  +V+ G YPID   Y + KE+LEKI LSDSS+T+E E+S+ALGFG R GFLG+LHM+V++ERL REFNI +IATAPSV YKV L +  +  + + + LPD+   K I+EPF ++ I+V ++F+G +MELCQ+ RG Y+++  +D  R K+ Y +PL+EI+  FFDKLKS SKGYA+ DYE ++YR  DLVKVDILLN  KVDA S I HRE A +RS+++ LKLK+ IPK  FEIPIQA+IG K+IARET+ A RK+V AK YGGD+TR++KLL++QKEGKKR+K+IG+V VP + F+ +L
  S:     1 MNKSKIRNFSIIAHIDHGKSTLADRILEITQTVSTRELKAQHLDSMDLEQERGITIKLNAVQIKY------KDYIFHLIDTPGHVDFTYEVSRSLAASEGALLLVDATQGIEAQTLANAYLALENNLKIIPIINKIDLPSADPERIKGEIEEVIGISAKDTILISAKSGLNVEKVLEEIVDKISYPIDADDDKPLKALVFDSYFDAYRGVILLVRIFEGKIAVNDQFKFISTNKQFHVIELGVRTPTEVKKPFLESGEVGWIAASIRDAKDVSVGDTLTLVKNPTKEALPGYKKVKAVVFTGFYPIDGKDYPVLKESLEKISLSDSSITWELESSKALGFGFRVGFLGMLHMEVLQERLKREFNIDIIATAPSVEYKVYLTNNKVEIVSNPSDLPDRNYIKNIKEPFIRSFILVTEEFIGGIMELCQSKRGVYVNIEYIDK-RVKIIYELPLSEIILDFFDKLKSISKGYASFDYEFIEYRDADLVKVDILLNKEKVDAFSFISHRENAYERSKELALKLKDVIPKQSFEIPIQAIIGAKVIARETIKAYRKDVTAKLYGGDVTRRQKLLKKQKEGKKRMKSIGSVEVPQEAFLSVL 590
>gi|184155241|ref|YP_001843581.1| GTP-binding protein LepA [Lactobacillus fermentum IFO 3956] >gi|183226585|dbj|BAG27101.1| GTP-binding protein LepA [Lactobacillus fermentum IFO 3956] (610 aa)
Score = 1854, Expect = 0.0e+00, Identities = 355/598 (59%), Positives = 466/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           ++ IRNFSIVAHIDHGKSTL+DRI+E T+T++ REMKNQILD M +ERERGITIKLNAV L YH  +D QDY FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+N YLA++N+LEI+PVINK+DLPSAD +  KKQ+ED IGLD   A  +SAKTG+N++Q++E I++ IP P   D   PL+AL+FDS YD Y+G V  VR+K G VK G KI FM++   + V+ +G+N+PK + ++ L+AG+VG++ A+IK+IK   VGDTITD  +P    L GY+++ PMVY GLYP D+ ++   ++ALEK+ L+D++LT+E E+SQALGFG RCGFLG+LHMDVI+ERL+REF++ LI TAPSV Y V L+DG+   +++ A++PD T  K I+EPF KA I+VP+D++G VMELCQ  RG++  +  +  TR  V Y IPL+EI+Y FFD+LKS ++GYA+LDYEI DYR  DLVK+DILLNG++VDALS I HR+FA +R R+I  KLK+ IP+  FEIP+QA IG KIIAR  + A RK+V A+ + GD  R+ KLL++QK GKKR+KA+G V VP   F+ +L  +
  S:    10 QQRIRNFSIVAHIDHGKSTLADRILEMTDTISKREMKNQILDDMPLERERGITIKLNAVALTYH-AQDGQDYIFHLIDTPGHVDFSYEVSRSLAACEGAILVVDATQGVEAQTLANTYLAIDNDLEILPVINKVDLPSADPEGTKKQIEDEIGLDTDEAVDISAKTGVNVDQVLEKIVQDIPAP-TGDLEAPLKALIFDSKYDDYRGVVLSVRVKEGTVKKGDKIEFMNSKAVYEVAEVGINSPKPLARDFLMAGDVGYVTAAIKDIKDARVGDTITDANHPTDKPLAGYRQMQPMVYAGLYPTDNAKFNDLRDALEKLQLNDAALTFEPESSQALGFGFRCGFLGMLHMDVIQERLEREFDLDLITTAPSVTYHVNLHDGSTRNVENPAEMPDVTEIKSIEEPFVKASIMVPNDYVGAVMELCQRKRGQFDTMEYLSDTRVNVIYHIPLSEIIYDFFDRLKSSTRGYASLDYEIDDYRPSDLVKIDILLNGDRVDALSFISHRDFAEERGREIASKLKKIIPRQNFEIPVQAAIGSKIIARTNIKAYRKDVTARIHTGDPDRRAKLLDKQKRGKKRMKAVGKVEVPQAAFMAVLQTD 605
>gi|78044431|ref|YP_359271.1| GTP-binding protein LepA [Carboxydothermus hydrogenoformans Z-2901] >gi|90185146|sp|Q3AF13|LEPA_CARHZ GTP-binding protein lepA >gi|77996546|gb|ABB15445.1| GTP-binding protein LepA [Carboxydothermus hydrogenoformans Z-2901] (603 aa)
Score = 1853, Expect = 0.0e+00, Identities = 358/595 (60%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNF I+AHIDHGKSTL+DR+IEFT  L+ RE+K Q+LD M++ERERGITIK  AV+L Y   KD   YY +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQG+EAQTL+NVYLA+E++LE++PV+NKIDLP+A+ +RV K++ED IGLD S A L SAKTG  I +++EAI+++IPPP   D+ KPL+AL+FDS+YD YKG +  +R+ +G +K G KI+ MSN++ F V+ +G+  P +   E L AGEVG+IAA IKN++   VGDTIT   NPA   LPGYK++ PMV+CGLYP++S QYE  ++ALEK+ L+D+SLT+E ETS ALGFG RCGFLGLLHM++I+ERL+RE+ + LI TAP+V+Y+V+  +G +LEID+ AKLP       I+EP+ KA I+VP +F+GN+M+LC   RG ++++  +   R  +TY +PLAEI+Y FFD+LKS SKGYA+LDYE + YR  DLVK+DIL+ G  VDALS I+H + A  R R++  KL+E IP+H FEIPIQA IG ++IARETV A+RK+VLAKCYGGD+TRKKKLLE+QKEGKKR+K IG V +P + F+ +L
  S:     5 QELIRNFCIIAHIDHGKSTLADRLIEFTGALSERELKEQVLDQMELERERGITIKAQAVKLTY-KAKDGNTYYLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGIEAQTLANVYLAMEHDLELIPVVNKIDLPNAEPERVLKEIEDVIGLDTSEAILASAKTGQGIEEVLEAIVKRIPPP-RGDEEKPLKALIFDSHYDPYKGVIAYIRLVDGFIKPGMKIKMMSNDKEFEVTEVGIFKPYLTPVEGLWAGEVGFIAAGIKNVRDCRVGDTITSAENPAKEPLPGYKQVKPMVFCGLYPVESNQYEDLRDALEKLKLNDASLTFEPETSVALGFGFRCGFLGLLHMEIIQERLEREYGLNLITTAPNVVYRVVQTNGEVLEIDNPAKLPPAGKIDHIEEPYVKATIMVPKEFVGNIMDLCIERRGVFINMEYLSENRVMLTYDLPLAEIIYDFFDQLKSRSKGYASLDYEFIGYRPGDLVKMDILIAGEPVDALSIIVHEDKAYYRGRQLVEKLRELIPRHLFEIPIQAAIGSRVIARETVKALRKDVLAKCYGGDVTRKKKLLEKQKEGKKRMKQIGRVEIPQEAFMAVL 597
>gi|160880447|ref|YP_001559415.1| GTP-binding protein LepA [Clostridium phytofermentans ISDg] >gi|189046434|sp|A9KKU4|LEPA_CLOPH GTP-binding protein lepA >gi|160429113|gb|ABX42676.1| GTP-binding protein LepA [Clostridium phytofermentans ISDg] (604 aa)
Score = 1852, Expect = 0.0e+00, Identities = 351/597 (58%), Positives = 458/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTP-KIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+K IRNF I+AHIDHGKSTL+DRIIE T  LT+REM +Q+LD+MD+ERERGITIK   V+ +Y   KD ++Y F+LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL++NL++ PVINKIDLPSAD  RV  ++ED IG++  +APL+SAK G+NI +++E I+ +IP P   D N PLQAL+FDS YD+YKG +   R+  G VK GT ++ M+   T  V  LG+  P + +  E L AG VG+I AS+KN+K   VGDT+TD  NP  T LPGYKK+ PMVYCG+YP D  +Y   ++ALEK+ L+D+SL +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAPSVIYKV   +G +LEI + + LPD +  + ++EP  KAEI+V  +F+G +M LCQ  RG YL +  ++STR  + Y +PL EI+Y FFD LKS S+GYA+ DYE+  Y   +LVK+DIL+N  +VDALS I+H E A +R R++C KLK+ IP+H FEIPIQA +G K+IARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ IGNV +P   F+ +L
  S:     4 IDQKRIRNFCIIAHIDHGKSTLADRIIEKTGLLTSREMSSQVLDNMDLERERGITIKAQTVRTVY-KAKDGEEYIFNLIDTPGHVDFNYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDHNLDVFPVINKIDLPSADPQRVIAEIEDVIGIEAQDAPLISAKNGINIEEVLEQIVSKIPAP-KGDKNAPLQALIFDSIYDSYKGVIIFCRVMEGTVKKGTTLKMMATGATADVVELGIFGPGQFIPAEELSAGMVGYITASLKNVKDTRVGDTVTDAENPCKTPLPGYKKVNPMVYCGMYPADGAKYPDLRDALEKLQLNDASLQFEPETSIALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPSVIYKVYKTNGEMLEITNPSNLPDPSEIEHMEEPMVKAEIMVTTEFVGAIMTLCQERRGIYLGMEYMESTRALLRYELPLNEIIYDFFDALKSRSRGYASFDYEMKGYVPSELVKLDILINKEEVDALSFIVHGESAYERGRRMCEKLKDEIPRHLFEIPIQAAVGSKVIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQIGNVEIPQKAFMSVL 599
>gi|167217575|ref|ZP_02287211.1| GTP-binding protein LepA [Listeria monocytogenes FSL J1-175] >gi|168265958|ref|ZP_02687923.1| GTP-binding protein LepA [Listeria monocytogenes FSL J2-071] (581 aa)
Score = 1850, Expect = 0.0e+00, Identities = 351/573 (61%), Positives = 460/573 (80%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKE 575
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT REMKNQ+LDSMD+ERERGITIKLNAVQL Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV++++ED IGLD S+A L SAK+G+ I  I+E I+E++P P   D NKPL+AL+FDS +DAY+G +  +RI +G VK G +I+ MSN + F V+ +GV +PK   ++ L+ G+VG++ A+IKN+    VGDTIT   NPA  +L GY+K+ PMVYCGLYPIDS++Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY V L DG+ + +D+ A++P+  + + ++EP+ KA ++VP+D++G VMEL QN RG ++ +  +D  R  + Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  KVDALS I+HR+FA +R + I  KLKE IP+ QFE+PIQA I  KI++R T+ A+RKNVLAKCYGGD++RK+KLLE+QKE
  S:    10 QKKIRNFSIIAHIDHGKSTLADRILEQTGALTHREMKNQLLDSMDLERERGITIKLNAVQLKY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVREEIEDVIGLDASDAVLASAKSGIGIEDILEQIVEKVPEP-SGDVNKPLKALIFDSVFDAYRGVIANIRIMDGVVKAGDRIKMMSNGKEFEVTEVGVFSPKATPRDELLVGDVGYLTAAIKNVGDTRVGDTITLANNPAEEALDGYRKLNPMVYCGLYPIDSSKYNDLRDALEKLELNDSALQFEAETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYHVNLTDGSNIVVDNPAEMPEPGVIESVEEPYVKATVMVPNDYVGAVMELAQNKRGNFITMEYLDDIRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKASKLVKMDILLNAEKVDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKIVSRSTIKALRKNVLAKCYGGDVSRKRKLLEKQKE 580
>gi|118726569|ref|ZP_01575192.1| small GTP-binding protein [Clostridium cellulolyticum H10] >gi|118664018|gb|EAV70657.1| small GTP-binding protein [Clostridium cellulolyticum H10] (602 aa)
Score = 1849, Expect = 0.0e+00, Identities = 348/595 (58%), Positives = 464/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPK-IVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +KYIRNF I+AHIDHGKSTL+DR++E T  LT+REM+ Q+LD+M++ERERGITIK  AV+++Y    D  +Y ++LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLALE+NLEI+PVINKIDLPSA  + VKK++ED IGLD S AP++SAK GLNI +++E I++ IP P ++D+  PL+AL+FDS+YD+YKG +  +R+K G +K G  IR M   + F+V+ LG   P  +   + L AG+VG+IAASIKN++   VGDTIT   NPA   LPGYKK+  MV+CG+YP D ++Y   ++AL+++ L+D++LT+E E+S ALGFG RCGFLGLLHM++I+ERL+RE+N  L+ TAPSVIY+V   DG ++EID+   LP  T    ++EP  KA I+VP +++GN+M+L Q  RG Y D+  +D  R  +TY +PL EI+Y FFD LKS +KGYA+ DYE++ Y++ DLVK+DI+LNG  VDALS I+HRE +  R R++  KLKE IP+  FEIPIQA IGGKIIARETV A RK+VL+KCYGGDI+RK+KLLE+QKEGKKR++ +G+V VP + F+ +L
  S:     6 QKYIRNFCIIAHIDHGKSTLADRLLEKTGVLTSREMQEQVLDNMELERERGITIKAQAVRMVY-KASDGHEYIYNLIDTPGHVDFNYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALEHNLEIMPVINKIDLPSAQPEVVKKEIEDVIGLDASQAPMISAKNGLNIEEVLEKIVDMIPCP-EADEKAPLRALIFDSFYDSYKGVIVYIRVKEGTLKTGDTIRLMYTKKEFLVTELGYLKPGGLSPADELKAGDVGYIAASIKNVRDTRVGDTITLVENPAKEPLPGYKKVNSMVFCGIYPADGSKYGDLRDALDRLQLNDAALTFEPESSVALGFGFRCGFLGLLHMEIIQERLEREYNFDLVTTAPSVIYRVTTTDGDVIEIDNPTNLPPVTEIDSMEEPMVKATIMVPTEYVGNIMDLSQERRGIYKDMSYIDEGRAMLTYEMPLNEIIYDFFDALKSRTKGYASFDYELVGYKESDLVKLDIMLNGEIVDALSFIVHREKSVARGRRMAEKLKESIPRQMFEIPIQACIGGKIIARETVKAFRKDVLSKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEVPQEAFMSVL 599
>gi|167766644|ref|ZP_02438697.1| hypothetical protein CLOSS21_01150 [Clostridium sp. SS2/1] >gi|167711767|gb|EDS22346.1| hypothetical protein CLOSS21_01150 [Clostridium sp. SS2/1] (603 aa)
Score = 1849, Expect = 0.0e+00, Identities = 344/597 (57%), Positives = 461/597 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNK-EVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRII+ T TLT REM+ Q+LD+MD+ERERGITIK  AV+++Y    D ++Y F+LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++++LE++PVINKIDLPSAD +RVK ++ED IG+D  +AP +SAK+GLN+ Q+++ I+E+IP P + D N PLQ L+FDS YDAYKG +   RIK G +KVGTK++ M+  E+  V  +G       N  + L AG VG++ AS+KN++   VGDTITD  +P    LPGYKK+ PMVYCGLYP D  +Y   ++ALEK+ L+D++L +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAP VIY+V   DG+++E+ + + LPD +    ++EP   AEI+V  +F+G +M LCQ  RG YL +  ++ TR  + Y +PL EI+Y FFD LKS S+GYA+LDYE+  Y+   LVK+DIL+N  +VDALS I+H + A +R RK+C KLKE IP+H FE+PIQA IG K+IARETV AMRK+VLAKCYGGDI+RK+KLLE+QK+GKKR++ +GNV +P + F+ +L
  S:     3 IDQSKIRNFCIIAHIDHGKSTLADRIIQMTGTLTDREMQEQVLDNMDLERERGITIKSQAVRIVY-KADDGEEYIFNLIDTPGHVDFNYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDHDLEVMPVINKIDLPSADPERVKAEIEDVIGIDAEDAPQISAKSGLNVEQVLKQIVEKIPSP-EGDKNAPLQGLIFDSMYDAYKGVIIFTRIKEGTIKVGTKMKMMATGESAEVVEVGTFGAGRFNPCDELTAGMVGYVTASLKNVQGTRVGDTITDADDPCAEPLPGYKKVNPMVYCGLYPTDGAKYPDLRDALEKLQLNDAALQFEAETSVALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPGVIYRVYKTDGSMIELTNPSNLPDPSEIDHMEEPIVTAEIMVTSEFVGAIMGLCQERRGVYLGMEYMEETRALLRYELPLNEIIYDFFDALKSRSRGYASLDYEMKGYQTSRLVKLDILINKEEVDALSFIVHEDTAYERGRKMCTKLKEEIPRHMFEVPIQAAIGSKVIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKKGKKRMRQVGNVEIPQEAFMSVL 598
>gi|169824481|ref|YP_001692092.1| GTP-binding protein [Finegoldia magna ATCC 29328] >gi|167831286|dbj|BAG08202.1| GTP-binding protein [Finegoldia magna ATCC 29328] (603 aa)
Score = 1847, Expect = 0.0e+00, Identities = 348/596 (58%), Positives = 463/596 (77%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           DKKY+RNFSI+AHIDHGKSTL+DR+IE T  LT REM  Q+LDSMD+ERERGITIKL A++L Y   KDN  Y  +LIDTPGHVDFTYEVSRSL ACEGA+L+VDA+QGVEAQTL NVYLA++ +LEI+PVINKIDLPSADI+  KK++ED IGLD  N P VSAK G+NI  ++E I++ +P P+  D+NKPL+AL+FDSYYD YKG V  VR+ +G +K G++I  MS N+TF V+  G  +  +++ + + AG+VG++  SIKN+K   VGDTITD  NP    L GYK++ PMVYCG+YP +   +   ++ALEK+ ++D++LT+E ETS ALGFG+RCGFLGLLHM++I+ERLDREF++ +IATAPSVIYKV   DGT +EI +    P +T    ++EP   AEI+ P D++G +MELCQ  RG ++D+  +D  R  + Y +PL E++Y F+D LKS ++GYA+LDYE++ Y K +L+K++I++N  KVDAL+ I+H + A +R+RKI  KLK+ IP+HQF IP+QA IG KIIARET+ A RK+VLAKCYGGDITRK+KLLE+QKEGKKR++++G+V VP + F+ +L
  S:     4 DKKYVRNFSIIAHIDHGKSTLADRLIEETGMLTHREMSEQVLDSMDLERERGITIKLKAIKLFY-KAKDNNVYILNLIDTPGHVDFTYEVSRSLKACEGAVLIVDATQGVEAQTLGNVYLAIDQDLEILPVINKIDLPSADINFAKKEIEDIIGLDAENVPAVSAKEGINIVDVLEDIVKNVPAPI-GDENKPLKALIFDSYYDFYKGVVVYVRVFDGCIKPGSEILMMSTNKTFEVTECGYTSSGMISTDEISAGDVGYVVCSIKNVKDARVGDTITDKNNPVDKPLEGYKQVTPMVYCGIYPAEGEDFNSVRDALEKLQVNDAALTFENETSIALGFGLRCGFLGLLHMEIIQERLDREFDLDIIATAPSVIYKVHKKDGTEIEIQNPTNFPKETEIDYVEEPVVHAEIMTPTDYVGVIMELCQGKRGTFIDMTYLDEKRVTIKYKLPLNEVIYDFYDALKSKTRGYASLDYELIGYEKSNLIKLEIMINSEKVDALTIIVHEDLAYERARKIVTKLKDEIPRHQFVIPVQAAIGNKIIARETIKAYRKDVLAKCYGGDITRKRKLLEKQKEGKKRMRSVGSVDVPQEAFLSVL 597
>gi|23099427|ref|NP_692893.1| GTP-binding protein LepA [Oceanobacillus iheyensis HTE831] >gi|33112367|sp|Q8CXD0|LEPA_OCEIH GTP-binding protein lepA >gi|22777656|dbj|BAC13928.1| GTP-binding protein (elongation factor family) [Oceanobacillus iheyensis HTE831] (602 aa)
Score = 1847, Expect = 0.0e+00, Identities = 347/595 (58%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K+ +RNFSI+AHIDHGKSTL+DRI+E T T+T REMK+Q+LD MD+ERERGITIKLNAVQL Y + K  +D+ FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA+EN+LEI+PVINKIDLPSAD ++VKK++ED +G+D  +  L SAK  + I +I+E I E +P P   D   PL+AL+FDS YD+Y+G +  V +K G +KVG KI+ M+  + F V+ +GV TPK V K+ L  G+VG++ ASIKN+    VGDTIT     A  +LPGY+++ PMV+CG+YP+D+  Y   +EALE++ L+DSSL YE ETSQALGFG RCGFLGLLHM++I+ER++REF I LI TAPSVI++V   DG +L ID+ +++PD  + ++I+EP+ +A I+VP++++G VME+ Q  RG ++D+  +D  R  V Y IPL+EI++ FFD+LKS +KGYA+ DYE++ Y++ +LVK+DILLNG+ +DALS ++HR+FA +R ++I  KLKE IP+ QFE+P+QA IG KI+AR  + A+RK+V AK YGGDITRK+KLLE+QKEGKKR+K +G+V VP + F+ +L
  S:     5 KRNVRNFSIIAHIDHGKSTLADRILENTKTVTKREMKDQLLDGMDLERERGITIKLNAVQLAYTSNK-GEDFIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAMENDLEIIPVINKIDLPSADTEKVKKELEDVLGIDGDDVILASAKANIGIEEILERITEVVPEPA-GDGEAPLKALIFDSLYDSYRGVIAYVCVKEGSIKVGDKIQMMATGKEFEVNEVGVFTPKTVVKKELHVGDVGYLTASIKNVGDSRVGDTITHANRKANEALPGYRRLNPMVFCGMYPVDTNDYNDLREALERLELNDSSLQYEPETSQALGFGYRCGFLGLLHMEIIQERIEREFGINLITTAPSVIFEVEKTDGEVLNIDNPSEMPDPQVVEQIREPYVEATIMVPNEYVGPVMEISQKKRGNFIDMQYLDDIRVNVVYHIPLSEIVFDFFDQLKSNTKGYASFDYELIGYQQSNLVKMDILLNGDTIDALSFVVHRDFAYERGKQIVEKLKELIPRQQFEVPVQAAIGNKIVARSNIKAVRKDVTAKLYGGDITRKRKLLEKQKEGKKRMKMVGSVEVPQEAFMAVL 597
>gi|187778456|ref|ZP_02994929.1| hypothetical protein CLOSPO_02050 [Clostridium sporogenes ATCC 15579] >gi|187772081|gb|EDU35883.1| hypothetical protein CLOSPO_02050 [Clostridium sporogenes ATCC 15579] (610 aa)
Score = 1844, Expect = 0.0e+00, Identities = 351/598 (58%), Positives = 463/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +KYIRNFSIVAHIDHGKSTL+DR+IE T TLT REM  Q+LD+MD+E+ERGITIK  AV+LIY      ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINKIDLPSA  + VK ++ED IG++  +APLVSAKTGLNI   +EAIIE++P P + D+  PL+AL+FDSYYD+YKG VC +R+K G +K GT+I+ M+  + + V  +GV  P  +  + L AG+VG++ ASIKN++   VGDTIT+   PA  +L GY+  +PMV+ G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHMD+I+ERL+REFN+ +I TAPSVIYK+   DGT++E+ +   +P  +  K ++EP  K+ II P D++G VM+L QN RG + D+  +D+TR  + Y IPL EI+Y FFD LKS ++GYA+ DYE++ Y+  DLVK+DILLN + VDALS I+ RE A  + R +  KLKE IP+  FEIPIQA +G KIIARET+ AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G+V VP + F+ +L  E
  S:    14 QKYIRNFSIVAHIDHGKSTLADRLIEATGTLTEREMDTQVLDNMDLEKERGITIKSQAVRLIYKR-DTGEEYTLNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKIDLPSARPEEVKHEIEDVIGIEAEDAPLVSAKTGLNIKDALEAIIEKVPAP-EGDEKAPLKALIFDSYYDSYKGVVCHIRVKEGTIKEGTEIKLMNTGKVYEVVEVGVFVPNYMPVDELKAGDVGYVTASIKNVRDARVGDTITEAKRPANEALSGYRPAVPMVFSGIYPVDGAKYEELKEALEKLQVNDAALSFEPETSIALGFGFRCGFLGLLHMDIIQERLEREFNLDIITTAPSVIYKITKTDGTLIELTNPTNMPSPSEIKLMEEPIVKSSIITPSDYVGAVMDLAQNRRGIFKDMQYLDTTRVSLNYEIPLNEIIYDFFDALKSRTRGYASFDYELIGYKDADLVKLDILLNADIVDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEVPQEAFMAVLKTE 609
>gi|163791136|ref|ZP_02185555.1| GTP-binding protein LepA [Carnobacterium sp. AT7] >gi|159873608|gb|EDP67693.1| GTP-binding protein LepA [Carnobacterium sp. AT7] (607 aa)
Score = 1843, Expect = 0.0e+00, Identities = 346/595 (58%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DRI++ T+T+  R+M+ Q+LDSMD+ERERGITIKLNA++L Y   KD + Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV+ ++ED IG+D S+A L SAK G+ I  I+E I+E++P P+  D + PL+AL+FDS YDAY+G V  +R+  G +K G  ++ MSN +TF V+ +G+ +PK + ++ L+ G+VG++ A+IK ++   VGDTIT   NPA  SL GY+K+ PMVYCG+YPIDS++Y   ++AL+K+ L+D++L +E ETSQALGFG RCGFLGLLHMDVI+ERL+REFN+ LI TAPSVIY   L DGT   + + A++P+  + + I+EP+ KA I+VP+D++G VME+ Q  RG++L +  +D  R  V Y IPL+EI+Y FFDKLKS +KGYA+LDYE++ Y+K  L K+DILLNG KVDAL  I+H++FA +R + I  +LK  IP+HQFEIP+QA IG KI+AR  + A+RK+V AK YGGD+TR++KLL++QK GKKR+K +G+V VP + F+ +L
  S:    10 QKRIRNFSIIAHIDHGKSTLADRILQMTHTVADRDMQAQLLDSMDLERERGITIKLNAIELNY-TAKDGETYTLHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEIIPVINKIDLPAADPERVRAEIEDVIGIDASDAVLASAKAGIGIEDILEQIVERVPAPV-GDTDSPLKALIFDSAYDAYRGVVLNIRVMEGMIKPGDTMKMMSNGKTFEVAEVGIFSPKPIKRDFLMVGDVGYVTANIKTVQDTRVGDTITLANNPAEESLEGYRKMTPMVYCGMYPIDSSRYGDLRDALDKLQLNDAALQFEAETSQALGFGYRCGFLGLLHMDVIQERLEREFNLDLITTAPSVIYHANLTDGTQQIVANPAEMPEPGVIESIEEPYVKATIMVPNDYVGAVMEISQRKRGDFLTMDYMDDNRVNVVYEIPLSEIVYDFFDKLKSSTKGYASLDYEMIGYKKSALSKMDILLNGEKVDALGFIVHKDFAFNRGKAIVDQLKTIIPRHQFEIPVQAAIGQKIVARSNIKALRKDVTAKLYGGDVTRRQKLLKKQKAGKKRMKQVGSVEVPQEAFMSVL 602
>gi|90961556|ref|YP_535472.1| GTP-binding protein LepA [Lactobacillus salivarius UCC118] >gi|119371361|sp|Q1WUE6|LEPA_LACS1 GTP-binding protein lepA >gi|90820750|gb|ABD99389.1| GTP-binding translation elongation factor [Lactobacillus salivarius UCC118] (609 aa)
Score = 1841, Expect = 0.0e+00, Identities = 355/598 (59%), Positives = 463/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K+IRNFSIVAHIDHGKSTL+DRI+E T+T+T REM++Q+LDSM++ERERGITIKLNAV+L YH  KD + Y FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+NVYLAL+++LEIVPVINKIDLPSAD +RV++++ED IGLD S A L SAK G+ I +++E I++ +P P D D   PL+AL+FDS YD Y+G V  +R+  G VK G KIR M++   + V  +GVN+PK + ++ L+AG+VG++ ASIK+I+   VGDT+T+  NP    L GY+++ PMVY GLYP D+ +Y   +EALEK+ L+D++L +E ETSQALGFG RCGFLGLLHMDV++ERL+REFN+ LI TAPSV Y V L DGT + + + +++P+  L K+I EP+ KAEI+VP+D++G VMELCQ  RG ++ +  +D  R  V Y IPL+EI++ FFDKLKS ++GYA+LDYE+   R  DLVK+DILLNG+KVDALS I HR+FA  R R I  KLK  IP+  FEIPIQA IG KIIAR  + A RK+V A+ + GD  R+ KLL++QK GKKR+KA+G V VP   F+ +L  +
  S:    10 QKHIRNFSIVAHIDHGKSTLADRILEMTDTVTKREMQDQLLDSMELERERGITIKLNAVELHYH-AKDGETYIFHLIDTPGHVDFSYEVSRSLAACEGAVLVVDAAQGVEAQTLANVYLALDDDLEIVPVINKIDLPSADPERVRQEIEDVIGLDASEAVLASAKKGIGIEEMLEQIVQNVPAP-DGDLEAPLKALIFDSVYDDYRGVVLSIRVVEGTVKPGDKIRLMNSGAEYEVVEVGVNSPKPLKRDFLMAGDVGYLTASIKDIQDTRVGDTVTNANNPTAKPLEGYREMNPMVYSGLYPTDNAKYNDLREALEKLQLNDAALEFEPETSQALGFGFRCGFLGLLHMDVVQERLEREFNMDLITTAPSVTYDVELTDGTHINVSNPSEMPETPLIKQINEPYVKAEIMVPNDYVGAVMELCQRKRGTFVTMDYLDDYRVNVIYEIPLSEIIFDFFDKLKSSTRGYASLDYELDGTRPSDLVKIDILLNGDKVDALSFISHRQFAQARGRVIVDKLKTIIPRQNFEIPIQAAIGAKIIARTNIKAYRKDVTARIHTGDPDRRAKLLDKQKRGKKRMKAVGTVDVPQAAFMAVLKTD 605
>gi|13508018|ref|NP_109967.1| GTP-binding protein LepA [Mycoplasma pneumoniae M129] >gi|1674255|gb|AAB96204.1| GTP-binding membrane protein LepA [Mycoplasma pneumoniae M129] (581 aa)
Score = 1840, Expect = 0.0e+00, Identities = 346/574 (60%), Positives = 445/574 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQK 574
           M+++ IRNFSI+AHIDHGKSTLSDR+IE +     R ++ Q+LD+M IERERGITIKLNAVQL     + NQ Y FHL+DTPGHVDFTYEVSRSLAACEG LL+VDA+QG++AQT+SN YLALENNLEI+PVINK+D+ SAD+++ K+     +G+D +  PLVSAKTGL I+Q++  IIE++PPP   D++KPL+AL+FDSYYD YKG VC +RI  G +K+  KIRF  +N  + +  LG+  P    ++VL AGE+GW +A IK ++ ++VGDTI    +  T  LPGYKK+LPM+YCGLYPID+  Y+  K A+EKI LSD +L YEYETSQALGFG+RCGFLGLLHMDVI+ERL+RE+N+ LI+  PSV YKVLL +G  LE+D+ + LP+++  K I EPF +  I +PD +LG V++LCQN+RG+Y  L  +D  RK++ YL+PL EI+YSFFDKLKS +KGYA+L+YE   Y+   L KV+I+LN  KVDALS I H +FA  R++K C+KLKE IPKH FEIPIQA IG K+IARET+ A+RK+V AK YGGD+TRKKKLLE+ K
  S:     1 MEQQKIRNFSIIAHIDHGKSTLSDRLIERSIGFEKRLLQAQMLDTMAIERERGITIKLNAVQL--KMAQGNQQYLFHLVDTPGHVDFTYEVSRSLAACEGVLLLVDATQGIQAQTISNTYLALENNLEIIPVINKVDMESADVEKTKQAFHQLLGVDPNTIPLVSAKTGLGIDQLITTIIEKVPPP-KGDESKPLKALLFDSYYDPYKGVVCFIRIFEGSLKLNDKIRFARSNSVYQIVELGIKNPFFEKQDVLKAGEIGWFSAGIKKLRDVTVGDTIVHAEDTTTPPLPGYKKVLPMIYCGLYPIDNNDYQNLKMAMEKIILSDVALEYEYETSQALGFGVRCGFLGLLHMDVIKERLEREYNLKLISAPPSVRYKVLLTNGEELELDNPSLLPERSRIKSISEPFVRVYIDLPDHYLGTVIDLCQNFRGQYEKLEEIDIDRKRLVYLMPLGEIIYSFFDKLKSITKGYASLNYEFDQYQVSQLAKVEIMLNKQKVDALSFIAHHDFAFQRAKKFCVKLKELIPKHLFEIPIQATIGSKVIARETIKAVRKDVTAKLYGGDVTRKKKLLEKTK 571
>gi|28378650|ref|NP_785542.1| GTP-binding protein LepA [Lactobacillus plantarum WCFS1] >gi|33112361|sp|Q88VN0|LEPA1_LACPL GTP-binding protein lepA 1 >gi|28271486|emb|CAD64391.1| GTP-binding translation elongation factor LepA [Lactobacillus plantarum WCFS1] (611 aa)
Score = 1840, Expect = 0.0e+00, Identities = 351/598 (58%), Positives = 469/598 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +++IRNFSIVAHIDHGKSTL+DRI+E T+T++ REM++Q+LDSMD+ERERGITIKLNAV+L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QGVEAQTL+NVYLA++++LEIVPVINKIDLPSA+ ++V+K++ED IG+D  +A L SAK G+ I  ++E I+ +IP P   D + PL+ALVFDS YD Y+G V  VRI  G V+ G +IR M++   + V+ +GVN+PK + ++ L+AG+VG+I ASIK+I+   VGDT+T+  NPA   L GY+++ PMVY G+YP D+ ++   +EALEK+ L+D++L +E E+SQALGFG RCGFLGLLHMDVI+ERL+REFN+ LI TAPSV Y V + DGT  ++++ A++P+ +  KEI+EP+ KA+I+VP+D++G VMEL Q  RGE+  +  +DS R  V Y IPL+EI++ FFDKLKS ++GYA+LDY++  YR  DLVK+DILLNG++VDALS I HR+FA  R R+I  KLK  IP+  FEIP+QA IG K+IAR  + A RK+V A  YGGD TR+ KLLE+QK GKKR+KA+G V +P + F+ +L  +
  S:    10 QQHIRNFSIVAHIDHGKSTLADRILELTDTISKREMQDQVLDSMDLERERGITIKLNAVELHYQ-AKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGVEAQTLANVYLAIDDDLEIVPVINKIDLPSAEPEKVRKEIEDDIGIDAEDAVLASAKAGIGIEDLLEQIVHKIPAP-QGDLDAPLKALVFDSVYDDYRGVVLSVRIHEGIVRPGDRIRLMNSGSEYEVTEVGVNSPKPLARDYLMAGDVGYITASIKDIQDTRVGDTVTNAKNPAEKPLAGYREMNPMVYAGIYPTDNAKFTDLREALEKLKLNDAALEFEAESSQALGFGFRCGFLGLLHMDVIQERLEREFNLELITTAPSVTYHVRMTDGTEKKVENPAEMPEASAIKEIREPYVKAQIMVPNDYVGAVMELAQRKRGEFDTMEYLDSNRVNVVYHIPLSEIIFDFFDKLKSNTRGYASLDYDLDGYRASDLVKIDILLNGDQVDALSFIAHRDFAPARGREIAAKLKTIIPRQNFEIPVQATIGSKVIARTNIKAYRKDVTAHLYGGDRTRRMKLLEKQKAGKKRMKAVGKVEIPQEAFMAVLKTD 605
>gi|194467757|ref|ZP_03073743.1| GTP-binding protein LepA [Lactobacillus reuteri 100-23] >gi|194452610|gb|EDX41508.1| GTP-binding protein LepA [Lactobacillus reuteri 100-23] (611 aa)
Score = 1838, Expect = 0.0e+00, Identities = 352/598 (58%), Positives = 465/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K+IRNFSIVAHIDHGKSTL+DRI+E T++++ REMKNQILD M +ERERGITIKLNAV L YH  KD +DY FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+NV+LAL+N+LEI+PVINKIDLPSAD +  KKQ+ED IGLD   A  +SAKTG+ +++++E I++ +P P   D   PL+AL+FDS YD Y+G V  VR+  G VK G +I+ M+    + V+ +G+N+PK + ++VL+AG+VG+I A+IK+IK   VGDT+T   NP    L GY+++ PMVY GLYP D+ ++   ++ALEK+ L+D++LT+E E+SQALGFG RCGFLGLLHMDVI+ERL+REFN+ LI TAPSV Y V L DGT  E+++ A++PD +  K I+EP+ +A I+VP+D++G VMELCQ  RG++  +  +  TR  V Y IPL+EI++ FFDKLKS ++GYA+LDYEI  YR  +LVK+DILLNG+KVDALS I HR+FA++R R+I  KLK+ IP+  FEIPIQA IG KIIAR  + A RK+V A+ + GD  R+ KLL++QK GKKR+KA+G V +P   F+ +L  +
  S:    10 QKHIRNFSIVAHIDHGKSTLADRILEMTDSISKREMKNQILDDMPLERERGITIKLNAVALTYH-AKDGEDYIFHLIDTPGHVDFSYEVSRSLAACEGAVLVVDATQGVEAQTLANVFLALDNDLEILPVINKIDLPSADPEGTKKQIEDEIGLDTDEAVDISAKTGMGVDEVLEKIVKDVPAP-TGDLTAPLKALIFDSKYDDYRGVVLSVRVVEGTVKKGDRIKLMNGGTEYEVAEVGINSPKPLARDVLMAGDVGYITAAIKDIKDTRVGDTVTSADNPTDKPLEGYRQMTPMVYAGLYPTDNAKFNDLRDALEKLQLNDAALTFEPESSQALGFGFRCGFLGLLHMDVIQERLEREFNLDLITTAPSVTYHVELADGTTKEVENPAEMPDASSIKAIKEPYVRASIMVPNDYVGPVMELCQRKRGDFDTMEYLSDTRVNVIYHIPLSEIIFDFFDKLKSSTRGYASLDYEIDGYRPSNLVKIDILLNGDKVDALSFIAHRDFAAERGREITAKLKKIIPRQNFEIPIQAAIGSKIIARTNIKAYRKDVTARIHTGDPDRRAKLLDKQKRGKKRMKAVGKVDIPQAAFMAVLKTD 605
>gi|148543940|ref|YP_001271310.1| GTP-binding protein LepA [Lactobacillus reuteri F275] >gi|184153336|ref|YP_001841677.1| GTP-binding translation elongation factor LepA [Lactobacillus reuteri F275] >gi|166987753|sp|A5VJE9|LEPA_LACRF GTP-binding protein lepA >gi|148530974|gb|ABQ82973.1| GTP-binding protein LepA [Lactobacillus reuteri F275] >gi|183224680|dbj|BAG25197.1| GTP-binding translation elongation factor LepA [Lactobacillus reuteri F275] (611 aa)
Score = 1836, Expect = 0.0e+00, Identities = 352/598 (58%), Positives = 465/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K+IRNFSIVAHIDHGKSTL+DRI+E T++++ REMKNQILD M +ERERGITIKLNAV L YH  KD +DY FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+NV+LAL+N+LEI+PVINKIDLPSAD +  KKQ+ED IGLD   A  +SAKTG+ +++++E I++ +P P   D   PL+AL+FDS YD Y+G V  VR+  G VK G +I+ M+    + V+ +G+N+PK + ++VL+AG+VG+I A+IK+IK   VGDT+T   NP    L GY+++ PMVY GLYP D+ ++   ++ALEK+ L+D++LT+E E+SQALGFG RCGFLGLLHMDVI+ERL+REFN+ LI TAPSV Y V L DGT  E+++ A++PD +  K I+EP+ +A I+VP+D++G VMELCQ  RG++  +  +  TR  V Y IPL+EI++ FFDKLKS ++GYA+LDYEI  YR  +LVK+DILLNG+KVDALS I HR+FA++R R+I  KLK+ IP+  FEIPIQA IG KIIAR  + A RK+V A+ + GD  R+ KLL++QK GKKR+KA+G V +P   F+ +L  +
  S:    10 QKHIRNFSIVAHIDHGKSTLADRILEMTDSISKREMKNQILDDMPLERERGITIKLNAVALTYH-AKDGEDYIFHLIDTPGHVDFSYEVSRSLAACEGAVLVVDATQGVEAQTLANVFLALDNDLEILPVINKIDLPSADPEGTKKQIEDEIGLDPDEAVDISAKTGMGVDEVLEKIVKDVPAP-TGDLTAPLKALIFDSKYDDYRGVVLSVRVVEGTVKKGDRIKLMNGGTEYEVAEVGINSPKPLARDVLMAGDVGYITAAIKDIKDTRVGDTVTSADNPTDKPLEGYRQMTPMVYAGLYPTDNAKFNDLRDALEKLQLNDAALTFEPESSQALGFGFRCGFLGLLHMDVIQERLEREFNLDLITTAPSVTYHVELADGTTKEVENPAEMPDASSIKAIKEPYVRASIMVPNDYVGPVMELCQRKRGDFDTMEYLSDTRVNVIYHIPLSEIIFDFFDKLKSSTRGYASLDYEIDGYRPSNLVKIDILLNGDKVDALSFIAHRDFAAERGREITAKLKKIIPRQNFEIPIQAAIGSKIIARTNIKAYRKDVTARIHTGDPDRRAKLLDKQKRGKKRMKAVGKVDIPQAAFMAVLKTD 605
>gi|168181649|ref|ZP_02616313.1| GTP-binding protein LepA [Clostridium botulinum Bf] >gi|182675136|gb|EDT87097.1| GTP-binding protein LepA [Clostridium botulinum Bf] (602 aa)
Score = 1832, Expect = 0.0e+00, Identities = 349/598 (58%), Positives = 461/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +KYIRNFSIVAHIDHGKSTL+DR+IE T TLT REM  Q+LD+MD+E+ERGITIK  AV+LIY      ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINKIDLPSA  + VK+++ED IG++   APLVSAKTGLNI   +EAI+ ++P P D D+  PL+AL+FDSYYD+YKG VC +R+K G +K GT+I+ M+  + + V  +GV  P  +  + L AG+VG++ ASIKN++   VGDTIT+    A  +L GY+  +PMV+ G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHMD+I+ERL+REFN+ +I TAPSVIYK+   DGT++E+ +   +P  +  K ++EP  K+ II P D++G VM+L QN RG + D+  +D+TR  + Y IPL EI+Y FFD LKS ++GYA+ DYE++ Y+  DLVK+DILLN + VDALS I+ RE A  + R +  KLKE IP+  FEIPIQA +G KIIARET+ AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G+V VP + F+ +L  E
  S:     6 QKYIRNFSIVAHIDHGKSTLADRLIEATGTLTEREMDTQVLDNMDLEKERGITIKSQAVRLIYKR-DTGEEYTLNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKIDLPSARPEEVKQEIEDVIGIEAEGAPLVSAKTGLNIKDALEAIVNKVPAP-DGDEKAPLKALIFDSYYDSYKGVVCHIRVKEGTIKEGTEIKLMNTGKVYEVVEVGVFVPNYMPVDELKAGDVGYVTASIKNVRDARVGDTITEAKRSANEALSGYRPAVPMVFSGIYPVDGAKYEELKEALEKLQVNDAALSFEPETSIALGFGFRCGFLGLLHMDIIQERLEREFNLDIITTAPSVIYKITKTDGTLIELTNPTNMPSPSEIKLMEEPIVKSSIITPSDYVGAVMDLAQNRRGIFKDMQYLDTTRVSLNYEIPLNEIIYDFFDALKSRTRGYASFDYELIGYKDADLVKLDILLNADIVDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEVPQEAFMAVLKTE 601
>gi|159029649|emb|CAO87727.1| lepA [Microcystis aeruginosa PCC 7806] (603 aa)
Score = 1831, Expect = 0.0e+00, Identities = 340/592 (57%), Positives = 462/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  REMK Q LD+MD+ERERGITIKL A ++ Y   KD Q Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLPSA+ +RV  ++E+ +GLDCS A   SAK G+ IN I+E+I++ +PPP D+ + +P +AL+FDSYYDAY+G +   R+ +G+VK G KIRFM++ + F++  LG+ +P+ V    L AGEVG++AA+IK +    VGDTIT  A PA   LPGY +  PMV+CGL+P D+ QY   K+ALEK+ L+D++L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   DG I+E+D+ + LP     ++I+EP+ + E+I P+ ++G +MELCQ+ RG + D+     TR  + Y +PLAE++  FFD+LKS S+GYA+++Y+++ YR+ +LVK+DI++NG+ VDAL+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG KIIA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQITGTVAQREMKEQFLDNMDLERERGITIKLQAARMDY-TAKDGQKYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPSAEPERVAAEIEEVVGLDCSEAIRASAKAGIGINDILESIVQLVPPPQDTLE-EPFRALIFDSYYDAYRGVIVYFRVMDGRVKKGDKIRFMASGKEFVIDELGILSPQQVQVNELHAGEVGYLAAAIKTVADARVGDTITLTAKPAQEPLPGYTEAKPMVFCGLFPTDADQYADLKDALEKLKLNDAALSYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVVYRVTTTDGEIVEVDNPSLLPSPQKREKIEEPYIQVEMITPETYVGALMELCQSRRGVFKDMRYFTKTRTALIYELPLAEVVTDFFDQLKSRSRGYASMEYQLIGYRENELVKLDIMVNGDPVDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKIIASEHIPALRKDVLAKCYGGDISRKKKLLDKQAKGKKRMKAIGTVDVPQEAFMAVL 598
>gi|148380915|ref|YP_001255456.1| GTP-binding protein LepA [Clostridium botulinum A str. ATCC 3502] >gi|153932212|ref|YP_001385223.1| GTP-binding protein LepA [Clostridium botulinum A str. ATCC 19397] >gi|153937382|ref|YP_001388692.1| GTP-binding protein LepA [Clostridium botulinum A str. Hall] >gi|168179394|ref|ZP_02614058.1| GTP-binding protein LepA [Clostridium botulinum NCTC 2916] >gi|166223187|sp|A7FXL9|LEPA_CLOB1 GTP-binding protein lepA >gi|166223188|sp|A5I644|LEPA_CLOBH GTP-binding protein lepA >gi|148290399|emb|CAL84526.1| GTP-binding protein [Clostridium botulinum A str. ATCC 3502] >gi|152928256|gb|ABS33756.1| GTP-binding protein LepA [Clostridium botulinum A str. ATCC 19397] >gi|152933296|gb|ABS38795.1| GTP-binding protein LepA [Clostridium botulinum A str. Hall] >gi|182669506|gb|EDT81482.1| GTP-binding protein LepA [Clostridium botulinum NCTC 2916] (602 aa)
Score = 1831, Expect = 0.0e+00, Identities = 349/598 (58%), Positives = 462/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +KYIRNFSIVAHIDHGKSTL+DR+IE T TLT REM  Q+LD+MD+E+ERGITIK  AV+LIY      ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINKIDLPSA  + VK+++ED IG++  +APLVSAKTGLNI   +EAI+ ++P P D D+  PL+AL+FDSYYD+YKG VC +R+K G +K GT+I+ M+  + + V  +GV  P  +  + L AG+VG++ ASIKN++   VGDTIT+    A  +L GY+  +PMV+ G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHMD+I+ERL+REFN+ +I TAPSVIYK+   DGT++E+ +   +P  +  K ++EP  K+ II P D++G VM+L QN RG + D+  +D+TR  + Y IPL EI+Y FFD LKS ++GYA+ DYE++ Y+  DLVK+DILLN + VDALS I+ RE A  + R +  KLKE IP+  FEIPIQA +G KIIARET+ AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G+V VP + F+ +L  E
  S:     6 QKYIRNFSIVAHIDHGKSTLADRLIEATGTLTEREMDTQVLDNMDLEKERGITIKSQAVRLIYKR-DTGEEYTLNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKIDLPSARPEEVKQEIEDVIGIEAEDAPLVSAKTGLNIKDALEAIVNKVPAP-DGDEKAPLKALIFDSYYDSYKGVVCHIRVKEGAIKEGTEIKLMNTGKVYEVVEVGVFVPNYMPVDELKAGDVGYVTASIKNVRDARVGDTITEAKRSANEALSGYRPAVPMVFSGIYPVDGAKYEELKEALEKLQVNDAALSFEPETSIALGFGFRCGFLGLLHMDIIQERLEREFNLDIITTAPSVIYKITKTDGTLIELTNPTNMPSPSEIKLMEEPIVKSSIITPSDYVGAVMDLAQNRRGIFKDMQYLDTTRVSLNYEIPLNEIIYDFFDALKSRTRGYASFDYELIGYKDADLVKLDILLNADVVDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEVPQEAFMAVLKTE 601
>gi|153938751|ref|YP_001392240.1| GTP-binding protein LepA [Clostridium botulinum F str. Langeland] >gi|170756691|ref|YP_001782596.1| GTP-binding protein LepA [Clostridium botulinum B1 str. Okra] >gi|166223189|sp|A7GHI0|LEPA_CLOBL GTP-binding protein lepA >gi|152934647|gb|ABS40145.1| GTP-binding protein LepA [Clostridium botulinum F str. Langeland] >gi|169121903|gb|ACA45739.1| GTP-binding protein LepA [Clostridium botulinum B1 str. Okra] (602 aa)
Score = 1830, Expect = 0.0e+00, Identities = 348/598 (58%), Positives = 462/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +KYIRNFSIVAHIDHGKSTL+DR+IE T TLT REM  Q+LD+MD+E+ERGITIK  AV+LIY      ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINKIDLPSA  + VK+++ED IG++  +APLVSAKTGLNI   +EAI+ ++P P + D+  PL+AL+FDSYYD+YKG VC +R+K G +K GT+I+ M+  + + V  +GV  P  +  + L AG+VG++ ASIKN++   VGDTIT+    A  +L GY+  +PMV+ G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHMD+I+ERL+REFN+ +I TAPSVIYK+   DGT++E+ +   +P  +  K ++EP  K+ II P D++G VM+L QN RG + D+  +D+TR  + Y IPL EI+Y FFD LKS ++GYA+ DYE++ Y+  DLVK+DILLN + VDALS I+ RE A  + R +  KLKE IP+  FEIPIQA +G KIIARET+ AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G+V VP + F+ +L  E
  S:     6 QKYIRNFSIVAHIDHGKSTLADRLIEATGTLTEREMDTQVLDNMDLEKERGITIKSQAVRLIYKR-NTGEEYTLNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKIDLPSARPEEVKQEIEDVIGIEAEDAPLVSAKTGLNIKDALEAIVNKVPAP-EGDEKAPLKALIFDSYYDSYKGVVCHIRVKEGTIKEGTEIKLMNTGKVYEVVEVGVFVPNYMPVDELKAGDVGYVTASIKNVRDARVGDTITEAKRSANEALSGYRPAVPMVFSGIYPVDGAKYEELKEALEKLQVNDAALSFEPETSIALGFGFRCGFLGLLHMDIIQERLEREFNLDIITTAPSVIYKITKTDGTLIELTNPTNMPSPSEIKLMEEPIVKSSIITPSDYVGAVMDLAQNRRGIFKDMQYLDTTRVSLNYEIPLNEIIYDFFDALKSRTRGYASFDYELIGYKDADLVKLDILLNADVVDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEVPQEAFMAVLKTE 601
>gi|12044990|ref|NP_072800.1| GTP-binding protein LepA [Mycoplasma genitalium G37] >gi|1346441|sp|P47384|LEPA_MYCGE GTP-binding protein lepA >gi|3844728|gb|AAC71355.1| GTP-binding protein LepA [Mycoplasma genitalium G37] >gi|166078784|gb|ABY79402.1| GTP-binding protein LepA [synthetic Mycoplasma genitalium JCVI-1.0] (598 aa)
Score = 1829, Expect = 0.0e+00, Identities = 354/600 (59%), Positives = 470/600 (78%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           M++K IRNFSI+AHIDHGKSTLSDR++E +     R ++ Q+LD+M+IERERGITIKLNAV+L  +   DN +Y FHLIDTPGHVDFTYEVSRSLAACEG LL+VDA+QG++AQT+SN YLALENNLEI+PVINKID+ +ADI+  K  + + +G++ ++  LVSAK  L I+Q+++ II +IPPP   + N+PL+AL+FDSYYD YKG VC +R+ +G +KV  K+RF+ +N  + +  LGV TP    ++ L AG+VGW +A IK ++ + VGDTI    +  T  L GYKKILPM+YCGLYP+D++ Y+  K A+EKI +SD++L YEYETSQALGFG+RCGFLGLLHMDVI+ERL+RE+N+ LI+  PSV+YKVLL +G  + ID+ + LP+++  K I EPF K  I +PD +LG+V++LCQN+RG+Y  L  +D  RK++ YL+PL EI+YSFFDKLKS SKGYA+L+YE  +Y+   L KV+I+LN  K+DALS I H++FA  R++K C KLKE IPKH FEIPIQA IG K+IARET+ A+RK+V+AK YGGD++RKKKLLE+QKEGKKRLKA+G+V +P + F  +L +E
  S:     1 MEQKNIRNFSIIAHIDHGKSTLSDRLLEHSLGFEKRLLQAQMLDTMEIERERGITIKLNAVELKIN--VDNNNYLFHLIDTPGHVDFTYEVSRSLAACEGVLLLVDATQGIQAQTISNAYLALENNLEIIPVINKIDMDNADIETTKDSLHNLLGVEKNSICLVSAKANLGIDQLIQTIIAKIPPP-KGEINRPLKALLFDSYYDPYKGVVCFIRVFDGCLKVNDKVRFIKSNSVYQIVELGVKTPFFEKRDQLQAGDVGWFSAGIKKLRDVGVGDTIVSFDDQFTKPLAGYKKILPMIYCGLYPVDNSDYQNLKLAMEKIIISDAALEYEYETSQALGFGVRCGFLGLLHMDVIKERLEREYNLKLISAPPSVVYKVLLTNGKEISIDNPSLLPERSKIKAISEPFVKVFIDLPDQYLGSVIDLCQNFRGQYESLNEIDINRKRICYLMPLGEIIYSFFDKLKSISKGYASLNYEFYNYQHSQLEKVEIMLNKQKIDALSFISHKDFAFKRAKKFCTKLKELIPKHLFEIPIQATIGSKVIARETIKAVRKDVIAKLYGGDVSRKKKLLEKQKEGKKRLKAVGSVQLPQELFSHLLKDE 597
>gi|166366725|ref|YP_001658998.1| GTP-binding protein LepA [Microcystis aeruginosa NIES-843] >gi|189046446|sp|B0JQT7|LEPA_MICAN GTP-binding protein lepA >gi|166089098|dbj|BAG03806.1| GTP-binding protein [Microcystis aeruginosa NIES-843] (603 aa)
Score = 1829, Expect = 0.0e+00, Identities = 340/592 (57%), Positives = 462/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  REMK Q LD+MD+ERERGITIKL A ++ Y   KD Q Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLPSA+ +RV  ++E+ +GLDCS A   SAK G+ IN I+E+I++ +PPP D+ + +P +AL+FDSYYDAY+G +   R+ +G+VK G KIRFM++ + F++  LG+ +P+ V    L AGEVG++AA+IK +    VGDTIT  A PA   LPGY +  PMV+CGL+P D+ QY   K+ALEK+ L+D++L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   DG I+E+D+ + LP     ++I+EP+ + E+I P+ ++G +MELCQ+ RG + D+     TR  + Y +PLAE++  FFD+LKS S+GYA+++Y+++ YR+ +LVK+DI++NG+ VDAL+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG KIIA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQITGTVAQREMKEQFLDNMDLERERGITIKLQAARMDY-TAKDGQKYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPSAEPERVAAEIEEVVGLDCSEAIRASAKAGIGINDILESIVQLVPPPQDTLE-EPFRALIFDSYYDAYRGVIVYFRVMDGRVKKGDKIRFMASGKEFVIDELGILSPQQVQVNELHAGEVGYLAAAIKTVADARVGDTITLTAKPAQEPLPGYTEAKPMVFCGLFPTDADQYADLKDALEKLKLNDAALSYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVVYQVTTTDGEIVEVDNPSLLPSPQKREKIEEPYIQVEMITPETYVGALMELCQSRRGVFKDMRYFTKTRTALIYELPLAEVVTDFFDQLKSRSRGYASMEYQLIGYRENELVKLDIMVNGDPVDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKIIASEHIPALRKDVLAKCYGGDISRKKKLLDKQAKGKKRMKAIGTVDVPQEAFMAVL 598
>gi|15924575|ref|NP_372109.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus Mu50] >gi|15927165|ref|NP_374698.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus N315] >gi|49483832|ref|YP_041056.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486419|ref|YP_043640.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus MSSA476] >gi|82751188|ref|YP_416929.1| GTP-binding protein LepA [Staphylococcus aureus RF122] >gi|148268068|ref|YP_001247011.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus JH9] >gi|150394137|ref|YP_001316812.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus JH1] >gi|156979903|ref|YP_001442162.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus Mu3] >gi|166224529|sp|A7X2Y7|LEPA_STAA1 GTP-binding protein lepA >gi|189046458|sp|A6U257|LEPA_STAA2 GTP-binding protein lepA >gi|189046459|sp|A5ITB2|LEPA_STAA9 GTP-binding protein lepA >gi|54037724|sp|P65272|LEPA_STAAN GTP-binding protein lepA >gi|54041426|sp|P65271|LEPA_STAAM GTP-binding protein lepA >gi|56748967|sp|Q6G8Y3|LEPA_STAAS GTP-binding protein lepA >gi|56749021|sp|Q6GGB6|LEPA_STAAR GTP-binding protein lepA >gi|119371401|sp|Q2YT42|LEPA_STAAB GTP-binding protein lepA >gi|13701383|dbj|BAB42677.1| GTP-binding protein [Staphylococcus aureus subsp. aureus N315] >gi|14247356|dbj|BAB57747.1| GTP-binding protein [Staphylococcus aureus subsp. aureus Mu50] >gi|49241961|emb|CAG40656.1| putative GTP-binding protein [Staphylococcus aureus subsp. aureus MRSA252] >gi|49244862|emb|CAG43323.1| putative GTP-binding protein [Staphylococcus aureus subsp. aureus MSSA476] >gi|82656719|emb|CAI81146.1| GTP binding protein protein [Staphylococcus aureus RF122] >gi|147741137|gb|ABQ49435.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus JH9] >gi|149946589|gb|ABR52525.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus JH1] >gi|156722038|dbj|BAF78455.1| GTP-binding protein [Staphylococcus aureus subsp. aureus Mu3] (607 aa)
Score = 1829, Expect = 0.0e+00, Identities = 345/595 (57%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T ++ TR+M++Q+LDSMD+ERERGITIKLNAV+L Y   KD   Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N LE++PVINKIDLP+A+ +RVK+++ED IGLD  +  L SAK+ + I +I+E I+E +P P D D   PL+AL+FDS YD Y+G +  +RI +G VK G KIR M+  + F V+ +G+NTPK +  + L  G+VG+I ASIKN+    VGDTIT  + PA+  L GYKK+ PMVYCGL+PID+  Y   +EALEK+ L+D+SL +E E+SQALGFG R GFLG+LHM++I+ER++REF I LIATAPSVIY+ +L DG+ + +D+ A++PD+    +I EP+ +A ++VP+D++G VMELCQ  RG+++++  +D  R  + Y +PLAE+++ FFD+LKS +KGYA+ DYE ++ ++ +LVK+DILLNG+KVDALS I+HR+FA +R + +  KLK  IP+ QFE+P+QA IG KI+AR  + +M KNVLAKCYGGDI+RK+KLLE+QK GK ++KA+GNV +P D F+ +L
  S:    10 RENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERGITIKLNAVRLKYE-AKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEEILEKIVEVVPAP-DGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKEFEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKMNPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEIIQERIEREFGIELIATAPSVIYQCILRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVPNDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDYEFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLAVL 602
>gi|167746555|ref|ZP_02418682.1| hypothetical protein ANACAC_01265 [Anaerostipes caccae DSM 14662] >gi|167653515|gb|EDR97644.1| hypothetical protein ANACAC_01265 [Anaerostipes caccae DSM 14662] (603 aa)
Score = 1829, Expect = 0.0e+00, Identities = 341/597 (57%), Positives = 461/597 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGV-NTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRII+ T TLT REM+ Q+LD+MD+ERERGITIK  AV+++Y   ++ ++Y F+LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+++LEI+PVINKIDLPSAD +RVK ++ED IG++  +APL+SAK G+NI  ++E I+ +IP P   D   PLQ L+FDS YDAYKG +   RIK G ++ GTK++ M++     V  +G+    + +  E L AG VG++ AS+KN++  +VGDTITD  NP +  LPGYKK+ PMV+CGLYP D  +Y   ++ALEK+ L+D+SL +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAP V+Y+V   DGT++E+ + + LPD +    ++EP   AEI+V  D++G +M LCQ  RG Y+ +  ++  R  + Y +PL EI+Y FFD LKS S+GYA+LDYE+  Y++ +LVK+DIL+N  +VDALS I+H E A +R RK+C KLKE IP+H FEIPIQA +G KIIARETV AMRK+VLAKCYGGDI+RK+KLLE+QK+GKKR++ +GNV +P + F+ +L
  S:     3 IDQSKIRNFCIIAHIDHGKSTLADRIIQKTGTLTDREMQEQVLDNMDLERERGITIKSQAVRIVY-KAENGEEYIFNLIDTPGHVDFNYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLALDHDLEIMPVINKIDLPSADPERVKTEIEDVIGIEAEDAPLISAKNGINIEDVLEQIVMKIPAP-SGDPEGPLQGLIFDSIYDAYKGVIIFARIKEGTIRPGTKMKMMASGAVAEVVEVGIFGAGQFIPSEELSAGMVGYVTASLKNVQDTTVGDTITDADNPCSEPLPGYKKVNPMVFCGLYPTDGAKYPDLRDALEKLQLNDASLQFEPETSVALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPGVVYRVYKTDGTMIELTNPSNLPDPSQIDYMEEPIVSAEIMVTSDYVGAIMGLCQERRGVYIGMEYIEEGRAVLRYELPLNEIIYDFFDALKSRSRGYASLDYEMKGYQRSELVKLDILINKEEVDALSFIVHAETAYERGRKMCSKLKEEIPRHLFEIPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKQGKKRMRQVGNVEIPQEAFMSVL 598
>gi|57651977|ref|YP_186481.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus COL] >gi|87161992|ref|YP_494239.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus USA300] >gi|88195394|ref|YP_500198.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|151221699|ref|YP_001332521.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus str. Newman] >gi|161509813|ref|YP_001575472.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727825|ref|ZP_02760102.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|172048914|sp|A6QHC7|LEPA_STAAE GTP-binding protein lepA >gi|189046460|sp|A8Z4C4|LEPA_STAAT GTP-binding protein lepA >gi|71153804|sp|Q5HFH6|LEPA_STAAC GTP-binding protein lepA >gi|119371399|sp|Q2FGD9|LEPA_STAA3 GTP-binding protein lepA >gi|119371400|sp|Q2FXY7|LEPA_STAA8 GTP-binding protein lepA >gi|57286163|gb|AAW38257.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus COL] >gi|87127966|gb|ABD22480.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|87202952|gb|ABD30762.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|150374499|dbj|BAF67759.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus str. Newman] >gi|160368622|gb|ABX29593.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus USA300_TCH1516] (607 aa)
Score = 1828, Expect = 0.0e+00, Identities = 345/595 (57%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T ++ TR+M++Q+LDSMD+ERERGITIKLNAV+L Y   KD   Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N LE++PVINKIDLP+A+ +RVK+++ED IGLD  +  L SAK+ + I +I+E I+E +P P D D   PL+AL+FDS YD Y+G +  +RI +G VK G KIR M+  + F V+ +G+NTPK +  + L  G+VG+I ASIKN+    VGDTIT  + PA+  L GYKK+ PMVYCGL+PID+  Y   +EALEK+ L+D+SL +E E+SQALGFG R GFLG+LHM++I+ER++REF I LIATAPSVIY+ +L DG+ + +D+ A++PD+    +I EP+ +A ++VP+D++G VMELCQ  RG+++++  +D  R  + Y +PLAE+++ FFD+LKS +KGYA+ DYE ++ ++ +LVK+DILLNG+KVDALS I+HR+FA +R + +  KLK  IP+ QFE+P+QA IG KI+AR  + +M KNVLAKCYGGDI+RK+KLLE+QK GK ++KA+GNV +P D F+ +L
  S:    10 RENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERGITIKLNAVRLKYE-AKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEEILEKIVEVVPAP-DGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKEFEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKMNPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEIIQERIEREFGIELIATAPSVIYQCVLRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVPNDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDYEFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLAVL 602
>gi|167040706|ref|YP_001663691.1| GTP-binding protein LepA [Thermoanaerobacter sp. X514] >gi|166854946|gb|ABY93355.1| GTP-binding protein LepA [Thermoanaerobacter sp. X514] (603 aa)
Score = 1828, Expect = 0.0e+00, Identities = 357/594 (60%), Positives = 469/594 (78%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +YIRNF I+AHIDHGKSTL+DR+IE T  L+ RE   QILD++++ERERGITIKL  V++IY   KD  +Y  +LIDTPGHVDFTYEVSRS+AACEGALLVVDA+QG+EAQTL+NVY+ALE++LEIVPVINKIDLPSA+ + VKK++ED IG+D  +A L SAK G+ I +++EAI+ +IPPP   D+NKPL+AL+FDS+YD YKGA+  VR+ +G VK G +I+  S  + F V+ +G+  P +   E L AGEVG+IAASIKN+K   VGDTITD  NPA   LPGYK+++PMV+CG+YP D   YE  KEALEK+ L+D+SL +E +TS ALGFG RCGFLGLLHM++++ERL+RE+N+ L+ TAPSVIYKV   +G +L++D+  K+P  T    I+EP  +A I+VP +++G VMELCQ+ RG YL +  ++ TR  + Y +PL EI+Y FFD LKS ++GYA+ DYE+  Y++ +LVK+DIL+NG  VDALS I+H++ A +++RKI  KLKE+IP+H FEIPIQA IG KIIARETV A+RKNVLAKCYGGD+TRKKKLLE+QKEGKKR++ +G+V +P + F+ IL
  S:     6 QYIRNFCIIAHIDHGKSTLADRLIEKTGFLSERETDKQILDNLELERERGITIKLKPVRMIY-KAKDGNEYELNLIDTPGHVDFTYEVSRSIAACEGALLVVDATQGIEAQTLANVYMALEHDLEIVPVINKIDLPSANPEHVKKEIEDVIGIDAEDALLTSAKEGIGIEEVLEAIVNRIPPP-KGDENKPLKALIFDSFYDNYKGAISFVRVVDGIVKPGMRIKMFSTGKVFEVTEVGMFRPNLYPVEELKAGEVGYIAASIKNVKDTRVGDTITDADNPADFPLPGYKEVVPMVFCGIYPADGQDYENLKEALEKLQLNDASLVFEPDTSAALGFGFRCGFLGLLHMEIVQERLEREYNLNLVTTAPSVIYKVYKTNGEVLDLDNPTKMPPPTQIDHIEEPIVEATIMVPTEYVGAVMELCQDRRGAYLGMEYLEQTRVLLKYEMPLNEIIYDFFDALKSRTRGYASFDYELKGYKESNLVKLDILINGELVDALSMIVHKDKAYEKARKIVEKLKENIPRHLFEIPIQAAIGSKIIARETVKALRKNVLAKCYGGDVTRKKKLLEKQKEGKKRMRQVGSVEIPQEAFMSIL 597
>gi|193216454|ref|YP_001999696.1| translation factor LepA [Mycoplasma arthritidis 158L3-1] >gi|193001777|gb|ACF06992.1| translation factor LepA [Mycoplasma arthritidis 158L3-1] (600 aa)
Score = 1827, Expect = 0.0e+00, Identities = 361/600 (60%), Positives = 476/600 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           M    IRNF+I+AHIDHGKSTL+DRI+EFT+T++ RE K QILDSM++E+ERGITIKLNAVQ+ Y      +DY FHLIDTPGHVDFTYEVSRSLAACEGALL+VDA+QG++AQTL+NVYLA+E++LEI+P+INKIDLPSAD +RVK ++E+ IG+D SNA L+SAKTG NI++++EAIIE++P P ++D  KPL+AL+FDSY+D Y+G V L RI NG+VKVG +I FM   +++ V+ LGV  P  V K+ L AGEVGWI+ASI+++K +SVGDT+T   N  TT LPGYKK+ P+VY G YP+D+  Y   K+ALEKI LSDSS+ +E ETS+ALGFG R GFLGLLHMDV++ERL+REFN+ +IATAPSV + V L +G +  I + +  PD++  K I+EPF KA I + D++LG +MELCQ  RG+Y+D+  +D  R+K+ Y +PL EI++ FFD +KS SKGYA+ +Y+ +  R+ DLVKVDILLNG K+DAL+ I+HR+FA ++SR +  KLKE IP+  FEIP+QA IG KIIARET+ + RK+V AK YGGD+TR++KLL++QK GKKR+K+IG V VP + F+ IL  +
  S:     1 MTNDKIRNFAIIAHIDHGKSTLADRILEFTSTVSARESKAQILDSMELEQERGITIKLNAVQIKY------KDYIFHLIDTPGHVDFTYEVSRSLAACEGALLLVDATQGIQAQTLANVYLAMEHDLEIIPIINKIDLPSADPERVKAEIENIIGIDASNAILISAKTGANIDKVIEAIIEKVPCPKEADSTKPLEALIFDSYFDNYRGVVILTRIFNGEVKVGDEIYFMQTKKSYFVTELGVKNPNEVKKDKLSAGEVGWISASIRDVKDVSVGDTLTLANNKLTTPLPGYKKLKPVVYTGFYPVDTRDYNDLKDALEKISLSDSSIVWEPETSKALGFGFRIGFLGLLHMDVLQERLEREFNLDIIATAPSVEFVVTLTNGDVQYITNPSLFPDRSTIKSIEEPFIKASIFLSDEYLGAIMELCQQKRGKYIDIEYIDDHRRKLIYELPLNEIIFDFFDLMKSYSKGYASFEYDFIGLRESDLVKVDILLNGEKIDALAMIVHRDFAYNKSRDLTEKLKEVIPRQNFEIPVQAAIGAKIIARETIKSYRKDVTAKLYGGDVTRRQKLLKKQKLGKKRMKSIGTVEVPQEAFLAILKTD 594
>gi|21283265|ref|NP_646353.1| GTP-binding protein LepA [Staphylococcus aureus subsp. aureus MW2] >gi|24211899|sp|Q8NWA7|LEPA_STAAW GTP-binding protein lepA >gi|21204705|dbj|BAB95401.1| GTP-binding protein [Staphylococcus aureus subsp. aureus MW2] (607 aa)
Score = 1827, Expect = 0.0e+00, Identities = 344/595 (57%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T ++ TR+M++Q+LDSMD+ERERGITIKLNAV+L Y   KD   Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N LE++PVINKIDLP+A+ +RVK+++ED IGLD  +  L SAK+ + I +I+E I+E +P P D D   PL+AL+FDS YD Y+G +  +RI +G VK G KIR M+  + F V+ +G+NTPK +  + L  G+VG+I ASIKN+    VGDTIT  + PA+  L GYKK+ PMVYCGL+PID+  Y   +EALEK+ L+D+SL +E E+SQALGFG R GFLG+LHM++I+ER++REF I LIATAPSVIY+ +L DG+ + +D+ A++PD+    +I EP+ +A ++VP+D++G VMELCQ  RG+++++  +D  R  + Y +PLAE+++ FFD+LKS +KGYA+ DYE ++ ++ +LVK+DILLNG+KVDALS I+HR+FA +R + +  KLK  IP+ QFE+P+QA IG KI+AR  + +M KNVLAKCYGGDI+RK+KLLE+QK GK ++KA+GN+ +P D F+ +L
  S:    10 RENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERGITIKLNAVRLKYE-AKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEEILEKIVEVVPAP-DGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKEFEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKMNPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEIIQERIEREFGIELIATAPSVIYQCILRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVPNDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDYEFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNIEIPQDAFLAVL 602
>gi|146296755|ref|YP_001180526.1| GTP-binding protein LepA [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|166223179|sp|A4XKA0|LEPA_CALS8 GTP-binding protein lepA >gi|145410331|gb|ABP67335.1| GTP-binding protein LepA [Caldicellulosiruptor saccharolyticus DSM 8903] (602 aa)
Score = 1826, Expect = 0.0e+00, Identities = 359/595 (60%), Positives = 463/595 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTP-KIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNF I+AHIDHGKSTL+DRIIE T  L+ REM++Q+LD+M+IERERGITIK  AV+L Y   KD ++Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLALE+NLEI+PVINKIDLPSA  D VKK++ED IGLD S+APL+SAK G+NI +++E I+  IPPP   DD KPL+AL+FDS YD YKG +  VR+ +G VK    I+ MS    F V+ +G   P  ++  E L AG+VG+IAASIK ++   VGDTITD  NPA   LPG++K+ PMV+CG+YP   T+YE  KEALEK+ L+D++L +E E+S ALGFG RCGFLGLLHM++++ERL+RE+++ +I TAPSV+Y+V   +G +L ID+  KLP      +++EP  KA I+VP++++G +MELCQ  RG + D+  +++TR  +TY +PL EI+Y FFD LKS SKGYA+ DYE + Y + +LVK+DI++ G  VDALS I+HR+ A  R+RKI  KLKE IP+H FEIPIQA IG K+IARETV A+RK+VLAKCYGGD+TRKKKLLE+QKEGKKR+K IG V +P + F+ +L  E
  S:     8 IRNFCIIAHIDHGKSTLADRIIELTGALSEREMQDQVLDTMEIERERGITIKAQAVRLNY-KAKDGKEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDATQGIEAQTLANVYLALEHNLEIIPVINKIDLPSARPDEVKKEIEDVIGLDASDAPLISAKQGINIEEVLERIVRDIPPP-KGDDTKPLKALIFDSLYDNYKGVLAYVRVFDGVVKPNMTIKMMSTGAQFTVTEVGYFKPGMLIPCEELRAGDVGYIAASIKTVRDTRVGDTITDANNPADEPLPGFRKLNPMVFCGIYPTGDTKYEELKEALEKLQLNDAALFFEPESSAALGFGFRCGFLGLLHMEIVQERLEREYDLNIITTAPSVVYRVTKTNGEVLYIDNPTKLPPPNEIDKMEEPMVKATIMVPNEYVGAIMELCQERRGIFKDMSYIETTRVILTYEMPLMEIVYDFFDALKSRSKGYASFDYEFIGYAESNLVKLDIMIKGEVVDALSFIVHRDKAYQRARKIVEKLKEEIPRHLFEIPIQACIGSKVIARETVKALRKDVLAKCYGGDVTRKKKLLEKQKEGKKRMKQIGEVEIPQEAFMAVLKLE 601
>gi|167037806|ref|YP_001665384.1| GTP-binding protein LepA [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166856640|gb|ABY95048.1| GTP-binding protein LepA [Thermoanaerobacter pseudethanolicus ATCC 33223] (603 aa)
Score = 1825, Expect = 0.0e+00, Identities = 355/594 (59%), Positives = 470/594 (79%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +YIRNF I+AHIDHGKSTL+DR+IE T  L+ RE   QILD++++ERERGITIKL  V++IY   KD  +Y  +LIDTPGHVDFTYEVSRS+AACEGALLVVDA+QG+EAQTL+NVY+ALE++LEIVPVINKIDLPSA+ + VKK++ED IG+D  +A L SAK G+ I +++EAI+ +IPPP   D+NKPL+AL+FDS+YD YKGA+  VR+ +G VK G +I+  S  + F V+ +G+  P +   E L +GEVG+IAASIKN+K   VGDTITD  NPA + LPGYK+++PMV+CG+YP D   YE  KEALEK+ L+D+SL +E +TS ALGFG RCGFLGLLHM++++ERL+RE+N+ L+ TAPSVIYKV   +G +L++D+  K+P  T    I+EP  +A I+VP +++G +MELCQ+ RG YL +  ++ TR  + Y +PL EI+Y FFD LKS ++GYA+ DYE+  Y++ +LVK+DIL+NG  VDALS I+H++ A +++RKI  KLKE+IP+H FEIPIQA IG KIIARETV A+RKNVLAKCYGGD+TRKKKLLE+QKEGKKR++ +G+V +P + F+ IL
  S:     6 QYIRNFCIIAHIDHGKSTLADRLIEKTGFLSERETDKQILDNLELERERGITIKLKPVRMIY-KAKDGNEYELNLIDTPGHVDFTYEVSRSIAACEGALLVVDATQGIEAQTLANVYMALEHDLEIVPVINKIDLPSANPEHVKKEIEDVIGIDAEDALLTSAKEGIGIEEVLEAIVNRIPPP-KGDENKPLKALIFDSFYDNYKGAISFVRVVDGIVKPGMRIKMFSTGKVFEVTEVGMFRPNLYPVEELKSGEVGYIAASIKNVKDTRVGDTITDADNPADSPLPGYKEVVPMVFCGIYPADGQDYENLKEALEKLQLNDASLVFEPDTSAALGFGFRCGFLGLLHMEIVQERLEREYNLNLVTTAPSVIYKVYKTNGEVLDLDNPTKMPPPTQIDHIEEPIVEATIMVPTEYVGAIMELCQDRRGVYLGMEYLEQTRVLLKYEMPLNEIIYDFFDALKSRTRGYASFDYELKGYKESNLVKLDILINGELVDALSMIVHKDKAYEKARKIVEKLKENIPRHLFEIPIQAAIGSKIIARETVKALRKNVLAKCYGGDVTRKKKLLEKQKEGKKRMRQVGSVEIPQEAFMSIL 597
>gi|170761067|ref|YP_001788276.1| GTP-binding protein LepA [Clostridium botulinum A3 str. Loch Maree] >gi|169408056|gb|ACA56467.1| GTP-binding protein LepA [Clostridium botulinum A3 str. Loch Maree] (602 aa)
Score = 1825, Expect = 0.0e+00, Identities = 347/598 (58%), Positives = 461/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +KYIRNFSIVAHIDHGKSTL+DR+IE T TLT REM  Q+LD+MD+E+ERGITIK  AV+LIY      ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINKIDLPSA  + VK+++ED IG++  +APLVSAKTGLNI   +EAI+ ++P P   D+  PL+AL+FDSYYD+YKG VC +R+K G ++ GT+I+ M+  + + V  +GV  P  +  + L AG+VG++ ASIKN++   VGDTIT+    A  +L GY+  +PMV+ G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHMD+I+ERL+REFN+ +I TAPSVIYK+   DGT++E+ +   +P  +  K ++EP  K+ II P D++G VM+L QN RG + D+  +D+TR  + Y IPL EI+Y FFD LKS ++GYA+ DYE++ Y+  DLVK+DILLN + VDALS I+ RE A  + R +  KLKE IP+  FEIPIQA +G KIIARET+ AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G+V VP + F+ +L  E
  S:     6 QKYIRNFSIVAHIDHGKSTLADRLIEATGTLTEREMDTQVLDNMDLEKERGITIKSQAVRLIYKR-DTGEEYTLNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKIDLPSARPEEVKQEIEDVIGIEAEDAPLVSAKTGLNIKDALEAIVSKVPAPY-GDEKAPLKALIFDSYYDSYKGVVCHIRVKEGTIREGTEIKLMNTGKVYEVVEVGVFVPNYMPVDELKAGDVGYVTASIKNVRDARVGDTITEAKRSANEALSGYRPAVPMVFSGIYPVDGAKYEELKEALEKLQVNDAALSFEPETSIALGFGFRCGFLGLLHMDIIQERLEREFNLDIITTAPSVIYKITKTDGTLIELTNPTNMPSPSEIKLMEEPIVKSSIITPSDYVGAVMDLAQNRRGIFKDMQYLDTTRVSLNYEIPLNEIIYDFFDALKSRTRGYASFDYELIGYKDADLVKLDILLNADVVDALSMIVPRERAYAKGRNMAQKLKEIIPRQMFEIPIQAAVGAKIIARETIKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEVPQEAFMAVLKTE 601
>gi|51891620|ref|YP_074311.1| GTP-binding protein LepA [Symbiobacterium thermophilum IAM 14863] >gi|60389955|sp|Q67S76|LEPA_SYMTH GTP-binding protein lepA >gi|51855309|dbj|BAD39467.1| elongation factor family GTP-binding protein [Symbiobacterium thermophilum IAM 14863] (603 aa)
Score = 1825, Expect = 0.0e+00, Identities = 336/600 (56%), Positives = 463/600 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +D+++IRNF I+AHIDHGKSTL+DR+IEFT  LT REM +Q+LD+M++ERERGITIK  +V++ Y    D + Y  +LIDTPGHVDFTYEVSR+LAACEGALLVVDASQG+EAQTL+NVY+ALE++LEI+PVINKIDLP+AD ++VKK++E+ IGLD S A L SAKTG+ + +I+EA++  +PPP   D   PL+AL++DS+YD+YKG +   RI  G V+ G +IRFM+  + FIV  L +  P +   E L AGEVG +AA+I+ +K + VGDTIT   NPA   LPGY+K  PMV+ GLYP+++  Y   ++ALEK+ L+D+SL++E ETS+ALGFG RCGFLGLLHMDVI+ERL+REF++ LI TAP+V+Y+V +  G  + I++ A  PD +  + ++EP  +A II P +++G +MELCQ+ RG +L++  ++  R  + Y +PLAEIMY FFD+LK+ S+GYA+ DYE+  Y   D+VK+DIL++G  VDALS I+HRE A    R +  KL++ IP+H FE+PIQA +G KI+ARE ++ +RK+VLAKCYGGD+TRK+KLLE+QKEGKKR+KA+G+V +P + F+ +LS +
  S:     2 VDQRHIRNFCIIAHIDHGKSTLADRLIEFTGVLTKREMTDQVLDNMELERERGITIKAQSVRMDY-VADDGEQYVLNLIDTPGHVDFTYEVSRALAACEGALLVVDASQGIEAQTLANVYMALEHDLEIIPVINKIDLPAADPEKVKKEIEEVIGLDTSIAILASAKTGIGMKEILEAVVNFVPPP-KGDRRAPLRALIYDSFYDSYKGVITYFRIFEGTVRKGDRIRFMATGKEFIVDELYIFRPGLTPVEELTAGEVGALAATIREVKHVRVGDTITLADNPAAEPLPGYRKATPMVFTGLYPVETNDYGRLRDALEKLQLNDASLSFEPETSEALGFGFRCGFLGLLHMDVIQERLEREFDLNLITTAPNVVYRVNMTSGEQIMIENPANWPDPSKIESVEEPVVRASIITPTEYVGPLMELCQDRRGTFLNMEYLNEKRVNLHYKLPLAEIMYDFFDQLKTRSRGYASFDYEVTGYEPSDMVKMDILVHGQPVDALSCIVHREKAQKLGRALVQKLRKLIPRHLFEVPIQAAVGNKILARENIAPLRKDVLAKCYGGDVTRKRKLLEKQKEGKKRMKAVGSVEIPQEAFMAVLSTD 599
>gi|73662482|ref|YP_301263.1| GTP-binding protein LepA [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|90185211|sp|Q49Y26|LEPA_STAS1 GTP-binding protein lepA >gi|72494997|dbj|BAE18318.1| putative GTPase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (607 aa)
Score = 1821, Expect = 0.0e+00, Identities = 342/595 (57%), Positives = 465/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DRI+E T ++ TR+M++Q+LDSMD+ERERGITIKLNAV+L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LE++PVINKIDLP+A+ +RVK+++ED IG+D  +  L SAK+ + I  I+E I+E +PPP + D   PL+AL+FDS YD Y+G +  +R+  G VK G +I+ M+  + F V+ +G+NTPK ++ + L  G+VG+I ASIKN+    VGDTIT    PA   L GYKK+ PMV+CGL+PID+  Y   +EALEK+ L+D+SL +E E+SQALGFG R GFLG+LHM++I+ER++REF I LIATAPSVIY+ +L  G  + +D+ A +PD+   + I EPF +A ++VP+D++G VMELCQ  RG+++++  +D  R  + Y IPL+E+++ FFD+LKS +KGYA+ DYE +D ++ DLVK+DILLNG KVDALS I+H+EFA +R + +  KLK  IP+ QFE+P+QA +G KI+AR  + +M KNVL+KCYGGDITRK+KLLE+QK GK ++KA+GNV +P D F+ +L
  S:    10 RKNIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQSQLLDSMDLERERGITIKLNAVRLKYE-AKDGETYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLELLPVINKIDLPAAEPERVKQELEDVIGIDKEDVVLASAKSNIGIEDILEKIVEVVPPP-EGDPEAPLKALIFDSEYDPYRGVISSIRVMEGVVKAGDRIKMMATGKEFEVTEVGINTPKQLSVDELTVGDVGYIIASIKNVDDSRVGDTITHAERPAEAPLQGYKKMNPMVFCGLFPIDNKDYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEIIQERIEREFGIELIATAPSVIYQCILKSGEEVSVDNPANMPDRDKIETIYEPFVRATMMVPNDYVGAVMELCQRKRGQFINMEYMDDIRVNIIYEIPLSEVVFDFFDQLKSNTKGYASFDYEFIDNKESDLVKMDILLNGEKVDALSFIVHKEFAYERGKTLVDKLKTLIPRQQFEVPVQAAVGQKIVARTNIKSMGKNVLSKCYGGDITRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLAVL 602
>gi|188589078|ref|YP_001920249.1| GTP-binding protein LepA [Clostridium botulinum E3 str. Alaska E43] >gi|188499359|gb|ACD52495.1| GTP-binding protein LepA [Clostridium botulinum E3 str. Alaska E43] (600 aa)
Score = 1820, Expect = 0.0e+00, Identities = 358/595 (60%), Positives = 465/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +KYIRNFSIVAHIDHGKSTL+DR++E T TLT REM+ QILD+MDIERERGITIK  A +L+Y   ++ ++Y F+LIDTPGHVDFTYEVSRSLAACEGALLVVDA+QG++AQTL+N YLAL+N+LEI PVINKIDLPSA  + VK+++ED IG+D  NAP++SAKTGLNI Q++E+I+E +PPP + D+  PL+AL+FDSYYD+YKG V +VR+ +G+VK G KI+ M+ N+ + V+ +GV  P  +    L AG+VG+I ASIKN++   VGDTIT+ + P   +LPGYK  +PMVY G+YP+D  +Y+  KEALEK+ ++D++L +E ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIYKV   +G + +I +   LP  T    ++EP  KA II P D++G VMELCQ  RG Y+D+  ++ TR  +TY +PL EI+Y FFD LKS ++GYA+LDYE   Y+   LVK+DILLNG+ VDALS I+  E A  + R I  KLKE IP+  FE+PIQA IG KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +G+V VP + F+ +L
  S:     5 QKYIRNFSIVAHIDHGKSTLADRLLETTGTLTKREMEEQILDNMDIERERGITIKSQAARLVYRR-ENGEEYIFNLIDTPGHVDFTYEVSRSLAACEGALLVVDATQGIQAQTLANCYLALDNDLEISPVINKIDLPSARPEEVKQEIEDVIGIDAENAPMISAKTGLNIEQVLESIVETLPPP-NGDEEAPLKALIFDSYYDSYKGVVSIVRVLDGKVKPGDKIKLMATNKVYDVTEVGVFIPSALAVPELSAGDVGYITASIKNVRDARVGDTITEASRPTEKALPGYKPAIPMVYSGIYPVDGAKYDELKEALEKLQINDAALNFEPETSIALGFGFRCGFLGLLHMEIIQERVEREFNLDIITTAPSVIYKVTKTNGEVFDITNPTNLPPMTEIDFMEEPVVKASIITPTDYVGAVMELCQERRGIYIDMEYIEETRAVITYDMPLNEIVYDFFDTLKSRTRGYASLDYEFKGYKTTKLVKLDILLNGDVVDALSMIVPDERAYSKGRGIAEKLKEIIPRQMFEVPIQAAIGSKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQVGSVEVPQEAFMAVL 597
>gi|71894501|ref|YP_278609.1| GTP-binding protein LepA [Mycoplasma synoviae 53] >gi|90185161|sp|Q4A5S3|LEPA_MYCS5 GTP-binding protein lepA >gi|71851289|gb|AAZ43898.1| GTP-binding protein LepA [Mycoplasma synoviae 53] (605 aa)
Score = 1819, Expect = 0.0e+00, Identities = 350/597 (58%), Positives = 472/597 (79%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMS----NNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M K  I+ FSI+AHIDHGKSTL+DRI+E TNT++ RE+ NQ LDSM++E+ERGI+IKLNAVQL Y      +DY F LIDTPGHVDFTYEVSRSLAA EGALL+VDA+QG++AQTL+NVYLA+EN LEI+PVINK+DLPSAD+DRVK+++ED IG+  ++A  VSAKTG  ++++++AI+E +P PLD+DD KPL+AL+FDSY+D Y+G V L+RIK G++KVG K  FMS     + T+ V  LGV  P    KE L +GEVGW++A+I++ K ISVGDTIT   NPA  +LPGYKKI  +V+ G YPID+  Y   KE+LEKI LSDSS+ +E ETS+ALGFG R GFLGLLHM++++ERLDRE+N+ +IATAPSV YK+   +G I  + +   +PD++  ++I+EP+ +A + +P++++GN+MELCQ+ RG Y+ L  +D  R K+ Y +PL+E +  FFDK+KS +KG+A+ +YE++ Y++ DLVKVDILLNG KVDA S I H++ A + +R++C+KLK+ IP+  FEIP+QA IGGKIIARET+ A RK+V AK YGGD+TRK+KLL++QK GKKR+K IG++ VP + F+ IL
  S:     1 MQKNKIKTFSIIAHIDHGKSTLADRILELTNTVSKRELTNQFLDSMELEKERGISIKLNAVQLKY------KDYIFQLIDTPGHVDFTYEVSRSLAASEGALLIVDATQGIQAQTLANVYLAIENKLEIIPVINKVDLPSADVDRVKQEIEDVIGIPTNSAIEVSAKTGFGVDKLLDAIVEYVPSPLDADDLKPLKALIFDSYFDPYRGVVLLIRIKEGKLKVGDKFMFMSRKHDESNTYHVIELGVKNPSETKKEFLESGEVGWVSAAIRDAKEISVGDTITHIDNPAKEALPGYKKIKAVVFTGFYPIDTKDYVQLKESLEKISLSDSSIVWEQETSKALGFGFRVGFLGLLHMEILQERLDREYNVGIIATAPSVEYKIFKTNGEIEFVSNPTMMPDRSTIEKIEEPYIEATVFIPNEYIGNLMELCQSKRGIYISLEALDDKRSKIVYELPLSETILDFFDKMKSYTKGFASFEYELIGYKESDLVKVDILLNGEKVDAFSIIAHKDKAYEHARELCIKLKDEIPRQNFEIPVQATIGGKIIARETIKAYRKDVTAKLYGGDVTRKQKLLKKQKAGKKRMKKIGSIEVPQEAFLNIL 595
>gi|166032760|ref|ZP_02235589.1| hypothetical protein DORFOR_02475 [Dorea formicigenerans ATCC 27755] >gi|166027117|gb|EDR45874.1| hypothetical protein DORFOR_02475 [Dorea formicigenerans ATCC 27755] (604 aa)
Score = 1819, Expect = 0.0e+00, Identities = 351/597 (58%), Positives = 463/597 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNN-ETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF IVAHIDHGKSTL+DRIIE T  LT+REM+ Q+LD+MD+ERERGITIK  AV+ +Y   KD ++Y F+LIDTPGHVDF YEVSRSLAAC+GA+LVVDA+QGVEAQTL+NVYLAL+++L+++PVINKIDLPSA+ DRV +++ED IG++  +APL+SAKTGLN++Q++E I+E+IP P   D   PL+AL+FDS YD+YKG +   R++ G VK GTKIR M+   E  +V        + +  + L AG VG+I AS+KN+    VGDTITD ANP    LPGYKK+ PMVYCGLYP D  +Y   ++ALEK+ L+D+SL +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAP VIYKV   +G ++E+ + + LPD +  + ++EP  KAEI+V  +F+G +M+LCQ  RGEYL +  ++ TR  + Y +PL EI+Y FFD LKS S+GYA+ DYE+  Y++ +LVK+DIL+N  +VDALS I+H + A +R RK+C KLKE IP+  FEIPIQA IGGKIIARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +GNV +P   F+ +L
  S:     4 IDQSKIRNFCIVAHIDHGKSTLADRIIEQTGLLTSREMQAQVLDNMDLERERGITIKAQAVRTVY-KAKDGEEYIFNLIDTPGHVDFNYEVSRSLAACDGAILVVDAAQGVEAQTLANVYLALDHDLDVMPVINKIDLPSAEPDRVIEEIEDIIGIEAHDAPLISAKTGLNVDQVLEQIVEKIPAP-GGDPKAPLKALIFDSLYDSYKGVIVFCRLREGTVKKGTKIRMMATGAEADVVEVGYFGAGQFIPCDELEAGMVGYITASLKNVGDTRVGDTITDAANPCEEPLPGYKKVNPMVYCGLYPADGAKYPDLRDALEKLQLNDASLQFEPETSIALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPGVIYKVYKTNGDVIELTNPSNLPDPSEIEYMEEPMVKAEIMVTSEFIGTIMDLCQERRGEYLGMEYIEETRAVLHYRLPLNEIIYDFFDALKSRSRGYASFDYEMDGYQRSELVKLDILVNKEEVDALSFIVHADTAYERGRKMCEKLKEEIPRQLFEIPIQAAIGGKIIARETVRAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGNVEIPQKAFMSVL 599
>gi|27468189|ref|NP_764826.1| GTP-binding protein LepA [Staphylococcus epidermidis ATCC 12228] >gi|57867041|ref|YP_188728.1| GTP-binding protein LepA [Staphylococcus epidermidis RP62A] >gi|33112366|sp|Q8CP13|LEPA_STAES GTP-binding protein lepA >gi|71153805|sp|Q5HNW2|LEPA_STAEQ GTP-binding protein lepA >gi|27315735|gb|AAO04870.1|AE016748_104 GTP-binding protein [Staphylococcus epidermidis ATCC 12228] >gi|57637699|gb|AAW54487.1| GTP-binding protein LepA [Staphylococcus epidermidis RP62A] (607 aa)
Score = 1819, Expect = 0.0e+00, Identities = 342/595 (57%), Positives = 469/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T ++ TREM++Q+LDSMD+ERERGITIKLNAV+L Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LE++PV+NKIDLP+A+ DRVK+++ED IG+D  +  L SAK+ + I +I+E I++ +P P D D   PL+AL+FDS YD Y+G +  +RI +G VK G +I+ M+  + F V+ +G+NTPK +  E L  G+VG+I ASIKN+    VGDTIT    PA   L GYKK+ PMV+CGL+PID+  Y   +EALEK+ L+D+SL +E E+SQALGFG R GFLG+LHM++I+ER++REF I LIATAPSVIY+ +L DG+ + +D+ A++P++   + I EPF KA ++VP+D++G VMELCQ  RG+++++  +D  R  + Y IPL+E+++ FFD+LKS +KGYA+ DYE ++ ++ +LVK+DILLNG+KVDALS I+HR+FA +R + +  KLK  IP+ QFE+P+QA IG KI+AR  + +M KNVL+KCYGGDI+RK+KLLE+QK GK ++KA+GNV +P D F+ +L
  S:    10 RENIRNFSIIAHIDHGKSTLADRILENTKSVETREMQDQLLDSMDLERERGITIKLNAVRLKYE-AKDGETYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLELLPVVNKIDLPAAEPDRVKQELEDVIGIDQEDVVLASAKSNIGIEEILEKIVDVVPAP-DGDPEAPLKALIFDSEYDPYRGVISSIRIIDGVVKAGDRIKMMATGKEFEVTEVGINTPKQLPVEELTVGDVGYIIASIKNVDDSRVGDTITLAERPADKPLQGYKKMNPMVFCGLFPIDNKDYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEIIQERIEREFGIELIATAPSVIYQCILKDGSEVSVDNPAQMPERDKIEHIYEPFVKATMMVPNDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYEIPLSEVVFDFFDQLKSNTKGYASFDYEFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLSKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLAVL 602
>gi|163816739|ref|ZP_02208102.1| hypothetical protein COPEUT_02929 [Coprococcus eutactus ATCC 27759] >gi|158447996|gb|EDP24991.1| hypothetical protein COPEUT_02929 [Coprococcus eutactus ATCC 27759] (604 aa)
Score = 1818, Expect = 0.0e+00, Identities = 341/597 (57%), Positives = 458/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGV-NTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRIIE T TLT+REM+NQ+LD+MD+ERERGITIK   V++IY N  D ++Y F+LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++++L+++PVINKIDLPSAD +RV  ++ED IG++  +AP +SAK G+NI +++E I+ +IP P   D N PL+AL+FDS YD+YKG +   R+ +G V  GT IR M+      V  +G+    + V  + L AG VG+I AS+KN+K  +VGDT+T    P   +LPGYKK  PMVYCGLYP D  +Y   ++ALEK+ L+D++L++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ L+ TAP V+YKV   DG ++E+ + + LPD +  + ++EPF  AEI+V  +F+G +M+LCQ  RG Y  +  ++ TR  + Y +PL EI+Y FFD LKS S+GYA+ DYE+  Y + +LVK+DIL+N  +VDALS I+H++ A +R RK+C KLKE IP+H FEIPIQA IG K+IARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +GNV +P   F+ +L
  S:     4 IDQSKIRNFCIIAHIDHGKSTLADRIIEKTGTLTSREMQNQVLDNMDLERERGITIKAQCVRIIY-NASDGEEYIFNLIDTPGHVDFNYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDHDLDVMPVINKIDLPSADPERVVNEIEDVIGIEAQDAPRISAKNGINIEEVLEQIVTKIPAP-HGDPNAPLKALIFDSLYDSYKGVIIFCRVFDGCVSRGTVIRMMATEAEAEVVEVGIFGAGRFVPCDELSAGMVGYITASLKNVKDTTVGDTVTQADMPCAEALPGYKKAQPMVYCGLYPADGAKYPDLRDALEKLQLNDAALSFEPETSIALGFGFRCGFLGLLHLEIIQERLEREFNLDLVTTAPGVVYKVHTTDGNVIELTNPSNLPDPSSIEYMEEPFVSAEIMVTTEFVGAIMQLCQERRGVYKSMEYMEETRALLKYDLPLNEIIYDFFDALKSRSRGYASFDYEMKGYVRSELVKLDILINKEEVDALSFIIHQDTAYERGRKMCEKLKEEIPRHLFEIPIQAAIGNKVIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGNVEIPQKAFMSVL 599
>gi|182418294|ref|ZP_02949589.1| GTP-binding protein LepA [Clostridium butyricum 5521] >gi|182377676|gb|EDT75220.1| GTP-binding protein LepA [Clostridium butyricum 5521] (601 aa)
Score = 1817, Expect = 0.0e+00, Identities = 355/595 (59%), Positives = 468/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +++IRNFSIVAHIDHGKSTL+DR++E T TLT REM+ Q+LD+M+IE+ERGITIK  A +LIY    D ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEI PVINKIDLPSA  D +K+++ED IG+D   AP++SAKTGLNI  ++E++++ IP P + ++  PL+AL+FDSYYD+YKG VC+VR+K+G+VK+G KI+ M+ N+ + V+ +GV TP ++    L AG+VG+I ASIKN++   VGDTIT+ + P   +LPGYK  +PMVY G+YP+D  +Y+  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIYKV+  DG ILEI +   LP+ T    ++EP  KA II P D++G VMELCQ+ RG Y+D+  ++ TR  V Y IPL EI+Y FFD LKS ++GYA+LDYE   Y +  LVK+DILLNG+ VDALS I+  E A  + R I  KLKE IP+  FE+PIQA IG KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +G+V VP + F+ +L
  S:     6 QQHIRNFSIVAHIDHGKSTLADRLLETTGTLTKREMEEQVLDNMEIEKERGITIKSQAARLIYRR-DDGEEYILNLIDTPGHVDFNYEVSRSLAACEGAVLVVDATQGIQAQTLANCYLALDNDLEIAPVINKIDLPSARPDEIKQEIEDIIGIDAEEAPMISAKTGLNIKDVLESVVKNIPAP-NGNEEAPLKALIFDSYYDSYKGVVCIVRVKDGKVKIGDKIKLMATNKVYDVTEVGVFTPNVLPIGSLSAGDVGYITASIKNVRDARVGDTITEASRPTEKALPGYKPAIPMVYSGIYPVDGAKYDELKEALEKLQINDAALSFEPETSIALGFGFRCGFLGLLHMEIIQERVEREFNLDIITTAPSVIYKVIKTDGEILEITNPTNLPEATEVDYMEEPVVKASIITPKDYVGAVMELCQDRRGTYIDMQYIEETRAVVNYDIPLNEIIYDFFDTLKSRTRGYASLDYEFKGYIRTKLVKLDILLNGDVVDALSMIVPDERAYHKGRGIAEKLKEIIPRQMFEVPIQAAIGSKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQVGSVEVPQEAFMAVL 598
>gi|150015711|ref|YP_001307965.1| GTP-binding protein LepA [Clostridium beijerinckii NCIMB 8052] >gi|149902176|gb|ABR33009.1| GTP-binding protein LepA [Clostridium beijerinckii NCIMB 8052] (603 aa)
Score = 1817, Expect = 0.0e+00, Identities = 356/595 (59%), Positives = 464/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNFSIVAHIDHGKSTL+DR++E T TLT REM+ Q+LD+M+IE+ERGITIK  A +L+Y    D ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEI PVINK+DLPSA  D VKK++ED IG+    AP +SAKTGLNI  ++E +++ IP P D D+  PL+AL+FDSYYD+YKG VC+VR+ +G+VK+GTKI+ M+ N+ + V+ +GV TP ++    L AG+VG++ ASIKN++   VGDTIT+   P  T+LPGYK  +PMVY G+YP+D  +Y+  +EALEK+ ++D++L++E ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIYKV+  DG ILEI +   LP  T    ++EP  KA II P D++G VMELCQ+ RG Y+D+  ++ TR  V Y IPL EI+Y FFD LKS ++GYA+LDYE   Y +  LVK+DILLNG+ VDALS I+  E A  + R I  KLKE IP+  FEIPIQA +G KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +G+V VP + F+ +L
  S:     8 QKHIRNFSIVAHIDHGKSTLADRLLETTGTLTKREMEEQVLDNMEIEKERGITIKSQAARLVYRR-DDGEEYILNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIAPVINKVDLPSARPDEVKKEIEDVIGIPAEEAPTISAKTGLNIGDVLECVVKTIPSP-DGDEEAPLKALIFDSYYDSYKGVVCIVRVMDGRVKIGTKIKLMATNKVYDVTEVGVFTPGVLPISELSAGDVGYVTASIKNVRDARVGDTITEANRPTETALPGYKPAIPMVYSGIYPVDGAKYDELREALEKLQINDAALSFEPETSIALGFGFRCGFLGLLHMEIIQERVEREFNLDIITTAPSVIYKVIKTDGEILEITNPTNLPPLTEVDYMEEPVVKASIITPKDYVGAVMELCQDRRGIYIDMQYIEETRAVVNYDIPLNEIIYDFFDTLKSRTRGYASLDYEFKGYIRTKLVKLDILLNGDVVDALSMIVPEERAYHKGRGIAEKLKEIIPRQLFEIPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQVGSVEVPQEAFMAVL 600
>gi|182626892|ref|ZP_02954626.1| GTP-binding protein LepA [Clostridium perfringens D str. JGS1721] >gi|177907742|gb|EDT70354.1| GTP-binding protein LepA [Clostridium perfringens D str. JGS1721] (600 aa)
Score = 1817, Expect = 0.0e+00, Identities = 358/595 (60%), Positives = 467/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVN-KEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           KKYIRNFSIVAHIDHGKSTL+DRI+E T TLT REM+ Q+LD+M++E+ERGITIK  A +LIY   ++ ++Y  +LIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINK+DL SA  D +K+++ED IG++  +APLVSAKTGLNI  ++E I+E++P P + D+N PL+AL+FDSYYD+YKG VC +R+K+G+VK GTKI+ MS ++ + V   GV TP ++  KE L AGEVG+I ASIKN++   VGDT+T+ A P   +LPGYK  +PMVY G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIYKV   +G   ++ +   LP  T    ++EP  KA II P D+ G VMELCQ+ RG+++D+  ++ TR  + Y IPL EI+Y FFD LKS ++GYA+LDYE+  Y +  LVK+DILLNG+ VDALS I+    A  R R I  KLKE IP+H FE+PIQA +G KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +G V VP + F+ +L
  S:     4 KKYIRNFSIVAHIDHGKSTLADRILEKTGTLTQREMEQQVLDTMELEKERGITIKSQAARLIYKR-ENGEEYILNLIDTPGHVDFTYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKVDLASARPDEIKQEIEDVIGIEAEDAPLVSAKTGLNIEDVLEEIVEKVPAP-EGDENAPLKALIFDSYYDSYKGVVCHIRVKDGKVKPGTKIKLMSTDKVYEVVETGVFTPALMPLKEGLSAGEVGYITASIKNVRDARVGDTVTEAARPTEEALPGYKPAIPMVYSGIYPVDGAKYEELKEALEKLQINDAALSFEPETSVALGFGFRCGFLGLLHMEIIQERVEREFNLDIITTAPSVIYKVTKTNGESFDLTNPTNLPPMTEIAYMEEPVVKASIITPTDYTGAVMELCQDRRGKFIDMQYLEETRVVIHYEIPLNEIVYDFFDTLKSKTRGYASLDYELKGYEQSKLVKLDILLNGDNVDALSMIVPEVKAYQRGRAIAEKLKEIIPRHMFEVPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQLGTVEVPQEAFMSVL 597
>gi|163867371|ref|YP_001608565.1| GTP-binding protein LepA [Bartonella tribocorum CIP 105476] >gi|161017012|emb|CAK00570.1| GTP-binding protein LepA [Bartonella tribocorum CIP 105476] (613 aa)
Score = 1817, Expect = 0.0e+00, Identities = 338/597 (56%), Positives = 453/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+ YIRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK Q+LDSMDIERERGITIK   V+L Y   K+ + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++N+ E+V V+NKIDLP+A+ +RVK+Q+ED IG+D S A  +SAKTGL I  ++EAI+ Q+PPP   D   PL+A++ DS+YDAY G + LVR+ +G +K G  IR M     + V  +GV TPK+V  + L  GE+G+I ASIK +    VGDTIT++  P   +LPG+K   P+V+CGL+PID+  ++  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSV+Y++ +NDG++ E+ + A +PD      I+EP+ +A I+ PD++LG+++ELCQ  RG  + L  V  TR  VTY +PL E+++ F+D+LKS SKGYA+ DY++ DY + DLVK+ IL+NG  +DALS ++HR  A  R R +C KLK+ IP+H F+IPIQA IGGKIIARET+ A+RK+V AKCYGGDITRK+KLLE+QKEGKKR++  G V +P   F++ L
  S:    15 IDRNYIRNFSIVAHIDHGKSTLADRLIQMTGGLDTREMKEQVLDSMDIERERGITIKAQTVRLHY-KAKNGETYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNSHELVVVLNKIDLPAAEPERVKEQIEDVIGIDTSQAVEISAKTGLGIPDVLEAIVTQLPPPRIGDVTNPLKAMLVDSWYDAYLGVIVLVRVIDGILKKGQTIRMMGTGAKYPVERVGVFTPKMVQVDELGPGEIGFITASIKEVADTRVGDTITEERRPCENALPGFKPAQPVVFCGLFPIDAADFDDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRMNMNDGSVKELHNPADMPDVVKISSIEEPWIRATIMTPDNYLGSILELCQERRGIQVGLSYV-GTRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQMTDYAEGDLVKMSILVNGEPIDALSMLVHRTIAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIQAL 609
>gi|90418853|ref|ZP_01226764.1| GTP-binding elongation factor [Aurantimonas sp. SI85-9A1] >gi|90336933|gb|EAS50638.1| GTP-binding elongation factor [Aurantimonas sp. SI85-9A1] (603 aa)
Score = 1816, Expect = 0.0e+00, Identities = 337/593 (56%), Positives = 450/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  R+MK Q+LDSMDIERERGITIK   V+L Y   K+ + Y  +LIDTPGHVDF YEVSRSLAACEGALLVVDA+QGVEAQTL+NVYLAL+ NLEIVPV+NKIDLP+A+ D+VK+Q+E+ IGLD S+A ++SAK+GL I  ++EAI+ ++P P + D   PL+A++ DS+YDAY G + LVRI +G++K G  IR M  +  + V  +GV TP +V  E L  GE+G+I ASIK +    VGDTITDD    T+ LPG+K   P+V+CGL+P+D++ ++  + A+ K+ L+D+S +YE E+S ALGFG RCGFLGLLH+++++ERL REF++ LIATAPSV+Y + L DG+ +++ + A +PD     EI EP+ KA I+ PDD+LGN+++LCQ  RG   DL  V   R  V+Y +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ I++NG  VDALS ++HR  A  R R +C KLKE IP H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD +RK+KLL++QKEGKKR++  G V +P + F+  L
  S:     9 HIRNFSIVAHIDHGKSTLADRLIQSTGGLELRDMKAQVLDSMDIERERGITIKAQTVRLHY-TAKNGETYVLNLIDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLALDANLEIVPVLNKIDLPAAEPDKVKEQIEEVIGLDASDAVMISAKSGLGIEDVLEAIVHRLPAPTEGDRKAPLKAMLVDSWYDAYLGVIVLVRIIDGELKKGQTIRMMGTDARYPVDRVGVFTPAMVQVEALGPGELGFITASIKEVADTRVGDTITDDKRQTTSMLPGFKPAQPVVFCGLFPVDASDFDELRAAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIVQERLSREFDLDLIATAPSVVYDIKLTDGSTIQLHNPADMPDVMKVAEIHEPWIKATILTPDDYLGNILQLCQERRGNQTDLSYV-GKRAMVSYELPLNEVVFDFYDRLKSISKGYASFDYHMADYREGDLVKMSIMVNGEPVDALSMLVHRNQAERRGRGMCEKLKELIPNHLFKIPIQAAIGGKVIARETISALRKDVTAKCYGGDASRKRKLLDKQKEGKKRMRQFGKVDIPQEAFIAAL 599
>gi|18311020|ref|NP_562954.1| GTP-binding protein LepA [Clostridium perfringens str. 13] >gi|110801855|ref|YP_699319.1| GTP-binding protein LepA [Clostridium perfringens SM101] >gi|168204723|ref|ZP_02630728.1| GTP-binding protein LepA [Clostridium perfringens E str. JGS1987] >gi|169343542|ref|ZP_02864541.1| GTP-binding protein LepA [Clostridium perfringens C str. JGS1495] >gi|24211910|sp|Q8XIS6|LEPA_CLOPE GTP-binding protein lepA >gi|119371342|sp|Q0SRD8|LEPA_CLOPS GTP-binding protein lepA >gi|18145702|dbj|BAB81744.1| GTP-binding protein [Clostridium perfringens str. 13] >gi|110682356|gb|ABG85726.1| GTP-binding protein LepA [Clostridium perfringens SM101] >gi|169298102|gb|EDS80192.1| GTP-binding protein LepA [Clostridium perfringens C str. JGS1495] >gi|170663584|gb|EDT16267.1| GTP-binding protein LepA [Clostridium perfringens E str. JGS1987] (600 aa)
Score = 1816, Expect = 0.0e+00, Identities = 358/595 (60%), Positives = 467/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVN-KEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           KKYIRNFSIVAHIDHGKSTL+DR++E T TLT REM+ Q+LD+M++E+ERGITIK  A +LIY   ++ ++Y  +LIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINK+DL SA  D +K+++ED IG++  +APLVSAKTGLNI  ++E I+E+IP P + D+N PL+AL+FDSYYD+YKG VC +R+K+G+VK GTKI+ MS ++ + V   GV TP ++  KE L AGEVG+I ASIKN++   VGDT+T+ A P   +LPGYK  +PMVY G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIYKV   +G   ++ +   LP  T    ++EP  KA II P D+ G VMELCQ+ RG+++D+  ++ TR  + Y IPL EI+Y FFD LKS ++GYA+LDYE+  Y +  LVK+DILLNG+ VDALS I+    A  R R I  KLKE IP+H FE+PIQA +G KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +G V VP + F+ +L
  S:     4 KKYIRNFSIVAHIDHGKSTLADRLLEKTGTLTQREMEQQVLDTMELEKERGITIKSQAARLIYKR-ENGEEYILNLIDTPGHVDFTYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKVDLASARPDEIKQEIEDVIGIEAEDAPLVSAKTGLNIEDVLEEIVEKIPAP-EGDENAPLKALIFDSYYDSYKGVVCHIRVKDGKVKPGTKIKLMSTDKVYEVVETGVFTPALMPLKEGLSAGEVGYITASIKNVRDARVGDTVTEAARPTEEALPGYKPAIPMVYSGIYPVDGAKYEELKEALEKLQINDAALSFEPETSVALGFGFRCGFLGLLHMEIIQERVEREFNLDIITTAPSVIYKVTKTNGESFDLTNPTNLPPMTEIAYMEEPVVKASIITPTDYTGAVMELCQDRRGKFIDMQYLEETRVVIHYEIPLNEIVYDFFDTLKSKTRGYASLDYELKGYEQSKLVKLDILLNGDNVDALSMIVPEVKAYQRGRAIAEKLKEIIPRHMFEVPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQLGTVEVPQEAFMSVL 597
>gi|187933987|ref|YP_001885088.1| GTP-binding protein LepA [Clostridium botulinum B str. Eklund 17B] >gi|187722140|gb|ACD23361.1| GTP-binding protein LepA [Clostridium botulinum B str. Eklund 17B] (600 aa)
Score = 1815, Expect = 0.0e+00, Identities = 357/595 (60%), Positives = 465/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +KYIRNFSIVAHIDHGKSTL+DR++E T TLT REM+ QILD+MDIERERGITIK  A +L+Y   ++ ++Y F+LIDTPGHVDFTYEVSRSLAACEGALLVVDA+QG++AQTL+N YLAL+N+LEI PVINKIDLPSA  + VK+++ED IG+D  +AP++SAKTGLNI Q++E+I+E +PPP + D+  PL+AL+FDSYYD+YKG V +VR+ +G+VK G KI+ M+ N+ + V+ +GV  P  +    L AG+VG+I ASIKN++   VGDTIT+ + P   +LPGYK  +PMVY G+YP+D  +Y+  KEALEK+ ++D++L +E ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIYKV   +G + +I +   LP  T    ++EP  KA II P D++G VMELCQ  RG Y+D+  ++ TR  +TY +PL EI+Y FFD LKS ++GYA+LDYE   Y+   LVK+DILLNG+ VDALS I+  E A  + R I  KLKE IP+  FE+PIQA IG KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +G+V VP + F+ +L
  S:     5 QKYIRNFSIVAHIDHGKSTLADRLLETTGTLTKREMEEQILDNMDIERERGITIKSQAARLVYRR-ENGEEYIFNLIDTPGHVDFTYEVSRSLAACEGALLVVDATQGIQAQTLANCYLALDNDLEISPVINKIDLPSARPEEVKQEIEDVIGIDADSAPMISAKTGLNIEQVLESIVETLPPP-NGDEEAPLKALIFDSYYDSYKGVVSIVRVLDGKVKPGDKIKLMATNKVYDVTEVGVFIPSALAVPELSAGDVGYITASIKNVRDARVGDTITEASRPTEKALPGYKPAIPMVYSGIYPVDGAKYDELKEALEKLQINDAALNFEPETSIALGFGFRCGFLGLLHMEIIQERVEREFNLDIITTAPSVIYKVTKTNGEVFDITNPTNLPPMTEIDFMEEPVVKASIITPTDYVGAVMELCQERRGIYIDMEYIEETRAVITYDMPLNEIVYDFFDTLKSRTRGYASLDYEFKGYKTTKLVKLDILLNGDVVDALSMIVPDERAYSKGRGIAEKLKEIIPRQMFEVPIQAAIGSKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQVGSVEVPQEAFMAVL 597
>gi|158320264|ref|YP_001512771.1| GTP-binding protein LepA [Alkaliphilus oremlandii OhILAs] >gi|166987747|sp|A8MFA6|LEPA_ALKOO GTP-binding protein lepA >gi|158140463|gb|ABW18775.1| GTP-binding protein LepA [Alkaliphilus oremlandii OhILAs] (602 aa)
Score = 1815, Expect = 0.0e+00, Identities = 344/595 (57%), Positives = 464/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSI+AHIDHGKSTL+DR+IE+T  ++ REM++Q+LD+MD+ERERGITIKL  ++L+Y   KD ++YY +LIDTPGHVDFTYEVSRSLAACEGA+L+VDA+QG+EAQTL+NVYLALE +LEI+PVINKIDLPSA  D +K ++ED IGLD S APL+SAK GLNI  ++E+I++ +P P   D N PL+AL+FDSYYD+YKG +  +R+  GQVK G K++ M+ N+ F V  +G  +P  +  + L AG+VG++AASIK+++   VGDTITD  NP  + LPGY+K+ PMVYCG+YP +  +YE  ++ALEK+ ++D++L +E E+S ALGFG RCGFLGLLHM++I+ERL+REF++ LI TAPSVIYK+   +G  L I + A +P     + ++EP  K  I+VP+ ++G VMELCQ+ RGE  D+  +D TR  + Y +PL E++Y FFD LKS +KGY +LDYE+L YR  DLVK+DIL+NG ++DALS I+H   A  R + +C KLK+ IP+HQF IP+QA +G K+I+RET+ A+RK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +GNV VP   F+ +L
  S:     6 QKKIRNFSIIAHIDHGKSTLADRLIEYTGLISQREMQSQMLDNMDLERERGITIKLQTIRLVY-KAKDGEEYYLNLIDTPGHVDFTYEVSRSLAACEGAVLIVDAAQGIEAQTLANVYLALEQDLEIIPVINKIDLPSARPDEIKTEIEDIIGLDASEAPLISAKEGLNIEDVLESIVKNVPSP-KGDINAPLKALIFDSYYDSYKGVIAYMRVMEGQVKKGMKVKMMATNKEFEVVEVGAFSPGAIPLDSLSAGDVGYLAASIKDVRHCRVGDTITDALNPTESPLPGYRKVNPMVYCGIYPAEGEKYEDIRDALEKLQVNDAALVFEPESSAALGFGFRCGFLGLLHMEIIQERLEREFDLDLITTAPSVIYKITKTNGEELMIQNPANMPTPQEIRIMEEPIVKTTIMVPNTYVGAVMELCQDRRGEMKDMQYIDDTRVNLYYEMPLNEVIYDFFDALKSKTKGYGSLDYELLGYRASDLVKLDILINGEQIDALSFIVHESKAYSRGKGMCEKLKDEIPRHQFPIPLQAAVGNKVISRETIKALRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQVGNVEVPQKAFMSVL 598
>gi|110800481|ref|YP_696718.1| GTP-binding protein LepA [Clostridium perfringens ATCC 13124] >gi|168208740|ref|ZP_02634365.1| GTP-binding protein LepA [Clostridium perfringens B str. ATCC 3626] >gi|168212925|ref|ZP_02638550.1| GTP-binding protein LepA [Clostridium perfringens CPE str. F4969] >gi|168215665|ref|ZP_02641290.1| GTP-binding protein LepA [Clostridium perfringens NCTC 8239] >gi|119371341|sp|Q0TNS2|LEPA_CLOP1 GTP-binding protein lepA >gi|110675128|gb|ABG84115.1| GTP-binding protein LepA [Clostridium perfringens ATCC 13124] >gi|170713149|gb|EDT25331.1| GTP-binding protein LepA [Clostridium perfringens B str. ATCC 3626] >gi|170715556|gb|EDT27738.1| GTP-binding protein LepA [Clostridium perfringens CPE str. F4969] >gi|182382166|gb|EDT79645.1| GTP-binding protein LepA [Clostridium perfringens NCTC 8239] (600 aa)
Score = 1814, Expect = 0.0e+00, Identities = 357/595 (60%), Positives = 467/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVN-KEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           KKYIRNFSIVAHIDHGKSTL+DR++E T TLT REM+ Q+LD+M++E+ERGITIK  A +LIY   ++ ++Y  +LIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG++AQTL+N YLAL+N+LEIVPVINK+DL SA  D +K+++ED IG++  +APLVSAKTGLNI  ++E I+E++P P + D+N PL+AL+FDSYYD+YKG VC +R+K+G+VK GTKI+ MS ++ + V   GV TP ++  KE L AGEVG+I ASIKN++   VGDT+T+ A P   +LPGYK  +PMVY G+YP+D  +YE  KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHM++I+ER++REFN+ +I TAPSVIYKV   +G   ++ +   LP  T    ++EP  KA II P D+ G VMELCQ+ RG+++D+  ++ TR  + Y IPL EI+Y FFD LKS ++GYA+LDYE+  Y +  LVK+DILLNG+ VDALS I+    A  R R I  KLKE IP+H FE+PIQA +G KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +G V VP + F+ +L
  S:     4 KKYIRNFSIVAHIDHGKSTLADRLLEKTGTLTQREMEQQVLDTMELEKERGITIKSQAARLIYKR-ENGEEYILNLIDTPGHVDFTYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALDNDLEIVPVINKVDLASARPDEIKQEIEDVIGIEAEDAPLVSAKTGLNIEDVLEEIVEKVPAP-EGDENAPLKALIFDSYYDSYKGVVCHIRVKDGKVKPGTKIKLMSTDKVYEVVETGVFTPALMPLKEGLSAGEVGYITASIKNVRDARVGDTVTEAARPTEEALPGYKPAIPMVYSGIYPVDGAKYEELKEALEKLQINDAALSFEPETSVALGFGFRCGFLGLLHMEIIQERVEREFNLDIITTAPSVIYKVTKTNGESFDLTNPTNLPPMTEIAYMEEPVVKASIITPTDYTGAVMELCQDRRGKFIDMQYLEETRVVIHYEIPLNEIVYDFFDTLKSKTRGYASLDYELKGYEQSKLVKLDILLNGDNVDALSMIVPEVKAYQRGRAIAEKLKEIIPRHMFEVPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQLGTVEVPQEAFMSVL 597
>gi|148264548|ref|YP_001231254.1| GTP-binding protein LepA [Geobacter uraniireducens Rf4] >gi|189046442|sp|A5G4G3|LEPA_GEOUR GTP-binding protein lepA >gi|146398048|gb|ABQ26681.1| GTP-binding protein LepA [Geobacter uraniireducens Rf4] (599 aa)
Score = 1814, Expect = 0.0e+00, Identities = 349/595 (58%), Positives = 456/595 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+DR++E+T  L+ REM+NQ LD MD+ERERGITIK  AV+L Y    + +DY  +LIDTPGHVDFTYEVSRSL+ACEGALLVVDASQGVEAQTL+NVYLALEN+L++ PV+NKIDLP+AD +RVK+++ED IGLD  +A L SAK G+   +I+E I+ +IPPP   D NKPL+AL+FDS+YD Y+G + LVRI +G VK G KI+ MSN   + V  +GV +P +     L AGEVG+I A IK+++   VGDTIT   NP    LPG+K++ PMV+ GLYPID++QYE  ++AL K+ L+DSS +YE ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ LI TAP+V+YKV   DG+I+ I+SA +LP     + ++EPF  A I VP++F+G ++ LC+  RG   ++  +  TR  V Y +PL E++  F+D+LKS +KGYA+LDYE LDYR+ +L +++I++NG  VDALS I+H++ A  R R +  K+KE IP+  FEI IQA IG K+IARETV AMRK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL  E
  S:     6 IRNFSIIAHIDHGKSTLADRLLEYTGALSEREMQNQFLDKMDLERERGITIKAQAVRLNYR-AANGKDYILNLIDTPGHVDFTYEVSRSLSACEGALLVVDASQGVEAQTLANVYLALENDLDVFPVLNKIDLPAADPERVKQEIEDIIGLDAHDAVLASAKEGIGTREILEEIVTKIPPP-QGDSNKPLKALLFDSWYDQYQGVIVLVRILDGMVKKGDKIQLMSNRRNYEVLKVGVFSPAMCEVAALSAGEVGFIIAGIKDVQDAKVGDTITSLHNPCDGPLPGFKEVQPMVFSGLYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLEREFNLDLITTAPTVVYKVHRLDGSIITIESANQLPPVQEIQYVEEPFILASIHVPNEFVGGILALCEEKRGVQREIKYLTPTRVMVIYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRRSNLERLNIMINGEVVDALSLIIHKDKAYFRGRDLVSKMKELIPRQMFEIAIQAAIGNKVIARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598
>gi|121602278|ref|YP_989572.1| GTP-binding protein LepA [Bartonella bacilliformis KC583] >gi|120614455|gb|ABM45056.1| GTP-binding protein LepA [Bartonella bacilliformis KC583] (613 aa)
Score = 1811, Expect = 0.0e+00, Identities = 337/597 (56%), Positives = 454/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+ YIRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK+Q+LDSMDIERERGITIK   V+L Y   K+ + Y  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++NN E+V V+NK+DLP+A+ +RVKKQ+ED IG+D S A  +SAKTGL +  ++EAI+ Q+PPP   D  KPL+A++ DS+YDAY G + LVR+ +G +K G  IR M     + V  +GV TPK+V  + L  GE+G+I ASI+ +    VGDTIT++       LPG+K + P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSV+Y++ +N+G++ E+ + A +PD      I+EP+ +A I+ PDD+LG+V+ LCQ  RG  + L  V  TR  VTY +PL E+++ F+D+LKS SKGYA+ DY++ DY + DLVK+ IL+NG  +DALS ++HR  A  R R +C KLK+ IP+H F+IPIQA IGGKIIARET+ A+RK+V AKCYGGD+TRK+KLLE+QKEGKKR++  G V++P   F++ L
  S:    15 IDRNYIRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKDQVLDSMDIERERGITIKAQTVRLRY-KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVVVLNKVDLPAAEPERVKKQIEDVIGIDASEAVEISAKTGLGVIDVLEAIVMQLPPPSIGDVTKPLKAMLVDSWYDAYLGVIVLVRVIDGVLKKGQIIRMMGTGAKYPVERVGVFTPKMVQVDELGPGEIGFITASIREVADTRVGDTITEERRACEEILPGFKPVQPVVFCGLFPVDAAHFEDLRIAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRMNMNNGSVKELHNPADMPDIVKISSIEEPWIRATIMTPDDYLGSVLALCQERRGLQVSLSYV-GTRAMVTYDLPLNEVVFDFYDRLKSLSKGYASFDYQMTDYAEGDLVKMSILVNGEPIDALSMLVHRSIAEKRGRSMCEKLKDLIPQHIFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVTIPQSAFIQAL 609
>gi|42519349|ref|NP_965279.1| GTP-binding protein LepA [Lactobacillus johnsonii NCC 533] >gi|46396179|sp|P60790|LEPA_LACJO GTP-binding protein lepA >gi|41583637|gb|AAS09245.1| membrane GTPase LepA [Lactobacillus johnsonii NCC 533] (612 aa)
Score = 1810, Expect = 0.0e+00, Identities = 346/595 (58%), Positives = 460/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNFSIVAHIDHGKST++DRI+E T+T++ R+MKNQ+LD M +ER+RGITIKLN+V++ YH  KD + Y FHLIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGV+AQTL+N YLA++++LEI+PVINKIDLPSAD +  K ++E+ IGLD S+A  VS KTG  I +++E I++++P P D D N PL+AL+FDS YD Y+G V  VRI+ G VK G KIR M+  + F V+ +GV++P  V K++L+AG+VG++ A+IK+++   VGDTIT    P    LPGY++I PMVY G+YP+D+ +Y+  KEAL+K+ L+D++L +E ETSQALGFG RCGFLGLLHMDV++ERL++EF + LI TAPSV Y  ++NDG+   ID+ A LPD   YKE+QEP+ KAEI+VP+DF+G VMELCQ  RGE++ +  +D  R  V Y +PLAEI+Y FFD+LKS +KGYA+LDYEI  YR  DLVK+D+LLN   +DALS I HRE A +R+R++   LK+ IP+  FE+ IQ  IG KII+R T+   RK+V  K + GD  R+ KLLE+Q+ GKKR+KA+G V VP D F+ +L
  S:    10 QKHIRNFSIVAHIDHGKSTIADRILELTDTVSERQMKNQLLDDMPLERQRGITIKLNSVEVKYH-AKDGETYIFHLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVQAQTLANTYLAIDDDLEILPVINKIDLPSADPEMCKNEIEEMIGLDASDAVEVSGKTGQGIPELLEEIVKKVPAP-DGDLNAPLKALIFDSKYDDYRGVVLSVRIEEGTVKPGDKIRIMNTGKEFEVTEVGVSSPHPVKKDMLIAGDVGYLTANIKSVRETRVGDTITSAETPTEKPLPGYRQIPPMVYSGMYPVDNQKYDDLKEALQKLQLNDAALEFEPETSQALGFGFRCGFLGLLHMDVVQERLEQEFGMDLIMTAPSVDYHAIMNDGSTKLIDNPADLPDAGEYKEVQEPYVKAEIMVPNDFVGPVMELCQRKRGEFVTMDYLDKYRVNVIYNMPLAEIIYDFFDELKSSTKGYASLDYEITGYRATDLVKIDMLLNKEPIDALSFIAHREEAQNRARQMTTMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRRAKLLEKQRRGKKRMKAVGRVEVPQDAFMAVL 602
>gi|49474893|ref|YP_032934.1| GTP-binding protein LepA [Bartonella henselae str. Houston-1] >gi|60389986|sp|Q6G550|LEPA_BARHE GTP-binding protein lepA >gi|49237698|emb|CAF26887.1| GTP-binding protein lepA [Bartonella henselae str. Houston-1] (601 aa)
Score = 1810, Expect = 0.0e+00, Identities = 336/597 (56%), Positives = 455/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+ YIRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK Q+LDSMDIERERGITIK   V+L Y   K+ + Y  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++N+ E+V V+NK+DLP+A+ +RVK+Q+ED IG+D S A  +SAKTGL ++ ++EAI+ Q+P P   D NKPL+A++ DS+YDAY G + LVR+ +G +K G  IR M     + V  +GV TPK++  + L  GE+G+I ASIK +    VGDTIT++  P   +LPG+K   P+V+CGL+PID+  ++  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSV+Y++ ++DG++ E+ + A +PD      I+EP+ +A I+ PD++LG+V+ELCQ  RG  + L  V  TR  VTY +PL E+++ F+D+LKS SKGYA+ DY++ DY + DLVK+ IL+NG  +DALS ++HR  A  R R +C KLK+ IP+H F+IPIQA IGGKIIARET+ A+RK+V AKCYGGD+TRK+KLLE+QKEGKKR++  G V +P   F++ L
  S:     3 VDRNYIRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLHY-KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNSHELVVVLNKVDLPAAEPERVKEQIEDVIGIDTSEAVEISAKTGLGVSDVLEAIVTQLPSPRTGDVNKPLKAMLVDSWYDAYLGVIVLVRVIDGILKKGQIIRMMGTGAKYPVERVGVFTPKMIQVDELGPGEIGFITASIKEVADTRVGDTITEERCPCEEALPGFKPAQPVVFCGLFPIDAADFDDLRAAMGKLRLNDASFSFEVETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRMNMHDGSVKELHNPADMPDIVKISSIEEPWIRATIMTPDNYLGSVLELCQERRGIQVSLSYV-GTRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQMRDYTEGDLVKMSILVNGESIDALSMLVHRTIAEKRGRSLCEKLKDLIPQHMFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIQAL 597
>gi|162452109|ref|YP_001614476.1| GTP-binding protein LepA [Sorangium cellulosum 'So ce 56'] >gi|189046457|sp|A9GWZ4|LEPA_SORC5 GTP-binding protein lepA >gi|161162691|emb|CAN93996.1| GTP-binding protein LepA [Sorangium cellulosum 'So ce 56'] (600 aa)
Score = 1809, Expect = 0.0e+00, Identities = 335/597 (56%), Positives = 452/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D K IRNFSI+AHIDHGKSTL+DRI++ T  LT RE K Q LD MDIERERGITIK   V+L Y   KD Q Y  HLIDTPGHVDF YEVSRSL ACEGALLVVDA+QGVEAQTL+NV+LAL+NNL I+PV+NKIDLPSADI+R  +++ED IGLDCS A   SAKTG+ I +I+EA++E+IP P   D N   +AL+FDS+YD+Y+GAV +VR+ +G ++ G K+RFM+    + V+ +GV TP       L  GEVG++  +IK++    +GDT+TD  +PATT LPG+K++ PMV+ G++P DS QYE  ++AL K++++D++  +E +TS+ALGFG RCGFLGLLHM++I+ERL+RE+N+ LI TAPSV+Y   LNDG++  I++ AKLP   L   I+EP  +  + VP  ++G V+ LCQ  RGE   +    S R  +TY +PL+E+++ F DKLKS S+GYA++DYE++ YR  DL+K+D+L+NG+ +DALS I+HR+ A  R R + +KLK+ +P+ Q+E+ IQA IG K+IAR TV AMRK+V AKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P + F+ IL
  S:     3 VDSKLIRNFSIIAHIDHGKSTLADRILDATGALTAREQKEQFLDKMDIERERGITIKAQTVRLDY-TAKDGQTYRLHLIDTPGHVDFNYEVSRSLQACEGALLVVDATQGVEAQTLANVFLALDNNLAILPVLNKIDLPSADIERTTREIEDVIGLDCSGAIPASAKTGIGIAEILEAVVERIPAP-KGDPNAAPRALIFDSWYDSYRGAVVMVRVVDGIIRKGQKVRFMATGRDYEVTEMGVFTPHATAITELGPGEVGFLVGNIKSVVDTKIGDTVTDAVHPATTPLPGFKEVKPMVFAGIFPTDSAQYEDLRDALSKLHMNDAAFVFEPDTSEALGFGFRCGFLGLLHMEIIQERLEREYNLDLITTAPSVVYHCYLNDGSMKSIENPAKLPPPNLTDRIEEPIFRMTVHVPSTYVGAVLALCQERRGEQKSIQYASSDRVIITYDMPLSEVLFDFHDKLKSVSRGYASMDYELVGYRADDLIKLDMLVNGDPLDALSVIVHRDKAYARGRDLAVKLKDIVPRQQYEVAIQAAIGSKVIARTTVKAMRKDVTAKCYGGDISRKRKLLEKQKEGKKRMKMVGSVEIPQEAFLAIL 597
>gi|169334996|ref|ZP_02862189.1| hypothetical protein ANASTE_01402 [Anaerofustis stercorihominis DSM 17244] >gi|169257734|gb|EDS71700.1| hypothetical protein ANASTE_01402 [Anaerofustis stercorihominis DSM 17244] (601 aa)
Score = 1809, Expect = 0.0e+00, Identities = 352/591 (59%), Positives = 455/591 (76%)
  Q:     7 RNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           RNF I+AHIDHGKSTL+DR+IE T  ++ REM +Q+LD MD+E+ERGITIKL AV+L+YH  KD ++YY +LIDTPGHVDFTYEVSRSLAACEGA+L+VDA+QG++AQT++NVYLALEN+LEI+PVINKIDLPSAD +  ++++ED IGL    APL+SAK GLNI+ ++EAI+  +PPP +  + +PL+ L+FDSYYD YKG V   RI +G++K GTKI+F +  +TF V  +G+ T  +     L +G+VG+I ASIKN+    VGDTI D+ NPA   LPGYK I PMVYCG+YP D ++YE  KEAL K+ L+D+SL YE ETS ALGFG RCGFLGLLH++V ++R+DRE+N+ ++ T PSVIY V   DG+ L++D+   LP       ++EPF  A I++P +++G VME+CQ  RG Y  +  +D  R  + Y +PL EI+Y FFD LKS +KGYA+LDYE+LDYRK DLVK+DILLNG  VDALS I+HRE A  R R+I  KLKE IP+  FEIPIQA IGGK+IARETV A+RK+VL+KCYGGDITRKKKLLE+QKEGKK+++ +G V VP + F  +L
  S:     9 RNFCIIAHIDHGKSTLADRLIEKTGLISKREMTSQVLDKMDLEQERGITIKLQAVRLVYH-AKDGEEYYLNLIDTPGHVDFTYEVSRSLAACEGAILIVDATQGIQAQTMANVYLALENDLEIIPVINKIDLPSADPEMARREIEDYIGLPADEAPLISAKEGLNIDDVLEAIVRDVPPP-EKKNKEPLRGLIFDSYYDQYKGVVISTRIVDGEIKKGTKIKFYATGKTFEVEEVGIFTSTLTPTNKLESGDVGYICASIKNVADTRVGDTIMDEENPAKEPLPGYKSITPMVYCGIYPADGSKYEDLKEALGKLKLNDASLLYEPETSVALGFGFRCGFLGLLHLEVTQQRIDREYNLDIVTTTPSVIYHVTKTDGSELKVDNPTNLPPVPEISFMEEPFVDANIMLPSEYVGAVMEICQGKRGIYKTMDYIDENRVNLKYEMPLNEIIYDFFDTLKSRTKGYASLDYELLDYRKADLVKLDILLNGEIVDALSFIVHREKAQTRGRQIVKKLKEEIPRQMFEIPIQAAIGGKVIARETVRALRKDVLSKCYGGDITRKKKLLEKQKEGKKKMRQVGKVEVPQEAFTAVL 597
>gi|70726333|ref|YP_253247.1| GTP-binding protein LepA [Staphylococcus haemolyticus JCSC1435] >gi|90185210|sp|Q4L6T4|LEPA_STAHJ GTP-binding protein lepA >gi|68447057|dbj|BAE04641.1| GTP-binding protein [Staphylococcus haemolyticus JCSC1435] (607 aa)
Score = 1808, Expect = 0.0e+00, Identities = 338/595 (56%), Positives = 468/595 (78%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T ++ TREM++Q+LDSMD+ERERGITIKLNAV+L Y    D Q Y FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LE++PV+NKIDLP+A+ +RVK+++ED IGL+  +  L SAK+ + I  I+E I+E +PPP + D ++PL+AL+FDS YD Y+G +  +R+  G VK G KI+ M+  + F VS +G+NTPK +  E L  G+VG+I ASIKN+    VGDTIT    PA   L GYKK+ PMVYCGL+PI++  Y   +EALEK+ L+D+SL +E E+SQALGFG R GFLG+LHM++I+ER++REF I LIATAPSVIY+ ++ DG+ + +D+ A++P++     I EP+ KA ++VP+D++G VMELCQ  RG+++++  +D  R  + Y IPL+E+++ FFD+LKS +KGYA+ DYE ++ ++ +LVK+DILLNG+KVDALS I+H++FA +R + +  KLK  IP+ QFE+P+QA IG KI+AR  + +M KNVL+KCYGGDI+RK+KLLE+QK GK ++KA+G+V +P D F+ +L
  S:    10 RENIRNFSIIAHIDHGKSTLADRILENTKSVETREMQDQLLDSMDLERERGITIKLNAVRLKYE-ANDGQTYTFHLIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLELLPVVNKIDLPAAEPERVKQELEDVIGLNQDDVVLASAKSNIGIEDILEKIVEVVPPP-EGDPSEPLKALIFDSEYDPYRGVISSIRVMEGVVKAGDKIKMMATGKEFEVSEVGINTPKQLPIEELTVGDVGYIIASIKNVDDSRVGDTITHANRPAEAPLKGYKKMNPMVYCGLFPIENKDYNDLREALEKLQLNDASLEFEPESSQALGFGFRTGFLGMLHMEIIQERIEREFGIELIATAPSVIYQCIMKDGSEVTVDNPAQMPERDKIDSIYEPYVKATMMVPNDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYEIPLSEVVFDFFDQLKSNTKGYASFDYEFIENKESNLVKMDILLNGDKVDALSFIVHKDFAYERGKALVEKLKTLIPRQQFEVPVQAAIGQKIVARTNIKSMGKNVLSKCYGGDISRKRKLLEKQKAGKAKMKAVGSVEIPQDAFLAVL 602
>gi|116629481|ref|YP_814653.1| GTP-binding protein LepA [Lactobacillus gasseri ATCC 33323] >gi|122273581|sp|Q044A7|LEPA_LACGA GTP-binding protein lepA >gi|116095063|gb|ABJ60215.1| GTP-binding protein LepA [Lactobacillus gasseri ATCC 33323] (612 aa)
Score = 1808, Expect = 0.0e+00, Identities = 344/595 (57%), Positives = 461/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNFSIVAHIDHGKST++DRI+E T+T++ R+MKNQ+LD M +ER+RGITIKLN+V++ YH  KD + Y FHLIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGV+AQTL+N YLA++++LEI+PVINKIDLPSAD +  K ++E+ IGLD S+A  VS KTG  I +++E I++++P P + D N PL+AL+FDS YD Y+G V  VRI+ G VK G +IR M+  + F V+ +GV++P  V K++L+AG+VG++ A+IK+++   VGDTIT   NP    LPGY++I PMVY G+YP+D+ +Y+  KEAL+K+ L+D++L +E ETSQALGFG RCGFLGLLHMDV++ERL++EF + LI TAPSV Y  ++NDG+   ID+ A LPD   YKE+QEP+ KAE++VP+DF+G VMELCQ  RGE++ +  +D  R  V Y +PLAEI+Y FFD+LKS +KGYA+LDYEI  YR  DLVK+D+LLN   +DALS I HRE A +R+R++   LK+ IP+  FE+ IQ  IG KII+R T+   RK+V  K + GD  R+ KLLE+Q+ GKKR+KA+G V VP D F+ +L
  S:    10 QKHIRNFSIVAHIDHGKSTIADRILELTDTVSERQMKNQLLDDMPLERQRGITIKLNSVEVKYH-AKDGETYIFHLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVQAQTLANTYLAIDDDLEILPVINKIDLPSADPEMCKNEIEEMIGLDASDAVEVSGKTGQGIPELLEEIVKKVPAP-NGDLNAPLKALIFDSKYDDYRGVVLSVRIEEGTVKPGDRIRIMNTGKEFEVTEVGVSSPHPVKKDMLIAGDVGYLTANIKSVRETRVGDTITSAENPTEKPLPGYRQIPPMVYSGMYPVDNQKYDDLKEALQKLQLNDAALEFEPETSQALGFGFRCGFLGLLHMDVVQERLEQEFGMDLIMTAPSVDYHAIMNDGSTKLIDNPADLPDAGEYKEVQEPYVKAEVMVPNDFVGPVMELCQRKRGEFVTMDYLDKYRVNVIYNMPLAEIIYDFFDELKSSTKGYASLDYEITGYRATDLVKIDMLLNKEPIDALSFIAHREEAQNRARQMTTMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRRAKLLEKQRRGKKRMKAVGKVEVPQDAFMAVL 602
>gi|46579116|ref|YP_009924.1| GTP-binding protein LepA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|60390041|sp|Q72E76|LEPA_DESVH GTP-binding protein lepA >gi|46448529|gb|AAS95183.1| GTP-binding protein LepA [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] (601 aa)
Score = 1807, Expect = 0.0e+00, Identities = 335/595 (56%), Positives = 464/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +++IRNFSI+AHIDHGKSTL+DRI+E T  ++ RE ++Q LD MD+ERERGITIK   V++ +   K  + Y  +LIDTPGHVDF YEVSRSLAAC+GALLVVDASQGVEAQTL+NVYLAL+++ +I+PV+NKIDLPS+D+DRVK ++E++IGLDC++A  VSAKTG+N+++++EAI+E++P P + + N PL+AL+FDS+YD+Y+G V L R+ +G ++ G ++R  +  +++ V  LGV +P IV+   L AGEVG++ A+IK +    VGDTIT    PA+  +PG+K++ PMV+CGLYP D+ +YE  K +LEK+ L+D++ +YE ETSQALGFG RCGFLGLLHM++I+ERL+REF + LIATAPSVIYKV   DG   +ID+ +KLPD T    + EP+ + +I VP++F+GNV++LC+  RG   ++  + + R  +TY +P AEI++ FFD+LKS +KGYA++DYE +DYR+  LV++DIL+NG  VDAL+ I+HR+ A    R + LKLK  IP+  FE+ IQA IG K+IARET+SAMRKNV AKCYGGDITRK+KLLE+QKEGK+R+K +GNV +P + F+  L
  S:     4 QEHIRNFSIIAHIDHGKSTLADRILEVTGLVSDREKRDQYLDRMDLERERGITIKAQTVRIPF-TSKTGRKYILNLIDTPGHVDFNYEVSRSLAACDGALLVVDASQGVEAQTLANVYLALDHDHDIIPVLNKIDLPSSDVDRVKAEIEESIGLDCTDAIAVSAKTGMNVDKVLEAIVERLPAP-EGNLNAPLKALIFDSWYDSYQGVVVLFRVMDGVLRKGDRVRMFATEKSYEVIRLGVFSPDIVDVAELGAGEVGFLCANIKELGDAKVGDTITHTDRPASEPVPGFKEVQPMVFCGLYPTDAAEYEPLKASLEKLQLNDAAFSYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQVDLIATAPSVIYKVETVDGKTQDIDNPSKLPDPTRITSLYEPYVRMDIHVPNEFVGNVLKLCEEKRGIQKNMGYIAANRVVITYELPFAEIVFDFFDRLKSGTKGYASMDYEPVDYRESSLVRLDILINGEAVDALAVIVHRDKAYHYGRALALKLKRTIPRQLFEVAIQAAIGQKVIARETISAMRKNVTAKCYGGDITRKRKLLEKQKEGKRRMKRMGNVELPQEAFLAAL 596
>gi|13473815|ref|NP_105383.1| GTP-binding protein LepA [Mesorhizobium loti MAFF303099] >gi|24211931|sp|Q98DV1|LEPA_RHILO GTP-binding protein lepA >gi|14024566|dbj|BAB51169.1| GTP-binding protein; LepA [Mesorhizobium loti MAFF303099] (601 aa)
Score = 1807, Expect = 0.0e+00, Identities = 335/593 (56%), Positives = 448/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  R+MK Q+LDSMDIERERGITIK   V+L Y    + +DY  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++NN EIV V+NK+DLP+A+ +R+++QVE+ IG+D S A L+SAKTGL I  ++EAI+ Q+PPP + D   PL+A++ DS+YDAY G + LVRI +G +K G  IR M     ++V   GV TP  +N + L  GE G+   SIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSV+Y++LLNDG++ E+ + A +PD      I+EP+ +A I+ PDD+LG +++LCQ+ RG   DL  V   R  +TY +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R++C KLKE IP H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD++RK+KLL++QKEGKKR++  G V +P + F++ L
  S:     7 HIRNFSIVAHIDHGKSTLADRLIQSTGGLELRDMKEQVLDSMDIERERGITIKAQTVRLKYR-ANNGEDYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVVVLNKVDLPAAEPERIREQVEEVIGIDASGAVLISAKTGLGIPDVLEAIVHQLPPPREGDATAPLKAMLVDSWYDAYLGVIVLVRIIDGVLKKGQTIRMMGTGAKYLVERTGVFTPARINVDELGPGEFGFFTGSIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAVGKLRLNDASFSYEMETSAALGFGYRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRLLLNDGSVKELHNPADMPDVVKISAIEEPWIRATILTPDDYLGGILKLCQDRRGIQADLSYV-GKRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYHLTDYREGDLVKMSILVNEEPVDALSMLVHRTAAEKRGRQMCEKLKELIPHHLFKIPIQAAIGGKVIARETISALRKDVTAKCYGGDVSRKRKLLDKQKEGKKRMRQFGKVDIPQEAFIQAL 597
>gi|120603304|ref|YP_967704.1| GTP-binding protein LepA [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|120563533|gb|ABM29277.1| GTP-binding protein LepA [Desulfovibrio vulgaris subsp. vulgaris DP4] (607 aa)
Score = 1806, Expect = 0.0e+00, Identities = 335/595 (56%), Positives = 464/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +++IRNFSI+AHIDHGKSTL+DRI+E T  ++ RE ++Q LD MD+ERERGITIK   V++ +   K  + Y  +LIDTPGHVDF YEVSRSLAAC+GALLVVDASQGVEAQTL+NVYLAL+++ +I+PV+NKIDLPS+D+DRVK ++E++IGLDC++A  VSAKTG+N+++++EAI+E++P P + + N PL+AL+FDS+YD+Y+G V L R+ +G ++ G ++R  +  +++ V  LGV +P IV+   L AGEVG++ A+IK +    VGDTIT    PA+  +PG+K++ PMV+CGLYP D+ +YE  K +LEK+ L+D++ +YE ETSQALGFG RCGFLGLLHM++I+ERL+REF + LIATAPSVIYKV   DG   +ID+ +KLPD T    + EP+ + +I VP++F+GNV++LC+  RG   ++  + + R  +TY +P AEI++ FFD+LKS +KGYA++DYE +DYR+  LV++DIL+NG  VDAL+ I+HR+ A    R + LKLK  IP+  FE+ IQA IG K+IARET+SAMRKNV AKCYGGDITRK+KLLE+QKEGK+R+K +GNV +P + F+  L
  S:    10 QEHIRNFSIIAHIDHGKSTLADRILEVTGLVSDREKRDQYLDRMDLERERGITIKAQTVRIPF-TSKTGRKYILNLIDTPGHVDFNYEVSRSLAACDGALLVVDASQGVEAQTLANVYLALDHDHDIIPVLNKIDLPSSDVDRVKAEIEESIGLDCTDAIAVSAKTGMNVDKVLEAIVERLPAP-EGNLNAPLKALIFDSWYDSYQGVVVLFRVMDGVLRKGDRVRMFATEKSYEVIRLGVFSPDIVDVAELGAGEVGFLCANIKELGDAKVGDTITHADRPASEPVPGFKEVQPMVFCGLYPTDAAEYEPLKASLEKLQLNDAAFSYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQVDLIATAPSVIYKVETVDGKTQDIDNPSKLPDPTRITSLYEPYVRMDIHVPNEFVGNVLKLCEEKRGIQKNMGYIAANRVVITYELPFAEIVFDFFDRLKSGTKGYASMDYEPVDYRESSLVRLDILINGEAVDALAVIVHRDKAYHYGRALALKLKRTIPRQLFEVAIQAAIGQKVIARETISAMRKNVTAKCYGGDITRKRKLLEKQKEGKRRMKRMGNVELPQEAFLAAL 602
>gi|49473747|ref|YP_031789.1| GTP-binding protein LepA [Bartonella quintana str. Toulouse] >gi|60389984|sp|Q6G1F5|LEPA_BARQU GTP-binding protein lepA >gi|49239250|emb|CAF25571.1| GTP-binding protein lepA [Bartonella quintana str. Toulouse] (601 aa)
Score = 1806, Expect = 0.0e+00, Identities = 333/597 (55%), Positives = 451/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+ YIRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK Q+LDSMDIERERGITIK   V+L Y   K+ + Y  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++N+ E+V V+NK+DLP+A+ +RVK+Q+ED IG+D S A  +SAKTG  +  ++EAI+ Q+PPP   D   PL+ ++ DS+YDAY G + LVR+ +G +K G  IR M     ++V  +GV TPK+V  + L  GE+G+I ASIK +    VGDTIT++  P   +LPG+K   P+V+CG++PID+  ++  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSV+Y++ +N+G++ E+ + A +PD      I+EP+ +A I+ PDD+LG ++ELCQ  RG  + L  V  TR  VTY +PL E+++ F+D+LKS SKGYA+ DY++ DY + DLVK+ IL+NG  +DALS ++HR  A  R R +C KLK+ IP+H F+IPIQA IGGKIIARET+ A+RK+V AKCYGGD+TRK+KLLE+QKEGKKR++  G V +P   F++ L
  S:     3 VDRNYIRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLHY-KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNSHELVVVLNKVDLPAAEPERVKEQIEDVIGIDTSEAVEISAKTGFGVPDVLEAIVRQLPPPHIGDVKNPLKVMLVDSWYDAYLGVIVLVRVIDGILKKGQIIRMMGTGVKYLVERVGVFTPKMVQVDTLGPGEIGFITASIKEVADTRVGDTITEERRPCENALPGFKPAQPVVFCGIFPIDAADFDGLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRMNMNNGSVKELHNPADMPDLVKVSSIEEPWIRATIMTPDDYLGAILELCQERRGIQVGLSYV-GTRAMVTYNLPLNEVVFDFYDRLKSISKGYASFDYQMTDYSEGDLVKMSILVNGESIDALSMLVHRTVAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIEAL 597
>gi|160946317|ref|ZP_02093526.1| hypothetical protein PEPMIC_00277 [Peptostreptococcus micros ATCC 33270] >gi|158447433|gb|EDP24428.1| hypothetical protein PEPMIC_00277 [Peptostreptococcus micros ATCC 33270] (602 aa)
Score = 1805, Expect = 0.0e+00, Identities = 346/597 (57%), Positives = 454/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +++K IRNFSI+AHIDHGKSTL+DR+IE T  +T REM+ Q+LDSMD+ERERGITIKL AV+L Y   KD + Y  +LIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QGVEAQTL NVYLALE +LEI+PVINKIDLPSA ID VK ++E+  G D    PLVSAK GLNI  ++E I+  +P P   D+N PL+AL+FDSYYD+YKG V  VR+  G ++ G  I  M+    F V+ +G      V    L AG+VG++ ASIKN+K   VGDTITD  N   ++LPGYKK++PMVYCG+YP +   +   +EALEK+ ++D+SL++E E+S ALGFG RCGFLGLLHM++I+ERLDREF++ +I TAPSVIYKV    G ILEI + + LP +T  + ++EP  +A I+ P D++G +M+LCQN RG + ++  +D  R  + Y++PL E++Y FFD LKS +KGYA+LDYE+  Y++ DL K+DIL+NG+ VDA S I+HRE + +R+R I  +LK+ IP+HQF +PIQA IG K+IARETV A+RK+VLAKCYGGDI+RK+KLLE+QKEGKK+++ IG+V VP   F+ +L
  S:     3 IEQKNIRNFSIIAHIDHGKSTLADRLIEKTGMMTKREMEEQVLDSMDLERERGITIKLKAVKLFY-KAKDGETYVLNLIDTPGHVDFTYEVSRSLAACEGAILVVDATQGVEAQTLGNVYLALEQDLEILPVINKIDLPSARIDEVKDEIEEITGFDTEGIPLVSAKEGLNIEDVLEDIVNNVPAP-TGDENAPLKALIFDSYYDSYKGVVSYVRVVEGTLREGMTIYMMATKGKFEVTEVGYTASGNVQTGELKAGDVGYVVASIKNVKDARVGDTITDFENMTDSALPGYKKVIPMVYCGIYPAEGEDFNSVREALEKLQVNDASLSFEPESSVALGFGFRCGFLGLLHMEIIQERLDREFDLNIITTAPSVIYKVAKKTGEILEIQNPSNLPKETEIEYMEEPIVEANIMTPKDYVGTIMDLCQNKRGVFENMEYLDQHRVSLRYILPLNEVIYDFFDALKSKTKGYASLDYELKGYQRSDLAKLDILINGDLVDAFSIIVHREKSYERARNIVERLKDEIPRHQFAVPIQASIGSKVIARETVRALRKDVLAKCYGGDISRKRKLLEKQKEGKKKMQQIGSVEVPQQAFLAVL 597
>gi|78357858|ref|YP_389307.1| GTP-binding protein LepA [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|90185154|sp|Q30XI4|LEPA_DESDG GTP-binding protein lepA >gi|78220263|gb|ABB39612.1| GTP-binding protein LepA [Desulfovibrio desulfuricans G20] (601 aa)
Score = 1804, Expect = 0.0e+00, Identities = 336/592 (56%), Positives = 461/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI++ T  +T R+ ++Q LD M++ERERGITIK  AV++ Y    D ++Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQTL+NV+LAL+++ EI+PV+NKIDLPS+DI RVK ++ED IGLD + A  VSAKTGLN+++++EAI+E++P P + D + PLQAL+FDS+YD+Y+G V + R+ +G ++ G  I+ M+  + + V+ LGV +P+  + +   AG+VG++ A+IK +    VGDT+T  + PA T LPG+K++ PMV+CGLYP DS++YE  K ALEK+ L+D++ ++E ETSQALGFG RCGFLGLLHM++++ERL+REFNI LIATAPSV+YKVL  DG    I++ A LPD T  + + EP+ + EI VP++F+GNV +LC+  RG   D+  +   R  +TY +P AEI+Y FFDKLKS ++GYA++DYEI+DYR+ +LVK+D+L+NG+ VDAL+ I+HR+ A  + R I L+LK  IP+  FE+ +QA IG KIIARE  + +RKNV AKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+  L
  S:     7 IRNFSIIAHIDHGKSTLADRILDVTGLVTERDKRDQYLDRMELERERGITIKAQAVRIPY-KAADGREYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTLANVFLALDHDHEIIPVLNKIDLPSSDIARVKAEIEDGIGLDAAEAVEVSAKTGLNVDKVLEAIVERLPAP-EGDSDAPLQALIFDSWYDSYQGVVVMFRVMHGTIRKGDSIQMMATGKKYEVTRLGVFSPEAKDVDCFTAGDVGFLCAAIKELGDAKVGDTVTHSSRPAATPLPGFKEVKPMVFCGLYPTDSSEYEQLKYALEKLQLNDAAFSFEAETSQALGFGYRCGFLGLLHMEIVQERLEREFNIGLIATAPSVVYKVLTVDGEEKYIENPAALPDPTKIEGLYEPYVRMEIHVPNEFVGNVFKLCEEKRGIQKDMRYLAVNRVIITYELPFAEIVYDFFDKLKSLTRGYASMDYEIIDYRQSNLVKLDMLINGDPVDALACIVHRDKAYYQGRAIALRLKRTIPRQMFEVVVQAAIGNKIIARERNAPLRKNVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAAL 596
>gi|167768728|ref|ZP_02440781.1| hypothetical protein ANACOL_00045 [Anaerotruncus colihominis DSM 17241] >gi|167669126|gb|EDS13256.1| hypothetical protein ANACOL_00045 [Anaerotruncus colihominis DSM 17241] (603 aa)
Score = 1804, Expect = 0.0e+00, Identities = 349/597 (58%), Positives = 461/597 (77%)
  Q:     1 MDKKY-IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGV-NTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK+  IRNF I+AHIDHGKSTL+DRI+E T T++ R+M++QILD+MDIERERGITIK  AV L Y    D ++Y F+LIDTPGHVDF YEVSRSLAACEGA+LVVDASQG+EAQTL+N YLA+E++LE+ PVINKIDLP+A+ +RV ++VED IG+ C +AP +SAKTG NI+ ++E ++  IP P   D++ PLQAL+FDSYYDAY+G +  VR+KNG V+ G +IR M+    F V   GV     +V +  L AG+VG+I ASIK ++  +VGDT+TD ANPA   LPGY+K+LPMV+ G++P D  +Y   ++ALEK+ L+D+SL++E ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ ++ T PSV+YK++L++G  + ID+ A  PD       QEPF KA I  P  ++GN+M+LCQ+ RG Y+D   +D+ R ++ Y +PL EI+Y FFD LKS ++GYA+ DYE+  YR   LVK+DILLNG  VDALS I H + A  R+R+IC  L+++IP+  FE+PIQA IGGK+IARETV AMRK+VLAKCYGGDITRKKKLLE+QKEGKK+++ +G+VSVP + F  +L
  S:     1 MDKRRNIRNFCIIAHIDHGKSTLADRILELTETVSKRDMEDQILDNMDIERERGITIKARAVSLTYR-ADDGEEYQFNLIDTPGHVDFNYEVSRSLAACEGAILVVDASQGIEAQTLANTYLAIEHDLEVTPVINKIDLPAAEPERVAQEVEDIIGIPCMDAPRISAKTGENIHAVLERVVSDIPAP-RGDEDAPLQALIFDSYYDAYRGVIVYVRVKNGVVRPGMRIRMMATGAEFDVVECGVMGATSLVPRSELFAGQVGYITASIKTVRDTAVGDTVTDAANPAAEPLPGYRKVLPMVFSGIFPQDGAKYPDLRDALEKLQLNDASLSFEPETSVALGFGFRCGFLGLLHMEIIQERLEREFNLDIVTTLPSVVYKLILSNGEEISIDNPASYPDPGQITTAQEPFVKANIFTPTAYIGNIMDLCQDRRGVYIDTKYLDADRVELHYELPLNEIVYDFFDALKSRTRGYASFDYEMCGYRDSKLVKLDILLNGEVVDALSFIAHADKAYPRARRICENLRDNIPRQLFEVPIQAAIGGKVIARETVRAMRKDVLAKCYGGDITRKKKLLEKQKEGKKKMRQLGSVSVPPEAFTAVL 597
>gi|46396455|sp|Q8GCP5|LEPA_MYCFE GTP-binding protein lepA >gi|26984084|gb|AAN85212.1| LepA [Mycoplasma fermentans] (599 aa)
Score = 1803, Expect = 0.0e+00, Identities = 351/597 (58%), Positives = 464/597 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK  IRNFSI+AHIDHGKSTL+DRI+E TNT++  +M +Q LD MD+ERERGITIKLNAVQ+ Y      +DY FHLIDTPGHVDFTYEVSRSLAA EGALL+VDA+QG+EAQTL+NVYLALENNL I+P+INKIDLPSADI+  K ++E+ IGL   NA  +SAKTGLN   ++ AI + IP P D+DD+KPL+AL+FDSY+D Y+G V L+RI  G++KVG +  FMSN + + VS LGV +PK   K+ L AGEVG++AA+I++ + +SVGDTIT    PA  +LPGYKK  P++Y G YPID+  Y   KE+LEKI LSDSS+T+E ETS+ALGFG R GFLG+LHM++++ERL+RE+ I +IAT+PSV Y V + DG+I +I + A LPD+T    I EP+ KAEI+VP++++GNVMELCQN RG Y+++  +D+ R ++ Y +PL EI++ FFD+LKS +KGYA+ +Y+++ Y+  DLVKVDILLNG+K+DA S I H++ A  ++R +  KLKE IP+  FE+P+QA IG KIIARET+ A RK+V +K +  D++R KKLLE+QK GKK++K +G V VP + F+ IL
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILEITNTVSDHDMDDQFLDQMDLERERGITIKLNAVQIKY------KDYVFHLIDTPGHVDFTYEVSRSLAASEGALLLVDATQGIEAQTLANVYLALENNLTIIPIINKIDLPSADIEATKNEIEEVIGLPTDNAVCISAKTGLNCEAVLAAIEKYIPAPKDADDSKPLKALIFDSYFDEYRGVVMLIRIFEGELKVGDEFMFMSNGQRYFVSELGVRSPKETKKKRLEAGEVGYVAATIRDAREVSVGDTITLVNRPAEKALPGYKKKKPVLYTGFYPIDTRDYMELKESLEKIALSDSSITWEQETSKALGFGFRVGFLGMLHMEILQERLNREYKIGIIATSPSVEYDVHMTDGSIKKISNPALLPDRTFIDHIDEPYIKAEILVPNEYIGNVMELCQNKRGIYINMDYIDANRSRLIYEMPLGEIIFDFFDRLKSLTKGYASFEYDLIGYKTSDLVKVDILLNGDKIDAFSIITHKDSAYSKARDLTQKLKEAIPRQNFEVPVQATIGSKIIARETIKAYRKDVTSKLHAADVSRYKKLLEKQKAGKKKMKMLGTVEVPQEAFLSIL 591
>gi|110636399|ref|YP_676607.1| GTP-binding protein LepA [Mesorhizobium sp. BNC1] >gi|119371365|sp|Q11AY3|LEPA_MESSB GTP-binding protein lepA >gi|110287383|gb|ABG65442.1| GTP-binding protein LepA [Mesorhizobium sp. BNC1] (605 aa)
Score = 1802, Expect = 0.0e+00, Identities = 334/594 (56%), Positives = 452/594 (76%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K IRNF+IVAHIDHGKSTL+DR+I+ T +L  REMK Q+LDSMDIERERGITIK N V+L Y + +D + Y  +LIDTPGHVDF YEVSRSLAACE +LLVVDASQGVEAQTL+NVY A++NN EIVPV+NK+DLP+A+ +RVK Q+ED IGLD S+A  +SAKTG+ +++++EAI+ ++PPP + D + PL+AL+ DS+YDAY G + LVRI +G +K G  +R M     + V  +GV TPK+V  E L  GE+G+I ASIK +    VGDTIT+D      +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+Y++ L DG  +E+ + A +PD     EI+EP+ +A I+ PD+ LG +++LCQ+ RG   DL +   +R  + Y +PL E+++ F+D+LKS S+GYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA IGG+IIARET+SA+RK+V AKCYGGD+TRK+KLLE+QKEGKK+++  G V +P + F++ L
  S:    10 KNIRNFAIVAHIDHGKSTLADRLIQMTGSLEEREMKEQVLDSMDIERERGITIKANTVRLEY-DARDGEHYVLNLIDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANVYQAIDNNHEIVPVLNKVDLPAAEPERVKAQIEDVIGLDASDAIPISAKTGVGVDEVLEAIVMRLPPPHEGDASAPLKALLVDSWYDAYLGVIVLVRIIDGVLKKGQTVRMMGTGARYPVDRVGVMTPKMVMVESLGPGEIGFITASIKEVADTRVGDTITEDKRATAAALPGFKPAQPVVFCGLFPVDAADFEDLRAAVGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLTREFDLDLIATAPSVVYRMNLTDGKTVELHNPADMPDPVKIAEIEEPWIRATILTPDEHLGGILKLCQDRRGVQADL-SYAGSRAMLVYDLPLNEVVFDFYDRLKSISRGYASFDYHLTDYREGDLVKMSILVNDEPVDALSMLVHRSQAERRGRAMCEKLKELIPQHMFKIPIQAAIGGRIIARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKKMRQFGKVEIPQEAFIQAL 601
>gi|89210898|ref|ZP_01189281.1| Small GTP-binding protein domain:GTP-binding protein LepA [Halothermothrix orenii H 168] >gi|89159538|gb|EAR79203.1| Small GTP-binding protein domain:GTP-binding protein LepA [Halothermothrix orenii H 168] (595 aa)
Score = 1800, Expect = 0.0e+00, Identities = 347/597 (58%), Positives = 459/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD  +IRNF I+AHIDHGKSTL+DR++E+T T++ REM++Q+LD MD+ERERGITIK  AV+L Y      + Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTL+N+YLALE++LEI+PVINKIDLPSAD +RVK+Q+ + IGL+  N  L SAK G  I  +++AI+E +PPP ++  N+PL+ALVFDS+YD+Y+G V  VRI NG++  G KI  MSN +T+ V  LG+  P +     L AG+VG++ A IK++K+  VGDTIT    PA + LPGYKK+ PMV+ GLYP DS  YEL K+ALEK+ L+D+SL++E ETS+ALGFG RCGFLGLLHM++I+ERL+RE+ + L+ TAPSV Y++   DG  LEI++ A+ P++   + I+EPF +AEI +P++F+G  MELCQ+ RGE+ D+  VD  R  + Y IPL+E++  FF++LKS ++GYATLDYE   Y++ +LVK+DIL+NG  VDALS I+HR+ A  R R +  KLK+ IP+  FE+PIQA IG KIIAR  + A+RKNVL KCYGGD+TRK+KLLE+QKEGKKR+K +G V +P   F+ +L
  S:     1 MDTSHIRNFCIIAHIDHGKSTLADRLLEYTGTISDREMQDQVLDKMDLERERGITIKAQAVRLNY------KGYELNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANIYLALEHDLEIIPVINKIDLPSADPERVKEQLIE-IGLEVDNVILTSAKEGTGIQDVLDAIVELVPPP-ENTVNRPLRALVFDSFYDSYQGVVAYVRIVNGEISPGDKIMMMSNQKTYEVDELGIFVPDMKTVNKLRAGDVGYVIAGIKDVKNCRVGDTITLSNKPAESPLPGYKKVKPMVFSGLYPTDSNDYELLKDALEKLQLNDASLSFEPETSEALGFGFRCGFLGLLHMEIIQERLEREYGLNLVVTAPSVNYRINTVDGEKLEIENPAEFPEQQQIESIEEPFVRAEIYLPEEFVGQAMELCQDNRGEFKDMQYVDRDRVSLIYEIPLSELITDFFNQLKSKTRGYATLDYEFKGYKESNLVKLDILINGEVVDALSCIVHRDSAEARGRSLIRKLKKLIPRQMFEVPIQAAIGNKIIARVNIKALRKNVLQKCYGGDVTRKRKLLEKQKEGKKRMKKVGKVEIPQKAFMAVL 589
>gi|167759411|ref|ZP_02431538.1| hypothetical protein CLOSCI_01758 [Clostridium scindens ATCC 35704] >gi|167662968|gb|EDS07098.1| hypothetical protein CLOSCI_01758 [Clostridium scindens ATCC 35704] (604 aa)
Score = 1799, Expect = 0.0e+00, Identities = 342/597 (57%), Positives = 459/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALG-VNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRIIE T  LT+REM++Q+LD+M++ERERGITIK  AV+ +Y   KD ++Y F+LIDTPGHVDF YEVSRSLAAC+GA+LVVDA+QGVEAQTL+NVYLAL+++L+++PVINK+DLPSA+ +RV +++ED IG++ ++AP +SAKTGLNI+Q++E I+E+IP P   D   PL+AL+FDS YD+YKG +   RIK G VK GT I+ M+      V  +G     + +  + L AG VG+I AS+KN+K   VGDTITD + P    LPGYKK+ PMVYCG+YP D  +Y   ++ALEK+ L+D+SL +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAP VIYKV   +G ++E+ + + LPD +  + ++EP  KAEI+V  +F+G +M+LCQ  RG Y  +  ++ TR  + Y +PL EI+Y FFD LKS S+GYA+ DYE+  Y + +LVK+DIL+N  +VDALS I+H + A +R RK+C KLKE IP+  FEIPIQA IG KIIARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +GNV +P   F+ +L
  S:     4 IDQSRIRNFCIIAHIDHGKSTLADRIIEKTGLLTSREMQSQVLDNMELERERGITIKAQAVRTVYQ-AKDGEEYIFNLIDTPGHVDFNYEVSRSLAACDGAILVVDAAQGVEAQTLANVYLALDHDLDVMPVINKVDLPSAEPERVIEEIEDVIGIEATDAPQISAKTGLNIDQVLEQIVEKIPAP-QGDPKAPLKALIFDSLYDSYKGVIVFCRIKEGSVKKGTPIQMMATGAKAEVVEVGYFGAGQFIPCDELNAGMVGYITASLKNVKDTRVGDTITDASRPCDKPLPGYKKVNPMVYCGMYPADGAKYPDLRDALEKLQLNDASLQFEPETSIALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPGVIYKVYKTNGEVIELTNPSNLPDPSEIEYMEEPMVKAEIMVTSEFIGAIMDLCQERRGIYEGMEYIEETRAVLRYHLPLNEIIYDFFDALKSRSRGYASFDYEMDGYVQSNLVKLDILINKEEVDALSFIIHADTAYERGRKMCEKLKEEIPRQLFEIPIQAAIGSKIIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGNVEIPQKAFMSVL 599
>gi|94967275|ref|YP_589323.1| GTP-binding protein LepA [Acidobacteria bacterium Ellin345] >gi|119371324|sp|Q1IV51|LEPA_ACIBL GTP-binding protein lepA >gi|94549325|gb|ABF39249.1| GTP-binding protein LepA [Acidobacteria bacterium Ellin345] (601 aa)
Score = 1798, Expect = 0.0e+00, Identities = 332/597 (55%), Positives = 457/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD+ +IRNF+I+AHIDHGKSTLSDR++E T +LT REM+ Q+LD+MD+ERERGITIK ++V+++Y    D+  Y  +LIDTPGHVDF+YEVSRSLA+CEGALLVVDASQGVEAQTL+N YLA+ N LEI+PVINKIDLPSAD++R K+ +E  +GLD S+A  +SAKTG+ +  I+E+I+  +PPP  + D+ PLQAL+FDS++D+Y+G V L RIK G V+ G KI   SN   F+V  +GV TPK V  E L AGEVG+I A+IK +  + +GDTIT    P   +LPG++++ PMV+ G+Y +D+ ++ L +EALEK+ L+DSS  +E E+S ALGFG RCGFLGLLHM++I+ERL+RE+++ LI TAP V YK+ L D +++E+D+ +K PD TL ++I+EP   A I+  ++++G +++L +  RG   +   V  +R  +TY +PL EI+  F+D+LKS S+GYA+LDY +    +  +VK+DI++ G  VDALSTI+H++FA DR R +  K++E IP+  FE+PIQA IG KIIARETV+AMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K IG V +P + F+ +L
  S:     1 MDRSFIRNFAIIAHIDHGKSTLSDRLLELTGSLTAREMQAQVLDAMDLERERGITIKAHSVRMMY-KAHDDVVYQLNLIDTPGHVDFSYEVSRSLASCEGALLVVDASQGVEAQTLANAYLAINNGLEIIPVINKIDLPSADVERAKEMIEGAVGLDASHALPISAKTGMGVEDILESIVHLVPPPKGNPDH-PLQALIFDSWFDSYRGVVILARIKEGTVRKGDKIMLWSNKHQFLVEEMGVLTPKPVAIEQLEAGEVGFIVANIKTVADVGIGDTITHVERPCLEALPGFEELKPMVFAGIYTVDAHEHTLLREALEKLRLNDSSFFFEPESSVALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPGVRYKITLTDNSVIEVDNPSKWPDSTLIEKIEEPIITAMILTNEEYVGGILKLVEEKRGRQKNFEYVTGSRVMLTYELPLNEIVLDFYDRLKSVSRGYASLDYHLAGAWESPMVKLDIMVAGESVDALSTIVHKDFAYDRGRALVSKMRELIPRQMFEVPIQAAIGAKIIARETVAAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKRIGKVDIPQEAFLAVL 595
>gi|148377744|ref|YP_001256620.1| GTP-binding protein LepA [Mycoplasma agalactiae PG2] >gi|148291790|emb|CAL59179.1| GTP-binding protein (LepA) [Mycoplasma agalactiae PG2] (597 aa)
Score = 1797, Expect = 0.0e+00, Identities = 346/597 (57%), Positives = 465/597 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MDK  IRNFSI+AHIDHGKSTL+DRI+E TNT+  R+++ Q LD MD+ERERGITIKLNAVQ+ Y      +DY FHLIDTPGHVDFTYEVSRSLAA EGALL+VDA+QG+EAQTL+NVYLALENNLEI+P+INKIDLPSA++++ K+++E+ IG+   NA  VSAKTGLN  ++++AI++ +P P D+DDNKPL+AL+FDSY+D Y+G + L+R+  G++KVG   +FMSNN  + V  LGV  PK   KE L AGEVG++AA+I++ K + VGDTIT   NPA   LPGYK+  P+++ G YPID+  Y   K++L+KI LSDSSLT+E ETS+ALGFG R GFLG+LHMDVI+ERL RE+ + +IAT+PSV YKV+  +GT   I + + +PD+T    I+EP+ +A II+P++++GN+M+LCQN RG Y  L  +D +R ++ Y +PL EI++ FFDK+KS SKGYA+ +Y+++ Y+  DLVKVDILLNG+K+DA S I H++ A ++SR +  +LK+ IP+  FE+P+QA IGGKIIARET+ A RK+V  K +  DI+R KKLLE+QK GKK++K +G+V VP + F+ IL
  S:     1 MDKSKIRNFSIIAHIDHGKSTLADRILELTNTVAARDLEEQFLDQMDLERERGITIKLNAVQIKY------KDYTFHLIDTPGHVDFTYEVSRSLAASEGALLLVDATQGIEAQTLANVYLALENNLEIIPIINKIDLPSANVEKTKEEIENVIGIPADNAVCVSAKTGLNCEKVLDAIVDYVPAPKDADDNKPLKALIFDSYFDEYRGVIMLIRVFQGKLKVGDDFKFMSNNANYHVIELGVRNPKETKKEYLEAGEVGYVAATIRDAKEVHVGDTITLVENPALEPLPGYKRKKPVLFTGFYPIDTRDYAELKKSLDKISLSDSSLTWEQETSKALGFGFRVGFLGMLHMDVIQERLSREYKVGIIATSPSVEYKVVKTNGTFEMISNPSLMPDRTYIDHIEEPYIEATIILPNEYIGNIMDLCQNKRGIYKSLDYIDDSRSRLIYEMPLGEIVFDFFDKMKSLSKGYASFEYDLIGYKTSDLVKVDILLNGDKIDAFSIITHKDSAYEKSRDLTKRLKDAIPRQNFEVPVQATIGGKIIARETIKAFRKDVTHKLHASDISRYKKLLEKQKAGKKKMKMLGSVEVPQEAFLDIL 591
>gi|27383261|ref|NP_774790.1| GTP-binding protein LepA [Bradyrhizobium japonicum USDA 110] >gi|27356435|dbj|BAC53415.1| GTP-binding elongation factor [Bradyrhizobium japonicum USDA 110] (616 aa)
Score = 1795, Expect = 0.0e+00, Identities = 338/592 (57%), Positives = 449/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  LT REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+NN EIVPV+NK+DLP+A+ ++VK+Q+ED IG+D S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V L+R+ +G +K G+++R M     + V  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DGT LEI +   +PD    +EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:    22 IRNFSIVAHIDHGKSTLADRLIQMTGGLTDREMAGKEQVLDSMDIERERGITIKAQTVRLAYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKVDLPAAEPEKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAIVTRLPPP-KGDRDATLKALLVDSWYDVYLGVVVLIRVVDGVMKKGSRVRMMGTGAAYDVERVGFFTPKMTQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLTDGTELEIHNPVDMPDVVKIEEIQEPWIEATILTPDEYLGSVLKLCQDRRGAQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 612
>gi|114568702|ref|YP_755382.1| GTP-binding protein LepA [Maricaulis maris MCS10] >gi|114339164|gb|ABI64444.1| GTP-binding protein LepA [Maricaulis maris MCS10] (608 aa)
Score = 1795, Expect = 0.0e+00, Identities = 332/597 (55%), Positives = 450/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D   IRNFSIVAHIDHGKSTL+DR+I+ T  LT REMK Q+LD+M++ERERGITIK   V+L Y   KD + Y  +LIDTPGHVDF YEV+RSLAACEG+LLVVDASQGVEAQTL+NVY A+E N EIVPV+NKIDLP+A+ +RVK+Q+ED IGLD S+A ++SAKTGL I  ++EA++ ++PPP   D N PL+A++ DS+YD Y G +CLVR+  G +K G K+R M    T+ V  +GV  PK    + L  GE+G++ ASIK ++   VGDT+TDD  PA  +L GYK   P+V+CGL+P+DS ++E  +EA+E++ L+D+S +YE ETS ALGFG RCGFLGLLH++VIRERL+RE+NI LI TAPSV+Y++ +NDG+ +++ + A +PD      I EP+ KA I+VPD++LG V++LCQ+ RG  ++L      R  V Y +PL E+++ F+D+LKS SKGYA+ DY+ ++ R  DLV++ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA +GG+I+ARET+SA+RK+V AKCYGGD +RK+KLL++QK GKK+++  G V +P + F+  L
  S:     9 IDPSLIRNFSIVAHIDHGKSTLADRLIQVTGGLTQREMKEQVLDNMELERERGITIKAQTVRLDY-TAKDGKTYVLNLIDTPGHVDFAYEVNRSLAACEGSLLVVDASQGVEAQTLANVYQAIEVNHEIVPVLNKIDLPAAEPERVKEQIEDVIGLDASDAVMISAKTGLGIEDVLEAVVTRLPPPAAGDPNGPLKAMLVDSWYDPYLGVICLVRVIEGTLKKGMKVRLMGTGATYPVDGVGVFRPKKEAIDSLGPGELGYLNASIKQVRDARVGDTVTDDRRPADKALTGYKPAQPVVFCGLFPVDSAEFEDLREAIERLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRERLEREYNIELITTAPSVVYRLHMNDGSEIDLHNPADMPDPVKIDTIAEPWIKATILVPDEYLGGVLKLCQDRRGNQVELTYA-GNRALVVYELPLNEVVFDFYDRLKSISKGYASFDYQWIEDRVGDLVRMSILVNDEPVDALSMVVHRARAELRGRAMCEKLKELIPRHMFKIPIQAALGGRIVARETLSALRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQEAFIAAL 603
>gi|83945030|ref|ZP_00957396.1| GTP-binding protein LepA [Oceanicaulis alexandrii HTCC2633] >gi|83851812|gb|EAP89667.1| GTP-binding protein LepA [Oceanicaulis alexandrii HTCC2633] (602 aa)
Score = 1794, Expect = 0.0e+00, Identities = 332/596 (55%), Positives = 452/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D   IRNFSIVAHIDHGKSTL+DR+I+ T  LT REMK Q+LD+M++ERERGITIK   V+L Y   KD   Y  +LIDTPGHVDF YEVSRSL ACEGALLVVDA+QGVEAQTL+NVY A++ +LEIVPV+NKIDLP+A+ DRVK Q+ED IG+D S+A  +SAKTGL I+ ++EAI+ ++P P   D + PL+AL+ DS+YD Y G +CLVRI  G +K G ++R M    ++ V  +GV TP   N++ L  GE+G++ ASIK ++   VGDTIT++  P  + LPG++  +P+V+CGL+P+D+  +E  ++A+E++ L+D+S ++E ETS ALGFG RCGFLGLLH++VIRERL+RE+N+ LI TAPSV+YK+ L DGT +++ + A +PD      I EP+ KA I+VPD++LG V++LCQ+ RG  L+L    + R  + Y +PL E+++ F+D+LKS +KGYA+ DY+ +++R++DLVK+ IL+N   VDALS I+HR  A  R R +C KLKE IP+H F+IPIQA IGG++IARET+SAMRK+V AKCYGGD TRK+KLLE+QK GKK+++  GNV +P + F+  L
  S:     4 DPSLIRNFSIVAHIDHGKSTLADRLIQHTGGLTDREMKEQVLDNMELERERGITIKAQTVRLEY-TAKDGNTYALNLIDTPGHVDFAYEVSRSLYACEGALLVVDAAQGVEAQTLANVYAAIDVDLEIVPVLNKIDLPAAEPDRVKAQIEDVIGIDASDAIEISAKTGLGIDNVLEAIVTRLPAPKSGDPSAPLKALLVDSWYDPYLGVICLVRIIEGTLKKGMRVRLMGAKASYGVDGVGVFTPAKENRDSLGPGEIGFLNASIKQVRDARVGDTITEEKRPTDSMLPGFEPAVPVVFCGLFPVDAADFEDLRDAVERLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRERLEREYNVDLITTAPSVVYKMQLTDGTEIDLHNPADMPDPVKIASIAEPWIKATILVPDEYLGGVLKLCQDRRGVQLELTYAGA-RAMLVYELPLNEVVFDFYDRLKSVTKGYASFDYQFIEHREEDLVKMSILVNEEPVDALSMIVHRSRADMRGRAMCEKLKELIPRHMFKIPIQAAIGGRVIARETLSAMRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQYGNVEIPQEAFIAAL 597
>gi|119371364|sp|Q0ATE3|LEPA_MARMM GTP-binding protein lepA (602 aa)
Score = 1794, Expect = 0.0e+00, Identities = 332/597 (55%), Positives = 450/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D   IRNFSIVAHIDHGKSTL+DR+I+ T  LT REMK Q+LD+M++ERERGITIK   V+L Y   KD + Y  +LIDTPGHVDF YEV+RSLAACEG+LLVVDASQGVEAQTL+NVY A+E N EIVPV+NKIDLP+A+ +RVK+Q+ED IGLD S+A ++SAKTGL I  ++EA++ ++PPP   D N PL+A++ DS+YD Y G +CLVR+  G +K G K+R M    T+ V  +GV  PK    + L  GE+G++ ASIK ++   VGDT+TDD  PA  +L GYK   P+V+CGL+P+DS ++E  +EA+E++ L+D+S +YE ETS ALGFG RCGFLGLLH++VIRERL+RE+NI LI TAPSV+Y++ +NDG+ +++ + A +PD      I EP+ KA I+VPD++LG V++LCQ+ RG  ++L      R  V Y +PL E+++ F+D+LKS SKGYA+ DY+ ++ R  DLV++ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA +GG+I+ARET+SA+RK+V AKCYGGD +RK+KLL++QK GKK+++  G V +P + F+  L
  S:     3 IDPSLIRNFSIVAHIDHGKSTLADRLIQVTGGLTQREMKEQVLDNMELERERGITIKAQTVRLDY-TAKDGKTYVLNLIDTPGHVDFAYEVNRSLAACEGSLLVVDASQGVEAQTLANVYQAIEVNHEIVPVLNKIDLPAAEPERVKEQIEDVIGLDASDAVMISAKTGLGIEDVLEAVVTRLPPPAAGDPNGPLKAMLVDSWYDPYLGVICLVRVIEGTLKKGMKVRLMGTGATYPVDGVGVFRPKKEAIDSLGPGELGYLNASIKQVRDARVGDTVTDDRRPADKALTGYKPAQPVVFCGLFPVDSAEFEDLREAIERLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRERLEREYNIELITTAPSVVYRLHMNDGSEIDLHNPADMPDPVKIDTIAEPWIKATILVPDEYLGGVLKLCQDRRGNQVELTYA-GNRALVVYELPLNEVVFDFYDRLKSISKGYASFDYQWIEDRVGDLVRMSILVNDEPVDALSMVVHRARAELRGRAMCEKLKELIPRHMFKIPIQAALGGRIVARETLSALRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQEAFIAAL 597
>gi|110602285|ref|ZP_01390406.1| Small GTP-binding protein domain [Geobacter sp. FRC-32] >gi|110546997|gb|EAT60302.1| Small GTP-binding protein domain [Geobacter sp. FRC-32] (599 aa)
Score = 1794, Expect = 0.0e+00, Identities = 345/595 (57%), Positives = 454/595 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+DR++E+T  LT REM+NQ+LD MD+ERERGITIK  AV+L Y    D + Y  +LIDTPGHVDFTYEVSRSL+ACEGALLVVDASQGVEAQTL+NVYLALEN+L++ PV+NKIDLP+A+ +RVK+++ED IGLD  +A L SAK G+   +I+E I+ +IPPP   D  KPL+AL+FDS+YD Y+G + LVRI +G VK G KI+ MSN   + V  +GV +P +     L AGEVG+I   IK+++   VGDTIT+  NP    L G+K++ PMV+ GLYPID++QYE  ++AL K+ L+DSS +YE ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ LI TAP+V+YKV   DG+I+ I+SA +LP     + ++EPF  A I VP++F+G ++ LC+  RG   ++  +  TR  + Y +PL E++  F+D+LKS +KGYA+LDYE LDYR+ +L +++I++NG  VDALS I+H+E A  R R +  K+KE IP+  FEI IQA IG K+IARETV A+RK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL  E
  S:     6 IRNFSIIAHIDHGKSTLADRLLEYTGALTEREMQNQVLDKMDLERERGITIKAQAVRLNYQ-ANDGRQYILNLIDTPGHVDFTYEVSRSLSACEGALLVVDASQGVEAQTLANVYLALENDLDVFPVLNKIDLPAAEPERVKQEIEDIIGLDAHDAVLASAKEGIGTREILEEIVNKIPPP-RGDAAKPLKALLFDSWYDQYQGVIVLVRILDGSVKKGDKIQLMSNRRNYEVLKVGVFSPAMCEVASLSAGEVGFIIGGIKDVQDAKVGDTITNLHNPCDAPLSGFKEVQPMVFSGLYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLEREFNLDLITTAPTVVYKVHRLDGSIITIESANQLPPTQEIEFVEEPFILASIHVPNEFVGGILALCEEKRGVQREIKYLTPTRVMIVYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRRSNLERLNIMINGEVVDALSLIIHKEKAYYRGRDLVSKMKELIPRQMFEIAIQAAIGNKVIARETVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598
>gi|23500761|ref|NP_700201.1| GTP-binding protein LepA [Brucella suis 1330] >gi|148558176|ref|YP_001257949.1| GTP-binding protein LepA [Brucella ovis ATCC 25840] >gi|161621087|ref|YP_001594973.1| GTP-binding protein LepA [Brucella canis ATCC 23365] >gi|163845152|ref|YP_001622807.1| GTP-binding protein LepA [Brucella suis ATCC 23445] >gi|166223171|sp|A5VVU4|LEPA_BRUO2 GTP-binding protein lepA >gi|189046430|sp|A9MCW5|LEPA_BRUC2 GTP-binding protein lepA >gi|189046431|sp|A9WW49|LEPA_BRUSI GTP-binding protein lepA >gi|33112376|sp|Q8FV17|LEPA_BRUSU GTP-binding protein lepA >gi|23464416|gb|AAN34206.1| GTP-binding protein LepA [Brucella suis 1330] >gi|148369461|gb|ABQ62333.1| GTP-binding protein LepA [Brucella ovis ATCC 25840] >gi|161337898|gb|ABX64202.1| GTP-binding protein LepA [Brucella canis ATCC 23365] >gi|163675875|gb|ABY39985.1| GTP-binding protein LepA [Brucella suis ATCC 23445] (602 aa)
Score = 1793, Expect = 0.0e+00, Identities = 337/593 (56%), Positives = 448/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK+Q+LDSMDIERERGITIK   V+L Y   K+ +DY  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++NN EIV V+NKIDLP+A+ +RVK+Q+E+ IG+D S+A  +SAKTGL I  ++EAI+ ++P P + D N PL+A++ DS+YD+Y G + LVR+ +G +K G  IR M     + V   GV TPK+V  + L  GE+G+I ASIK +    VGDTIT+D  P    L G+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI TAPSV+Y++ + DGT  E+ + A +PD      I+EP+ KA I+ PDD+LG +M+LCQ  RG  +DL  V   R  +TY +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA IGG+I+ARET+SA+RK+V AKCYGGD+TRK+KLLE+QKEGKKR++  G V +P + F++ L
  S:     7 HIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQTVRLSY-KAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVNKLPAPKEGDRNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVERTGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVFCGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLGAIMKLCQERRGIQIDLTYV-GPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYREGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQAL 597
>gi|22297848|ref|NP_681095.1| GTP-binding protein LepA [Thermosynechococcus elongatus BP-1] >gi|33112368|sp|Q8DM20|LEPA_SYNEL GTP-binding protein lepA >gi|22294025|dbj|BAC07857.1| GTP-binding protein [Thermosynechococcus elongatus BP-1] (603 aa)
Score = 1791, Expect = 0.0e+00, Identities = 335/593 (56%), Positives = 455/593 (76%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSI+AHIDHGKSTL+DR+++ T T+  REMK Q LD+M++ERERGITIKL A ++ Y   +D + Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALE+NLEI+PV+NKIDLP A+ DRVK ++E+ IGLDCS A L SAK G+ I +I+E+I+  +PPP D+ D +PL+AL+FDSYYDAY+G +   R+ +G V+ G +IR M++ + + +  LGV  P     E L AGEVG++AA+IK +    VGDTIT   NPA   LPGY +  PMV+CGL+P D+ Q+E  +EALEK+ L+D+SL YE ETS A+GFG RCGFLGLLHM++I+ERL+RE+N+ LI TAPSV+Y+V    G +L ID+ + LP+    ++I+EP+ + E+I P+ ++G +MEL Q+ RG + D+  +   R  + Y +PLAEI+  FFD++KS S+GYA+++Y ++ YR  DLVK+DIL+N + VD+L+ I+HR+ A    R +  KLK+ IP+HQF+IPIQA IG ++IA E++ A+RK+VLAKCYGGD+TRK+KLLE+QK GKKR+KAIG V VP + F+ +L
  S:     8 HIRNFSIIAHIDHGKSTLADRLLQLTGTVDPREMKEQFLDNMELERERGITIKLQAARMTY-TSRDGETYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALEHNLEIIPVLNKIDLPGAEPDRVKAEIEEIIGLDCSQAVLASAKEGIGIEEILESIVHLVPPPRDTVD-QPLRALIFDSYYDAYRGVIVYFRVMDGIVRRGDRIRLMASGKEYEIDELGVLAPNQKPVESLHAGEVGYLAAAIKAVGDARVGDTITLAHNPAKEPLPGYTEAKPMVFCGLFPTDADQFEDLREALEKLKLNDASLHYEPETSSAMGFGFRCGFLGLLHMEIIQERLEREYNLDLIITAPSVVYRVTTVKGEVLMIDNPSLLPEPQYREKIEEPYVQLEMITPETYVGTLMELAQSRRGIFKDMRYLTQGRTTLVYEMPLAEIVTDFFDEMKSRSRGYASMEYHLIGYRANDLVKLDILINNDPVDSLAAIVHRDKAYHVGRALVSKLKDLIPRHQFKIPIQAAIGSRVIASESIPALRKDVLAKCYGGDVTRKRKLLEKQKAGKKRMKAIGRVDVPQEAFMAVL 598
>gi|153008672|ref|YP_001369887.1| GTP-binding protein LepA [Ochrobactrum anthropi ATCC 49188] >gi|166224503|sp|A6WYK4|LEPA_OCHA4 GTP-binding protein lepA >gi|151560560|gb|ABS14058.1| GTP-binding protein LepA [Ochrobactrum anthropi ATCC 49188] (602 aa)
Score = 1790, Expect = 0.0e+00, Identities = 335/593 (56%), Positives = 447/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK+Q+LDSMDIERERGITIK   V+L Y   K+ +DY  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++NN EIV V+NKIDLP+A+ +RVK+Q+E+ IG+D + A  +SAKTG+ I  ++EAI+ Q+P P + D N PL+A++ DS+YD+Y G + LVRI +G +K G  IR M     + V   GV TPK+V  + L  GE+G+I ASIK +    VGDTIT+D  P    L G+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI TAPSV+Y++ + DG+  E+ + A +PD      I+EP+ +A I+ PDD+LG +M+LCQ  RG  +DL  V   R  +TY +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA IGG+I+ARET+SA+RK+V AKCYGGD+TRK+KLLE+QKEGKKR++  G V +P + F++ L
  S:     7 HIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQTVRLSY-KAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDAAQAVHISAKTGIGIEDVLEAIVTQLPAPKEGDRNAPLKAMLVDSWYDSYLGVIVLVRIIDGVLKKGQTIRMMGTGAKYPVERTGVFTPKMVQVDELGPGELGFITASIKEVADTRVGDTITEDRRPTNKMLSGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLITTAPSVVYRLNMQDGSQKELHNPADMPDVVKINAIEEPWIRATIMTPDDYLGAIMKLCQERRGLQIDLTYV-GPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYREGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQAL 597
>gi|196255928|ref|ZP_03154466.1| GTP-binding protein LepA [Cyanothece sp. PCC 7822] >gi|196203108|gb|EDX97925.1| GTP-binding protein LepA [Cyanothece sp. PCC 7822] (604 aa)
Score = 1790, Expect = 0.0e+00, Identities = 333/592 (56%), Positives = 457/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  R+MK Q LD++D+ERERGITIKL A ++ Y   KD Q Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+ +RV +++E+ +GLDCS     SAK G+ I++I+E+I+  +PPP D+  N+PL+AL+FDSYYDAY+G V   R+ +G VK G ++  M++ + + +  LGV +P  +    L AGEVG+ AA+IK ++   VGDTIT    PA+  LPGYK+  PMV+CGL+P DS QYE  ++AL K+ L+D++L +E ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSV+Y+V   D  +LEID+ ++LP      +I+EP+ K EI+ P+ ++G +M+LCQ+ RGE+ D+     TR  + Y +PLAEI+  FFD+LKS ++GYA+++Y ++ YR+ +LVK+DI++NG+ VDAL+ I+HR+ A +  R +  KLKE IP+HQF++PIQA IG KIIA E + A+RK+VLAKCYGGDITRKKKLLE+Q +GKKR+K+IG V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRMLQVTGTVEERKMKEQFLDNLDLERERGITIKLQAARMNY-TAKDGQHYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPERVAEEIEEIVGLDCSGIIKASAKEGIGIDEILESIVHLVPPPQDTT-NQPLRALIFDSYYDAYRGVVVYFRVMDGTVKKGDRVLLMASGKEYEIDELGVLSPHQIQVNELHAGEVGYFAAAIKTVEDARVGDTITLAQKPASEPLPGYKEAKPMVFCGLFPTDSDQYESLRDALNKLKLNDAALNFEPETSTAMGFGFRCGFLGLLHMEIVQERLEREYDLDLITTAPSVVYQVTTTDEEVLEIDNPSQLPPPQKRIKIEEPYVKVEILTPETYVGALMDLCQSRRGEFKDMRYFTQTRTALIYELPLAEIVTDFFDQLKSRTRGYASMEYHLIGYRENELVKLDIMVNGDGVDALAMIVHRDKAYNVGRALTEKLKELIPRHQFKVPIQAAIGAKIIASEHIPALRKDVLAKCYGGDITRKKKLLEKQAKGKKRMKSIGTVDVPQEAFMAVL 598
>gi|15887591|ref|NP_353272.1| GTP-binding protein LepA [Agrobacterium tumefaciens str. C58] >gi|24211907|sp|Q8UIQ2|LEPA_AGRT5 GTP-binding protein lepA >gi|15155132|gb|AAK86057.1| GTP-binding protein LepA [Agrobacterium tumefaciens str. C58] (608 aa)
Score = 1789, Expect = 0.0e+00, Identities = 334/593 (56%), Positives = 451/593 (76%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPL-DSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  R+M  Q+LDSMDIERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN E+V V+NKIDLP+A+ +R+K+Q+E+ IG+D S+A ++SAKTGL I  ++EAI+ ++PPP  D  +N PL+AL+ DS+YD Y G + LVR+ +G +  G +IR M +   + V  +GV TPK+VN + L  GE+G+I ASIK +    VGDTITDD  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REFN+ L+ATAPSV+Y++ L DGT  E+ + A +PD    KEI+EP+ KA I+ PD++LG +++LCQ+ RG   +L  V   R  +TY +PL E+++ F+D+LKS SKGYA+ DY I+DYR+ DLVK+ IL+NG+ VDALS ++HR  A  R R +C KLKE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGD TRK+KLL++QKEGKKR++  G V +P + F+  L
  S:    12 HIRNFSIVAHIDHGKSTLADRLIQSTGGLAERDMSEQVLDSMDIERERGITIKAQTVRLHY-KANNGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPERIKEQIEEVIGIDASDAVMISAKTGLGIPDVLEAIVNRLPPPKSDVGENGPLKALLVDSWYDTYLGVMVLVRVIDGVLTKGQQIRMMGSGAKYGVERVGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITDDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAVGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLVATAPSVVYEMTLTDGTEKELHNPADMPDVVKIKEIREPWIKATILTPDEYLGGILKLCQDRRGLQTELTYV-GNRAMITYELPLNEVVFDFYDRLKSISKGYASFDYNIIDYREGDLVKMSILVNGDPVDALSMLVHRSAADRRGRGMCEKLKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDATRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAAL 603
>gi|153953532|ref|YP_001394297.1| GTP-binding protein LepA [Clostridium kluyveri DSM 555] >gi|189046433|sp|A5N6L8|LEPA_CLOK5 GTP-binding protein lepA >gi|146346413|gb|EDK32949.1| LepA [Clostridium kluyveri DSM 555] (602 aa)
Score = 1789, Expect = 0.0e+00, Identities = 346/598 (57%), Positives = 461/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K+IRNFSIVAHIDHGKSTL+DR+IE T TLT REM +Q+LD+M++E+ERGITIK  A++LIY   KD  +Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLA+E++LEI+PVINKIDLPSA  + VK+++ED IG++ S APLVSAKTGLNI Q++EAI+++IP P   D+N PL+AL+FDS YD+YKG VC +R+K G +K G +I+ M+  + + V+  G+  P  + +  L AG+VG+  ASIKN++   VGDT+T   N A   L GY+ ++ MVY G+YP+D  +Y   KEALEK+ ++D++L +E ETS ALGFG RCGFLGLLHMDVI+ER++REFN+ +I TAPSVIYK+   DGT++E+ +   +P  +  K ++EP  KA II P +++G VMEL QN RG + D+  +++TR  + Y IPL EI+Y+FFD LKS ++GYA+LDYE+  Y+   LV++D+LLNG+ VDALS I+  E A DR R I  KLK  IP+  FEIPIQA +GGK+IARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G V +P + F+ IL  E
  S:     6 QKHIRNFSIVAHIDHGKSTLADRLIEKTGTLTEREMNSQVLDNMELEKERGITIKSQAIRLIYKR-KDGGEYVLNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLAMEHDLEILPVINKIDLPSARAEEVKEEIEDIIGIEASEAPLVSAKTGLNIEQVLEAIVDKIPSP-QGDENAPLKALIFDSNYDSYKGVVCHIRVKEGNIKPGDEIKLMATGKIYEVTETGIFVPNFMPRAELRAGDVGYFTASIKNVRDARVGDTVTGAKNQAKEPLKGYRPVISMVYSGIYPVDGAKYGELKEALEKLQVNDAALNFEPETSVALGFGFRCGFLGLLHMDVIQERVEREFNLDIITTAPSVIYKIGKTDGTVVELTNPTNMPPVSEIKYMEEPIVKASIITPSEYVGAVMELAQNRRGVFRDMQYIETTRVSLNYDIPLNEIIYNFFDVLKSRTRGYASLDYELKGYKSAKLVRLDVLLNGDMVDALSMIVPEERAYDRGRGIAEKLKGIIPRQLFEIPIQAAVGGKVIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGTVEIPQEAFMAILKTE 601
>gi|92116059|ref|YP_575788.1| GTP-binding protein LepA [Nitrobacter hamburgensis X14] >gi|119371372|sp|Q1QR19|LEPA_NITHX GTP-binding protein lepA >gi|91798953|gb|ABE61328.1| GTP-binding protein LepA [Nitrobacter hamburgensis X14] (610 aa)
Score = 1788, Expect = 0.0e+00, Identities = 342/592 (57%), Positives = 447/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REM  K Q+LDSMDIERERGITIK   V+L YH  KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+NN EIVPV+NK+DLP+A+ D+VK+Q+ED IG+D S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V LVRI +G +K  ++IR M  N  + V  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DG  +EI +   +PD     EI EP+ +A I+ PDD+LG+V++LCQ  RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+NG  VDALS ++HR  A  R R +  K+KE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:    16 IRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGITIKAQTVRLNYH-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKVDLPAAEPDKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAIVTRLPPP-QGDRDATLKALLVDSWYDVYLGVVVLVRIVDGVMKKNSRIRMMGTNAAYDVERVGFFTPKMQQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRTAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLTDGGEIEIHNPIDMPDVVKIAEIAEPWIEATILTPDDYLGSVLKLCQERRGSQKELTYVGS-RAMVRYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKVADLVKMQILVNGEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 606
>gi|33112363|sp|Q89BJ8|LEPA_BRAJA GTP-binding protein lepA (603 aa)
Score = 1787, Expect = 0.0e+00, Identities = 338/592 (57%), Positives = 449/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  LT REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+NN EIVPV+NK+DLP+A+ ++VK+Q+ED IG+D S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V L+R+ +G +K G+++R M     + V  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DGT LEI +   +PD    +EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQMTGGLTDREMAGKEQVLDSMDIERERGITIKAQTVRLAYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKVDLPAAEPEKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAIVTRLPPP-KGDRDATLKALLVDSWYDVYLGVVVLIRVVDGVMKKGSRVRMMGTGAAYDVERVGFFTPKMTQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLTDGTELEIHNPVDMPDVVKIEEIQEPWIEATILTPDEYLGSVLKLCQDRRGAQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 599
>gi|17988604|ref|NP_541237.1| GTP-binding protein LepA [Brucella melitensis 16M] >gi|24211916|sp|Q8YDB8|LEPA_BRUME GTP-binding protein lepA >gi|17984405|gb|AAL53501.1| GTP-BINDING PROTEIN LEPA [Brucella melitensis 16M] (602 aa)
Score = 1787, Expect = 0.0e+00, Identities = 336/593 (56%), Positives = 447/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK+Q+LDSMDIERERGITIK   V+L Y   K+ +DY  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++NN EIV V+NKIDLP+A+ +RVK+Q+E+ IG+D S+A  +SAKTGL I  ++EAI+ ++P P + D N PL+A++ DS+YD+Y G + LVR+ +G +K G  IR M     + V   GV TPK+V  + L  GE+G+I ASIK +    VGDTIT+D  P    L G+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI TAPSV+Y++ + DGT  E+ + A +PD      I+EP+ KA I+ PDD+LG +M+LCQ  RG  +DL  V   R  +TY +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA IGG+I+ARET+SA+RK+V AKCYGGD+TRK+KLLE+QKE KKR++  G V +P + F++ L
  S:     7 HIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQTVRLSY-KAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVNKLPAPKEGDRNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVERTGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVFCGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLGAIMKLCQERRGIQIDLTYV-GPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYREGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRKRKLLEKQKESKKRMRQFGKVEIPQEAFIQAL 597
>gi|126700084|ref|YP_001088981.1| GTP-binding protein LepA [Clostridium difficile 630] >gi|145952905|ref|ZP_01801913.1| hypothetical protein CdifQ_04002873 [Clostridium difficile QCD-32g58] >gi|168694093|ref|ZP_02726370.1| GTP-binding protein LepA [Clostridium difficile QCD-37x79] >gi|168713030|ref|ZP_02745307.1| GTP-binding protein LepA [Clostridium difficile QCD-63q42] >gi|168725182|ref|ZP_02757459.1| GTP-binding protein LepA [Clostridium difficile QCD-76w55] >gi|168729713|ref|ZP_02761990.1| GTP-binding protein LepA [Clostridium difficile QCD-97b34] >gi|196126611|ref|ZP_03118360.1| GTP-binding protein LepA [Clostridium difficile ATCC 43255] >gi|196159111|ref|ZP_03119672.1| GTP-binding protein LepA [Clostridium difficile CIP 107932] >gi|196164547|ref|ZP_03125078.1| GTP-binding protein LepA [Clostridium difficile QCD-23m63] >gi|119371340|sp|Q182F4|LEPA_CLOD6 GTP-binding protein lepA >gi|115251521|emb|CAJ69354.1| GTP-binding elongation factor [Clostridium difficile 630] (601 aa)
Score = 1786, Expect = 0.0e+00, Identities = 354/597 (59%), Positives = 456/597 (76%)
  Q:     1 MDKKY--IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD K    RNFSI+AHIDHGKSTL+DR+I+ T  ++ R+MK+Q+LD+MD+ERERGITIKL  ++L+Y   KD  +YY +LIDTPGHVDF YEVSRSLAACEGALLVVDA+QGVEAQTL+NVYLA++ +LEI+P+INKIDLPSA  + VK ++ED IGLD S APL+SAKTGLNI  ++E I++ +PPP   D+  PL+AL+FDSYYDAYKG V  VR+  G VK G  I+ M+ N+ F V+ +GV  P       L AG+VG+IAASIK+I+S  VGDTITD  NP    LPGYKK  PMVYCG+YP +  +YE  ++ALEK+ ++D++L YE ETS ALGFG RCGFLGLLHM++++ERL+REFN+ +I TAPSVIY+V   DG ++ I + A LP+ +  K I+EP  K +IIVP D++G VMELCQ  RG  L++  +D  R  + Y +PL E++Y FFD LKS ++GY +LDYE+  Y    LVK+DIL+N  +VDALS I+H   A  R + +C KLK  IP+HQF IPIQA +G K+IARET+SA+RK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ IG+V VP   F+ +L
  S:     1 MDNKQSRTRNFSIIAHIDHGKSTLADRLIQQTGLVSERDMKSQLLDNMDLERERGITIKLQNIRLMY-KAKDGNEYYLNLIDTPGHVDFNYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLAIDQDLEILPIINKIDLPSARPEEVKNEIEDLIGLDSSEAPLISAKTGLNIEDVLEDIVKNVPPP-KGDNEAPLKALIFDSYYDAYKGVVAYVRVFEGTVKKGMTIKMMNTNKKFEVTEVGVMAPGQTELSELSAGDVGYIAASIKDIRSCRVGDTITDSNNPTEEPLPGYKKATPMVYCGIYPGEGEKYENVRDALEKLQVNDAALEYEAETSAALGFGFRCGFLGLLHMEIMQERLEREFNLDIITTAPSVIYRVTKMDGEVVMIQNPANLPEPSEIKMIEEPIVKGDIIVPKDYVGVVMELCQERRGNMLNMEYIDERRVMLHYDLPLNEVVYDFFDALKSRTRGYGSLDYEVKGYVASTLVKLDILINKEQVDALSFIVHETRAFPRGKAMCEKLKGEIPRHQFAIPIQAAVGNKVIARETISALRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQIGSVEVPQKAFMSVL 597
>gi|170738573|ref|YP_001767228.1| GTP-binding protein LepA [Methylobacterium sp. 4-46] >gi|168192847|gb|ACA14794.1| GTP-binding protein LepA [Methylobacterium sp. 4-46] (601 aa)
Score = 1786, Expect = 0.0e+00, Identities = 335/592 (56%), Positives = 447/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REM  Q+LDSMDIERERGITIK   V+L Y   +D ++Y  +L+DTPGHVDFTYEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++ N EIVPV+NKIDLP+A+ DRVK+Q+E+ IG+D S A  +SAKTGLNI  ++EAI+ ++PPP   D   PL+AL+ DS+YD Y G V LVRI +G ++ G  IR M  +  + V  +GV  PK+ +   L  GEVG++ ASIK +    VGDTIT+D  P   +LPG+K + P+V+CGL+P+D+ ++E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI+TAPSV+Y++ + DGT+ E+ + A +PD      I+EP+ +A I+ PDD+LG V++LCQ+ RG  +DL N    R  V Y +PL E+++ F+D+LKS SKGYA+ DY I DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F+IP+QA IGGKIIARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKKR++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQLTGALSAREMTEQVLDSMDIERERGITIKAQTVRLDY-KAQDGREYVLNLMDTPGHVDFTYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDANHEIVPVLNKIDLPAAEPDRVKEQIEEVIGIDASEAVPISAKTGLNIEAVLEAIVAKLPPP-KGDCEAPLKALLVDSWYDVYLGVVVLVRIVDGVLRKGMTIRMMGADAVYGVDRVGVFRPKMQDVAELGPGEVGFLTASIKEVADTRVGDTITEDRRPTDQALPGFKPVQPVVFCGLFPVDAAEFENLRAAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLISTAPSVVYRLNMADGTMRELHNPADMPDVMKIDTIEEPWIRATILTPDDYLGGVLKLCQDRRGAQIDL-NYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHISDYREGDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAAL 597
>gi|196240366|ref|ZP_03139135.1| GTP-binding protein LepA [Cyanothece sp. PCC 7425] >gi|196215658|gb|EDY10308.1| GTP-binding protein LepA [Cyanothece sp. PCC 7425] (603 aa)
Score = 1786, Expect = 0.0e+00, Identities = 332/592 (56%), Positives = 458/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y   +D ++Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALE+NLEI+PV+NKIDLP A+ +RVK+++E+ IGLDCS A + SAK G+ I +I+E+I+  +PPP D+  ++PL+AL+FDSYYD Y+G V   R+ +G VK G KIR M++ + + +  LGV +P  V  + L AGEVG++AA+IK +    VGDTIT    PA T LPGY++  PMV+CG++P D+ Q+E  +EALEK+ L+D++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V    G +  ID+ + LPD    ++I+EP+ + E+I P+ ++G +MEL Q  RG + D+  +   R  + Y +PLAEI+  FFD++KS S+GYA+++Y+++ YR+  LVK+DIL+N + VD+L+ I+HR+ A    R +  KL+E IP+HQF+IPIQA IG K+IA E++ A+RK+VLAKCYGGDITRKKKLLE+QK GKKR+KA+G+V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQTTGTVAARDMKEQFLDNMDLERERGITIKLQAARMNYRG-EDGEEYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALEHNLEIIPVLNKIDLPGAEPERVKQEIEEIIGLDCSGAVMASAKEGIGIAEILESIVHLVPPPQDTV-SEPLRALIFDSYYDPYRGVVVYFRVMDGTVKQGDKIRLMASGKEYQIDELGVLSPAQVQVKELHAGEVGYLAAAIKAVTDARVGDTITLATAPAKTPLPGYEEAKPMVFCGMFPTDADQFEDLREALEKLRLNDAALQYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLIITAPSVVYRVTPLKGEVFMIDNPSTLPDPQHREKIEEPYVQVEMITPETYVGTLMELAQTRRGVFKDMKYLTPERTTLIYELPLAEIVTDFFDQMKSRSRGYASMEYQLIGYRENPLVKLDILINSDPVDSLAAIVHRDKAYGVGRALVSKLRELIPRHQFKIPIQAAIGSKVIASESIPALRKDVLAKCYGGDITRKKKLLEKQKAGKKRMKAVGSVDVPQEAFMAVL 598
>gi|163699886|ref|ZP_02118743.1| GTP-binding protein LepA [Methylobacterium nodulans ORS 2060] >gi|162433756|gb|EDQ44343.1| GTP-binding protein LepA [Methylobacterium nodulans ORS 2060] (601 aa)
Score = 1785, Expect = 0.0e+00, Identities = 336/592 (56%), Positives = 448/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REM  Q+LDSMDIERERGITIK   V+L Y   +D + Y  +L+DTPGHVDFTYEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++ N EIVPV+NKIDLP+A+ DRVK+Q+E+ IG+D S A  +SAKTGLNI  ++EAI+ ++PPP   D   PL+AL+ DS+YD Y G V LVRI +G +K G  IR M  +  + V  +GV  PK+ +   L  GEVG++ ASIK +    VGDTIT+D  P  + LPG+K + P+V+CGL+P+D+ ++E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI+TAPSV+Y++ ++DGT+ E+ + A +PD      I+EP+ +A I+ PDD+LG+V++LCQ+ RG  +DL N    R  V Y +PL E+++ F+D+LKS SKGYA+ DY I DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F+IP+QA IGGKIIARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKKR++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQLTGALSAREMTEQVLDSMDIERERGITIKAQTVRLDY-TAQDGRTYILNLMDTPGHVDFTYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDANHEIVPVLNKIDLPAAEPDRVKQQIEEVIGIDASEAVPISAKTGLNIEAVLEAIVAKLPPP-KGDRAAPLKALLVDSWYDVYLGVVVLVRIVDGVLKKGMTIRMMGADAVYGVDRIGVFRPKMQDVAELGPGEVGFLTASIKEVADTRVGDTITEDRRPTDSPLPGFKPVQPVVFCGLFPVDAAEFENLRAAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLISTAPSVVYRLNMSDGTMRELHNPADMPDVMKIDTIEEPWIRATILTPDDYLGSVLKLCQDRRGTQIDL-NYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHISDYREGDLVKMSILVNSEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAAL 597
>gi|62317867|ref|YP_223720.1| GTP-binding protein LepA [Brucella abortus bv. 1 str. 9-941] >gi|83269845|ref|YP_419136.1| GTP-binding protein LepA [Brucella melitensis biovar Abortus 2308] >gi|189023117|ref|YP_001932858.1| GTP-binding protein LepA [Brucella abortus S19] >gi|75495354|sp|Q576S5|LEPA_BRUAB GTP-binding protein lepA >gi|119371334|sp|Q2YJP8|LEPA_BRUA2 GTP-binding protein lepA >gi|62198060|gb|AAX76359.1| LepA, GTP-binding protein LepA [Brucella abortus biovar 1 str. 9-941] >gi|82940119|emb|CAJ13167.1| Elongation factor G, C-terminal:Elongation factor, GTP-binding:ATP/GTP-binding site motif A (P-loop):Ras GTPase superfamily:E... [Brucella melitensis biovar Abortus 2308] >gi|189021691|gb|ACD74412.1| GTP-binding protein LepA [Brucella abortus S19] (602 aa)
Score = 1785, Expect = 0.0e+00, Identities = 336/593 (56%), Positives = 447/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L TREMK+Q+LDSMDIERERGITIK   V+L Y   K+ +DY  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++NN EIV V+NKIDLP+A+ +RVK+Q+E+ IG+D S+A  +SAKTGL I  ++EAI+ ++P P + D N PL+A++ DS+YD+Y G + LVR+ +G +K G  IR M     + V   GV TPK+V  + L  GE+G+I ASIK +    VGDTIT+D  P    L G+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI TAPSV+Y++ + DGT  E+ + A +PD      I+EP+ KA I+ PDD+LG +M+LCQ  RG  +DL  V   R  +TY +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA IGG+I+ARET+SA+RK+V AKCYGGD+TRK+KLLE+QKE KKR++  G V +P + F++ L
  S:     7 HIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQTVRLSY-KAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVNKLPAPKEGDRNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVERTGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENILSGFKPAQPVVFCGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLGAIMKLCQERRGIQIDLTYV-GPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYREGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRIVARETISALRKDVTAKCYGGDVTRKRKLLEKQKESKKRMRQFGKVEIPQEAFIQAL 597
>gi|160932609|ref|ZP_02079999.1| hypothetical protein CLOLEP_01451 [Clostridium leptum DSM 753] >gi|156868568|gb|EDO61940.1| hypothetical protein CLOLEP_01451 [Clostridium leptum DSM 753] (602 aa)
Score = 1785, Expect = 0.0e+00, Identities = 345/595 (57%), Positives = 453/595 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALG-VNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DRI+E T +++ R+M +Q+LD+MD+ERERGITIK +AV L+YH   D +DY F+LIDTPGHVDF YEVSRSLAACEGA+LVVDASQG+EAQTL+N YLA++  LEIVPVINKIDLPSAD DRV++++ED IG++  +AP +SAK G NI  +ME I+ +IP P + D+  PLQAL+FDSYYDAYKG +  VR+K G +  G  I+ M+    + V   G +    +     L AGEVG+IAASIK +    VGDT+T  A PA   LPGY+ + PMV+CG+YP D   Y   ++ALEK+ L+D+SLT+E ETS ALGFG RCGFLGLLHM++I+ERL+RE+N+ L+ TAPSVIYK+   DG+++ ID+    PD ++  + +EP   A I  P +++GN+MELCQ  RG + D+  ++ TR  + Y +PL EI+Y FFD LKS ++GYA+ DYE++ Y+K DLVK+DI+LNG  VDALS I+H E A  R+RK+  KLKE IP+  FE+PIQA IGGKIIARETV A+RK+VLAKCYGGDITRKKKLLE+QKEGKK+++ +G+V VP + F+ +L
  S:     5 REQIRNFSIIAHIDHGKSTLADRILEQTQSVSLRDMSDQLLDNMDLERERGITIKAHAVTLVYH-ADDGEDYIFNLIDTPGHVDFNYEVSRSLAACEGAILVVDASQGIEAQTLANTYLAVDAGLEIVPVINKIDLPSADPDRVRQEIEDVIGIEAESAPAISAKMGTNIKAVMEEIVHKIPSP-EGDETAPLQALIFDSYYDAYKGVIIYVRVKEGTLHPGDNIKLMATGSEYNVVECGFLRATSLEPASELSAGEVGYIAASIKTVSDARVGDTVTLAARPAPEPLPGYRAVNPMVFCGIYPADGAHYTDLRDALEKLQLNDASLTFEPETSVALGFGFRCGFLGLLHMEIIQERLEREYNLDLVTTAPSVIYKITKTDGSVVMIDNPTNYPDPSVIAQAEEPITNAHIYAPSEYVGNIMELCQERRGVFKDMHYIEETRVDIHYELPLNEIIYDFFDALKSRTRGYASFDYELMGYQKSDLVKLDIMLNGEVVDALSFIIHAEKAYPRARKMAEKLKEKIPRQLFEVPIQACIGGKIIARETVKALRKDVLAKCYGGDITRKKKLLEKQKEGKKKMRQLGSVEVPQEAFMAVL 598
>gi|158421881|ref|YP_001523173.1| GTP-binding protein LepA [Azorhizobium caulinodans ORS 571] >gi|158328770|dbj|BAF86255.1| GTP-binding LepA protein [Azorhizobium caulinodans ORS 571] (612 aa)
Score = 1785, Expect = 0.0e+00, Identities = 337/595 (56%), Positives = 453/595 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REM +Q+LD+MDIERERGITIK   V+L Y   +D + Y  +LIDTPGHVDF YEVSRSLAA EG+LLVVDASQGVEAQTL+NVY A++NN +IVPV+NKIDLP+A+ ++VK Q+ED IGLD SNA  +SAKTGLNI+Q++EAI+ ++P P+  D   PL+AL+ DS+YD Y G V LVRI +G +K G +I+ M  +  + V  +GV TPK+V  E L  GE+G++  SIK +    VGDTITDD  P + +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REFN+ LIATAPSVIY++ L DG+ +++ + A +PD    +EI+EP+ +A I+ PDD+LG V++LCQ+ RG  ++L  V + R  VTY +PL E+++ F+DKLKS SKGYA+ DY I DYR  +LVK+ IL+NG  VDALS ++HR  A  R R +C KLK+ IP+H F IPIQA IG K+IARET+ A+RK+V AKCYGGD++RK+KLL++QKEGKK+++  G V +P + F+  L
  S:    17 QKNIRNFSIVAHIDHGKSTLADRLIQLTGGLSEREMSDQVLDNMDIERERGITIKAQTVRLSY-KAQDGETYTLNLIDTPGHVDFAYEVSRSLAAVEGSLLVVDASQGVEAQTLANVYQAIDNNHDIVPVLNKIDLPAAEPEKVKSQIEDVIGLDASNAIGISAKTGLNIDQVLEAIVTRLPAPV-GDREAPLKALLVDSWYDTYLGVVVLVRIIDGVLKKGMRIKMMGADAVYDVDRVGVFTPKMVAMESLGPGEIGFLNGSIKEVADTRVGDTITDDKRPTSEALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFNLDLIATAPSVIYQMELTDGSTIDLHNPADMPDVVKIEEIREPWIRATIMTPDDYLGAVLKLCQDRRGNQIELTYVGA-RAMVTYDLPLNEVVFDFYDKLKSISKGYASFDYNITDYRPGELVKMSILVNGEPVDALSMLVHRTRAEFRGRAMCEKLKDLIPQHLFNIPIQAAIGAKVIARETIKALRKDVTAKCYGGDVSRKRKLLDKQKEGKKKMRQFGKVEIPQEAFIAAL 608
>gi|118589640|ref|ZP_01547045.1| GTP-binding protein LepA [Stappia aggregata IAM 12614] >gi|118437726|gb|EAV44362.1| GTP-binding protein LepA [Stappia aggregata IAM 12614] (601 aa)
Score = 1785, Expect = 0.0e+00, Identities = 335/592 (56%), Positives = 451/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T TLT REM  Q+LDSMDIERERGITIK   V+LIY N KD + Y  +LIDTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++N+ EIV V+NKIDLP+A+ DR+K+Q+ED IG+D S A ++SAKTGL ++ ++EAI++++PPP + D +  L+A++ DS+YD Y G + LVR+ +G +K G KI+ M     + V  +GV TPK +  + L AGE+G I  SIK +    VGDTIT +  P T +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+Y++ L DG+ +E+ + A +PD     EI+EP+ +A I+ PD++LG +++LCQ  RG  +DL  V S R  VTY +PL E+++ F+D+LKS SKGYA+ DY+I DYR  DLV++ IL+N   VDALS ++HR  A  R R +C KLKE IP+H F+IPIQA IGG++IARET+SA+RK+V AKCYGGD TRK+KLLE+QK GKK+++  G V +P + F++ L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQMTGTLTDREMTEQVLDSMDIERERGITIKAQTVRLIY-NAKDGEQYTLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNDHEIVTVLNKIDLPAAEPDRIKEQIEDVIGIDASEACMISAKTGLGVDDVLEAIVKKLPPP-EGDPDATLKAMLVDSWYDTYLGVMVLVRVIDGSLKRGQKIKMMGTGAAYDVDRVGVMTPKFLQVDELHAGEIGVITGSIKEVADTRVGDTITLEKKPCTQALPGFKPAQPVVFCGLFPVDANDFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLYREFDLDLIATAPSVVYQMSLTDGSDVELHNPADMPDVVKISEIREPWIRATIMTPDEYLGGILKLCQERRGLQIDLSYVGS-RAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQISDYRAGDLVRMSILVNEEPVDALSVLVHRSQAERRGRAMCEKLKELIPRHMFKIPIQAAIGGRVIARETISALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFIQAL 597
>gi|182680029|ref|YP_001834175.1| GTP-binding protein LepA [Beijerinckia indica subsp. indica ATCC 9039] >gi|182635912|gb|ACB96686.1| GTP-binding protein LepA [Beijerinckia indica subsp. indica ATCC 9039] (616 aa)
Score = 1784, Expect = 0.0e+00, Identities = 339/593 (57%), Positives = 444/593 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T TL  REM  Q+LDSMDIERERGITIK   V+L Y   KD + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NKIDLP+A+ DR+K+Q+ED IGLD SNA L+SAKTGL I++++EAI+ ++PPP   D   PL+AL+ DS+YDAY G V LVRI +G +K   KI+ + +   + V  +GV  PK+ +   L  GEVG+I A IK +    VGDTITD+  P + +LPG+K   P+V+CGL+P+D+  ++  + A+ K+ L+D+S +YE E+S ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSV+Y++++ DG  +E+ + A +PD T  + I+EP+ +A I+ PDD+LG V++LCQ  RG   DL  V   R   TY +PL E+++ F+D+LKS SKGYA+ DY I DYR  DLVK+ IL+N   VDALS ++HR+ A  R R +  KLKE IP H F+IPIQA IGGKIIARETV A+RK+V AKCYGGD TRK+KLLE+QK GKK+++  G V +P + F+  L
  S:    23 HIRNFSIVAHIDHGKSTLADRLIQATGTLAEREMVEQVLDSMDIERERGITIKAQTVRLEYR-AKDGELYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKIDLPAAEPDRIKQQIEDVIGLDASNAVLISAKTGLGIDEVLEAIVTRLPPP-KGDKEAPLKALLVDSWYDAYLGVVVLVRIIDGTLKKNQKIQMLGSGAHYEVDRIGVFRPKMQDLPELGPGEVGFITAQIKQVADTRVGDTITDERRPCSEALPGFKPAQPVVFCGLFPVDAADFDDLRAAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRIVMRDGETIELHNPADMPDPTRIEAIEEPWIRATILTPDDYLGAVLKLCQERRGLQADLSYV-GKRAMATYDLPLNEVVFDFYDRLKSISKGYASFDYAITDYRAGDLVKMQILVNAEPVDALSMLVHRDRADMRGRAMVEKLKELIPPHMFQIPIQAAIGGKIIARETVRALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFIAAL 612
>gi|186900251|ref|ZP_02973210.1| GTP-binding protein LepA [Cyanothece sp. PCC 7424] >gi|186692741|gb|EDU17358.1| GTP-binding protein LepA [Cyanothece sp. PCC 7424] (604 aa)
Score = 1782, Expect = 0.0e+00, Identities = 329/592 (55%), Positives = 454/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  R+MK Q LD++D+ERERGITIKL A ++ Y   +D Q Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+ +RV +++E+ +GLDCS     SAK G+ +N+I+E+I+  +PPP D   NKPL+AL+FDSYYD+Y+G V   R+ +G VK G ++  M++ + + +  LGV +P  +  + L AGEVG+ AA+IK ++   VGDTIT    PA   LPGYK+  PMV+CGL+P DS QYE  ++AL K+ L+D++L +E ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSV+Y+V   +  ++E+D+ ++LP      +I+EP+   E+I P+ ++G +MELCQN RGE+ D+     TR  + Y +PLAEI+  FFD+LKS ++GYA+++Y ++ YR+  LVK+DI++NG+ VDAL+ I+HR+ A +  R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDITRKKKLLE+Q +GKKR+K+IG V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRMLQMTGTVEDRKMKEQFLDNLDLERERGITIKLQAARMNY-TAQDGQHYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPERVAQEIEEIVGLDCSGIIKASAKEGIGVNEILESIVHLVPPP-DDTTNKPLRALIFDSYYDSYRGVVVYFRVMDGTVKKGDRVLLMASGKEYEIDELGVLSPHQIQVDELHAGEVGYFAAAIKTVEDARVGDTITLAPKPADEPLPGYKEAKPMVFCGLFPTDSDQYEDLRDALHKLKLNDAALNFEPETSTAMGFGFRCGFLGLLHMEIVQERLEREYDLDLITTAPSVVYRVTTTEEEVIEVDNPSQLPPPQKRIKIEEPYVHMEMITPETYVGALMELCQNRRGEFKDMRYFTQTRTALVYELPLAEIVTDFFDQLKSRTRGYASMEYHLIGYRENALVKLDIMVNGDGVDALAMIVHRDKAYNVGRALTEKLKELIPRHQFKVPIQAAIGSKVIASEHIPALRKDVLAKCYGGDITRKKKLLEKQAKGKKRMKSIGTVDVPQEAFMAVL 598
>gi|58337524|ref|YP_194109.1| GTP-binding protein LepA [Lactobacillus acidophilus NCFM] >gi|75357534|sp|Q5FJP6|LEPA_LACAC GTP-binding protein lepA >gi|58254841|gb|AAV43078.1| GTP-binding protein [Lactobacillus acidophilus NCFM] (612 aa)
Score = 1782, Expect = 0.0e+00, Identities = 342/595 (57%), Positives = 457/595 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + +IRNFSIVAHIDHGKST++DRI+E T+T++ R++KNQ+LD M +ER+RGITIK+N+V++ YH  K+ +DY FHLIDTPGHVDF+YEVSRSLAACEGALLVVDASQGV+AQTL+N YLA++++LEIVPVINKIDLPSAD +  K+++E+ +GLD S+A  VS KTG  I +++E I+  IP P   D   PL+AL+FDS YD Y+G V  VRI++G VK G KI+ M+  + + V+ +GV++P  V K++L+AG+VG+I A+IK+++   VGDTITD  +P    LPGY++I PMVY G+YP+D+  Y+  KEAL+K+ L+D++L +E ETS ALGFG RCGFLGLLHMDV++ERL++EF++ LI TAPSV Y  ++NDGT   ID+ + LPD   YKE+QEP+ KAEI+VP+D++G VMELCQ  RGE++ +  +D  R  V Y +PLAEI++ FFD LKS +KGYA+LDYEI  YR  DLVK+DILLN   +DALS I HR  A DR+R++   LK+ IP+  FE+ IQ  IG KII+R T+   RK+V  K + GD  R+ KLLE+QK GKKR+KA+G V VP D F+ +L
  S:    10 QNHIRNFSIVAHIDHGKSTIADRILELTDTVSERQLKNQMLDDMPLERQRGITIKMNSVEVKYH-AKNGEDYIFHLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVQAQTLANTYLAIDDDLEIVPVINKIDLPSADPENAKEEIEEMLGLDASDAVEVSGKTGQGIPELLEKIVTDIPAP-SGDIEAPLKALIFDSKYDDYRGVVLSVRIEDGTVKPGDKIQIMNTGKEYEVTEVGVSSPHPVKKDILIAGDVGYITANIKSVRETRVGDTITDAGHPTAEPLPGYRQIPPMVYSGMYPVDNRDYDDLKEALQKLQLNDAALEFEPETSTALGFGFRCGFLGLLHMDVVQERLEQEFDLDLIMTAPSVDYHAIMNDGTTKVIDNPSDLPDAGEYKEVQEPYVKAEIMVPNDYVGPVMELCQRKRGEFVTMDYLDKYRVNVIYNMPLAEIIFDFFDDLKSSTKGYASLDYEITGYRATDLVKIDILLNKEPIDALSFIAHRSEAQDRARQMTSMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRRAKLLEKQKRGKKRMKAVGRVEVPQDAFMAVL 602
>gi|150390802|ref|YP_001320851.1| GTP-binding protein LepA [Alkaliphilus metalliredigens QYMF] >gi|166987746|sp|A6TSM4|LEPA_ALKMQ GTP-binding protein lepA >gi|149950664|gb|ABR49192.1| GTP-binding protein LepA [Alkaliphilus metalliredigens QYMF] (602 aa)
Score = 1782, Expect = 0.0e+00, Identities = 348/595 (58%), Positives = 461/595 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++ IRNFSI+AHIDHGKSTL+DR+IE T  ++ REM+ Q+LD+M++ERERGITIKL +++LIY   KD QDYY +LIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQT++NVYLALE NLEI+PVINKIDLPSA  D +K+++ED IGLD S APL+SAK GLNI+ ++EAI++ IPPP + D+  PL+ALVFDSYYD YKG V   R+  G VK G KIR M+  + F V+ +GV +P  +  + L AG+VG+IAASIK+++   VGDTITD  NP   SLPGY+K+ PMVYCG+YP +  +YE  ++AL+++ ++D++L +E ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ L+ TAPSVIY+V   +G ++ I + A LP       I+EP  KA I+VP ++ G V+ELCQ+ RGE   +  ++ TR  + Y +PL E++Y FFD LKS +KGY +LDYE+  Y+   LVK+DIL+N  +VDALS I+H   A  R + +C KLK+ IP+HQF +P+QA IG KIIARET+ A+RK+VLAKCYGGDI+RKKKLLE+QK+GKKR++ +G+V VP   F+ +L
  S:     6 QRKIRNFSIIAHIDHGKSTLADRLIERTGLISQREMQAQVLDNMELERERGITIKLQSIRLIY-KAKDGQDYYLNLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTMANVYLALEQNLEIIPVINKIDLPSARPDEIKREIEDIIGLDASEAPLISAKDGLNIDDVLEAIVKNIPPPTE-DEEAPLKALVFDSYYDNYKGVVAYTRVVEGTVKKGMKIRMMATKKEFEVTEVGVYSPGPIQLDQLSAGDVGYIAASIKDVRYCRVGDTITDALNPTEHSLPGYRKVTPMVYCGVYPAEGEKYEDVRDALDRLQVNDAALVFEAETSAALGFGFRCGFLGLLHMEIIQERLEREFNLDLVTTAPSVIYRVTKTNGEVVMIQNPANLPVTQEISVIEEPIVKATIMVPSEYAGIVIELCQDRRGEMKGMDYIEETRVNLHYELPLNEVIYDFFDALKSKTKGYGSLDYEMKGYKPSTLVKLDILINSEQVDALSFIVHESKAYARGKGMCEKLKDEIPRHQFPVPLQASIGTKIIARETIRALRKDVLAKCYGGDISRKKKLLEKQKKGKKRMRQVGSVEVPQKAFMSVL 598
>gi|154245110|ref|YP_001416068.1| GTP-binding protein LepA [Xanthobacter autotrophicus Py2] >gi|154159195|gb|ABS66411.1| GTP-binding protein LepA [Xanthobacter autotrophicus Py2] (601 aa)
Score = 1780, Expect = 0.0e+00, Identities = 335/595 (56%), Positives = 454/595 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K IRNFSIVAHIDHGKSTL+DR+I+ T  LT REM +Q+LDSMDIERERGITIK   V+L Y   KD + Y  +LIDTPGHVDF YEV+RSLAA EG+LLVVDASQGVEAQTL+NVY A++NN +IVPV+NK+DLP+A+ ++VK Q+ED IGLD S+A  +SAKTGLN++Q++EAI+ ++PPP+  D   PL+AL+ DS+YD Y G V LVRI +G +K G +I+ M +     V  +GV TPK+V    L  GE+G++  SIK +    VGDTIT+D  P    LPG+K   P+V+CGL+P+D+ Q+E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSVIY++ + DG+++++ + A +PD    +EI+EP+ +A I+ PD++LG+V++LCQ+ RG  ++L  V + R  VTY +PL E+++ F+D+LKS SKGYA+ DY+I +YR  DLVK+ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F IPIQA IG KIIARET+ A+RK+V AKCYGGDI+RK+KLL++QKEGKK+++  G V +P + F+  L
  S:     6 QKNIRNFSIVAHIDHGKSTLADRLIQITGGLTEREMTDQVLDSMDIERERGITIKAQTVRLSY-KAKDGETYILNLIDTPGHVDFAYEVNRSLAAVEGSLLVVDASQGVEAQTLANVYQAIDNNHDIVPVLNKVDLPAAEPEKVKAQIEDVIGLDASDAIGISAKTGLNVDQVLEAIVTRLPPPM-GDRAAPLKALLVDSWYDTYLGVVVLVRIIDGVLKKGQRIKMMGSGAVNDVDRVGVFTPKMVAMAELGPGEIGFLTGSIKEVADTRVGDTITEDKRPCADMLPGFKPAQPVVFCGLFPVDAAQFEDLRAAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVIYEIQMTDGSVIDLHNPADMPDVVKIEEIREPWIRATILTPDEYLGSVLKLCQDRRGTQIELTYVGA-RAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQITEYRAGDLVKMSILVNSEPVDALSMLVHRARADARGRVMCEKLKDLIPQHLFNIPIQAAIGAKIIARETIKALRKDVTAKCYGGDISRKRKLLDKQKEGKKKMRQFGKVEIPQEAFIAAL 597
>gi|167645146|ref|YP_001682809.1| GTP-binding protein LepA [Caulobacter sp. K31] >gi|167347576|gb|ABZ70311.1| GTP-binding protein LepA [Caulobacter sp. K31] (602 aa)
Score = 1778, Expect = 0.0e+00, Identities = 335/592 (56%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTLSDR+I+ T  LT REM  Q+LD+MDIE+ERGITIK   V+L Y    D Q Y  +L+DTPGHVDF YEVSRSLAACEG++LVVDASQGVEAQTL+NVY A++NN EIVPV+NKIDLP+A+ +RV+ Q+ED IGLD S+A L SAK+G+ I++++EAI+ ++PPP   D+N PL+AL+ D++YDAY G V LVR+ +G++K G KI+ M +  T +V  +GV  PK    E L  GE+G+I A IK +   +VGDTITD+  P   +LPG+K + P+V+CGL+P+D+  +E  + A+ K+ L+D S TYE E+S ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+YK+ + DG  +E+ + A LPD    + I EP+ KA I  PD++LG V++LCQ+ RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY++ DYR  DLVK+ IL+N   VDALS ++HR+ A  R R +C K+KE IP+H F IPIQA IGG+IIARETV A+RK+V AKCYGGD +RK+KLL++QK GKKR++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLSDRLIQETGGLTAREMTAQVLDNMDIEKERGITIKAQTVRLDY-KADDGQTYVLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYSAIDNNHEIVPVLNKIDLPAAEPERVRAQIEDLIGLDASDAVLASAKSGVGIHEVLEAIVTRLPPP-KGDENAPLKALLVDAWYDAYLGVVVLVRVIDGRLKAGQKIKMMQHGSTHLVDRVGVFKPKNTPVESLGPGEIGFITAQIKEVADAAVGDTITDEKKPTDKALPGFKDVQPVVFCGLFPVDAADFEDLRAAVGKLRLNDGSFTYEMESSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYKIHMRDGAEIELHNPADLPDVMQIESISEPWIKATIFTPDEYLGGVIKLCQDRRGAQRELSYVGS-RAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQVEDYRVGDLVKMSILVNAEPVDALSMLVHRDRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRIIARETVRALRKDVTAKCYGGDASRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAAL 597
>gi|94987162|ref|YP_595095.1| GTP-binding protein LepA [Lawsonia intracellularis PHE/MN1-00] >gi|119371362|sp|Q1MQF3|LEPA_LAWIP GTP-binding protein lepA >gi|94731411|emb|CAJ54774.1| membrane GTPase LepA [Lawsonia intracellularis PHE/MN1-00] (606 aa)
Score = 1778, Expect = 0.0e+00, Identities = 332/592 (56%), Positives = 456/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRI+E+TN ++ RE ++Q LD M++ERERGITIK   V++ Y    D + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLV+D +QGVEAQTL+NVYLALE+N E++P++NKIDLPSADI++VK ++E+TIGLDCS A  +SAKTGL ++ ++EAI++Q+P P   D N PL+AL+FDS+YDAY+G V L RI +G +K    I+  S  +++ ++ LGV +P+ ++   L AGEVG++  +IK +    VGDTIT   NP T ++PG+K+I P+V+CGLYP +S+ Y++ K ALEK+ L+D++ ++E ETSQALGFG RCGFLGLLHM++I+ERL+REF + LIATAPSVIYKV   DG I EID+ +KLP+      + EP+   +I VP +F+GNV++LC+  RG   ++      R  +TY +P +EI++ FFD+LKS +KGYA++DYE++DYR  +LV++DILLNG  VDAL+ I+HR+ A    R + +KLK+ IP+  FE+ IQA IG K+IARE++SA+RKNV AKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+  L
  S:    12 IRNFSIIAHIDHGKSTLADRILEYTNLVSDREKRDQYLDKMELERERGITIKAQTVRIPYIT-ADGKTYILNLIDTPGHVDFNYEVSRSLSACEGSLLVIDTTQGVEAQTLANVYLALEHNHEVIPILNKIDLPSADIEKVKAEIEETIGLDCSTAISISAKTGLGVDSVLEAIVQQLPAP-KGDPNNPLKALIFDSWYDAYQGVVVLFRIMDGTIKKNDIIKLFSTEKSYEITRLGVFSPEAIDIPQLSAGEVGFLCGNIKTLGDAKVGDTITLLHNPCTKAIPGFKEIQPVVFCGLYPSESSDYDILKAALEKLQLNDAAFSWEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQVELIATAPSVIYKVETTDGKIQEIDNPSKLPELGKIVHLYEPYVHIDIHVPSEFVGNVLKLCEEKRGIQKNIAYPAQQRVIITYELPFSEIVFDFFDRLKSATKGYASMDYEVIDYRISNLVRLDILLNGEPVDALAVIVHRDKAYHYGRSLAIKLKKTIPRQMFEVAIQAAIGQKVIARESISALRKNVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAAL 601
>gi|148258558|ref|YP_001243143.1| GTP-binding protein LepA [Bradyrhizobium sp. BTAi1] >gi|146410731|gb|ABQ39237.1| GTP-binding protein LepA [Bradyrhizobium sp. BTAi1] (617 aa)
Score = 1778, Expect = 0.0e+00, Identities = 339/592 (57%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+NN EIVPV+NKIDLP+A+ +++K+Q+ED IG+D S+A ++SAKTGL I  ++EAI+ ++PPP   D    L+AL+ DS+YD Y G V LVRI +G +K G +IR M     + V  +G  TPK+   + L  GEVG+I A+IK +    VGDTITDD  P +  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DG  +EI +   +PD     EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+K+ IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:    23 IRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGITIKAQTVRLQYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKIDLPAAEPEKIKQQIEDVIGIDASDAVMISAKTGLGIPDVLEAIVTRLPPP-KGDREATLKALLVDSWYDVYLGVVVLVRIVDGVMKKGQRIRMMGTGAAYDVERVGFFTPKMQQVDELGPGEVGFITAAIKEVADTRVGDTITDDRKPVSEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLTDGQEIEIHNPVDMPDVVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGS-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNNEPVDALSMLVHRTRAEGRGRAMVEKMKDLIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 613
>gi|114705632|ref|ZP_01438535.1| GTP-binding protein LepA [Fulvimarina pelagi HTCC2506] >gi|114538478|gb|EAU41599.1| GTP-binding protein LepA [Fulvimarina pelagi HTCC2506] (603 aa)
Score = 1778, Expect = 0.0e+00, Identities = 333/592 (56%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L  R+MK Q+LD+MDIERERGITIK   V+L Y    D + Y  +LIDTPGHVDF YEVSRSLAAC+GALLVVDA+QGVEAQTL+NVYLAL+N+LEIVPV+NKIDLP+A+ D+VK+Q+ED IGLD S+A ++SAK+GL I  ++EAI++++PPP + D + PL+A++ DS+YD Y G V LVRI +G++K G +IR M  +  + V  +GV TPK+V  + L  GE+G+I ASIK +    VGDTITD+  P    LPG+K   P+V+CGL+P+D+  ++  + A+ K+ L+D+S +YE E+S ALGFG RCGFLGLLH+++++ERL REF++ LIATAPSV+Y V + +G   ++ + A +PD      I EP+  A I+ PDD+LG +++LCQ  RG    L  V   R  V+Y +PL E+++ F+D+LKS SKGYA+ DY++ DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLKE IP H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRK+KLLE+QKEGKKR++  G V +P + F+  L
  S:    10 IRNFSIVAHIDHGKSTLADRLIQNTGGLEIRDMKEQVLDNMDIERERGITIKAQTVRLHY-TASDGETYVLNLIDTPGHVDFAYEVSRSLAACDGALLVVDAAQGVEAQTLANVYLALDNDLEIVPVLNKIDLPAAEPDKVKEQIEDVIGLDASDAVMISAKSGLGIEDVLEAIVKRLPPPSEGDRSAPLKAMLVDSWYDVYLGVVVLVRIIDGELKKGQQIRMMGTDAKYPVDRVGVFTPKMVLVDALGPGELGFITASIKEVADTRVGDTITDEKRPTDKMLPGFKPAQPVVFCGLFPVDAADFDDLRAAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIVQERLSREFDLDLIATAPSVVYDVTMTNGNTTQLHNPADMPDVVKIDHIAEPWITANILTPDDYLGPILQLCQERRGIQTGLSYV-GKRAMVSYELPLNEVVFDFYDRLKSISKGYASFDYQMADYREGDLVKMSILVNAEPVDALSMLVHRTQAEKRGRAMCEKLKELIPNHLFKIPIQAAIGGKVIARETISALRKDVTAKCYGGDATRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIAAL 599
>gi|146337850|ref|YP_001202898.1| GTP-binding protein LepA [Bradyrhizobium sp. ORS278] >gi|146190656|emb|CAL74658.1| GTP-binding elongation factor [Bradyrhizobium sp. ORS278] (617 aa)
Score = 1777, Expect = 0.0e+00, Identities = 340/592 (57%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+NN EIVPV+NKIDLP+A+ D++K+Q+ED IG+D S+A ++SAKTGL I  ++EAI+ ++PPP   D    L+AL+ DS+YD Y G V LVRI +G +K G +IR M     + V  +G  TPK+   + L  GEVG+I A+IK +    VGDTITDD  P +  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DG  +EI +   +PD     EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+K+ IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:    23 IRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGITIKAQTVRLQYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKIDLPAAEPDKIKQQIEDVIGIDASDAVMISAKTGLGIPDVLEAIVTRLPPP-KGDREATLKALLVDSWYDVYLGVVVLVRIVDGVMKKGQRIRMMGTGAAYDVERVGFFTPKMQQVDELGPGEVGFITAAIKEVADTRVGDTITDDRKPVSEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLTDGEEIEIHNPVDMPDVVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGS-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNNEPVDALSMLVHRTRAEGRGRAMVEKMKDLIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 613
>gi|153814297|ref|ZP_01966965.1| hypothetical protein RUMTOR_00506 [Ruminococcus torques ATCC 27756] >gi|145848693|gb|EDK25611.1| hypothetical protein RUMTOR_00506 [Ruminococcus torques ATCC 27756] (606 aa)
Score = 1776, Expect = 0.0e+00, Identities = 334/597 (55%), Positives = 453/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGV-NTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRIIE T  LT+REM++Q+LD+M++ERERGITIK   V+ +Y    D ++Y F+LIDTPGHVDF YEVSRSLAAC+GA+LVVDA+QGVEAQTL+NVYLAL+++L+++PVINKIDLPSAD +RVK+++ED IG++  +APL+SAKTG NI+ ++E I++++P P   D   PL+AL+FDS YD+YKG +   RIK G VK GT +  M+      V  +G     + +  E L AG VG+I AS+KN+K   VGDT+TD + P  + LPGYKK+ PMVYCGLYP D  +Y   ++ALEK+ L+D++L +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAPSVIYK+   +G ++++ +   +PD      ++EP  KAEI+V  +++G +M+LCQ  RG Y  +  ++  R  + Y +PL EI+Y FFD LKS S+GYA+ DYE++ Y+K +LVK+DIL+N  +VDALS I+    A DR RK+C KLKE IP+  FEIPIQA +G KIIARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +G+V +P   F+ +L
  S:     6 IDQSKIRNFCIIAHIDHGKSTLADRIIEQTGLLTSREMQSQVLDNMELERERGITIKAQTVRTVY-KADDGEEYMFNLIDTPGHVDFNYEVSRSLAACDGAILVVDAAQGVEAQTLANVYLALDHDLDVIPVINKIDLPSADPERVKEEIEDVIGIEAEDAPLISAKTGQNIHDVLEQIVKKVPAP-QGDPKAPLKALIFDSVYDSYKGVIVFCRIKEGTVKKGTPMLMMATGAQADVVEVGTFGAGRFIPCEELSAGMVGYITASLKNVKETRVGDTVTDASRPCDSPLPGYKKVNPMVYCGLYPADGAKYPDLRDALEKLQLNDAALQFEAETSVALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPSVIYKIHKTNGEVIDLTNPTNMPDPAEIDYMEEPMVKAEIMVTSEYIGAIMDLCQERRGIYQGMEYIEEKRAVLNYHLPLNEIIYDFFDALKSRSRGYASFDYEMMGYQKSELVKLDILINKEEVDALSFIVFAGSAYDRGRKMCAKLKEEIPRQLFEIPIQAAVGSKIIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGSVEIPQKAFMSVL 601
>gi|108761403|ref|YP_631702.1| GTP-binding protein LepA [Myxococcus xanthus DK 1622] >gi|119371370|sp|Q1D6M1|LEPA_MYXXD GTP-binding protein lepA >gi|108465283|gb|ABF90468.1| GTP-binding protein LepA [Myxococcus xanthus DK 1622] (603 aa)
Score = 1775, Expect = 0.0e+00, Identities = 334/599 (55%), Positives = 453/599 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDST--RKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +  +IRNF I+AHIDHGKSTL+DR+++ T TLT RE + Q LD+M IERERGITIK  +V++ Y   KD + Y  +LIDTPGHVDF YEVSRSLAACEGALLVVDA+QGVEAQTLSNVY+AL++NLEI+PVINKIDLPSAD+DR + ++ED IG+D S A   SAK G+ I  I+E++++ +PPP  S D  PL+AL+FDS+YD Y+G V LVR+  G +K+  KI+  SNN+ F V  LGV +P       L+AGEVG + A++K ++   VGDT+T+++ P     PG++++ PMV+ G++P+DS  YE  ++AL K+ L+DS+ TYE E+S ALGFG RCG+LGLLHM++++ERL+RE+N+ LI TAPSV+Y++  + G  L +D+ AKLP     ++ +EP     I VP+D LG +++LCQ  RG   D+  + S+  R +VTY +PLAE+++ FFDKLKS S+GYA+LDYE+  Y + DL ++DIL+NG+ VDALS I+HRE A  R R++C KLKE IPK  +E+ IQA IG KII+RET+SA+RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G V +P + F+ +L  E
  S:     4 ENAHIRNFCIIAHIDHGKSTLADRLLDKTGTLTKREAQAQFLDNMAIERERGITIKAQSVRMNY-TAKDGKQYVLNLIDTPGHVDFAYEVSRSLAACEGALLVVDATQGVEAQTLSNVYMALDHNLEIIPVINKIDLPSADVDRTRAEIEDVIGIDASVAVPCSAKEGIGIQDILESVVQNVPPPSGSAD-APLKALIFDSWYDNYRGVVTLVRVLEGTLKLKQKIKLFSNNKVFEVQELGVFSPFSRPVPQLIAGEVGVLVANVKELQDAKVGDTVTEESRPTAEPFPGFQEVKPMVFSGIFPVDSADYENLRDALAKLVLNDSAFTYEPESSTALGFGFRCGYLGLLHMEIVQERLEREYNLNLITTAPSVVYRITTSKGETLLVDNPAKLPPVQHIEKFEEPILTCHIHVPNDHLGAILKLCQERRGVQKDMKYLGSSGQRVQVTYEMPLAEVVFDFFDKLKSVSRGYASLDYELAGYIESDLARLDILINGDPVDALSVIVHRERAYLRGREVCQKLKEVIPKQMYEVAIQAAIGAKIISRETISAIRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGTVEIPQEAFLAVLKSE 602
>gi|116492675|ref|YP_804410.1| GTP-binding protein LepA [Pediococcus pentosaceus ATCC 25745] >gi|116102825|gb|ABJ67968.1| GTP-binding protein LepA [Pediococcus pentosaceus ATCC 25745] (613 aa)
Score = 1775, Expect = 0.0e+00, Identities = 339/598 (56%), Positives = 459/598 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           + +IRNFSIVAHIDHGKSTL+DRI+E T T+  R+M+NQ+LD+MD+ERERGITIKLNAV+L Y    D + Y FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+NVYLA++++LEIVPVINKIDLP+AD +RVK ++E+ +GLD S+A + SAK G+ I +++E I+E+IP P D D + PLQAL+FDS YD Y+G V  VR+  G VK G KI+ M++   + V+ +GVN+P  + ++ L+AG+VG++ ASIK+IK   VGDT+T   NPA   L GY+++ PMVY GLYP D+ +Y   +EALEK+ L+D++L +E E+SQALGFG RCGFLGLLHMDV++ERL+REFN+ LI TAPSV Y+V + DG+   +++ +++PD +  K I+EP+  A I+VP++++G VMEL Q  RG +  +  +D  R  V Y +PL+EI++ FFDKLKS ++GYA+LDYE+ +Y+  DLVK+DILLNG +VDALS I HR+FA  R  +I   LKE IP+  FEIP+QA IG KIIAR  + A RK+V +K + GD  R+ KLL++QK GKKR+K++G V VP + F+ +L  +
  S:    11 QAHIRNFSIVAHIDHGKSTLADRILELTETVAKRDMQNQLLDTMDLERERGITIKLNAVELHY-TANDGEKYIFHLIDTPGHVDFSYEVSRSLAACEGAVLVVDAAQGVEAQTLANVYLAIDDDLEIVPVINKIDLPAADPERVKNEIENVVGLDASDAVMASAKQGIGIPELLEQIVEKIPAP-DGDLDAPLQALIFDSKYDDYRGVVLSVRLFEGMVKPGDKIKLMNSGSVYEVNEVGVNSPDPLKRDFLMAGDVGYLTASIKDIKDTRVGDTVTLVKNPAAQPLEGYREMSPMVYSGLYPTDNAKYNDLREALEKLQLNDAALEFEPESSQALGFGFRCGFLGLLHMDVVQERLEREFNLDLITTAPSVTYRVEMTDGSEKIVENPSEMPDASSIKNIKEPYVNASIMVPNEYVGAVMELSQFRRGIFDTMDYIDENRVNVKYALPLSEIIFDFFDKLKSSTRGYASLDYELGEYKVSDLVKIDILLNGERVDALSFISHRDFAQQRGNEITASLKEIIPRRNFEIPVQAAIGNKIIARTNIRAYRKDVTSKIHTGDPDRRAKLLDKQKRGKKRMKSVGKVEVPQEAFMTVLKTD 606
>gi|160940359|ref|ZP_02087704.1| hypothetical protein CLOBOL_05249 [Clostridium bolteae ATCC BAA-613] >gi|158436939|gb|EDP14706.1| hypothetical protein CLOBOL_05249 [Clostridium bolteae ATCC BAA-613] (604 aa)
Score = 1775, Expect = 0.0e+00, Identities = 346/597 (57%), Positives = 454/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSN-NETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRIIE T  LT+REM+ Q+LD+MD+ERERGITIK  AV+ +Y   +D  +Y F+LIDTPGHVDF YEVSRSLAAC+GA+LVVDASQG+EAQTL+NVYLAL+++L++ PVINKIDLPSA+ +RV  ++ED IGLD S+AP +SAKTG+NI +++EAI+ +IP P   D   PL+AL+FDS YD+YKG +   RI  G VK GT IR M+  +E  +V        + +  E L AG VG+I ASIKN++   VGDT+T   NP  + LPGYKK+ PMVYCGLYP D  +Y   ++ALEK+ L+D+SL YE ETS ALGFG RCGFLGLLH+++I ERL+RE+N+ L+ TAP V+Y+V    G ++E+ + + LPD T  + ++EP   AEI+V  +F+G++M LCQ  RG YL +  +++TR  + Y +PL EI+Y FFD LKS S+GYA+ DYE+  Y +  LVK+DIL+N  +VDALS I+H + A +R RK+C KLK+ IP+H FEIPIQA IGGKIIARETV A+RK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ IGNV +P   F+ +L
  S:     4 VDQSKIRNFCIIAHIDHGKSTLADRIIEKTGLLTSREMQEQVLDNMDLERERGITIKSQAVRTVY-KAQDGNEYIFNLIDTPGHVDFNYEVSRSLAACDGAILVVDASQGIEAQTLANVYLALDHDLDVFPVINKIDLPSAEPERVAAEIEDVIGLDASDAPHISAKTGVNIEEVLEAIVHKIPAP-KGDPQAPLKALIFDSTYDSYKGVIIFCRIMEGTVKRGTPIRMMATGSEEDVVEVGYFGAGQFIPCEELRAGMVGYITASIKNVRDTRVGDTVTSRDNPCASPLPGYKKVTPMVYCGLYPADGAKYNDLRDALEKLQLNDASLFYEPETSIALGFGFRCGFLGLLHLEIIEERLEREYNLDLVTTAPGVVYRVHKTTGEMMELTNPSNLPDPTEIEYMEEPIVSAEIMVTTEFVGSIMTLCQERRGNYLGMEYIETTRALLKYELPLNEIIYDFFDALKSRSRGYASFDYELKGYERSSLVKLDILVNREEVDALSFIVHADSAYERGRKMCEKLKDEIPRHLFEIPIQAAIGGKIIARETVKAVRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQIGNVEIPQKAFMSVL 599
>gi|162447536|ref|YP_001620668.1| translation elongation factor 4 (EF4), GTPase [Acholeplasma laidlawii PG-8A] >gi|161985643|gb|ABX81292.1| translation elongation factor 4 (EF4), GTPase [Acholeplasma laidlawii PG-8A] (609 aa)
Score = 1774, Expect = 0.0e+00, Identities = 353/598 (59%), Positives = 452/598 (75%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K IRNFSI+AHIDHGKSTL+DRI+E T+T+  R MK Q+LDSMD+ERERGITIKLNAVQL Y   KD  +Y  HLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG++AQTL+NVYLAL+N+LEI+PV+NKIDLPSA+ ++V++++E+ IG+D S+A + S K+GL +  I+E I+  +  P + D N+PLQAL+FDS++D Y+G +  +R+ NG +K G  I FM+    F V  +GV TP+    ++L  G+VG+I A+IK +  + VGDTIT   N    +LPGY+ + P+V+CGL+PID  QY   +EALEK+ L+D+SL YE ETSQALGFG R GFLGLLHMD+I+ER+ REFNI LIATAPSVIY V L DG+ L +D+ + LPD      I+EP  KA I+ P D++G VME+CQ  RG + D+  VD TR  +TY IPLAEI+Y FFDKLKS +KGYA+ DY +  Y    L K+DILLNG  VDALS I+H +FA  R + I  KLK  IP+  FEIP+QA +GGKIIARET+ AMRK+V+AKCYGGD++RKKKLLE+QKEGKKR+K  G V +P   F+ ILS E
  S:    13 QKNIRNFSIIAHIDHGKSTLADRILEMTSTVDKRNMKAQLLDSMDLERERGITIKLNAVQLTY-KAKDGNEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIQAQTLANVYLALDNDLEIIPVLNKIDLPSAEPEKVRREIEEIIGIDASDAVIASGKSGLGVIDILERIVRDVKAP-EGDSNEPLQALIFDSFFDMYRGVIPTIRVVNGSIKKGDLIEFMATKAQFEVVEVGVYTPEQKPVDILGPGDVGYITAAIKTLDDVRVGDTITHVKNHTKKALPGYRTLNPVVFCGLFPIDPDQYRDLREALEKLKLNDASLIYEPETSQALGFGFRTGFLGLLHMDIIQERISREFNIELIATAPSVIYDVYLTDGSKLLVDNPSFLPDVQKIDRIEEPIVKATIMCPKDYVGAVMEICQKKRGIFKDMTYVDQTRVMITYRIPLAEIVYDFFDKLKSSTKGYASFDYVLDGYMTSRLRKMDILLNGEVVDALSVIVHHDFAYSRGKAIVEKLKTLIPRQMFEIPVQAALGGKIIARETIKAMRKDVIAKCYGGDVSRKKKLLEKQKEGKKRMKTFGRVDIPQSAFLAILSNE 608
>gi|16332331|ref|NP_443059.1| GTP-binding protein LepA [Synechocystis sp. PCC 6803] >gi|2494266|sp|P74751|LEPA_SYNY3 GTP-binding protein lepA >gi|1653961|dbj|BAA18871.1| LepA gene product [Synechocystis sp. PCC 6803] (603 aa)
Score = 1773, Expect = 0.0e+00, Identities = 343/592 (57%), Positives = 463/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T+T+  REMK Q LD+MD+ERERGITIKL A ++ Y   KD QDY  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLAL+NNLEI+PV+NKIDLPSA+ DRV  ++E+ +GLDCS+    SAK G+ ++ I+EAI++Q+PPP D+ D +PL+AL+FDSYYDAY+G V   R+ +GQVK G K+R M++++ +++  LGV +P  V  E L AGEVG+ AA+IK +    VGDTIT   +PA   LPGY +  PMV+CGL+PID+ QY   K+ALEK+ L+D++L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSVIY+V   D  ++E+D+ + LP      +++EPF K E+I P+ ++G +MELCQ+ RG + D+     TR  + Y +PLAE++  FFD+LKS +KGYA+++Y+++ YR+  LVK+DIL+NG+ VDAL+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQVTDTVQQREMKEQFLDNMDLERERGITIKLQAARMNY-KAKDGQDYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALDNNLEIIPVLNKIDLPSAEPDRVAAEIEEVVGLDCSDIIQASAKAGIGVDDILEAIVQQVPPPADTVD-QPLRALIFDSYYDAYRGVVVYFRVMDGQVKKGDKVRLMASDKEYVIDELGVLSPTQVQVEALHAGEVGYFAAAIKAVADARVGDTITMANSPAAEPLPGYTEANPMVFCGLFPIDADQYPDLKDALEKLKLNDAALSYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVIYRVTTTDEEVIEVDNPSLLPPIQKRLKVEEPFIKVEMITPETYVGTLMELCQSRRGVFKDMKFFTQTRTALIYELPLAEVVTDFFDQLKSRTKGYASMEYQLIGYRENPLVKLDILVNGDGVDALAMIVHRDKAYYVGRAMVSKLKELIPRHQFKVPIQAAIGAKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKAIGTVDVPQEAFMAVL 598
>gi|188580443|ref|YP_001923888.1| GTP-binding protein LepA [Methylobacterium populi BJ001] >gi|179343941|gb|ACB79353.1| GTP-binding protein LepA [Methylobacterium populi BJ001] (601 aa)
Score = 1773, Expect = 0.0e+00, Identities = 333/592 (56%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+M  Q+LDSMDIERERGITIK N V+L Y   +D QDY  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+ N EIVPV+NK+DLP+A+ DRVK+Q+E+ IGLD S A  +SAKTGLNI  ++EAI++++PPP   D   PL+AL+ DS+YD Y G V LVRI +G +K G  IR M  +  + V  +GV  PK+ +   L  GEVG+   SIK +    VGDTIT+D    T  LPG+K++  +V+CGL+P+D+  +E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI+TAPSV+Y++++ DG + E+ + A +PD    + ++EP+ +A I+ PDD+LG V++LCQ+ RG  +DL N    R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F+IP+QA IGGKIIARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKKR++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQQTGTVALRDMSEQMLDSMDIERERGITIKANTVRLEY-KAEDGQDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASEAVPISAKTGLNIEAVLEAIVKRLPPP-KGDREAPLKALLVDSWYDVYLGVVVLVRIVDGVLKKGMTIRMMGADAAYGVDRIGVFRPKMADIGELGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTQMLPGFKEVQAVVFCGLFPVDAADFENLRGAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLISTAPSVVYRLMMRDGELKELHNPADMPDPMKIETVEEPWIRATILTPDDYLGGVLKLCQDRRGIQIDL-NYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREGDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGRVEIPQEAFIAAL 597
>gi|144898653|emb|CAM75517.1| GTP-binding protein LepA [Magnetospirillum gryphiswaldense MSR-1] (600 aa)
Score = 1773, Expect = 0.0e+00, Identities = 327/594 (55%), Positives = 449/594 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++IRNF+I+AHIDHGKSTL+DR+I+    +  R+MK Q+LDSMDIERERGITIK   V+L Y   KD + Y  +L+DTPGHVDF YEVSRSLAACEG++LVVDASQGVEAQTL+NVY AL+   EIVPV+NKIDLP+A+ +RVK+QVED IGLD S+A ++SAK+G+ I  ++EA++ ++P P + D+   LQAL+ DS+YDAY G + LVR+KNG +K G KIR M+N   + V ++G  TPK++  + L  GE+G+I A IK +   +VGDTITDD  PA T+L G+K  +P+V+CGL+PID+  YE  +++L K+ L+D+S  YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI TAPSV+Y + + +G++ E+ + A +PD+ L   + EP+ KA I+VPD++LG++++LC   RG+ LDL      R    Y +PL E+++ F+D+LKS S+GYA+ DYE+  Y + DLVKV IL+N   VDAL+ I+HR  A  R R IC +LKE IP+  F+I IQA IGG+I+ARE++SA+RK+VLAKCYGGD++RK+KLL++QKEGKKR++  G V +P   F+  L
  S:     5 EHIRNFAIIAHIDHGKSTLADRLIQQCGAVEARDMKEQMLDSMDIERERGITIKAQTVRLAYQ-AKDGKTYQLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQALDAGHEIVPVLNKIDLPAAEPERVKQQVEDVIGLDASDAVMISAKSGIGIEDVLEALVTRLPCP-EGDEKADLQALLVDSWYDAYLGVIILVRVKNGVLKRGMKIRMMANGSAYEVDSVGYFTPKMIKADALRPGEMGFITAGIKAVADTNVGDTITDDKKPAATALAGFKPSIPVVWCGLFPIDAADYEDLRDSLAKLRLNDASFQYEPETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLITTAPSVVYHIHMTNGSMQELHNPADMPDQGLIDHVDEPWIKATIMVPDEYLGSILQLCTERRGQQLDLTYA-GNRAMAVYKLPLNEVVFDFYDRLKSISRGYASFDYEMDCYTESDLVKVSILVNQEPVDALAFIVHRANAESRGRGICTRLKELIPRQMFQIAIQAAIGGRIVARESISALRKDVLAKCYGGDVSRKRKLLDKQKEGKKRMRQFGRVEIPQSAFLAAL 595
>gi|28211657|ref|NP_782601.1| GTP-binding protein LepA [Clostridium tetani E88] >gi|28204099|gb|AAO36538.1| GTP-binding protein lepA [Clostridium tetani E88] (607 aa)
Score = 1772, Expect = 0.0e+00, Identities = 345/598 (57%), Positives = 462/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K +RNFSI+AHIDHGKSTL+DR++E T TLT REM  Q LD+MD+E+ERGITIK  A +LIY    D ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLALE+NLEIVPVINKIDLPSA  + VK+++ED IG+D S+APL+SAKTGLNI  ++EA++E++P P   ++ +PL+AL+FDSYYDAYKG VC VR+K G +K GT+I+ M+    + V+  GV  P+ +  + L AG+VG+I ASIKN++   VGDTIT+   PAT +L GY+  +PMV+ G+YP+D  +Y   KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHMD+I+ER++REFN+ +I TAPSVIYKV   +   +++ +   LP+++    ++EP  +  II P D++G +MELCQN RG + D+  +++TR  + Y IPL EI+Y FFD LKS S+GYA+LDYE+  Y +  LVK+DILLNG+ VDALS I+  E A  R R++  KLKE IP+  FE+PIQA +G K+IARETV A+RK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ IG+V +P + F+ +L  E
  S:    11 QKRVRNFSIIAHIDHGKSTLADRLLEETGTLTQREMDEQTLDTMDLEKERGITIKSQAARLIYKR-DDEKEYILNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALEHNLEIVPVINKIDLPSARPEEVKREIEDIIGIDASDAPLISAKTGLNIKDVLEAVVEKVPYP-KGEEEEPLKALIFDSYYDAYKGVVCYVRVKEGTIKPGTEIKLMATGRKYEVTETGVFVPEYMKIDGLEAGDVGYITASIKNVRDARVGDTITEAKRPATEALEGYRPAIPMVFSGIYPVDGAKYGELKEALEKLQINDAALSFEPETSIALGFGFRCGFLGLLHMDIIQERIEREFNLDIITTAPSVIYKVTKTNKETIDVTNPTNLPEESEIAYMEEPIVECSIITPSDYVGPIMELCQNRRGVFKDMQYIETTRVVLNYDIPLNEIIYDFFDALKSRSRGYASLDYELKGYTQSKLVKLDILLNGDNVDALSMIVPEERAYSRGRQMAEKLKEIIPRQMFEVPIQAAVGSKVIARETVRALRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQIGSVEIPQEAFMSVLKTE 606
>gi|60416422|sp|Q892Q6|LEPA_CLOTE GTP-binding protein lepA (602 aa)
Score = 1772, Expect = 0.0e+00, Identities = 345/598 (57%), Positives = 462/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K +RNFSI+AHIDHGKSTL+DR++E T TLT REM  Q LD+MD+E+ERGITIK  A +LIY    D ++Y  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG++AQTL+N YLALE+NLEIVPVINKIDLPSA  + VK+++ED IG+D S+APL+SAKTGLNI  ++EA++E++P P   ++ +PL+AL+FDSYYDAYKG VC VR+K G +K GT+I+ M+    + V+  GV  P+ +  + L AG+VG+I ASIKN++   VGDTIT+   PAT +L GY+  +PMV+ G+YP+D  +Y   KEALEK+ ++D++L++E ETS ALGFG RCGFLGLLHMD+I+ER++REFN+ +I TAPSVIYKV   +   +++ +   LP+++    ++EP  +  II P D++G +MELCQN RG + D+  +++TR  + Y IPL EI+Y FFD LKS S+GYA+LDYE+  Y +  LVK+DILLNG+ VDALS I+  E A  R R++  KLKE IP+  FE+PIQA +G K+IARETV A+RK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ IG+V +P + F+ +L  E
  S:     6 QKRVRNFSIIAHIDHGKSTLADRLLEETGTLTQREMDEQTLDTMDLEKERGITIKSQAARLIYKR-DDEKEYILNLIDTPGHVDFNYEVSRSLAACEGAILVVDATQGIQAQTLANCYLALEHNLEIVPVINKIDLPSARPEEVKREIEDIIGIDASDAPLISAKTGLNIKDVLEAVVEKVPYP-KGEEEEPLKALIFDSYYDAYKGVVCYVRVKEGTIKPGTEIKLMATGRKYEVTETGVFVPEYMKIDGLEAGDVGYITASIKNVRDARVGDTITEAKRPATEALEGYRPAIPMVFSGIYPVDGAKYGELKEALEKLQINDAALSFEPETSIALGFGFRCGFLGLLHMDIIQERIEREFNLDIITTAPSVIYKVTKTNKETIDVTNPTNLPEESEIAYMEEPIVECSIITPSDYVGPIMELCQNRRGVFKDMQYIETTRVVLNYDIPLNEIIYDFFDALKSRSRGYASLDYELKGYTQSKLVKLDILLNGDNVDALSMIVPEERAYSRGRQMAEKLKEIIPRQMFEVPIQAAVGSKVIARETVRALRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQIGSVEIPQEAFMSVLKTE 601
>gi|116618291|ref|YP_818662.1| GTP-binding protein LepA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116097138|gb|ABJ62289.1| GTP-binding protein LepA [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (620 aa)
Score = 1772, Expect = 0.0e+00, Identities = 339/598 (56%), Positives = 463/598 (77%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K+IRNFSIVAHIDHGKST++DRI+E T+T+  R+M+NQ+LD+MD+ERERGITIKLNAV+ ++++ KD + Y FHLIDTPGHVDF+YEVSR+LAA EGA+LVVDASQGVEAQTL+NVYLAL+N+LEI+PVINKIDLP+AD ++V+ ++ED IG+D S A L SAK G+ I +++E I+  +P P   D + PL+AL+FDS YDAY+G V  +R++ G VK G K+R M+    + V+ +GV +P    ++ L+AG+VG++ A+IK+I +   GDTIT   NPA+  L GY+ + PMVY GLYP D+ +Y   +EALEK+ L+D++LT+E ETSQALGFG R GFLGLLHMDVI+ERL+REF++ L+ TAPSV Y+V+ ND   +EI++ +++PD    K I+EP+  A+I+VP+D++G VMEL Q  RGE+  +  +D TR  V Y +PL+EI+++FFDKLKS ++GYA+LDYE+  YR+ DLVK+DILLN  KVDALS I+HR+FA +R R I  KLKE IP+  FEIP+QA IG KI+AR  + A RK+V AK + GD  R+ KLL++QK GK R+K++G+V VP + F+ +L  E
  S:    16 QKHIRNFSIVAHIDHGKSTIADRILEQTHTVAERDMQNQLLDTMDLERERGITIKLNAVE-VHYDAKDGETYIFHLIDTPGHVDFSYEVSRALAAAEGAILVVDASQGVEAQTLANVYLALDNDLEILPVINKIDLPAADAEKVRTEIEDVIGIDASEAVLASAKQGIGIPELLEKIVTDLPAP-QGDIDAPLRALIFDSAYDAYRGVVVNMRVREGIVKPGDKVRMMNTGAEYEVTEVGVMSPNAQKRDYLMAGDVGYLTAAIKDIHTTHSGDTITLVNNPASEPLSGYQPMTPMVYSGLYPSDNAKYTDLREALEKLQLNDAALTFEPETSQALGFGYRVGFLGLLHMDVIQERLEREFDLDLVTTAPSVTYRVVTNDEETIEIENPSEMPDTPKVKYIEEPYVHAQIMVPNDYVGAVMELAQRKRGEFDTMEYLDDTRVNVKYYMPLSEIIFNFFDKLKSSTRGYASLDYELSSYRQSDLVKIDILLNSEKVDALSFIVHRDFAVERGRIITSKLKEIIPRQNFEIPVQAAIGAKILARTNIKAYRKDVTAKIHTGDPDRRAKLLDKQKRGKARMKSVGSVEVPQEAFMAVLKTE 611
>gi|15964022|ref|NP_384375.1| GTP-binding protein LepA [Sinorhizobium meliloti 1021] >gi|24211926|sp|Q92SU3|LEPA_RHIME GTP-binding protein lepA >gi|15073198|emb|CAC41706.1| Probable GTP-binding protein membrane [Sinorhizobium meliloti 1021] (608 aa)
Score = 1772, Expect = 0.0e+00, Identities = 330/593 (55%), Positives = 449/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPL-DSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  REM  Q+LDSMDIERERGITIK   V+L Y    D + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN E+V V+NKIDLP+A+ +R+K+Q+E+ IG+D S+A L+SAKTGL I  ++EAI+ ++P P  +  D  PL+AL+ DS+YDAY G + LVR+ +G +K G  IR M  +  + V  +GV TPK+V  E L  GE+G+I ASIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ LIATAPSV+YK+ + DG+  E+ + A +PD     EI EP+ +A I+ PD++LG +++LCQ+ RG  ++L  V  TR  +TY +PL E+++ F+D+LKS SKGYA+ DY+I ++++ +LVK+ IL+NG  VDALS ++HR  A  R R++C KLKE IPKH F+IPIQA IGG +IARET+SA+RK+V AKCYGGD TRK+KLLE+QK GKKR++  G V +P + F+  L
  S:    12 HIRNFSIVAHIDHGKSTLADRLIQSTGGLAEREMSEQVLDSMDIERERGITIKAQTVRLHY-KANDGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPERIKEQIEEVIGIDASDAVLISAKTGLGIPDVLEAIVHKLPAPKSEGGDTAPLKALLVDSWYDAYLGVMVLVRVIDGTLKKGMTIRMMGTDAKYQVERVGVLTPKMVAMEALGPGEIGFITASIKEVADTRVGDTITEDKRPTAKALPGFKPAQPVVFCGLFPVDAADFEDLRSAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKLFMTDGSERELHNPADMPDVVKIAEIHEPWIRATILTPDEYLGGILKLCQDRRGIQIELTYV-GTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYQITEHKEGNLVKMSILVNGEPVDALSMMVHRMAAEKRGREMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRKLLEKQKAGKKRMRQFGKVEIPQEAFIAAL 603
>gi|160895332|ref|ZP_02076103.1| hypothetical protein CLOL250_02891 [Clostridium sp. L2-50] >gi|156863025|gb|EDO56456.1| hypothetical protein CLOL250_02891 [Clostridium sp. L2-50] (604 aa)
Score = 1771, Expect = 0.0e+00, Identities = 341/597 (57%), Positives = 460/597 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGV-NTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRIIE T  LT REM+NQ+LD+MD+ERERGITIK   V+ IY   +D ++Y F+LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLA++++L+++PVINKIDLPSA+ +RV  ++ED IG++  +AP +SAK G+NI+Q++E I+ +IP P   D  KPLQAL+FDS YD+YKG +   R+ +G VK GT IR M+      V  +G+    + V  + L AG VG+I AS+KN++  +VGDT+TD+ NP   +LPGYKK  PMVYCGLYP D  +Y   ++ALEK+ L+D+SL++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ L+ TAP V+Y+V   DG ++E+ + + LPD +  + ++EPF  AEI+V  +++G +M+LCQ  RG Y  +  ++ TR  + Y +PL EI+Y FFD LKS S+GYA+ DYE+  Y + +LVK+DIL+N  +VDALS I+H++ A +R RK+C KLK+ IP+H FEIPIQA IG K+IARETV A+RK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ IGNV +P   F+ +L
  S:     4 IDQSKIRNFCIIAHIDHGKSTLADRIIEKTGLLTEREMQNQVLDNMDLERERGITIKAQCVRTIY-KAQDGEEYIFNLIDTPGHVDFNYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDHDLDVMPVINKIDLPSAEPERVVNEIEDVIGIEAQDAPRISAKNGINIDQVLEQIVTKIPAPA-GDPEKPLQALIFDSIYDSYKGVIIFCRLFDGVVKRGTSIRMMATGAVAEVVEVGIFGAGRFVPCDELSAGMVGYITASLKNVRDTTVGDTVTDNDNPCAEALPGYKKAQPMVYCGLYPADGAKYPDLRDALEKLQLNDASLSFEPETSIALGFGFRCGFLGLLHLEIIQERLEREFNLDLVTTAPGVVYRVHTTDGKMIELTNPSNLPDPSNIEYMEEPFVSAEIMVTTEYVGAIMQLCQERRGVYQGMEYMEETRALLRYDLPLNEIIYDFFDALKSRSRGYASFDYEMKGYVRSELVKLDILINKEEVDALSFILHQDTAYERGRKMCEKLKQEIPRHLFEIPIQAAIGNKVIARETVRAVRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQIGNVEIPQQAFMSVL 599
>gi|85713445|ref|ZP_01044435.1| GTP-binding protein LepA [Nitrobacter sp. Nb-311A] >gi|85699349|gb|EAQ37216.1| GTP-binding protein LepA [Nitrobacter sp. Nb-311A] (603 aa)
Score = 1771, Expect = 0.0e+00, Identities = 334/592 (56%), Positives = 448/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  LT REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+NN EIVPV+NK+DLP+A+ D+VK+Q+ED IG+D S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V L+R+ +G ++ G++IR M  +  + V  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DG  +EI +   +PD     EI+EP+ +A I+ PD++LG V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + +Y+  DLVK+ IL+NG  VDALS ++HR  A  R R +  K+KE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGD++RK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQMTGGLTDREMAGKEQVLDSMDIERERGITIKAQTVRLKYR-AKDGKDYVFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKVDLPAAEADKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAIVTRLPPP-KGDRDATLKALLVDSWYDVYLGVVVLIRVIDGVLRKGSRIRMMGTSAAYDVERVGFFTPKMQQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPVVFCGLFPVDADDFETLRTAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMHLTDGQEIEIHNPIDMPDVVKIAEIEEPWIEATILTPDEYLGGVLKLCQDRRGVQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTEYKPADLVKMQILVNGEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDVSRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 599
>gi|153813169|ref|ZP_01965837.1| hypothetical protein RUMOBE_03585 [Ruminococcus obeum ATCC 29174] >gi|149830700|gb|EDM85791.1| hypothetical protein RUMOBE_03585 [Ruminococcus obeum ATCC 29174] (602 aa)
Score = 1771, Expect = 0.0e+00, Identities = 343/597 (57%), Positives = 460/597 (77%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALG-VNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRIIE T TLT REM++Q+LD+M++ERERGITIK  AV+++Y    D ++Y F+LIDTPGHVDF YEVSRSLAAC+GA+LVVDA+QG+EAQTL+NVYLAL+++L+++PVINKIDLPSAD +RV  ++ED IGL+  +AP +SAKTGLN+ +++E I+ +IP P   D N PL+AL+FDS YDAYKG +   R+ +G+VK GT+IR M+   T  V  +G     + +  + L AG VG+I ASIKN+    VGDT+TD+  P   +LPGYKK+ PMVYCGLYP D  +Y   ++ALEK+ L+D+SL +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAP V+YKV   +G ++E+ + + LPD +  + ++EP   AEI+V  +F+G +M+LCQ  RG+Y  +  ++ TR  + Y +PL EI+Y FFD LKS S+GYA+LDYE+  Y + +LVK+DIL+N  +VDALS I+H + A +R RK+C KLKE IP+  FEIPIQA IG KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +GNV +P   F+ +L
  S:     2 IDQSKIRNFCIIAHIDHGKSTLADRIIEKTGTLTEREMQSQVLDNMELERERGITIKSQAVRIVY-KANDGEEYIFNLIDTPGHVDFNYEVSRSLAACDGAILVVDAAQGIEAQTLANVYLALDHDLDVLPVINKIDLPSADPERVVNEIEDVIGLEAHDAPRISAKTGLNVEEVLEQIVTKIPAP-HGDVNAPLKALIFDSVYDAYKGVIVFCRVMDGRVKKGTQIRMMATGFTTEVVEVGYFGAGQFIPCDELTAGMVGYITASIKNLGDTRVGDTVTDNERPCAEALPGYKKVQPMVYCGLYPADGARYGDLRDALEKLQLNDASLFFEPETSIALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPGVVYKVYKTNGEVIELTNPSNLPDPSEIEYMEEPMVNAEIMVTTEFIGAIMDLCQERRGQYNGMEYMEETRALLKYKLPLNEIIYDFFDALKSRSRGYASLDYELCGYERSELVKLDILVNKEEVDALSFIVHADTAYERGRKMCEKLKEEIPRQLFEIPIQAAIGSKIIARETVRAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQVGNVEIPQKAFMSVL 597
>gi|117924213|ref|YP_864830.1| GTP-binding protein LepA [Magnetococcus sp. MC-1] >gi|166987754|sp|A0L631|LEPA_MAGSM GTP-binding protein lepA >gi|117607969|gb|ABK43424.1| GTP-binding protein LepA [Magnetococcus sp. MC-1] (598 aa)
Score = 1770, Expect = 0.0e+00, Identities = 338/597 (56%), Positives = 447/597 (74%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M   +IRNFSI+AHIDHGKSTL+DR+I+FT  L+ R+MK Q+LDSMDIERERGITIK  +V+L Y   KD + Y  +LIDTPGHVDFTYEVSRSLAACEGALL+VDA+QGVEAQT++NVYLALE++LEI+PV+NKIDLPSA+ +RV++Q+E+ IGLD S A L SAK+G+ I +I+EAI++++PPP   D + P +ALV DS+YD Y G V L R+ +G +K G KIRFM     + +  +G  TP +     L AGEVG I A IK +    VGDTIT    P  + LPG++    MV+ GLYP+DS  YE  K+ALEK+ ++D+SL YE ETS ALGFG RCGFLG+LHM++I+ERL+REF++ L+ TAP+V+Y+V   DG I++I S   LP  T  + I+EP+  A I+VP +++G VM+LC + RG   D+  +  TR  V Y +P++E++  FFD+LKS +KGYA+LDY +LDYR  DLVK+DIL+NG+ VDALS I+HR  +  R R++  K+KE I +  F++ +QA IGGKIIARETV A+RKNV AKCYGGDITRK+KLLE+QK GKKR+K +G V +P + F+ +L
  S:     1 MSLDHIRNFSIIAHIDHGKSTLADRLIQFTGALSERDMKEQVLDSMDIERERGITIKAQSVRLNY-KAKDGKTYVLNLIDTPGHVDFTYEVSRSLAACEGALLIVDAAQGVEAQTMANVYLALEHDLEIIPVLNKIDLPSAEPERVREQIEEVIGLDASEAILASAKSGIGIEEILEAIVKRVPPP-KGDLDAPAKALVVDSWYDNYLGVVSLARVYDGVLKAGEKIRFMGVGMDYPLDNVGFLTPVLTKVAELKAGEVGCIMAGIKKLSDARVGDTITTVRRPCASQLPGFQPAKSMVFAGLYPVDSADYEDLKDALEKLAINDASLNYEVETSPALGFGFRCGFLGMLHMEIIQERLEREFDLDLVTTAPTVVYRVKQTDGQIMDIRSPGDLPPTTKREYIEEPYILANIMVPAEYMGPVMQLCTDRRGTQKDMSYISDTRVMVQYEMPMSEVVMDFFDRLKSMTKGYASLDYHLLDYRMSDLVKLDILINGDPVDALSVIVHRNISQYRGRELAKKMKELIHRQMFDVAVQACIGGKIIARETVKALRKNVTAKCYGGDITRKRKLLEKQKAGKKRMKQVGKVEIPQEAFLAVL 595
>gi|145617863|ref|ZP_01773926.1| GTP-binding protein LepA [Geobacter bemidjiensis Bem] >gi|144945910|gb|EDJ80972.1| GTP-binding protein LepA [Geobacter bemidjiensis Bem] >gi|197087626|gb|ACH38897.1| GTP-binding protein LepA [Geobacter bemidjiensis Bem] (599 aa)
Score = 1769, Expect = 0.0e+00, Identities = 338/597 (56%), Positives = 453/597 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           ++IRNFSI+AHIDHGKSTL+DR++EFT T++ RE ++Q LD MD+ERERGITIK   V+L Y    D +DY  +LIDTPGHVDFTYEVSRSL ACEG LLVVDASQGVEAQTL+NVYLAL+ NLE+  V+NKIDLP+A+ +RVK ++E+ IGLD  +A L SAK G+    I+E I+++IPPP   D  KP++AL+FDS+YD Y+G + LVR+ +G VK G KI+ MSN +++ V   GV +P++    +L AGEVG+I A I+ +    VGDT+T   NP   +LPGYK++ PMV+ GLYPID++QYE  ++AL K+ L+DSS +Y+ ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ LI TAP+V+Y+V   DG++  I SA +LP       ++EPF  A I VP+DF+G ++ LC+  RG   ++  +  TR  V Y +PL E++  F+D+LKS +KGYA+LDYE+LDYR+ +LV+++I++NG  VDALS I+H++ A  R R++  K+KE IP+  FEI IQA +G K+IARETV AMRK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL  E
  S:     4 EHIRNFSIIAHIDHGKSTLADRLLEFTGTVSAREKQDQFLDKMDLERERGITIKAQTVRLNYR-ADDGKDYILNLIDTPGHVDFTYEVSRSLTACEGGLLVVDASQGVEAQTLANVYLALDANLEVFVVLNKIDLPAAEPERVKAEIEEIIGLDTHDAVLASAKEGIGTKDILEEIVKKIPPP-KGDATKPMKALLFDSWYDQYQGVIILVRLVDGTVKKGDKIQLMSNRKSYEVLKAGVFSPEMRETPMLSAGEVGFIIAGIREVADAKVGDTVTLLHNPCDAALPGYKEVKPMVFSGLYPIDTSQYEQLRDALAKLKLNDSSFSYDPETSLALGFGFRCGFLGLLHMEIIQERLEREFNLELITTAPTVVYRVHGTDGSLTSIQSANQLPPTQEIAYVEEPFILASIHVPNDFVGGILALCEEKRGVQREIKYLTPTRVMVVYELPLNEVVLDFYDRLKSITKGYASLDYELLDYRQSELVRLNIMINGEVVDALSLIIHKDKAYYRGRELVSKMKELIPRQMFEIAIQAAVGTKVIARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598
>gi|104774196|ref|YP_619176.1| GTP-binding protein LepA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116514286|ref|YP_813192.1| GTP-binding protein LepA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|122274982|sp|Q049W8|LEPA_LACDB GTP-binding protein lepA >gi|119371360|sp|Q1G9R4|LEPA_LACDA GTP-binding protein lepA >gi|103423277|emb|CAI98112.1| GTP-binding protein LepA [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|116093601|gb|ABJ58754.1| GTP-binding protein LepA [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (612 aa)
Score = 1769, Expect = 0.0e+00, Identities = 340/595 (57%), Positives = 453/595 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNFSIVAH+DHGKST++DRI+E T+T++ R++KNQ+LD M +ER+RGITIK+N+VQ+ YH   D +DY FHLIDTPGHVDF+YEVSRSLAACEGA+LVVDASQGV+AQTLSN YLALEN+LEI+PV+NKIDLPSAD D  K ++ D +GLD S+A  VS KTG  I +++E I+  I  P   D  KPL+AL+FDS YD Y+G V  VRI+ G VK G +I  M+  + + V+ +GV++P  V +++L+AG+VG+I A+IK+++   VGDTIT   NP   +LPGY++I PMVY G+YP D+  Y+  KEAL+K+ L+D+SL +E ETSQALGFG RCGFLGLLHMDV++ERL++EF++ LI TAPSV Y  ++  G +  ID+ A LPD   YKE+QEP+ KAEI+VP+DF+G VM+LC+  RGE+  +  +D  R  V Y +PLAEI+Y FFD+LKS +KGYA+LDYEI+ Y+  +LVK+DILLN   +DALS I HRE A DR+ ++C  LK+ IP+  F++ IQ  IG KII+R T+   RK+V  K + GD  R+ KLLE+QK GKKR+K++G V VP D F+ +L
  S:    10 QKHIRNFSIVAHVDHGKSTIADRILELTDTVSKRQLKNQMLDDMPLERQRGITIKMNSVQVKYH-ANDGEDYIFHLIDTPGHVDFSYEVSRSLAACEGAVLVVDASQGVQAQTLSNTYLALENDLEILPVLNKIDLPSADPDMAKSEIGDMLGLDASDAVEVSGKTGAGIPELLERIVTDISAP-TGDLTKPLKALIFDSKYDDYRGVVMSVRIEEGTVKPGDEIMIMNTGKKYEVTEVGVSSPHPVKEDILIAGDVGYITANIKSVRETRVGDTITSAENPTAEALPGYRQIPPMVYSGMYPTDNRDYDDLKEALQKLQLNDASLEFEPETSQALGFGFRCGFLGLLHMDVVQERLEQEFDLDLIMTAPSVDYHAIMPTGEVKLIDNPADLPDAGEYKELQEPYVKAEIMVPNDFVGAVMQLCEGKRGEFQTMDYLDKYRVNVIYEMPLAEIIYDFFDQLKSSTKGYASLDYEIIGYKATNLVKIDILLNKEPIDALSFIAHREEARDRAVQMCSLLKKLIPRQNFQVDIQGAIGSKIISRATIKPYRKDVTWKIHTGDPDRRAKLLEKQKRGKKRMKSVGRVEVPQDAFMAVL 602
>gi|83312961|ref|YP_423225.1| GTP-binding protein LepA [Magnetospirillum magneticum AMB-1] >gi|119371363|sp|Q2W0F9|LEPA_MAGMM GTP-binding protein lepA >gi|82947802|dbj|BAE52666.1| Membrane GTPase LepA [Magnetospirillum magneticum AMB-1] (600 aa)
Score = 1769, Expect = 0.0e+00, Identities = 332/593 (55%), Positives = 439/593 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+    +  REMK Q+LDSMDIERERGITIK   V+L Y   KD + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   E+VPV+NKIDLP+A+ +RVK+Q+ED IGLD S+A ++SAKTG+ I  ++EA++ ++P P + D + PLQAL+ DS+YD Y G + LVRIKNG +K G KIR M+    + V + G  TPK+V    L  GE+G+  A+IK +    VGDT+TDD  PA T LPG+K  +P+V+CGL+PID+  YE  +++L K+ L+D+S  YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI TAPSV+Y+V   +G + E+ + A +PD      ++EP+ KA I+VPD++LG V+ LC   RG+ +DL    S R    Y +PL E+++ F+D+LKS S+GYA+ DYE+  Y + DLVKV IL+N   VDALS ++HR  A  R R IC +LKE IP+  F+I IQA IGG+I+ARE++SA+RK+V AKCYGGD TRK+KLLE+QKEGKKR++  G V +P   F+  L
  S:     6 HIRNFSIVAHIDHGKSTLADRLIQACGAIEAREMKEQMLDSMDIERERGITIKAQTVRLDY-KAKDGKTYQLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEVVPVLNKIDLPAAEPERVKQQIEDVIGLDTSDAVMISAKTGIGIGDVLEALVNRLPCP-EGDADAPLQALLVDSWYDPYLGVIILVRIKNGVLKKGQKIRMMATQAAYQVDSCGYFTPKLVQTTELRPGEMGFFTAAIKAVADTKVGDTVTDDKKPADTPLPGFKPSVPVVWCGLFPIDAADYEDLRDSLAKLRLNDASFQYEPETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLITTAPSVVYRVHKTNGEMEELHNPADMPDPARIDHMEEPWIKATIMVPDEYLGPVLTLCTERRGQQIDLTYAGS-RAMAVYKLPLNEVVFDFYDRLKSISRGYASFDYEVDSYAQSDLVKVSILVNAEPVDALSFVVHRANAESRGRGICTRLKELIPRQMFQIAIQAAIGGRIVARESISALRKDVTAKCYGGDATRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAAL 595
>gi|170017334|ref|YP_001728253.1| GTP-binding protein LepA [Leuconostoc citreum KM20] >gi|169804191|gb|ACA82809.1| GTP-binding protein LepA [Leuconostoc citreum KM20] (617 aa)
Score = 1768, Expect = 0.0e+00, Identities = 339/598 (56%), Positives = 460/598 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K+IRNFSIVAHIDHGKST++DRI+E T+T+  R+M+NQ+LD+MD+ERERGITIKLNAV+ ++++ KD + Y FHLIDTPGHVDF+YEVSRSLAA EGA+LVVDA+QGVEAQTL+NVYLAL+NNLEI+PVINKIDLP+AD ++V+ ++ED IG+D S A L SAK G+ I +++E I+  +P P   D   PL+AL+FDS YD Y+G V  +R++ G VK G K+R M+    + V+ +GV +P    ++ L+AG+VG++ A+IK+I +   GDTIT   NPA+  L GYK + PMVY GLYP D+ +Y   ++ALEK+ L+D++L++  ETSQALGFG R GFLGLLHMDVI+ERL+REF + L+ TAPSV Y V  NDG +LEI++ +++P+ +  K I+EP+  A+I+VP+D++G VMEL Q  RGE+  +  +D TR  V Y IPL+EI+++FFDKLKS ++GYA+LDYEI  YR+ DL+K+DILLN  KVDALS I+HR+FA++R R I  KLKE IP+  FEIP+QA IG KI+AR  + A RK+V AK + GD  R+ KLL++QK GK R+K++G V VP + F+ +L  E
  S:    13 QKHIRNFSIVAHIDHGKSTIADRILEQTHTVAERDMQNQLLDTMDLERERGITIKLNAVE-VHYDAKDGETYIFHLIDTPGHVDFSYEVSRSLAAAEGAILVVDAAQGVEAQTLANVYLALDNNLEILPVINKIDLPAADPEKVRAEIEDVIGIDASEAVLASAKKGVGIPELLEKIVTDLPAP-TGDLTAPLRALIFDSAYDPYRGVVVNMRVREGIVKPGDKVRMMNTGAEYEVNEVGVMSPTAQKRDYLMAGDVGYLTAAIKDIHTTHSGDTITSVNNPASEPLAGYKPMTPMVYSGLYPSDNAKYTDLRDALEKLQLNDAALSFGPETSQALGFGYRVGFLGLLHMDVIQERLEREFGLDLVTTAPSVTYHVTTNDGEMLEIENPSEMPEASQIKYIEEPYVDAQIMVPNDYVGAVMELAQRKRGEFDTMEYLDETRVNVKYKIPLSEIIFNFFDKLKSSTRGYASLDYEISGYRQSDLLKIDILLNSEKVDALSFIVHRDFAAERGRIITSKLKEIIPRQNFEIPVQAAIGAKILARTNIKAYRKDVTAKIHTGDPDRRAKLLDKQKRGKARMKSVGTVDVPQEAFMAVLKTE 608
>gi|116250022|ref|YP_765860.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. viciae 3841] >gi|119371382|sp|Q1MMQ8|LEPA_RHIL3 GTP-binding protein lepA >gi|115254670|emb|CAK05744.1| putative GTP-binding protein [Rhizobium leguminosarum bv. viciae 3841] (610 aa)
Score = 1767, Expect = 0.0e+00, Identities = 330/593 (55%), Positives = 445/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLD-SDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  REM  Q+LD+MDIERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN EIV V+NKIDLP+A+ DR+K+Q+E+ IG+D S A L+SAKTGL I  ++EAI+ ++P P     D  PL+AL+ DS+YDAY G + LVR+ +G +  G  +R M  +  + V  +GV TPK+VN + L  GE+G+I ASIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ LIATAPSV+YK+ + DGT  E+ + A +PD     EI EP+ +A I+ PDD+LG +++LCQ+ RG  ++L  V  TR  +TY +PL E+++ F+D+LKS SKGYA+ DY + D+R+ +LVK+ IL+NG  VDALS ++HR  A  R R +C KLKE IPKH F+IPIQA IGG +IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKKR++  G V +P + F+  L
  S:    14 HIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQTVRLHYQ-ANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVHKLPAPKSPGGDKAPLKALLVDSWYDAYLGVMVLVRVIDGVLTKGQTVRMMGTDAKYQVERVGVLTPKMVNIDRLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKMFMTDGTERELHNPADMPDVVKISEIHEPWIRATILTPDDYLGGILKLCQDRRGIQIELTYV-GTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHREGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAAL 605
>gi|116625392|ref|YP_827548.1| GTP-binding protein LepA [Solibacter usitatus Ellin6076] >gi|122252308|sp|Q01SV7|LEPA_SOLUE GTP-binding protein lepA >gi|116228554|gb|ABJ87263.1| GTP-binding protein LepA [Solibacter usitatus Ellin6076] (604 aa)
Score = 1766, Expect = 0.0e+00, Identities = 325/597 (54%), Positives = 451/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD+++IRNFSI+AHIDHGKSTL+DR++E T  L+ REM  Q+LDSMD+ERERGITIK +AV+L Y    D + Y  +LIDTPGHVDF+YEVSRSL ACEGALLVVDASQGVEAQTL+N YLAL +NLEI+PVINKIDLP+A+ +R+++Q+E  +G+D  +A L SAK G+ I+ I+EAI+  +PPP  S D  PL+AL+FDS++D+Y+G + L+RI +G++K+G KI+ M+N + F V  LG   PK      L AGEVG++ A+IK +    +GDTIT+  NPAT  LPG+++I PMV+ GLYP++S ++ L ++ALEK+ L+DS+  +E E S ALGFG RCGFLGLLH+++++ERL+REFNI LI TAP V Y++    G ++E+D+  K PD +  + I+EP   A +I  +DFLG ++ L +  RG      ++ + R  +TY +PL EI+  F+D+LKS SKGYA+LDY +  YR+  +VK+D+L+ G  VDALS I+H++FA +R + +  +L++ IPK  FE+ +QA IG KI+ARET+SAMRKNV+AKCYGGDI+RK+KLLE+QKEGKKR+K +G V +P + F+ +L
  S:     1 MDREFIRNFSIIAHIDHGKSTLADRLLEVTGALSQREMMEQVLDSMDLERERGITIKAHAVRLNYR-ADDGKLYQLNLIDTPGHVDFSYEVSRSLQACEGALLVVDASQGVEAQTLANTYLALHHNLEIIPVINKIDLPAAEPERIREQIETVVGIDARDAVLCSAKQGVGIHDILEAIVHLVPPPKGSPD-APLRALIFDSWFDSYRGVIILMRIIDGRMKLGQKIKLMANGQVFEVEGLGYQAPKATACSELQAGEVGFLYANIKTVGDAKIGDTITEVENPATEPLPGFEEIKPMVFAGLYPVESHEHGLLRDALEKLRLNDSAFNFEPENSAALGFGFRCGFLGLLHLEIVQERLEREFNIDLITTAPGVRYRITDTSGNLVEVDNPTKFPDPSYIETIEEPIIDASVITREDFLGGILALLEEKRGTQKKFEHIGAGRVMLTYELPLNEIVLDFYDRLKSASKGYASLDYHLSGYRESPMVKLDVLVAGEPVDALSIIVHKDFAFERGKALISRLRKLIPKQMFEVALQAAIGNKIVARETISAMRKNVIAKCYGGDISRKRKLLEKQKEGKKRMKRVGRVEIPQEAFLSVL 595
>gi|167362771|ref|ZP_02297274.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii WSM1325] >gi|167070378|gb|EDR74351.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii WSM1325] (610 aa)
Score = 1765, Expect = 0.0e+00, Identities = 330/593 (55%), Positives = 446/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNK-PLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  REM  Q+LD+MDIERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN EIV V+NKIDLP+A+ DR+K+Q+E+ IG+D S A L+SAKTGL I  ++EAI+ ++P P      K PL+AL+ DS+YDAY G + LVR+ +G +  G  +R M  +  + V  +GV TPK+VN + L  GE+G+I ASIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ LIATAPSV+YK+ + DGT  E+ + A +PD     EI EP+ +A I+ PDD+LG++++LCQ+ RG  ++L  V  TR  +TY +PL E+++ F+D+LKS SKGYA+ DY + D+R+ +LVK+ IL+NG  VDALS ++HR  A  R R +C KLKE IPKH F+IPIQA IGG +IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKKR++  G V +P + F+  L
  S:    14 HIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQTVRLHYQ-ANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVHRLPAPKSPGGEKAPLKALLVDSWYDAYLGVMVLVRVIDGVLTKGQTVRMMGTDAKYQVERVGVLTPKMVNIDRLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKMFMTDGTERELHNPADMPDVVKISEIHEPWIRATILTPDDYLGSILKLCQDRRGIQIELTYV-GTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHREGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAAL 605
>gi|75674541|ref|YP_316962.1| GTP-binding protein LepA [Nitrobacter winogradskyi Nb-255] >gi|90185163|sp|Q3SVT1|LEPA_NITWN GTP-binding protein lepA >gi|74419411|gb|ABA03610.1| GTP-binding protein LepA [Nitrobacter winogradskyi Nb-255] (603 aa)
Score = 1765, Expect = 0.0e+00, Identities = 331/592 (55%), Positives = 448/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+NN EIVPV+NK+DLP+A+ D+VK+Q+ED IG+D S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V L+R+ +G ++ G++IR +  +  + V  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++++ERL REF++ LIATAPSVIY++ L DG  +EI +   +PD     EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R    Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+NG  VDALS ++HR  A  R R +  K+KE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGD++RK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGITIKAQTVRLKYR-AKDGKDYVFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDNNHEIVPVLNKVDLPAAEPDKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAIVTRLPPP-KGDRDATLKALLVDSWYDVYLGVVVLIRVIDGALRKGSRIRMIGTSAAYDVERVGFFTPKMQQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIVQERLSREFDLNLIATAPSVIYRMRLTDGVEIEIHNPIDMPDVVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGVQKELTYVGA-RAMAKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNGEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDVSRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 599
>gi|154502622|ref|ZP_02039682.1| hypothetical protein RUMGNA_00435 [Ruminococcus gnavus ATCC 29149] >gi|153796814|gb|EDN79234.1| hypothetical protein RUMGNA_00435 [Ruminococcus gnavus ATCC 29149] (606 aa)
Score = 1765, Expect = 0.0e+00, Identities = 342/597 (57%), Positives = 456/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALG-VNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +D+  IRNF I+AHIDHGKSTL+DRIIE T  LT+REM++Q+LD+M++ERERGITIK   V+ +Y    D ++Y F+LIDTPGHVDF YEVSRSLAAC+GA+LVVDA+QGVEAQTL+NVYLAL+++L++ PVINKIDLPSA+ DRVK+++ED IG++  +APL+SAKTGLNI +++E I+++IP P + D  +PL+AL+FDS YDAYKG +   RIK G VK GT IR M+      V  +G     + +  + L AG VG+I AS+KN+K   VGDTITD A P    LPGYKK+ PMVYCGLYP D  +Y   ++ALEK+ L+D++L +E ETS ALGFG RCGFLGLLH+++++ERL+RE+N+ L+ TAPSVIYK+   +G ++++ +   +PD    + ++EP  KAEI+V  +F+G +M+LCQ  RG Y  +  ++  R  + Y +PL EI+Y FFD LKS S+GYA+ DYE+L Y + +LVK+DIL+N  +VDALS I+H   A +R RK+C KLKE IP+  FEIPIQA +G KIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ +GNV +P   F+ +L
  S:     6 IDQNKIRNFCIIAHIDHGKSTLADRIIEKTGLLTSREMQSQVLDNMELERERGITIKAQTVRTVY-KANDGEEYIFNLIDTPGHVDFNYEVSRSLAACDGAILVVDAAQGVEAQTLANVYLALDHDLDVFPVINKIDLPSAEPDRVKEEIEDVIGIEADDAPLISAKTGLNIEEVLEQIVKKIPAP-EGDPKEPLKALIFDSVYDAYKGVIVFCRIKEGSVKKGTTIRMMATGAQADVVEVGYFGAGQFIPCDELSAGMVGYITASLKNVKDTRVGDTITDAARPCAEPLPGYKKVNPMVYCGLYPADGAKYPDLRDALEKLQLNDAALQFEAETSVALGFGFRCGFLGLLHLEIVQERLEREYNLDLVTTAPSVIYKIHKTNGEVIDLTNPTNMPDPAEIEYMEEPMVKAEIMVTSEFIGAIMDLCQERRGGYQGMEYIEEKRAVIHYHLPLNEIIYDFFDALKSRSRGYASFDYEMLGYEQSELVKLDILINKEEVDALSFIVHSATAYERGRKMCEKLKEEIPRQLFEIPIQAAVGSKIIARETVRAMRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQVGNVEIPQKAFMSVL 601
>gi|191160917|ref|ZP_03022800.1| GTP-binding protein LepA [Geobacter sp. M21] >gi|190997648|gb|EDV73093.1| GTP-binding protein LepA [Geobacter sp. M21] (599 aa)
Score = 1765, Expect = 0.0e+00, Identities = 340/597 (56%), Positives = 452/597 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           ++IRNFSI+AHIDHGKSTL+DR++EFT T+++RE ++Q LD MD+ERERGITIK   V+L Y    D +DY  +LIDTPGHVDFTYEVSRSL ACEG LLVVDASQGVEAQTL+NVYLAL+ NLE+  V+NKIDLP+A+ +RVK ++E+ IGLD  +A L SAK G+    I+E I+++IPPP   D  KPL+AL+FDS+YD Y+G + LVRI +G VK G KI+ MSN +T  V   GV +P++   + L AGEVG+I A I+ +    VGDT+T   NP   +L GYK++ PMV+ GLYPID++QYE  ++AL K+ L+DSS +Y+ ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ LI TAP+V+Y+V   DG++  I SA +LP       ++EPF  A I VP+DF+G ++ LC+  RG   ++  +  TR  V Y +PL E++  F+D+LKS +KGYA+LDYE+LDYR+ +LV+++I++NG  VDALS I+H++ A  R R++  K+KE IP+  FEI IQA +G K+IARETV AMRK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL  E
  S:     4 EHIRNFSIIAHIDHGKSTLADRLLEFTGTVSSREKQDQFLDKMDLERERGITIKAQTVRLNYR-ADDGKDYVLNLIDTPGHVDFTYEVSRSLTACEGGLLVVDASQGVEAQTLANVYLALDANLEVFVVLNKIDLPAAEPERVKAEIEEIIGLDTHDAVLASAKEGIGTKDILEEIVKKIPPP-QGDPAKPLKALLFDSWYDQYQGVIILVRIVDGVVKKGDKIQLMSNKKTHEVLKAGVFSPEMRETQQLCAGEVGFIIAGIREVADAKVGDTVTLLHNPCDAALAGYKEVKPMVFSGLYPIDTSQYEQLRDALAKLKLNDSSFSYDPETSLALGFGFRCGFLGLLHMEIIQERLEREFNLELITTAPTVVYRVHGTDGSLTTIQSANQLPPTQEIAYVEEPFILASIHVPNDFVGGILALCEEKRGVQREIKYLTPTRVMVVYELPLNEVVLDFYDRLKSITKGYASLDYELLDYRQSELVRLNIMINGEVVDALSLIIHKDKAYYRGRELVSKMKELIPRQMFEIAIQAAVGTKVIARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598
>gi|157273483|gb|ABV27382.1| GTP-binding protein LepA [Candidatus Chloracidobacterium thermophilum] (731 aa)
Score = 1763, Expect = 0.0e+00, Identities = 337/597 (56%), Positives = 446/597 (74%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD ++IRNFSI+AHIDHGKSTL+DR++E T  LT REM  Q+LD+MD+ERERGITIK +AV+L Y   ++ +DY  +LIDTPGHVDF+YEVSRSLAACEGAL+VVDA+QGVEAQTL+N YLALENNLE+ PVINKIDLPSA+ +RV  Q+E  IGLD  +A L SAKTG+ I++++E I+E+IPPP   D N+PL+AL+FDS++D+YKG V LVRI +G ++ G KIRFM+    + V  +GV TPK+     L AGEVG+  ++IK +  + +GDT+T+   PA   LPG++++ PMV+ GLYP++S QYE  ++AL+K+ L+DSS  YE E S ALGFG RCGFLGLLHM++++ERL+REF + LI TAPSV ++V L +G  + +DS +KLP+      I+EP  +A I+  DD+LG ++ L    RG       +   R  +TY +PL E++  FFD+LKS S+GYA+LDY +  Y   DLVK+DIL+ G  VDALS I+HR  A  R R +  K+KE IP+  FE+PIQA IG ++IARET+ AM KNVLAKCYGGDITRKKKLLE+QKEGKKR+K +G V +P + F+ +L
  S:   131 MDLQHIRNFSIIAHIDHGKSTLADRLLERTGALTQREMAEQVLDAMDLERERGITIKAHAVRLTYR-ARNGEDYILNLIDTPGHVDFSYEVSRSLAACEGALVVVDATQGVEAQTLANAYLALENNLEMFPVINKIDLPSAEPERVLAQIEQVIGLDPRHAVLASAKTGVGIDELLERIVERIPPP-QGDPNQPLRALIFDSWFDSYKGVVVLVRIVDGILRPGMKIRFMATGREYEVEGIGVMTPKMREIGELSAGEVGFFFSNIKTVSDVRIGDTVTEAMRPAAEPLPGFQEVKPMVFAGLYPVESNQYEALRDALDKLRLNDSSFLYEPEHSAALGFGFRCGFLGLLHMEIVQERLEREFGLDLITTAPSVRFEVYLTNGEKITVDSPSKLPEPVKIDHIEEPIIRATIMTQDDYLGPILALLDEKRGVQRGFDYIGEKRVMLTYDLPLLEVVLDFFDRLKSVSRGYASLDYHLKGYEPADLVKLDILVAGEPVDALSLIVHRSNAYARGRALVEKMKELIPRQLFEVPIQAAIGNRVIARETIKAMGKNVLAKCYGGDITRKKKLLEKQKEGKKRMKKVGRVDIPQEAFLAVL 725
>gi|115380333|ref|ZP_01467338.1| GTP-binding protein LepA [Stigmatella aurantiaca DW4/3-1] >gi|115362663|gb|EAU61893.1| GTP-binding protein LepA [Stigmatella aurantiaca DW4/3-1] (626 aa)
Score = 1762, Expect = 0.0e+00, Identities = 332/599 (55%), Positives = 450/599 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDST--RKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           D  +IRNF I+AHIDHGKSTL+DR++E T TLT RE + Q LD+MDIERERGITIK  +V++ Y   KD Q Y  +LIDTPGHVDF YEVSRSLAACEG LLVVDASQGVEAQTL+NVY+AL+++LEI+PVINKIDLPSAD+ R ++++ED IG+D S A   SAK G+ I +I+E+++++IP P   + + PL+AL+FDS+YD Y+G V LVR+  G +K+  KI+  SNN+ F V  LGV +P       L+AGEVG + A+IK ++   VGDT+T++A       PG+K++ PMV+ G++P+DS  YE  ++AL K+ L+DS+ TYE E+S ALGFG RCG+LGLLHM++++ERL+RE+N+ LI TAPSV+Y++  + G +L ID+ AKLP     ++ +EP     I VP++ LG +++LCQ  RG   D+  + S+  R +VTY +PLAE+++ FFDKLKS S+GYA+LDYE+  Y   +L ++DIL+NG  VDALS I+HR+ A  R R++C KLKE IPK  +E+   A IG K+IARET+SAMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G V +P + F+ +L  E
  S:    27 DNAHIRNFCIIAHIDHGKSTLADRLLEKTGTLTKREAQAQFLDNMDIERERGITIKAQSVRMTY-KAKDGQQYVLNLIDTPGHVDFAYEVSRSLAACEGCLLVVDASQGVEAQTLANVYMALDHSLEIIPVINKIDLPSADVARTREEIEDVIGIDASVAVPASAKEGIGIEEILESVVQRIPSP-KGEPSAPLKALIFDSWYDNYRGVVTLVRVLEGTLKLKQKIKLWSNNKVFEVQELGVFSPFSRPVPQLMAGEVGVLVANIKELQDAKVGDTVTEEARATDAPFPGFKEVKPMVFSGIFPVDSADYEGLRDALAKLKLNDSAFTYEPESSTALGFGFRCGYLGLLHMEIVQERLEREYNLNLITTAPSVVYRITTSKGEVLLIDNPAKLPPVQNIEKFEEPILTCHIHVPNEHLGAILKLCQERRGVQKDMKYLGSSGQRVQVTYAMPLAEVVFDFFDKLKSVSRGYASLDYELAGYMDAELARLDILINGEPVDALSVIVHRDRAYLRGREVCQKLKEVIPKQMYEVAXXAAIGAKVIARETISAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGTVEIPQEAFLAVLKTE 625
>gi|150398655|ref|YP_001329122.1| GTP-binding protein LepA [Sinorhizobium medicae WSM419] >gi|150030170|gb|ABR62287.1| GTP-binding protein LepA [Sinorhizobium medicae WSM419] (611 aa)
Score = 1762, Expect = 0.0e+00, Identities = 329/593 (55%), Positives = 447/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPL-DSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  REM  Q+LDSMDIERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN E+V V+NKIDLP+A+ DR+K+Q+E+ IG+D S A L+SAKTGL I  ++EAI+ ++P P  +  D  PL+AL+ DS+YD Y G + LVRI +G +K G  IR M  +  + V  +GV TPK+V  + L  GE+G+I ASIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ LIATAPSV+YK+ + DG+  E+ + A +PD     EI EP+ +A I+ PD++LG +++LCQ+ RG  ++L  V  TR  +TY +PL E+++ F+D+LKS SKGYA+ DY+I ++++ +LVK+ IL+NG  VDALS ++HR  A  R R++C KLKE IPKH F+IPIQA IGG +IARET+SA+RK+V AKCYGGD TRK+KLLE+QK GKKR++  G V +P + F+  L
  S:    15 HIRNFSIVAHIDHGKSTLADRLIQSTGGLAEREMSEQVLDSMDIERERGITIKAQTVRLHY-KANNGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVHKLPAPKSEGGDTAPLKALLVDSWYDTYLGVMVLVRIIDGTLKKGMTIRMMGTDAKYQVERVGVLTPKMVAMDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAKALPGFKPAQPVVFCGLFPVDAADFEDLRSAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKLFMTDGSERELHNPADMPDVVKIAEIHEPWIRATILTPDEYLGGILKLCQDRRGIQIELTYV-GTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYQITEHKEGNLVKMSILVNGEPVDALSMMVHRMAAEKRGREMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRKLLEKQKAGKKRMRQFGKVEIPQEAFIAAL 606
>gi|161507675|ref|YP_001577629.1| GTP-binding protein LepA [Lactobacillus helveticus DPC 4571] >gi|172048296|sp|A8YVQ1|LEPA_LACH4 GTP-binding protein lepA >gi|160348664|gb|ABX27338.1| GTP-binding protein [Lactobacillus helveticus DPC 4571] (612 aa)
Score = 1762, Expect = 0.0e+00, Identities = 335/595 (56%), Positives = 456/595 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNF+IVAHIDHGKST++DRI+E T+T++ R++KNQ+LD M +ER+RGITIK+N+V++ YH  +D +DY FHLIDTPGHVDF+YEVSRSLAACEGAL+VVDASQGV+AQTL+N Y+A++++LEI+PVINKIDLPSADI + K+++E+ +GLD S A  VS KTG  I  ++E +++ IP P   D   PL+AL+FDS YD Y+G V  V+I++G VK G +I+ M+  + + V+ +GV++P  V K++L+AG+VG+I A+IK+++   VGDTITD  NP    L GY++I PMVY G+YP+D+  Y+  KEAL+K+ L+D++L +E ETS ALGFG RCGFLGLLHMDV++ERL++EF++ LI TAPSV Y  ++NDG+   ID+ + LPD   Y+E+QEP+ KAEI+V +DF+G VMELCQ  RGE++ +  +D  R  V Y +PLAEI++ FFD LKS +KGYA+LDYEI  YR  DLVK+DILLN   +DALS I HR  A DR+R++   LK+ IP+  FE+ IQ  IG KII+R T+   RK+V  K + GD  R+ KLLE+QK GKKR+KA+G V VP D F+ +L
  S:    10 QKHIRNFAIVAHIDHGKSTIADRILELTDTVSQRQLKNQMLDDMPLERQRGITIKMNSVEVKYH-ARDGEDYIFHLIDTPGHVDFSYEVSRSLAACEGALMVVDASQGVQAQTLANTYVAIDDDLEILPVINKIDLPSADIPKTKEEIEEMLGLDASEAAEVSGKTGQGIEDMLEKVVKDIPAP-SGDITAPLKALIFDSKYDDYRGVVMSVKIEDGVVKPGDRIKIMNTGKEYEVTEVGVSSPHPVKKDLLIAGDVGYITANIKSVRETRVGDTITDATNPTEEPLEGYRQIPPMVYSGMYPVDNRDYDDLKEALQKLQLNDAALEFEPETSTALGFGFRCGFLGLLHMDVVQERLEQEFDLGLIMTAPSVDYHAIMNDGSTKVIDNPSDLPDAGEYQEVQEPYVKAEIMVLNDFVGPVMELCQRKRGEFVTMDYLDKYRVNVIYNMPLAEIIFDFFDDLKSSTKGYASLDYEITGYRSTDLVKIDILLNKEPIDALSFIAHRSEAQDRARQMTSMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRRAKLLEKQKRGKKRMKAVGRVEVPQDAFMAVL 602
>gi|16125286|ref|NP_419850.1| GTP-binding protein LepA [Caulobacter crescentus CB15] >gi|13422328|gb|AAK23018.1| GTP-binding protein LepA [Caulobacter crescentus CB15] (648 aa)
Score = 1761, Expect = 0.0e+00, Identities = 343/597 (57%), Positives = 448/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +DK  IRNFSIVAHIDHGKSTLSDR+I+ T  LT REM  Q+LD+MDIE+ERGITIK   V+L Y    D + Y  +L+DTPGHVDF YEVSRSLAACEG++LVVDASQGVEAQTL+NVY A++NN EIVPV+NK+DLP+AD+DRVK Q+ED IGLD S+A   SAKTG+ I +++EAI+ ++PPP   D N PL+AL+ D++YDAY G V LVRI +G +K G ++R M    T  +  +GV TPK  + E L  GEVG+  ASIK +   +VGDTITD+  P   +L G+K+++P+V+CGL+P+D+  +E  + A+ K+ L+D+S TYE E+S ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+YK+ L +G  +E+ + A LPD    +EI EP+ KA I  PDD+LG V++LCQ+ RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY++ DYR  DLVK+ IL+N   VDALS ++HR  A  R R +C K+KE IP+H F IPIQA IGG+IIARETV A+RK+V AKCYGGD +RKKKLLE+QKEGKKR++  G V +P + F+  L
  S:    52 LDK--IRNFSIVAHIDHGKSTLSDRLIQTTGGLTAREMSAQVLDNMDIEKERGITIKAQTVRLTY-KAADGETYILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQAIDNNHEIVPVLNKVDLPAADVDRVKAQIEDVIGLDASDAVECSAKTGVGIPEVLEAIVTRLPPP-KGDPNAPLKALLVDAWYDAYLGVVVLVRIFDGSLKAGQQVRMMQTGATHRIDKVGVFTPKATDVEYLGPGEVGFFTASIKEVADAAVGDTITDEKKPTAEALKGFKEVVPVVFCGLFPVDAADFEDLRAAVGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYKIKLRNGDEIELHNPADLPDVMQIEEIAEPWIKATIFTPDDYLGGVIKLCQDRRGMQRELSYVGS-RAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQLEDYRAGDLVKMSILVNSEPVDALSMLVHRSRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRIIARETVRALRKDVTAKCYGGDASRKKKLLEKQKEGKKRMRQFGKVEIPQEAFIAAL 643
>gi|169196323|ref|ZP_02855677.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii WSM2304] >gi|169091066|gb|EDS69776.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii WSM2304] (610 aa)
Score = 1760, Expect = 0.0e+00, Identities = 329/593 (55%), Positives = 444/593 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLD-SDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  REM  Q+LD+MDIERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN E+V V+NKIDLP+A+ DR+K+Q+E+ IG+D S A L+SAKTGL I  ++EAI+ ++P P     D  PL+AL+ DS+YD Y G + LVRI +G +  G  IR M  +  + V  +GV TPK+VN + L  GE+G+I ASIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ LIATAPSV+YK+ + DG+  E+ + A +PD     EI EP+ +A I+ PDD+LG +++LCQ+ RG  ++L  V  TR  +TY +PL E+++ F+D+LKS SKGYA+ DY + D+R+ +LVK+ IL+NG  VDALS ++HR  A  R R +C KLKE IPKH F+IPIQA IGG +IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKKR++  G V +P + F+  L
  S:    14 HIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQTVRLHYQ-ANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVNRLPAPKSPGGDKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVERVGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKMFMTDGSERELHNPADMPDVVKISEIHEPWIRATILTPDDYLGGILKLCQDRRGIQIELTYV-GTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHREGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAAL 605
>gi|114328171|ref|YP_745328.1| GTP-binding protein LepA [Granulibacter bethesdensis CGDNIH1] >gi|114316345|gb|ABI62405.1| GTP-binding protein lepA [Granulibacter bethesdensis CGDNIH1] (638 aa)
Score = 1758, Expect = 0.0e+00, Identities = 328/592 (55%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+ T  L+ REM NQ+LD+M++ERERGITIK   V+L Y   KD   Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++ N EIVPV+NK+DLP+A+ DRVKKQ+ED IGLD S+A ++SAKTGL ++ ++EA++ ++P P   + N  L+AL+ DS+YDAY G + LVR+K+G ++ G KIR MS   T+ V  +GV +P++   E L  GE+G+I A+IK +   +VGDTITDD  PA   L G+K  +P+V+CGLYPID+  +E  +++L K+ L+D+S  +E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+YK+   +G  LE+ + A +PD ++ ++I+EP+ KA I+VPDD+LG ++ LC   RG+ +DL  V   R    Y +PL E+++ F+D+LKS S+GYA+ DY++  Y + DLV++ IL+N   VDALS I HR  A +R R+IC KLKE IP+  F+I IQA IG +IIARET+ A+ K+V AKCYGGDI+RK+KLLE+QKEGKKR++  G V +P   F+  L
  S:    46 IRNFSIIAHIDHGKSTLADRLIQLTGALSDREMTNQVLDNMELERERGITIKAQTVRLTYR-AKDGLVYALNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDANHEIVPVLNKVDLPAAEPDRVKKQIEDVIGLDASDALMISAKTGLGVDTVLEALVTRLPAP-KGNANGELKALLVDSWYDAYLGVIILVRVKDGVLRRGQKIRMMSTGATYTVDQVGVFSPRMTPVETLNPGEMGYINAAIKTVADTNVGDTITDDRVPAAEPLAGFKPSIPVVWCGLYPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYKLHKTNGEHLELHNPADMPDGSVIEKIEEPWIKATIMVPDDYLGAILTLCSERRGQQVDLTYV-GNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDGYEESDLVRISILVNAEAVDALSFIAHRSAAENRGRQICAKLKELIPRQLFKIAIQAAIGSRIIARETLGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAAL 634
>gi|190889913|ref|YP_001976455.1| GTP-binding elongation factor protein [Rhizobium etli CIAT 652] >gi|190695192|gb|ACE89277.1| GTP-binding elongation factor protein [Rhizobium etli CIAT 652] (610 aa)
Score = 1758, Expect = 0.0e+00, Identities = 330/593 (55%), Positives = 444/593 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNK-PLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  REM  Q+LD+MDIERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN E+V V+NKIDLP+A+ DR+K+Q+E+ IG+D S A L+SAKTGL I  ++EAI+ ++P P      K PL+AL+ DS+YD Y G + LVRI +G +  G  IR M  +  + V  +GV TPK+VN + L  GE+G+I ASIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ LIATAPSV+YK+ + DGT  E+ + A +PD     EI EP+ +A I+ PDD+LG +++LCQ+ RG  ++L  V  TR  +TY +PL E+++ F+D+LKS SKGYA+ DY + D+R+ +LVK+ IL+NG  VDALS ++HR  A  R R +C KLKE IPKH F+IPIQA IGG +IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKKR++  G V +P + F+  L
  S:    14 HIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQTVRLHYQ-ANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVRKLPAPKSPGGEKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVERVGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYKMYMTDGTERELHNPADMPDVVKISEIHEPWIRATILTPDDYLGGILKLCQDRRGIQIELTYV-GTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHREGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAAL 605
>gi|154250679|ref|YP_001411503.1| GTP-binding protein LepA [Parvibaculum lavamentivorans DS-1] >gi|154154629|gb|ABS61846.1| GTP-binding protein LepA [Parvibaculum lavamentivorans DS-1] (612 aa)
Score = 1757, Expect = 0.0e+00, Identities = 325/596 (54%), Positives = 444/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSI+AHIDHGKSTL+DR+I+    L+ REMK Q+LDSMDIERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEV+RSLAACEG+LLVVDASQGVEAQTL+NVY AL+ N EIVPV+NKIDLP+A+  + ++Q+ED IGLD S A  +SAK+G+ I  ++EAI+ ++PPP   D + PL+A++ DS+YDAY G V LVRI +G++K G +I+ M    T+ +  +G+  PK      L  GE+G+  ASIK +    VGDT+T++  P   +LPG+K   P+V+CGL+P+D+ ++E  ++A+ ++ L+D+S  +E ETS ALGFG RCGFLGLLH++++RERL+REFNI LI TAPSVIY++ +NDG+I+E+ + A +PD      I+EP+ +A I+VPD++LG V++LC++ RG  +DL    S R  + Y +PL E++  F+D+LKS S+GYA+ DY I  Y   DLVK+ IL+N   VDALST++HR  A  R R +C KLKE IPKH F+IPIQA IGG+I+ARET+SAMRK+V AKCYGGD++RK+KLL++QKEGKK+++  G V +P D F+  L
  S:    15 DLSHIRNFSIIAHIDHGKSTLADRLIQLCGGLSVREMKEQVLDSMDIERERGITIKAQTVRLDY-KAANGEMYELNLIDTPGHVDFAYEVNRSLAACEGSLLVVDASQGVEAQTLANVYHALDVNHEIVPVLNKIDLPAAEPAKTRQQIEDVIGLDASEAVEISAKSGIGIPDVLEAIVNRLPPP-KGDLSAPLKAMLVDSWYDAYLGVVVLVRIIDGELKKGQRIKMMGTGGTYTIDNVGIFRPKKETVASLTPGEIGFFTASIKEVADTRVGDTVTEEKRPCAQALPGFKPAQPVVFCGLFPVDAAEFEDLRDAMGRLRLNDASFEFEMETSAALGFGFRCGFLGLLHLEIVRERLEREFNIDLITTAPSVIYQLHMNDGSIIEMHNPADMPDTMKIDHIEEPWIRATILVPDEYLGAVLKLCEDRRGHQVDLTYAGS-RAMLVYRLPLNEVVLDFYDRLKSVSRGYASFDYHIEGYETGDLVKMTILVNEELVDALSTVVHRSRAEQRGRVMCEKLKELIPKHLFKIPIQAAIGGRIVARETISAMRKDVTAKCYGGDVSRKRKLLDKQKEGKKKMRQFGRVEIPQDAFISAL 607
>gi|148260281|ref|YP_001234408.1| GTP-binding protein LepA [Acidiphilium cryptum JF-5] >gi|166223160|sp|A5FY07|LEPA_ACICJ GTP-binding protein lepA >gi|146401962|gb|ABQ30489.1| GTP-binding protein LepA [Acidiphilium cryptum JF-5] (601 aa)
Score = 1755, Expect = 0.0e+00, Identities = 323/592 (54%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+ T  L+ REM  Q+LD+MDIE+ERGITIK   V+L Y   KD + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++ N EIVPV+NKIDLP+A+ +RVK+Q+ED IGLD S+A  +SAKTGLNI  ++EA++ ++PPP   D+  PL+A++ DS+YD+Y G + LVR+++G+++ G ++R MS      +  +G  +PK+  +  L  GE+G+I A+IK +   +VGDTITDD  PAT  LPG+K  +P+V+CGLYP+D+  +E  +++L K+ L+D+S  YE ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+Y++    G ++E+ + A +PD ++   I+EP+ +A I+VPDD+LG V+ LC   RG+ +DL  V   R    Y +PL E+++ F+D+LKS S+GYA+ DY++ DY + DLVK+ IL+N   VDAL+ I HR  A  R R IC KLK+ IP+  F+I IQA IGG++IARET+ A+ K+V AKCYGGDI+RK+KLLE+QKEGKKR++  G V +P   F+  L
  S:     9 IRNFSIIAHIDHGKSTLADRLIQTTGALSAREMTEQVLDNMDIEKERGITIKAQTVRLNY-KAKDGKTYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDANHEIVPVLNKIDLPAAEPERVKQQIEDVIGLDASDAVEISAKTGLNIEAVLEALVTRLPPP-KGDETAPLKAMLVDSWYDSYLGVIILVRVRDGRLRKGQRVRMMSTGAVHTIDQVGTFSPKLTPQADLGPGEIGYITAAIKTVADCNVGDTITDDRAPATEPLPGFKPSIPVVWCGLYPVDADDFEKLRDSLAKLRLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYRLYKTSGEMMELHNPADMPDGSVIDHIEEPWIRATIMVPDDYLGAVLTLCNERRGQQVDLTYV-GNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDDYVEGDLVKISILVNQEPVDALAFIAHRSVADTRGRAICAKLKDLIPRQLFKIAIQAAIGGRVIARETLGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQTAFLAAL 597
>gi|182704815|ref|ZP_02957215.1| GTP-binding protein LepA [Methylocella silvestris BL2] >gi|172066139|gb|EDT52273.1| GTP-binding protein LepA [Methylocella silvestris BL2] (601 aa)
Score = 1754, Expect = 0.0e+00, Identities = 331/594 (55%), Positives = 443/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K IRNFSIVAHIDHGKSTL+DR+I+ T  +  R+M  Q+LDSMDIERERGITIK   V+L Y    D + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NKIDLP+A+ +R+K+Q+ED IGLD S+A ++SAKTG+ I+ ++EAI+ ++PPP   D+  PL+AL+ DS+YDAY G V LVR+ +G ++ G KI+ M+ +  + V  +GV  PK+ + E L  GE+G+I A IK +    VGDTITD+  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ ++ L+D+S +YE E+S ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSVIYK++  DG  +E+ + A +PD T  + I+EP+ +A I+ PDD+LG V++LCQ  RG  +DL N    R    Y +PL E+++ F+D+LKS SKGYA+ DY I DYR  DLVK+ IL+N   VDALS ++HR+ A  R R +  KLKE IP H F+IPIQA IGGKIIARETV A+RK+V AKCYGGD +RK+KLL++QK GKK+++  G V +P + F+  L
  S:     7 KNIRNFSIVAHIDHGKSTLADRLIQQTGAVAARDMVEQVLDSMDIERERGITIKAQTVRLEY-KAADGEAYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKIDLPAAEPERIKQQIEDVIGLDASHAVMISAKTGVGIDLVLEAIVTRLPPP-QGDETAPLKALLVDSWYDAYLGVVVLVRVIDGVLRKGQKIKMMAADAHYEVDRIGVFRPKMQDAEQLSPGEIGFITAQIKQVADTRVGDTITDERRPCAQALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGRLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVIYKIVQRDGDTIELHNPADMPDPTKIETIEEPWIRATILTPDDYLGAVLKLCQERRGVQVDL-NYVGKRAMAVYDLPLNEVVFDFYDRLKSISKGYASFDYAITDYRPGDLVKMSILVNAEPVDALSMLVHRDRADTRGRVMVEKLKELIPPHMFQIPIQAAIGGKIIARETVRALRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQEAFIAAL 597
>gi|86355906|ref|YP_467798.1| GTP-binding protein LepA [Rhizobium etli CFN 42] >gi|119371381|sp|Q2KDL5|LEPA_RHIEC GTP-binding protein lepA >gi|86280008|gb|ABC89071.1| GTP-binding elongation factor protein [Rhizobium etli CFN 42] (610 aa)
Score = 1754, Expect = 0.0e+00, Identities = 329/593 (55%), Positives = 444/593 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNK-PLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T  L  REM  Q+LD+M+IERERGITIK   V+L Y    + + Y  +LIDTPGHVDF YEVSRSL+ACEG+LLVVDASQGVEAQTL+NVY A++NN E+V V+NKIDLP+A+ DR+K+Q+E+ IG+D S A L+SAKTGL I  ++EAI+ ++P P  +   K PL+AL+ DS+YD Y G + LVRI +G +  G  IR M  +  + V  +GV TPK+VN + L  GE+G+I ASIK +    VGDTIT+D  P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ LIATAPSV+Y++ + DG+  E+ + A +PD     EI+EP+ KA I+ PDD+LG +++LCQ+ RG   +L  V  TR  VTY +PL E+++ F+D+LKS SKGYA+ DY +  YR  +LVK+ IL+NG  VDALS ++HR  A  R R +C +LKE IPKH F+IPIQA IGG +IARET+SA+RK+V AKCYGGD TRK+KLL++QKEGKKR++  G V +P + F+  L
  S:    14 HIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMEIERERGITIKAQTVRLHYQ-ANNGEKYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQAIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVHKLPAPKSAGGEKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVERVGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAEALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLEREFDLDLIATAPSVVYQLTMTDGSERELHNPADMPDVVKIAEIREPWIKATIMTPDDYLGGILKLCQDRRGIQTELTYV-GTRAMVTYELPLNEVVFDFYDRLKSISKGYASFDYHLEGYRAGNLVKMSILVNGEPVDALSMLVHRTAAEKRGRDMCERLKELIPKHMFKIPIQAAIGGNVIARETISALRKDVTAKCYGGDATRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAAL 605
>gi|112148547|gb|ABI13555.1| leader peptidase GTP-binding protein [Lactobacillus helveticus CNRZ32] (612 aa)
Score = 1754, Expect = 0.0e+00, Identities = 334/595 (56%), Positives = 455/595 (76%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +K+IRNF+IVAHIDHGKST++DRI+E T+T++ R++KNQ+LD M +ER+RGITIK+N+V++ YH  +D +DY FHLIDTPGHVDF+YEVSRSLAACEGAL+VVDASQGV+AQTL+N Y+A++++LEI+PVINKIDLPSADI + K+++E+ +GLD S A  VS KTG  I  ++E +++ IP P   D   PL+AL+FDS YD Y+G V  V+I++G VK G +I+ M+  + + V+ +GV+ P  V K++L+AG+VG+I A+IK+++   VGDTITD  NP    L GY++I PMVY G+YP+D+  Y+  KEAL+K+ L+D++L +E ETS ALGFG RCGFLGLLHMDV++ERL++EF++ LI TAPSV Y  ++NDG+   ID+ + LPD   Y+E+QEP+ KAEI+V +DF+G VMELCQ  RGE++ +  +D  R  V Y +PLAEI++ FFD LKS +KGYA+LDYEI  YR  DLVK+DILLN   +DALS I HR  A +R+R++   LK+ IP+  FE+ IQ  IG KII+R T+   RK+V  K + GD  R+ KLLE+QK GKKR+KA+G V VP D F+ +L
  S:    10 QKHIRNFAIVAHIDHGKSTIADRILELTDTVSQRQLKNQMLDDMPLERQRGITIKMNSVEVKYH-ARDGEDYIFHLIDTPGHVDFSYEVSRSLAACEGALMVVDASQGVQAQTLANTYVAIDDDLEILPVINKIDLPSADIPKTKEEIEEMLGLDASEAAEVSGKTGQGIEDMLEKVVKDIPAP-SGDITAPLKALIFDSKYDDYRGVVMSVKIEDGVVKPGDRIKIMNTGKEYEVTEVGVSNPHPVKKDLLIAGDVGYITANIKSVRETRVGDTITDATNPTEEPLEGYRQIPPMVYSGMYPVDNRDYDDLKEALQKLQLNDAALEFEPETSTALGFGFRCGFLGLLHMDVVQERLEQEFDLGLIMTAPSVDYHAIMNDGSTKVIDNPSDLPDAGEYQEVQEPYVKAEIMVLNDFVGPVMELCQRKRGEFVTMDYLDKYRVNVIYNMPLAEIIFDFFDDLKSSTKGYASLDYEITGYRSTDLVKIDILLNKEPIDALSFIAHRSEAQERARQMTSMLKKLIPRQNFEVDIQGAIGAKIISRATIKPYRKDVTWKIHTGDPDRRAKLLEKQKRGKKRMKAVGRVEVPQDAFMAVL 602
>gi|157827016|ref|YP_001496080.1| GTP-binding protein LepA [Rickettsia bellii OSU 85-389] >gi|166224518|sp|A8GW16|LEPA_RICB8 GTP-binding protein lepA >gi|157802320|gb|ABV79043.1| GTP-binding protein LepA [Rickettsia bellii OSU 85-389] (600 aa)
Score = 1753, Expect = 0.0e+00, Identities = 330/596 (55%), Positives = 448/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++KYIRNFSI+AHIDHGKSTL+DR+IE+   L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+EN+ EIVPV+NKIDLP+++ D+VK+Q+ED IG+D S A L+SAK+G+ I+ ++EAI+ ++PPP +S  +  L+AL+ DS+YD Y G V LVR+ +G ++   K++ M+ N  + +  +G  TPK    +VL AGE+G+  ASIK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS+++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSV+YK+ + +G +LEI + A LPD      ++EP+ KA I+VPD+FLG V+ LC   RG  LD  N  + R KV Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+N   VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDITRK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     3 NQKYIRNFSIIAHIDHGKSTLADRLIEYCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVPVLNKIDLPASEPDQVKQQIEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPPKESSTDI-LKALLVDSWYDPYLGVVILVRVIDGSLRKNMKVKMMATNSVYTIENVGYFTPKKHISDVLHAGEIGFFTASIKQVADCKVGDTITDEKKPCKQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMREGEVLEIHNPADLPDLQKIDSMEEPWIKATIMVPDEFLGAVLSLCTEKRGIQLDH-NYIANRAKVVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDTYEPSELVKLGILVNSEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDITRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 595
>gi|170749497|ref|YP_001755757.1| GTP-binding protein LepA [Methylobacterium radiotolerans JCM 2831] >gi|170656019|gb|ACB25074.1| GTP-binding protein LepA [Methylobacterium radiotolerans JCM 2831] (600 aa)
Score = 1752, Expect = 0.0e+00, Identities = 329/592 (55%), Positives = 447/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+M  Q+LDSMDIE+ERGITIK   V+L Y   +D +DY  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+ N EIVPV+NK+DLP+A+ DRVK+Q+E+ IGLD S+A  +SAKTGLNI  ++EAI+ ++PPP  + D  PL+AL+ DS+YDAY G V LVRI +G +K G  IR M  +  + V  +GV  PK+ + + L  GEVG+   SIK +    VGDTIT+D    T  LPG+K++  +V+CGL+P+D+ ++E  + A+ K+ L+D+S +YE E+S ALGFG RCGFLGLLH+++I+ERL+REFN+ LI+TAPSV+Y++ + DG I E+ + A +PD    + ++EP+ +A I+ PD++LG V++LCQ+ RG  +DL N    R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F+IP+QA IGGKIIARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKK+++  G V +P + F+  L
  S:     8 IRNFSIVAHIDHGKSTLADRLIQATGTVALRDMSEQMLDSMDIEKERGITIKAQTVRLEY-KAQDGKDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASDAVPISAKTGLNIEAVLEAIVTRLPPPKGNRD-APLKALLVDSWYDAYLGVVVLVRIIDGTLKKGMTIRMMGADAVYGVDRIGVFRPKMADIDALGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTEMLPGFKEVQAVVFCGLFPVDAAEFENLRSAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLISTAPSVVYRLKMRDGEIKELHNPADMPDVMKIETVEEPWIRATILTPDEYLGGVLKLCQDRRGVQIDL-NYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREGDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIKALSKDVTAKCYGGDISRKRKLLDKQKEGKKKMRQFGRVEIPQEAFIAAL 596
>gi|86158039|ref|YP_464824.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-C] >gi|119371327|sp|Q2IIA6|LEPA_ANADE GTP-binding protein lepA >gi|85774550|gb|ABC81387.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-C] (601 aa)
Score = 1752, Expect = 0.0e+00, Identities = 332/596 (55%), Positives = 445/596 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +IRNFSI+AHIDHGKSTL+DR++E T T+T RE + Q LD+M++ERERGITIK   V++ Y   +D +DY  +LIDTPGHVDF YEVSRS+AACEGA+LVVDA+QGVEAQTL+NVY AL+++LEIVPVINKIDLPSAD++ V++++E+ IGLD  +A   SAK G+ I +I+E I+ ++PPP + D   PL+A+VFDS+YD+Y+G V LVR+  G V+   KIR  SN + F V  LG+  P       L AGEVG + A++K++    VGDTITD A P     PG+K + PMV+ G++PI++  YE  ++ALEK+ L+DS+ TYE ETSQALGFG RCG+LGLLHM++++ERL+RE+ +ALI TAPSV+Y+V    G + EID+ AKLP      +++EP     I    + +G +++LCQ  RG   DL  + + R ++TY IPLAE+++ FFDKLKS S+GYA+LDYE+  Y + DLVK+DIL+NG  VDALS I+HRE A  R R +C +L+E IPK  +E+ IQA IG K+IARETV A RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P + F+ +L  E
  S:     7 HIRNFSIIAHIDHGKSTLADRLLEHTGTVTKREAQAQFLDNMELERERGITIKAQTVRMKYR-AQDGRDYELNLIDTPGHVDFAYEVSRSMAACEGAILVVDATQGVEAQTLANVYQALDHDLEIVPVINKIDLPSADVEGVRQEIEEVIGLDAKDAVPASAKEGIGIGEILEQIVHRVPPP-EGDPEAPLKAIVFDSWYDSYRGVVMLVRVFEGTVRPKQKIRLWSNRKEFEVQELGIFAPFAKAVGELQAGEVGVVVANVKDVHDAKVGDTITDAARPTEAPFPGFKVVKPMVFSGVFPIEAADYEQLRDALEKLSLNDSAFTYEPETSQALGFGFRCGYLGLLHMEIVQERLEREYQLALITTAPSVVYRVTDTTGAVEEIDNPAKLPPVQKIAKLEEPHLTCHIHARTEDVGAILKLCQERRGLQRDLKYLGTKRVQITYDIPLAEVVFDFFDKLKSVSRGYASLDYELKGYEEADLVKLDILINGEPVDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVIARETVKAFRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQEAFLAVLKVE 600
>gi|24211938|sp|Q9A9F4|LEPA_CAUCR GTP-binding protein lepA (606 aa)
Score = 1751, Expect = 0.0e+00, Identities = 343/597 (57%), Positives = 448/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +DK  IRNFSIVAHIDHGKSTLSDR+I+ T  LT REM  Q+LD+MDIE+ERGITIK   V+L Y    D + Y  +L+DTPGHVDF YEVSRSLAACEG++LVVDASQGVEAQTL+NVY A++NN EIVPV+NK+DLP+AD+DRVK Q+ED IGLD S+A   SAKTG+ I +++EAI+ ++PPP   D N PL+AL+ D++YDAY G V LVRI +G +K G ++R M    T  +  +GV TPK  + E L  GEVG+  ASIK +   +VGDTITD+  P   +L G+K+++P+V+CGL+P+D+  +E  + A+ K+ L+D+S TYE E+S ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+YK+ L +G  +E+ + A LPD    +EI EP+ KA I  PDD+LG V++LCQ+ RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY++ DYR  DLVK+ IL+N   VDALS ++HR  A  R R +C K+KE IP+H F IPIQA IGG+IIARETV A+RK+V AKCYGGD +RKKKLLE+QKEGKKR++  G V +P + F+  L
  S:    10 LDK--IRNFSIVAHIDHGKSTLSDRLIQTTGGLTAREMSAQVLDNMDIEKERGITIKAQTVRLTY-KAADGETYILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQAIDNNHEIVPVLNKVDLPAADVDRVKAQIEDVIGLDASDAVECSAKTGVGIPEVLEAIVTRLPPP-KGDPNAPLKALLVDAWYDAYLGVVVLVRIFDGSLKAGQQVRMMQTGATHRIDKVGVFTPKATDVEYLGPGEVGFFTASIKEVADAAVGDTITDEKKPTAEALKGFKEVVPVVFCGLFPVDAADFEDLRAAVGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYKIKLRNGDEIELHNPADLPDVMQIEEIAEPWIKATIFTPDDYLGGVIKLCQDRRGMQRELSYVGS-RAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQLEDYRAGDLVKMSILVNSEPVDALSMLVHRSRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRIIARETVRALRKDVTAKCYGGDASRKKKLLEKQKEGKKRMRQFGKVEIPQEAFIAAL 601
>gi|169832201|ref|YP_001718183.1| GTP-binding protein LepA [Candidatus Desulforudis audaxviator MP104C] >gi|169639045|gb|ACA60551.1| GTP-binding protein LepA [Candidatus Desulforudis audaxviator MP104C] (602 aa)
Score = 1750, Expect = 0.0e+00, Identities = 326/598 (54%), Positives = 456/598 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           +++  IRNF I+AHIDHGKSTL+DR++E+T  L  R M+ Q+LD MD+ERERGITIKL AV+L Y   +D +DY  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQG+EAQTL+NV LAL++NL I+P+INKIDL SA+ DRV++++ED IGLD ++A L SAK G  + +I+E I+  +PPP        L+AL+FDS+YD Y+G V  +R+ +G++  G  +R M+    F VS LGV TP  V    L AGEVG++AA IKN+K   VGDT+TD   PA++ LPGY+K  PMVYCGL+P+D  ++E  ++AL+++ L+D+SL YE ETS ALGFG RCGFLGLLHM++I+ERL+RE+ + LI TAPSV+Y+V   +G +L+I + +++P     ++++EPF    +++P D++G VMELCQ+ RG + ++  + + R  +TY +PLAEI+Y FFD+LKS ++GYA++DY++L YR+  LV+VDIL+ G ++DALS I+HR+ A  RS+ I  +L++ IP+  FEI IQA IG ++IARE++ A+RK VL KCYGGD+TRK+KLLE+QKEGKKR+K +G+V +P + F+ +LS
  S:     3 VERDRIRNFCIIAHIDHGKSTLADRLLEYTGALVGRRMQEQVLDQMDLERERGITIKLQAVRLAYR-ARDGRDYQLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGIEAQTLANVNLALDHNLTIIPIINKIDLASAEPDRVRRELEDVIGLDGADAVLASAKRGDGVEEILERIVRDVPPPGGDPGAP-LRALIFDSHYDPYRGVVTYLRLMDGRLFPGGPVRMMATGREFEVSELGVFTPAPVTVNELRAGEVGFMAAGIKNVKDCRVGDTVTDARRPASSPLPGYRKAKPMVYCGLFPVDGAEFEKVRDALDRLSLNDASLVYEPETSTALGFGFRCGFLGLLHMEIIQERLEREYGLDLITTAPSVVYRVTRTNGAVLDIRNPSEMPPAGEIEKMEEPFVLTSLLLPQDYIGPVMELCQDRRGVFRNMEYISTHRVLITYEMPLAEIIYDFFDRLKSATRGYASMDYDLLGYRESKLVRVDILVAGERLDALSIIVHRDRAYHRSKIIVERLRDLIPRQLFEIVIQAAIGQRVIARESIRALRKAVLEKCYGGDVTRKRKLLEKQKEGKKRMKQVGHVQIPQEAFMSVLS 598
>gi|119371354|sp|Q0BRZ7|LEPA_GRABC GTP-binding protein lepA (601 aa)
Score = 1750, Expect = 0.0e+00, Identities = 328/592 (55%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+ T  L+ REM NQ+LD+M++ERERGITIK   V+L Y   KD   Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++ N EIVPV+NK+DLP+A+ DRVKKQ+ED IGLD S+A ++SAKTGL ++ ++EA++ ++P P   + N  L+AL+ DS+YDAY G + LVR+K+G ++ G KIR MS   T+ V  +GV +P++   E L  GE+G+I A+IK +   +VGDTITDD  PA   L G+K  +P+V+CGLYPID+  +E  +++L K+ L+D+S  +E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+YK+   +G  LE+ + A +PD ++ ++I+EP+ KA I+VPDD+LG ++ LC   RG+ +DL  V   R    Y +PL E+++ F+D+LKS S+GYA+ DY++  Y + DLV++ IL+N   VDALS I HR  A +R R+IC KLKE IP+  F+I IQA IG +IIARET+ A+ K+V AKCYGGDI+RK+KLLE+QKEGKKR++  G V +P   F+  L
  S:     9 IRNFSIIAHIDHGKSTLADRLIQLTGALSDREMTNQVLDNMELERERGITIKAQTVRLTYR-AKDGLVYALNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDANHEIVPVLNKVDLPAAEPDRVKKQIEDVIGLDASDALMISAKTGLGVDTVLEALVTRLPAP-KGNANGELKALLVDSWYDAYLGVIILVRVKDGVLRRGQKIRMMSTGATYTVDQVGVFSPRMTPVETLNPGEMGYINAAIKTVADTNVGDTITDDRVPAAEPLAGFKPSIPVVWCGLYPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYKLHKTNGEHLELHNPADMPDGSVIEKIEEPWIKATIMVPDDYLGAILTLCSERRGQQVDLTYV-GNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDGYEESDLVRISILVNAEAVDALSFIAHRSAAENRGRQICAKLKELIPRQLFKIAIQAAIGSRIIARETLGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAAL 597
>gi|196172500|gb|ACG73473.1| GTP-binding protein LepA [Anaeromyxobacter sp. K] (601 aa)
Score = 1749, Expect = 0.0e+00, Identities = 333/596 (55%), Positives = 445/596 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +IRNFSI+AHIDHGKSTL+DR++E T T+T RE + Q LD+M++ERERGITIK   V++ Y   KD +DY  +LIDTPGHVDF YEVSRS+AACEGA+LVVDA+QGVEAQTL+NVY AL+++LEIVPVINKIDLPSAD++ V++++E+ IGLD  +A   SAK G+ I +I+E I+ ++P P + D + PL+A+VFDS+YD+Y+G V LVR+  G V+   KIR  SN + F V  LGV  P       L AGEVG + A++K++    VGDTITD A P     PG+K + PMV+ G++PI++  YE  ++ALEK+ L+DS+ TYE ETSQALGFG RCG+LGLLHM++++ERL+RE+ +ALI TAPSV+Y+V    G + EID+ AKLP      +++EP     I    + +G +++LCQ  RG   DL  + + R ++TY IPLAE+++ FFDKLKS S+GYA+LDYE+  Y + DLVK+DIL+NG  VDALS I+HRE A  R R +C +L+E IPK  +E+ IQA IG K+IARETV A RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P + F+ +L  E
  S:     7 HIRNFSIIAHIDHGKSTLADRLLEHTGTVTKREAQAQFLDNMELERERGITIKAQTVRMKYR-AKDGRDYELNLIDTPGHVDFAYEVSRSMAACEGAILVVDATQGVEAQTLANVYQALDHDLEIVPVINKIDLPSADVEGVRQEIEEVIGLDAKDAVPASAKEGIGIGEILEQIVHRVPAP-EGDPDAPLKAIVFDSWYDSYRGVVMLVRVFEGTVRPKQKIRLWSNRKEFEVQELGVFAPFAKAVGELQAGEVGVVVANVKDVHDAKVGDTITDAARPTEEPFPGFKVVKPMVFSGVFPIEAADYEQLRDALEKLSLNDSAFTYEPETSQALGFGFRCGYLGLLHMEIVQERLEREYQLALITTAPSVVYRVTDTSGAVEEIDNPAKLPPVQKIAKLEEPHLTCHIHARTEDVGAILKLCQERRGLQRDLKYLGTKRVQITYDIPLAEVVFDFFDKLKSVSRGYASLDYELKGYEEADLVKLDILINGEPVDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVIARETVKAFRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQEAFLAVLKVE 600
>gi|196479862|gb|ACG79390.1| GTP-binding protein LepA [Phenylobacterium zucineum HLK1] (601 aa)
Score = 1749, Expect = 0.0e+00, Identities = 334/597 (55%), Positives = 443/597 (74%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +DK  IRNFSIVAHIDHGKSTLSDR+I+ T  LT REM  Q+LD+M+IERERGITIK   V+L Y    D + Y  +L+DTPGHVDF YEVSRSLAACEG++LVVDASQGVEAQTL+NVY A++NN EIVPV+NKIDLP+A+ DRV++Q+ED IGLD S+A   SAK+G+ I+ ++EAI+ ++PPP   D + PL+AL+ D++YD Y G V LVR+ +G +KVG K++ M     + +  LGV  PK      L  GEVG+I ASIK +   +VGDTITD   P    LPG++++ P+V+CGL+P+D+  +E  + A+ ++ L+D+S TYE ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSV+Y+V L +G  +E+ + A LPD      I EP+ KA I  PD++LG +++LCQ+ RGE  +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY++  YR  DLVK+ IL+N   VDALS ++HR+ A  R R +  K+KE IP H F+IPIQA IGG+IIARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKKR++  G V +P + F+  L
  S:     5 LDK--IRNFSIVAHIDHGKSTLSDRLIQETGALTAREMSEQVLDNMEIERERGITIKAQTVRLHY-KADDGETYVLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQAIDNNHEIVPVLNKIDLPAAEPDRVRQQIEDVIGLDASDAVECSAKSGVGIHDVLEAIVTRLPPP-KGDRDAPLKALLVDAWYDQYLGVVVLVRVFDGTLKVGQKVKMMQTGAEYQIDRLGVFRPKQTEMPELGPGEVGFITASIKEVAHAAVGDTITDLRKPTDKPLPGFREVQPVVFCGLFPVDAADFEDLRAAIGRLRLNDASFTYEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYRVKLTNGEEIELHNPADLPDPVKIDSIAEPWIKATIFTPDEYLGAIIKLCQDRRGEQRELSYVGA-RAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQVEGYRVGDLVKMSILVNAEPVDALSMLVHRDRAESRGRGMVEKMKELIPPHMFQIPIQAAIGGRIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIAAL 596
>gi|170079016|ref|YP_001735654.1| GTP-binding protein LepA [Synechococcus sp. PCC 7002] >gi|169886685|gb|ACB00399.1| GTP-binding protein LepA [Synechococcus sp. PCC 7002] (602 aa)
Score = 1749, Expect = 0.0e+00, Identities = 326/592 (55%), Positives = 462/592 (78%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+M++ERERGITIKL A ++ Y   KD ++Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLAL+NNLEI+PV+NKIDLP A+ DRV +++E+ +GLDC++    SAK GL IN I+E+I++Q+PPP D+ D +PL+AL+FDSYYD Y+G +   R+ +G+VK G K+R M++ + + +  LGV  P  V  + L AGEVG+ AA+IK+++   VGDTIT   +PA   LPGY +  PMV+CGL+P D+ QY   ++AL+K+ L+D++L++E ETS A+GFG RCGFLGLLH+++++ERL+RE+N+ LI TAPSV+Y+V   DG ++EID+ ++LPD    ++I+EP+ + ++I P++F+G +M+LCQ  RG + D+     +R  + Y +PLAE++  FFD+LKS ++GYA+++Y+++ YR   LV++DIL+N + VD+L+ I+HR+ A +  R +  KLKE IP+HQF+IPIQA IG KIIA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+K+IG V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRMLQDTQTVAQRDMKEQFLDNMELERERGITIKLQAARMRY-VAKDGEEYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALDNNLEIIPVLNKIDLPGAEPDRVTEEIEEVVGLDCTDIIRASAKQGLGINDILESIVQQVPPPADTID-QPLRALIFDSYYDPYRGVIVYFRVMDGEVKKGDKVRLMASKKEYEIDELGVLAPNQVQVDALHAGEVGYFAAAIKSVEDARVGDTITSAVHPAPAPLPGYTEAKPMVFCGLFPTDADQYSDLRDALDKLKLNDAALSFEPETSSAMGFGFRCGFLGLLHLEIVQERLEREYNLDLITTAPSVVYRVTTTDGEVMEIDNPSQLPDPQKREKIEEPYIQVDVITPEEFVGTIMDLCQTRRGIFKDMKYFTESRTNIIYELPLAEVVTDFFDQLKSRTRGYASMEYQLIGYRVGQLVRLDILVNKDSVDSLAMIVHRDKAYNVGRAMAEKLKELIPRHQFKIPIQAAIGSKIIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKSIGTVDVPQEAFMAVL 598
>gi|83594694|ref|YP_428446.1| GTP-binding protein LepA [Rhodospirillum rubrum ATCC 11170] >gi|83577608|gb|ABC24159.1| GTP-binding protein LepA [Rhodospirillum rubrum ATCC 11170] (621 aa)
Score = 1748, Expect = 0.0e+00, Identities = 326/596 (54%), Positives = 450/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNF+I+AHIDHGKSTL+DR+I+    +  R+MK Q+LDSMD+ERERGITIK   V+L Y    D + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++   EI+PV+NKIDLP+A+ +R+K+Q+ED IGLD S+A  +SAKTGLNI+Q++EA++ ++PPP   D + P QAL+ DS+YD+Y G V LVR+++G ++ G K+  M+      +  +GV TPK++  + L AGE+G++ A IK++    +GDTITDD  PA  +LPG+K  +P+V+CGL+P+DS+ +E+ +E+L K+ L+DSS  ++ E+S ALGFG RCGFLGLLHM++I+ERL+REF + LI TAPSV+Y++ + DGT+LE+ + A +PD      ++EP+ KA I+VPD++LG ++ LC   RG  +DL    S R    Y +PL EI++ F+D+LKS S+GYA+ DYE+ DY + DLVKV IL+N   VDAL+ I HR  A  R R+IC +LK+ IP+H F++PIQA IGG++IARET++AMRK+V AKCYGGDITRKKKLLE+QKEGKK+++  G V +P   F+  L
  S:    23 DLSHIRNFAIIAHIDHGKSTLADRLIQTCGGVEARDMKEQLLDSMDLERERGITIKAQTVRLHYTAKSDGRTYQLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDAGHEIIPVLNKIDLPAAEPERIKQQIEDVIGLDTSDAVGISAKTGLNIDQVLEALVLRLPPP-TGDVDAPTQALLVDSWYDSYLGVVILVRVRHGVLRKGMKMLMMATGAVHPIDKVGVFTPKMLETDSLSAGEMGFVMAGIKSVADCQIGDTITDDRAPAAEALPGFKASIPVVWCGLFPVDSSDFEVLRESLAKLRLNDSSFEFQAESSAALGFGFRCGFLGLLHMEIIQERLEREFGLDLITTAPSVVYRMHMTDGTLLELHNPADMPDPVRLDFVEEPWVKATIMVPDEYLGQILALCTERRGIQMDLTYAGS-RAMAVYKLPLNEIVFDFYDRLKSISRGYASFDYEVADYAESDLVKVSILVNNEPVDALAFIAHRTQADFRGRQICGRLKDLIPRHLFKVPIQAAIGGRVIARETIAAMRKDVTAKCYGGDITRKKKLLEKQKEGKKKMRQFGKVEIPQSAFINAL 616
>gi|162147311|ref|YP_001601772.1| GTP-binding protein LepA [Gluconacetobacter diazotrophicus PAl 5] >gi|187597655|ref|ZP_02983912.1| GTP-binding protein LepA [Gluconacetobacter diazotrophicus PAl 5] >gi|189046443|sp|A9HG78|LEPA_GLUDA GTP-binding protein lepA >gi|161785888|emb|CAP55459.1| GTP-binding protein lepA [Gluconacetobacter diazotrophicus PAl 5] >gi|187490169|gb|EDU28113.1| GTP-binding protein LepA [Gluconacetobacter diazotrophicus PAl 5] (601 aa)
Score = 1747, Expect = 0.0e+00, Identities = 326/592 (55%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+    LT REM NQ+LD+M++ERERGITIK   V+L Y   KD + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++ N EIVPV+NK+DLP+A+ +RVK Q+E+ IG+   +A  +SAKTGLNI  ++EA++ ++PPP+  D++KPLQAL+ DS+YD Y G + LVRIK G+++ G++IR MSN   + V  +GV  P++V  + L  GE+G+I A+IK +   +VGDTITDD +PA  +L G+K  +P+V+CGLYPID+  +E  +++L K+ L+D+S  YE ETS ALGFG RCGFLGLLH+++I+ERL REFN+ LIATAPSV+Y++   +G + E+ + A +PD ++ ++I+EP+  A I+VPDD+LG V+ LC   RG   DL  V  TR    Y +PL E+++ F+D+LKS S+GYA+ DY++  Y + DLV++ IL+N   VDAL+ I HR  A  R R IC KLKE IP+  F+I IQA IG ++IARET+ A+ K+V AKCYGGDI+RK+KLLE+QKEGKKR++  G V +P   F+  L
  S:     9 IRNFSIIAHIDHGKSTLADRLIQACGALTAREMTNQVLDNMELERERGITIKAQTVRLSY-PAKDGKTYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDANHEIVPVLNKVDLPAAEPERVKAQIEEVIGIPADDAVEISAKTGLNIEGVLEALVTRLPPPV-GDESKPLQALLVDSWYDPYLGVIILVRIKEGRLRKGSRIRMMSNGAVYHVDQVGVFAPRMVPVDDLGPGEMGYINAAIKTVADCNVGDTITDDRHPAERALAGFKPSIPVVWCGLYPIDADDFEKLRDSLSKLRLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLSREFNLDLIATAPSVVYRLYRTNGGMEELHNPADMPDGSVVEKIEEPWITATIMVPDDYLGAVLTLCSERRGIQKDLTYV-GTRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDGYEESDLVRISILVNQEPVDALAFIAHRSAAESRGRSICAKLKELIPRQLFKIAIQAAIGSRVIARETIGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAAL 597
>gi|188585805|ref|YP_001917350.1| GTP-binding protein LepA [Natranaerobius thermophilus JW/NM-WN-LF] >gi|179350492|gb|ACB84762.1| GTP-binding protein LepA [Natranaerobius thermophilus JW/NM-WN-LF] (599 aa)
Score = 1747, Expect = 0.0e+00, Identities = 332/598 (55%), Positives = 451/598 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           M ++ IRNFSI+AHIDHGKSTL+DR++E+T TLT REM+ Q LD+MD+ERERGITIKL AV + Y   KD ++YY ++IDTPGHVDFTYEVSRSL ACEG LLVVDA+QG+EAQTL+N+YLALE NLEI+PVINKIDLP+AD+++V +++E+ +G+D     L SAK G  I  I+EAI+E+IP P D +D+  L+AL+FDSYYD Y+G +  +R+ +GQ+  G +I+ M   + F  S +G+  P     + L AGEVG++AA+IK++K   VGDTIT    PA   L GYK++ PMVYCGL+P D   YE  ++AL+K+ L+D+SL YE E S ALGFG RCGFLGLLHM++I+ERL+RE+ I+L+ TAP+V+Y+V L +G  + I++   LP++     I EP  +A  +VP D++G VMELC+  RGEY  L  +DS R  + Y +PL+EI++ FFD LKS ++GYA+ DYEI+ Y   DLVKVDIL+N   VDALS I+H++ A  + R++  KL+E +P+  F++P+QA IG K+IARETV A++KNVLAKCYGGDITRK+KLLE+QKEGK+R+K +G V +P + F+ +LS
  S:     1 MTQERIRNFSIIAHIDHGKSTLADRLLEYTKTLTEREMQEQFLDNMDLERERGITIKLQAVTMNYQ-AKDGKEYYLNVIDTPGHVDFTYEVSRSLKACEGVLLVVDAAQGIEAQTLANIYLALEQNLEIIPVINKIDLPNADVEKVTRELEEIVGIDEDEVILASAKDGTGIEDILEAIVERIPAPDDKEDDH-LKALIFDSYYDTYRGVITYLRVFSGQLVPGMEIKMMQTGKKFEASEIGILNPGPKKVDALNAGEVGFMAANIKDVKDSRVGDTITSYKKPAPEPLAGYKQVKPMVYCGLFPADGEDYEDLRDALDKLQLNDASLVYEQENSAALGFGFRCGFLGLLHMEIIQERLEREYGISLVTTAPNVVYRVELVEGEEITIENPTDLPERNEINAIYEPVVRANFMVPQDYIGPVMELCEEKRGEYETLEYLDSLRVLLKYKLPLSEIVFDFFDLLKSKTRGYASFDYEIIGYEGADLVKVDILVNKEPVDALSFIVHQDKAYYKGRQLAGKLREMLPRQMFDVPVQAAIGNKVIARETVKAVKKNVLAKCYGGDITRKRKLLEKQKEGKQRMKQVGKVDIPQEAFMAVLS 596
>gi|158338359|ref|YP_001519536.1| GTP-binding protein LepA [Acaryochloris marina MBIC11017] >gi|189046428|sp|B0C9R9|LEPA_ACAM1 GTP-binding protein lepA >gi|158308600|gb|ABW30217.1| GTP-binding protein lepA [Acaryochloris marina MBIC11017] (603 aa)
Score = 1747, Expect = 0.0e+00, Identities = 322/592 (54%), Positives = 453/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  REMK Q LD+M++ERERGITIKL A ++ Y    D +DY  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLA+E++LEI+PV+NKIDLP A+ DRVK+++E+ +GLDCS A L SAKTG+ I +I+E+I+  +PPP D+   +PL+AL+FDSYYD Y+G V   R+ +G VK G ++R M++ + + V  LGV +P  V  + L AGEVG+ AA+IK ++   VGDTIT     A   LPGY +  PMV+CG++P D+ Q+   ++ALE++ L+D++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y++    G  L ID+ + LPD    ++I+EPF + ++I P++++G +MEL Q+ RG + D+  +   R  + Y +PLAE++  FFD++KS S+GYA+++Y ++ YR+  LVK+DIL+N + VD+L+ I+HR+ A    R +  KL+E IP+HQF+IPIQA IG K+IA E++ A+RK+VLAKCYGGD++RK+KLLE+QK GKKR+K++G V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQTTGTVADREMKEQFLDNMELERERGITIKLQAARMAYQ-ASDKEDYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLAIEHDLEIIPVLNKIDLPGAEPDRVKQEIEEIVGLDCSGAILASAKTGIGIAEILESIVHLVPPPEDTT-QEPLRALIFDSYYDLYRGVVVYFRVMDGTVKKGDRVRLMASGKEYDVDELGVLSPTQVQVDELHAGEVGYFAAAIKAVEDARVGDTITLAKAQAAEPLPGYVEAKPMVFCGMFPTDADQFPDLRDALERLKLNDAALNYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLIITAPSVVYRITTLKGETLLIDNPSSLPDPQHREKIEEPFVQVDMITPEEYVGTLMELGQSRRGTFKDMKYLTPGRTTLVYELPLAEVVTDFFDQMKSRSRGYASMEYHLIGYRENPLVKLDILINADPVDSLAAIVHRDKAYYTGRALVSKLRELIPRHQFKIPIQAAIGAKVIASESIPALRKDVLAKCYGGDVSRKRKLLEKQKAGKKRMKSVGRVDVPQEAFMAVL 598
>gi|159043361|ref|YP_001532155.1| GTP-binding protein LepA [Dinoroseobacter shibae DFL 12] >gi|189046438|sp|A8LR11|LEPA_DINSH GTP-binding protein lepA >gi|157911121|gb|ABV92554.1| GTP-binding protein LepA [Dinoroseobacter shibae DFL 12] (599 aa)
Score = 1745, Expect = 0.0e+00, Identities = 328/592 (55%), Positives = 450/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ TNT++ R+MK Q+LD+MDIERERGITIK N V++ Y    D QDY  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP++D DRV +Q+ED IG+D S A  VSAKTG  I++ +EAI+  +P P  + D  PL+A++ DS+YDAY G + LVRI +G ++ G +I+ MSN     V  +GV  P +   + L  GE+G++ ASIK ++   VGDTIT +   A T+LPG+K   P+V+CGL+P+DS ++E  ++A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY V + DGT+ E+ + A +PD T    ++EP  KA I+VPDD+LG+V++LCQ+ RG  +DL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY+++ YR+ +LVK+ +L+N   VDALST++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P + F+  L
  S:     7 IRNFSIVAHIDHGKSTLADRLIQETNTVSARDMKEQLLDAMDIERERGITIKANTVRIDY-TADDGQDYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIRVSAKTGQGIHETLEAIVHHLPAPKGTRD-APLKAMLVDSWYDAYLGVIVLVRIIDGTLRKGERIKMMSNGTVHHVDRIGVFRPAMQPVDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGAETALPGFKPSQPVVFCGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIELITTAPSVIYHVYMRDGTMRELHNPADMPDLTHVDHLEEPRIKATILVPDDYLGDVLKLCQDRRGIQMDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYRQDNLVKMQVLVNDEPVDALSTMVHRDRAEARGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|90422115|ref|YP_530485.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB18] >gi|90104129|gb|ABD86166.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB18] (637 aa)
Score = 1745, Expect = 0.0e+00, Identities = 340/592 (57%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L  REMK Q+LDSMDIERERGITIK   V+L YH  +D +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ ++V++Q+ED IG+D S A ++SAKTGL I+ ++EAI+ ++PPP   D   PL+AL+ DS+YD Y G V LVR+ +G +K G +IR M  N  + +  +G  TPK+   + L  GE+G+I A IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DGT LEI +   +PD     EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:    45 IRNFSIVAHIDHGKSTLADRLIQTTGGLQAREMKEQVLDSMDIERERGITIKAQTVRLNYH-AQDGRDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPEQVRQQIEDVIGIDASEAVMISAKTGLGIDLVLEAIVHRLPPP-QGDREAPLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERVGFFTPKMTQVDELGPGEIGFITAGIKEVADTRVGDTITDDKKPVTEMLPGFKPAVPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMHLTDGTELEIHNPIDMPDVVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGTQKELTYVGS-RAMVKYNLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYQPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 633
>gi|164686304|ref|ZP_02210334.1| hypothetical protein CLOBAR_02742 [Clostridium bartlettii DSM 16795] >gi|164601906|gb|EDQ95371.1| hypothetical protein CLOBAR_02742 [Clostridium bartlettii DSM 16795] (601 aa)
Score = 1744, Expect = 0.0e+00, Identities = 358/597 (59%), Positives = 453/597 (75%)
  Q:     1 MDKKY--IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD K    RNFSI+AHIDHGKSTL+DR+I++T  ++ REMKNQ+LD+MD+ERERGITIKL  ++L Y N KD  +YY +LIDTPGHVDF YEVSRSLAACEGALLVVDA+QGVEAQTL+NVYLAL+ +LEI+PVINKIDLPSA  D +K ++ED IGLD S APLVSAK+GLNI  ++E I+  +P P + D  KPL+AL+FDSYYDAYKG V  VR+  G+VK G  I  M+  + F V+ +GV  P     E L AG+VG+IAASIK+I+S  VGDTITD   P    LPGYKK  PMVYCG+YP +  +YE  K+ALEK+ ++D++L +E ETS ALGFG RCGFLGLLH+++I ERL+REFN+ L+ TAPSVIY+V  N G ++ I +   LPD +  K I+EP  KA+IIVP D++G VMELCQ  RG   ++  +D  R  + Y +PL E++Y FFD LKS ++GY +LD+E+  Y    LVK+DIL+N  +VDALS I+H   A  R + +C KLK  IP+HQF +PIQA +G KIIARET+SA+RK+VLAKCYGGDI+RKKKLLE+QKEGKKR++ IGNV VP   F+ +L
  S:     1 MDNKQSRTRNFSIIAHIDHGKSTLADRLIQYTGLVSDREMKNQLLDNMDLERERGITIKLQNIRLKY-NAKDGNEYYLNLIDTPGHVDFNYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLALDQDLEILPVINKIDLPSARPDEIKAEIEDIIGLDASEAPLVSAKSGLNIQDVLEDIVNNVPAP-EGDIEKPLKALIFDSYYDAYKGVVAYVRVFEGEVKKGMTIEMMNTKKKFEVTEVGVMAPHPTELESLQAGDVGYIAASIKDIRSCHVGDTITDAKRPTDEPLPGYKKATPMVYCGIYPGEGEKYENVKDALEKLQVNDAALEFELETSAALGFGFRCGFLGLLHLEIIEERLEREFNLNLVTTAPSVIYRVTKNTGEVVMIQNPTNLPDPSEIKMIEEPIVKADIIVPKDYVGIVMELCQERRGTMHNMEYIDPKRVMLHYDLPLNEVIYDFFDALKSRTRGYGSLDFEMKGYVPSTLVKLDILINKEQVDALSFIVHESKAYARGKAMCEKLKNEIPRHQFAVPIQAAVGNKIIARETISALRKDVLAKCYGGDISRKKKLLEKQKEGKKRMRQIGNVEVPQKAFMAVL 597
>gi|194246683|ref|YP_002004322.1| GTP-binding protein [Candidatus Phytoplasma mali] >gi|193807040|emb|CAP18476.1| GTP-binding protein [Candidatus Phytoplasma mali] (605 aa)
Score = 1743, Expect = 0.0e+00, Identities = 336/598 (56%), Positives = 452/598 (75%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +K IRNFSI+AH+DHGKSTL+DRI+E TNT+  R M+ Q LDSMD+E+ERGITIKLNAVQ+I+ N K   +Y  HLIDTPGHVDF YEVSR+LAACEG +LV+DA+QG++AQTL+N YLA+ENNL I+PVINKIDLP+AD+++V+++++DT+G++  N  LVS KTG+ + +I+E ++  IP P   D N+P Q+LVFDS++D YKG V L+R+ +G+++ G +IRFMSNNE + VS +GV +P    K  L  GEVG+++ASIKNI  + VGDTIT+  NP    LPGY+KI P+V+CGLYPI  ++YE  K ALEK+ L+D+SLT+E ETS ALG G R GFLGLLHM++I+ER+ REF+I  I TAPSVIY V    GT + +D+ +K P+  + + ++EPF KA II P  ++G VM L Q+ RG+  D+  +D     + Y  PL+EIMY++FDKLKS +KGYA+ +YEI  YR   L K+DILLNG  +DALS I+H++FA  R + IC KL E IPK  FE+PIQ  IG ++I RE + +MRK+V++KCYGGD++RKKKLL +QKEGKK++K +G V +P   F+ ILS E
  S:    10 QKRIRNFSIIAHVDHGKSTLADRILEITNTVEKRLMQKQFLDSMDLEKERGITIKLNAVQIIF-NDKKGDEYIMHLIDTPGHVDFNYEVSRALAACEGVILVIDATQGIQAQTLTNFYLAIENNLLIIPVINKIDLPNADVNKVRREIKDTLGIEPENTILVSGKTGVGVTEILEKVVSNIPSP-RGDINEPFQSLVFDSFFDPYKGVVSLIRVFSGKIQKGDQIRFMSNNEVYEVSEVGVYSPFQTPKPFLFVGEVGYLSASIKNIDKVRVGDTITNHKNPTKQRLPGYRKIQPVVFCGLYPITCSKYETLKSALEKLKLNDASLTFEPETSVALGLGFRIGFLGLLHMEIIQERISREFDIEAITTAPSVIYHVYTKKGTKILVDNPSKWPNTQIIERVEEPFIKATIICPQIYIGTVMTLSQSKRGQLKDISYLDKNIAMIIYFFPLSEIMYNYFDKLKSVTKGYASFEYEIDSYRSSSLQKMDILLNGEVIDALSIIIHKDFAYSRGKVICSKLIECIPKQMFEVPIQVAIGKRVIVRENIKSMRKDVISKCYGGDVSRKKKLLSKQKEGKKKMKNLGKVKLPQKAFLAILSTE 605
>gi|119371387|sp|Q2RNY6|LEPA_RHORT GTP-binding protein lepA (601 aa)
Score = 1743, Expect = 0.0e+00, Identities = 326/596 (54%), Positives = 450/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNF+I+AHIDHGKSTL+DR+I+    +  R+MK Q+LDSMD+ERERGITIK   V+L Y    D + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++   EI+PV+NKIDLP+A+ +R+K+Q+ED IGLD S+A  +SAKTGLNI+Q++EA++ ++PPP   D + P QAL+ DS+YD+Y G V LVR+++G ++ G K+  M+      +  +GV TPK++  + L AGE+G++ A IK++    +GDTITDD  PA  +LPG+K  +P+V+CGL+P+DS+ +E+ +E+L K+ L+DSS  ++ E+S ALGFG RCGFLGLLHM++I+ERL+REF + LI TAPSV+Y++ + DGT+LE+ + A +PD      ++EP+ KA I+VPD++LG ++ LC   RG  +DL    S R    Y +PL EI++ F+D+LKS S+GYA+ DYE+ DY + DLVKV IL+N   VDAL+ I HR  A  R R+IC +LK+ IP+H F++PIQA IGG++IARET++AMRK+V AKCYGGDITRKKKLLE+QKEGKK+++  G V +P   F+  L
  S:     3 DLSHIRNFAIIAHIDHGKSTLADRLIQTCGGVEARDMKEQLLDSMDLERERGITIKAQTVRLHYTAKSDGRTYQLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDAGHEIIPVLNKIDLPAAEPERIKQQIEDVIGLDTSDAVGISAKTGLNIDQVLEALVLRLPPP-TGDVDAPTQALLVDSWYDSYLGVVILVRVRHGVLRKGMKMLMMATGAVHPIDKVGVFTPKMLETDSLSAGEMGFVMAGIKSVADCQIGDTITDDRAPAAEALPGFKASIPVVWCGLFPVDSSDFEVLRESLAKLRLNDSSFEFQAESSAALGFGFRCGFLGLLHMEIIQERLEREFGLDLITTAPSVVYRMHMTDGTLLELHNPADMPDPVRLDFVEEPWVKATIMVPDEYLGQILALCTERRGIQMDLTYAGS-RAMAVYKLPLNEIVFDFYDRLKSISRGYASFDYEVADYAESDLVKVSILVNNEPVDALAFIAHRTQADFRGRQICGRLKDLIPRHLFKVPIQAAIGGRVIARETIAAMRKDVTAKCYGGDITRKKKLLEKQKEGKKKMRQFGKVEIPQSAFINAL 596
>gi|118580746|ref|YP_901996.1| GTP-binding protein LepA [Pelobacter propionicus DSM 2379] >gi|166224506|sp|A1ARG8|LEPA_PELPD GTP-binding protein lepA >gi|118503456|gb|ABK99938.1| GTP-binding protein LepA [Pelobacter propionicus DSM 2379] (598 aa)
Score = 1743, Expect = 0.0e+00, Identities = 337/600 (56%), Positives = 450/600 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           MD   +RNFSI+AHIDHGKSTL+DR++EFT  L+ REM+NQ LD MD+ERERGITIK   V+L Y    D  DY  +LIDTPGHVDFTYEVSRSLAACEG LLVVDASQGVEAQTL+NVYLAL+ NLE+ PV+NKIDLP+AD +RV +++E+ IG+D  +A L SAK G+  ++I+E I+++IPPP   D + PL+AL+FDS+YD Y+G + LVRI +G +K G +I+ M+   +F    +GV  P +V  + L AGEVG++ A IK +    VGDT+T    P +++L G+K++ PMV+ GLYPID+ QYE  ++AL K+ L+DSS +Y+ ETS ALGFG RCGFLGLLHM++I+ERL+REF + LI TAP+V+Y+V    G +  I+SA ++P+    + ++EPF  A I VP++F+G V+ LC++ RG   ++  +   R  + Y +PL EI+  F+D+LKS +KGYA+LDYE LDYRK DLV++++++NG  VDALS I+HR+ A  R R +  K+KE IP+  FE+ IQA IG KIIARETV AMRK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P D F+ IL  E
  S:     1 MDISRLRNFSIIAHIDHGKSTLADRLLEFTGALSQREMQNQFLDKMDLERERGITIKAQTVRLTYR-ADDGNDYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLALDINLEVFPVLNKIDLPAADPERVIQEIEEIIGIDAHDAVLASAKEGIGTHEILEEIVKKIPPP-KGDASAPLRALLFDSWYDQYQGVIILVRIFDGTLKKGDRIQLMATRSSFEALKVGVFAPTMVETQQLAAGEVGFVIAGIKEVADAKVGDTVTLQHRPCSSALEGFKEVKPMVFSGLYPIDTVQYEQLRDALAKLKLNDSSFSYDPETSLALGFGFRCGFLGLLHMEIIQERLEREFGLDLITTAPTVVYRVHRVTGEVQSIESANQMPELQHVEYLEEPFILAHIHVPNEFVGGVLALCEDKRGVQREIKYLTQNRVMIIYELPLNEIVLDFYDRLKSITKGYASLDYEHLDYRKSDLVRMNVMINGEVVDALSLILHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGNKIIARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQDAFLAILKVE 598
>gi|147841933|emb|CAN60938.1| hypothetical protein [Vitis vinifera] (680 aa)
Score = 1743, Expect = 0.0e+00, Identities = 321/595 (53%), Positives = 453/595 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNF I+AHIDHGKSTL+D++++ T T+  REMK Q LD+MD+ERERGITIKL A ++ Y    +N+ Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+  RV +++E+ +GLDCS+A   SAK G+ I +I+ AI+++IPPP D+ + +PL+AL+FDSYYD Y+G +   R+ +G +K G +I FM++ + +    +GV +P  +  + L AGEVG++AASI+++    VGDTIT     A  SLPGY++  PMV+CGL+P+D+ ++   ++ALEK+ L+D++L +E ETS A+GFG RCGFLGLLHM++I+ERL+RE+N+ LI TAPSV+Y+V   +G  +E  + + LP+      I+EP+ K E++ P D++G +MEL Q+ RGE+ ++  +   R  +TY +PLAE++  FFD+LKS SKGYA+++Y  L Y++ +L+K+DI +NG +V+ L+TI+H++ A    R +  KLKE IP+  F++PIQA IG K+IA E++SA+RK+VL+KCYGGDITRKKKLL++Q EGKKR+KAIG V VP + F+ +L  E
  S:    85 IRNFCIIAHIDHGKSTLADKLLQMTGTVQKREMKEQFLDNMDLERERGITIKLQAARMRY--VFENEPYCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPVRVSQEIEEVVGLDCSDAIHCSAKEGIGITEILNAIVKRIPPPCDTAE-RPLRALIFDSYYDPYRGVIVYFRVIDGTIKKGDRIYFMASKKDYFADEIGVLSPNQLQADELYAGEVGYLAASIRSVADARVGDTITHYGRKAENSLPGYEEATPMVFCGLFPVDADKFPDLRDALEKLQLNDAALKFEPETSSAMGFGFRCGFLGLLHMEIIQERLEREYNLTLITTAPSVVYRVNCINGDTVECSNPSLLPEPGKRTSIEEPYVKIEMLTPKDYIGPLMELAQDRRGEFKEMKFITENRASITYELPLAEMVGDFFDQLKSRSKGYASMEYSFLGYKESELIKLDIQINGERVEPLATIVHKDKAYAVGRALTQKLKELIPRQMFKVPIQACIGAKVIASESLSAIRKDVLSKCYGGDITRKKKLLKKQAEGKKRMKAIGKVDVPQEAFMAVLKLE 676
>gi|50251243|dbj|BAD28023.1| putative LepA protein [Oryza sativa Japonica Group] >gi|50252173|dbj|BAD28168.1| putative LepA protein [Oryza sativa Japonica Group] (680 aa)
Score = 1743, Expect = 0.0e+00, Identities = 326/595 (54%), Positives = 454/595 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDS--------SLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+D+++E T T+  REMK Q LD+MD+ERERGITIKL A ++ Y    +++ Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALEN+LEI+PV+NKIDLP A+ DRV +++E+ IG+DCSNA   SAK G+ I +I++AI+ +IPPP ++  + PL+AL+FDSYYD Y+G +   R+ +G +K G KI FM++ + ++   +GV +P  +    L AGEVG+++ASI+++    VGDTIT  +  A  +LPGY +  PMV+CGL+PID+ Q+E  +EALEK+ L+D+        S+ +E E+S A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y V L DG  +E  + + LP+    + I+EP+ K +++ P +++G +MEL Q  RGE+ ++  +   R  V Y +PLAE++  FFD+LKS SKGYA+++Y ++ YR+ +LVK+DI +NG+ V+ALSTI+HR+ A    R +  KLKE IP+  F +PIQA IG K+IA E +SA+RK+VL+KCYGGDI+RKKKLL++Q EGKKR+KAIG V VP + F+ +L  E
  S:    77 IRNFSIIAHIDHGKSTLADKLLELTGTVQKREMKQQFLDNMDLERERGITIKLQAARMRY--IMNDEPYCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPGAEPDRVAQEIEEIIGMDCSNAIRCSAKEGIGITEILDAIVTKIPPPQNTAIS-PLRALIFDSYYDPYRGVIVYFRVVDGSIKKGDKICFMASGKEYVADEIGVLSPNQMQVSELYAGEVGYLSASIRSVADARVGDTITHSSKRAECALPGYSQATPMVFCGLFPIDADQFEELREALEKLQLNDAALKAVTRFSMQFEPESSSAMGFGFRCGFLGLLHMEIVQERLEREYNLNLIITAPSVVYHVNLADGETVECSNPSLLPEPGKRRSIEEPYVKIDMLTPKEYIGPIMELGQERRGEFKEMNFITENRASVVYELPLAEMVGDFFDQLKSRSKGYASMEYSLIGYRESNLVKLDIQINGDPVEALSTIVHRDKAYSVGRALTQKLKELIPRQMFRVPIQACIGAKVIASEALSAIRKDVLSKCYGGDISRKKKLLKKQAEGKKRMKAIGRVDVPQEAFMAVLKLE 676
>gi|39996368|ref|NP_952319.1| GTP-binding protein LepA [Geobacter sulfurreducens PCA] >gi|46396178|sp|P60789|LEPA_GEOSL GTP-binding protein lepA >gi|39983248|gb|AAR34642.1| GTP-binding protein LepA [Geobacter sulfurreducens PCA] (600 aa)
Score = 1742, Expect = 0.0e+00, Identities = 334/595 (56%), Positives = 445/595 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+DR++E+T  LT REM++Q LD MD+ERERGITIK   V+L Y    D  DY  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTL+NVYLA++NNLE+ PV+NKIDLP+A+ +RVK ++E+ IGLD  +A + SAK G+   +I+E I+++IPPP + D   PL+AL+FDS+YD Y+G + LVR+ +G VK G KI+ +S   ++    +GV  P +     L AGEVG++ A IK++    +GDT+T    P  T L G+K++ PMV+ GLYPID+ QYE  ++AL K+ L+DSS ++E ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ LI TAP+V+YKV    G ++ I+SA +LP       I+EPF  A I  P++F+G ++ LC+  RG   ++  +  TR  + Y +PL E++  F+D+LKS +KGYA+LDYE L+YR+ DLV+++IL+NG  VDALS I+HR+ A  R R +  K+KE IP+  FE+ IQA IG K+IARETV A+RK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL  E
  S:     6 IRNFSIIAHIDHGKSTLADRLLEYTGALTEREMQDQFLDKMDLERERGITIKAQTVRLTYR-ADDGNDYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLAIDNNLEVFPVLNKIDLPAAEPERVKHEIEEIIGLDAHDAVMASAKEGIGTREILEEIVKKIPPP-EGDPAAPLKALLFDSWYDQYQGVIILVRVIDGTVKKGDKIQLVSTGRSYEALKVGVFAPVMREVPQLAAGEVGFLIAGIKDVADAKIGDTVTHALKPCVTPLGGFKEVKPMVFSGLYPIDTAQYEQLRDALAKLKLNDSSFSFEPETSLALGFGFRCGFLGLLHMEIIQERLEREFNLDLITTAPTVVYKVHRIKGDVITIESANQLPPLQEIDYIEEPFILASIHTPNEFVGGILSLCEEKRGVQREIKYLTPTRVMIIYELPLNEVVLDFYDRLKSITKGYASLDYEHLNYRRSDLVRMNILINGEAVDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVVIQAAIGAKVIARETVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598
>gi|177664607|ref|ZP_02940409.1| GTP-binding protein LepA [Cyanothece sp. PCC 8801] >gi|196244552|ref|ZP_03143278.1| GTP-binding protein LepA [Cyanothece sp. PCC 8802] >gi|172076443|gb|EDT61855.1| GTP-binding protein LepA [Cyanothece sp. PCC 8801] >gi|196207296|gb|EDY02089.1| GTP-binding protein LepA [Cyanothece sp. PCC 8802] (603 aa)
Score = 1741, Expect = 0.0e+00, Identities = 329/592 (55%), Positives = 457/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y   KD + Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVD+SQGVEAQTL+NVYLAL+NNLEI+P++NKIDLP ++ +RV  ++E+ +GLDCSN    SAK G+ I++I+E+I+  +PPP D+ D +PL+AL+FDSYYDAY+G +   R+ +GQVK G ++R M++ + + +  LG+ +P  +  + L AGEVG+ AA+IK ++   VGDTIT    PA   LPGY +  PMV+CGL+P D+ QYE  +EALEK+ L+D++L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   DG + EID+ + LP     ++I+EP+ + E+I P+ ++G +MELCQ+ RG + D+     +R  V Y +PLAE++  FFD+LKS S+GYA+++Y ++ YR+  LVK+DIL+NG+ VDAL+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+K+IG V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQDTGTVQQRQMKEQFLDNMDLERERGITIKLQAARMNY-TAKDGEKYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDSSQGVEAQTLANVYLALDNNLEIIPILNKIDLPGSEPERVANEIEEVVGLDCSNIIKASAKAGIGIDEILESIVHLVPPPQDTVD-QPLRALIFDSYYDAYRGVIVYFRVMDGQVKKGDRVRLMASGKEYEIDELGILSPNQIPIDSLHAGEVGYFAAAIKTVEDARVGDTITLAEKPAKEPLPGYTEANPMVFCGLFPTDADQYEDLREALEKLKLNDAALSYEPETSTAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVVYRVTTVDGEVTEIDNPSLLPPPQKREKIEEPYIQVEMITPETYVGTLMELCQSRRGVFKDMRYFTLSRTAVVYELPLAEVVTDFFDQLKSRSRGYASMEYHLIGYRENPLVKLDILVNGDSVDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKSIGTVDVPQEAFMAVL 598
>gi|119371385|sp|Q21BS0|LEPA_RHOPB GTP-binding protein lepA (601 aa)
Score = 1741, Expect = 0.0e+00, Identities = 340/592 (57%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  L  REMK Q+LDSMDIERERGITIK   V+L YH  +D +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ ++V++Q+ED IG+D S A ++SAKTGL I+ ++EAI+ ++PPP   D   PL+AL+ DS+YD Y G V LVR+ +G +K G +IR M  N  + +  +G  TPK+   + L  GE+G+I A IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DGT LEI +   +PD     EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V S R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQTTGGLQAREMKEQVLDSMDIERERGITIKAQTVRLNYH-AQDGRDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPEQVRQQIEDVIGIDASEAVMISAKTGLGIDLVLEAIVHRLPPP-QGDREAPLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERVGFFTPKMTQVDELGPGEIGFITAGIKEVADTRVGDTITDDKKPVTEMLPGFKPAVPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMHLTDGTELEIHNPIDMPDVVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGTQKELTYVGS-RAMVKYNLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYQPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 597
>gi|167459128|ref|ZP_02325320.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-1] >gi|167414613|gb|EDR81358.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-1] (601 aa)
Score = 1741, Expect = 0.0e+00, Identities = 331/596 (55%), Positives = 444/596 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +IRNFSI+AHIDHGKSTL+DR++E T T+T RE + Q LD+M++ERERGITIK   V++ Y   +D +DY  +LIDTPGHVDF YEVSRS+AACEGA+LVVDA+QGVEAQTL+NVY AL+++LEIVPVINKIDLPSAD++ V++++E+ IGLD  +A   SAK G+ I +I+E I+ ++P P + D + PL+A+VFDS+YD+Y+G V LVR+  G V+   KIR  SN + F V  LGV  P       L AGEVG + A++K++    VGDTITD   P     PG+K + PMV+ G++PI++  YE  ++ALEK+ L+DS+ TYE ETSQALGFG RCG+LGLLHM++++ERL+RE+ +ALI TAPSV+Y+V    G + EID+ AKLP      +++EP     I    + +G +++LCQ  RG   DL  + + R ++TY IPLAE+++ FFDKLKS S+GYA+LDYE+  Y + DLVK+DIL+NG  VDALS I+HRE A  R R +C +L+E IPK  +E+ IQA IG K+IARETV A RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P + F+ +L  E
  S:     7 HIRNFSIIAHIDHGKSTLADRLLEHTGTVTKREAQAQFLDNMELERERGITIKAQTVRMKYR-AQDGRDYELNLIDTPGHVDFAYEVSRSMAACEGAILVVDATQGVEAQTLANVYQALDHDLEIVPVINKIDLPSADVEGVRQEIEEVIGLDAKDAVPASAKEGIGIGEILEQIVHRVPAP-EGDPDAPLKAIVFDSWYDSYRGVVMLVRVFEGTVRPKQKIRLWSNRKEFEVQELGVFAPFAKAVVELQAGEVGVVVANVKDVHDAKVGDTITDATRPTEEPFPGFKVVKPMVFSGVFPIEAADYEQLRDALEKLSLNDSAFTYEPETSQALGFGFRCGYLGLLHMEIVQERLEREYQLALITTAPSVVYRVTDTSGAVEEIDNPAKLPPVQKIAKLEEPHLTCHIHARTEDVGAILKLCQERRGLQRDLKYLGTKRVQITYDIPLAEVVFDFFDKLKSVSRGYASLDYELKGYEEADLVKLDILINGEPVDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVIARETVKAFRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQEAFLAVLKVE 600
>gi|196177142|gb|EDX72150.1| GTP-binding protein LepA [Microcoleus chthonoplastes PCC 7420] (603 aa)
Score = 1741, Expect = 0.0e+00, Identities = 327/595 (54%), Positives = 458/595 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+DR+++ T T++ R+MK Q LD+M++ERERGITIKL A ++ Y   KD + Y  +LIDTPGHVDF+YEVSRSL ACEGALLVVDASQGVEAQTL+NVYLALE++LEI+PV+NKIDLP A+ +RV  ++E+ IGLDCS A L SAK G+ I++I+E+I+  +PPP D+ D +PL+AL+FDSYYD Y+G +   R+ +G V+ G K+R M + + + +  LGV +P  +  E L AGEVG+IAA+IK ++   VGDTIT  A PA   LPGYK+  PMV+CGL+P D+ QYE  +EAL ++ L+DS+L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSV+Y+V   DG +LEID+ + LP     ++I+EP+ + E+I P+ ++G +MELCQ  RGE+ D+  +   R  + Y +PLAE++  FFD+LKS S+GYA+++Y ++ Y++  LV++D+L+NG+ VD+L+ I+HR+ A    R +  KL+E IP+HQF+IP+QA IG ++IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+K++G V VP + F+ +L  E
  S:     9 IRNFSIIAHIDHGKSTLADRLLQTTGTVSDRQMKEQFLDNMELERERGITIKLQAARMNYQG-KDGEQYVLNLIDTPGHVDFSYEVSRSLVACEGALLVVDASQGVEAQTLANVYLALEHDLEIIPVLNKIDLPGAEPERVISEIEEIIGLDCSGAILASAKEGIGIDEILESIVHLVPPPQDTID-QPLRALIFDSYYDPYRGVIVYFRVMDGSVRTGEKVRLMVSKKEYEIDELGVLSPTQIQVEQLHAGEVGYIAAAIKTVEDARVGDTITLAAEPAEKPLPGYKEAKPMVFCGLFPTDADQYEDLREALNRLKLNDSALNYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYDLDLIITAPSVVYRVTNMDGEVLEIDNPSLLPPPQQREKIEEPYVRIEMITPETYVGTLMELCQTRRGEFKDMRYLTQGRTTLVYELPLAEVVTDFFDQLKSRSRGYASMEYHLIGYQENTLVRLDVLINGDPVDSLAMIVHRDKAYSVGRALVEKLRELIPRHQFKIPLQASIGSRVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKSLGTVDVPQEAFMAVLRLE 601
>gi|163757691|ref|ZP_02164780.1| GTP-binding elongation factor protein [Hoeflea phototrophica DFL-43] >gi|162285193|gb|EDQ35475.1| GTP-binding elongation factor protein [Hoeflea phototrophica DFL-43] (602 aa)
Score = 1741, Expect = 0.0e+00, Identities = 319/593 (53%), Positives = 443/593 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+    L  REM  Q+LDSMDIE+ERGITIK   V+L ++  KD + Y  +LIDTPGHVDF YEVSRSL ACEG+LLVVDASQGVEAQTL+NVY AL+ + EIVPV+NKIDLP+A+ DR+K+Q+E+ IGLD S+A ++SAKTG+ I +++EAI+ ++P P        L+A++ DS+YD Y G + LVR+ +G++K G +IR M     + V  +G+ TPK+V  + L  GE+G+I ASIK +    VGDTIT++ +P   +LPG+K   P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LIATAPSV+Y++ + +G ++E+ + A +PD      I+EP+ KA I+ PDD+LG +++LCQ  RG   DL  V   R  VTY +PL E+++ F+D+LKS +KGYA+ DY+I  +   DLV++ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F+IPIQA IGG+++ARET+SAMRK+V AKCYGGD TRK+KLL++QK GKKR++  G V +P + F++ L
  S:     8 HIRNFSIVAHIDHGKSTLADRLIQTCGGLAEREMSQQVLDSMDIEKERGITIKAQTVRL-HYKAKDGEMYVLNLIDTPGHVDFAYEVSRSLRACEGSLLVVDASQGVEAQTLANVYAALDADHEIVPVLNKIDLPAAEPDRIKEQIEEVIGLDASDAVMISAKTGIGIPEVLEAIVTRLPAPKGGTTKDALKAMLVDSWYDTYLGVIVLVRVIDGEMKKGQQIRLMGTGARYTVERIGIITPKLVATDTLGPGEIGFITASIKEVADTRVGDTITEEKHPTAEALPGFKPAQPVVFCGLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVVYRMNMTNGDVIELHNPADMPDVVKIASIEEPWIKATILTPDDYLGPILKLCQERRGIQTDLSYV-GKRAMVTYQLPLNEVVFDFYDRLKSITKGYASFDYQITGHEAGDLVRMSILVNEEPVDALSMLVHRSAAEKRGRVMCEKLKDLIPRHMFKIPIQAAIGGRVVARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIEAL 598
>gi|156450686|ref|ZP_02057065.1| GTP-binding protein LepA [Methylobacterium chloromethanicum CM4] >gi|156190583|gb|EDO22773.1| GTP-binding protein LepA [Methylobacterium chloromethanicum CM4] (606 aa)
Score = 1741, Expect = 0.0e+00, Identities = 328/592 (55%), Positives = 442/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+M  Q+LDSMDIE+ERGITIK   V+L Y   +D +DY  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+ N EIVPV+NK+DLP+A+ DRVK+Q+E+ IGLD S A  +SAKTGLNI  ++EAI++++P P   D   PL+AL+ DS+YD Y G V LVRI +G +K G  IR M  +  + V  +GV  PK+ +   L  GEVG+   SIK +    VGDTIT+D    T  L G+K++  +V+CGL+P+D+  +E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI+TAPSV+Y++L+ DG + E+ + A +PD    + ++EP+ +A I+ PD++LG V++LCQ+ RG  +DL N    R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F+IP+QA IGGKIIARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKKR++  G V +P + F+  L
  S:    14 IRNFSIVAHIDHGKSTLADRLIQTTGTVALRDMSEQMLDSMDIEKERGITIKAQTVRLEYR-AEDGKDYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASEAVPISAKTGLNIEAVLEAIVKRLPAP-KGDREAPLKALLVDSWYDVYLGVVVLVRIIDGVLKKGMTIRMMGADAAYGVDRIGVFRPKMADIGELGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTQMLAGFKEVQAVVFCGLFPVDAADFESLRGAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLISTAPSVVYRLLMRDGELKELHNPADMPDPMKIETVEEPWIRATILTPDEYLGGVLKLCQDRRGIQIDL-NYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREGDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGRVEIPQEAFIAAL 602
>gi|163850670|ref|YP_001638713.1| GTP-binding protein LepA [Methylobacterium extorquens PA1] >gi|163662275|gb|ABY29642.1| GTP-binding protein LepA [Methylobacterium extorquens PA1] (606 aa)
Score = 1741, Expect = 0.0e+00, Identities = 328/592 (55%), Positives = 442/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+M  Q+LDSMDIE+ERGITIK   V+L Y   +D +DY  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+ N EIVPV+NK+DLP+A+ DRVK+Q+E+ IGLD S A  +SAKTGLNI  ++EAI++++P P   D   PL+AL+ DS+YD Y G V LVRI +G +K G  IR M  +  + V  +GV  PK+ +   L  GEVG+   SIK +    VGDTIT+D    T  L G+K++  +V+CGL+P+D+  +E  + A+ K+ L+D+S +YE ETS ALGFG RCGFLGLLH+++I+ERL+REFN+ LI+TAPSV+Y++L+ DG + E+ + A +PD    + ++EP+ +A I+ PD++LG V++LCQ+ RG  +DL N    R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DYR+ DLVK+ IL+N   VDALS ++HR  A  R R +C KLK+ IP+H F+IP+QA IGGKIIARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKKR++  G V +P + F+  L
  S:    14 IRNFSIVAHIDHGKSTLADRLIQTTGTVALRDMSEQMLDSMDIEKERGITIKAQTVRLEYR-AEDGRDYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASEAVPISAKTGLNIEAVLEAIVKRLPAP-KGDREAPLKALLVDSWYDVYLGVVVLVRIIDGVLKKGMTIRMMGADAAYGVDRIGVFRPKMADIGELGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTQMLAGFKEVQAVVFCGLFPVDAADFESLRGAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLISTAPSVVYRLLMRDGELKELHNPADMPDPMKIETVEEPWIRATILTPDEYLGGVLKLCQDRRGIQIDL-NYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREGDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIARETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGRVEIPQEAFIAAL 602
>gi|170790877|gb|EDT31921.1| GTP-binding protein LepA [Oligotropha carboxidovorans OM5] (601 aa)
Score = 1740, Expect = 0.0e+00, Identities = 343/592 (57%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +RNFSIVAHIDHGKSTL+DR+I+ T  L  REMK Q+LDSMDIERERGITIK   V+L Y   KD +DY  +L+DTPGHVDF YEVSR LAACEGALLVVDASQGVEAQTL+NVY A++NNLEIVPV+NK+DLP+A+ D+VK+Q+ED IG+D S A +VSAKTG+ I  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V LVR+ +G +K G +IR M  N  + V  +GV TPK+VN + L  GEVG+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REFN+ LIATAPSVIYK+ L DG  +EI +   +PD     EI+EP+ +A I+ PDD+LG V++LCQ  RG   +L  V S R    Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 VRNFSIVAHIDHGKSTLADRLIQTTGGLQDREMKEQVLDSMDIERERGITIKAQTVRLRY-KAKDGKDYILNLMDTPGHVDFAYEVSRCLAACEGALLVVDASQGVEAQTLANVYQAIDNNLEIVPVLNKVDLPAAEPDQVKQQIEDVIGIDASEAIMVSAKTGIGIPDVLEAIVTRLPPP-KGDRDATLKALLVDSWYDVYLGVVVLVRVVDGVLKKGDRIRMMGTNAAYDVERVGVFTPKMVNVDELGPGEVGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFNLNLIATAPSVIYKMHLTDGQEIEIHNPIDMPDVVKIAEIEEPWIEATIMTPDDYLGAVLKLCQERRGTQKELTYVGS-RAMAKYELPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKAADLVKMQILVNNEPVDALSMLVHRSRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 597
>gi|126731515|ref|ZP_01747321.1| GTP-binding protein LepA [Sagittula stellata E-37] >gi|126708051|gb|EBA07111.1| GTP-binding protein LepA [Sagittula stellata E-37] (601 aa)
Score = 1739, Expect = 0.0e+00, Identities = 327/595 (54%), Positives = 444/595 (74%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +  IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LD+MDIERERGITIK N V++ Y   KD   Y  +LIDTPGHVDF YEVSRS+ ACEG+LLVVDASQGVEAQTL+NVY A++ + EIVPV+NK+DLP+A+ +RV +Q+ED IG+D SNA L+SAKTG+ I  ++EAI+ ++P P + D + PL+A++ DS+YD Y G V L+R+  G ++ G  IR M     + V  LGV  P + + + L  GE+G+   SIK ++   VGDTIT +   A T LPG+K  +P+V+CGL+P+D+  +E  ++A+EK+ L+D+S TYE ETS ALGFG RCGFLGLLH++VIR+RL+RE++I LI TAPSVIY + + DG  +++ + A +PD T    I+EP  KA I+VPDD+LG+V++LCQ+ RG  LDL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY+++ YR+  LVK+ IL+N   VDALS ++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRKKKLLE+QK GKK+++  G V +P + F+  L
  S:     5 QNLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKEQMLDAMDIERERGITIKANTVRIDY-PAKDGNTYVLNLIDTPGHVDFAYEVSRSMRACEGSLLVVDASQGVEAQTLANVYTAIDADHEIVPVLNKVDLPAAEPERVAEQIEDVIGIDASNACLISAKTGVGIPDVLEAIVTRLPAPPERDADAPLKAMLIDSWYDPYLGVVVLIRVMEGTIRKGDNIRMMKTGGKYGVDKLGVFRPAMQDVKELGPGEIGFFTGSIKQVRDTRVGDTITTEKKGAETPLPGFKPSIPVVFCGLFPVDANDFEDMRDAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVIRDRLEREYDIDLITTAPSVIYHLYMKDGEKIDLHNPADMPDMTKVDHIEEPRIKATILVPDDYLGDVLKLCQDRRGIQLDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLVGYREDALVKMQILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQEAFISAL 597
>gi|124515310|gb|EAY56820.1| Membrane GTPase LepA [Leptospirillum sp. Group II UBA] (609 aa)
Score = 1738, Expect = 0.0e+00, Identities = 325/592 (54%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEI--DSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR++E T ++T RE ++Q LD+MD+ERERGITIK + V+L+Y   +D QDY  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQT++N YLALEN++ ++PVINKIDLP ADI++ ++Q+E+ IGL    A L+SAK G+ +  ++EA++ ++PPP+ S   + L+AL+FDS++D ++GAV LVR+  G ++VG + R  S  +T  V  +   TPK V  E L  GEVG I + IK+++   +GDT+  +++PA  + PG+ +  PMV+CGL+P ++ QY+  KEALEK+ L+D+S T+E ETS ALGFG RCGFLGLLHM++I+ERL+REF++ LI+TAP+V+Y+V L  G   EI   + ++LP      E+ EPF    + +P ++LG VM LCQ  R    D+  +DS R  + Y +PL E++  F+D+LKS SKGYA+ DYE L YR  +LVKVD+++NG +VDALS I+H++ A  R+R +  KLKE IP+  FE+ +QA IG +IIARET+ AMRKNVLAKCYGGDITRK+KLLE+QKEGKKR+K IG V VP + F+ +L
  S:     8 IRNFCIIAHIDHGKSTLADRLLEMTGSVTARETRDQQLDAMDLERERGITIKAHTVRLVYR-ARDGQDYLLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTIANAYLALENDVHMIPVINKIDLPGADIEKTREQIEEAIGLPSEEALLISAKAGIGVEDVLEAVVSRVPPPV-SHPGRSLKALLFDSWFDPFQGAVILVRVFEGTIRVGDRFRLFSTGKTHEVLEISAQTPKKVLLEELGPGEVGIIVSGIKSVRETRIGDTLVLESDPAPEAFPGFHEAKPMVFCGLFPTETEQYDDLKEALEKLRLNDASFTFEMETSLALGFGFRCGFLGLLHMEIIQERLEREFHLTLISTAPTVVYRVRLLGGASEEILVVNPSELPPPNKIDEVFEPFILGTLFLPAEYLGPVMALCQEKRAVQKDMRYLDSRRVSIQYEMPLNEVVLDFYDRLKSISKGYASFDYEWLGYRPSNLVKVDVMVNGEQVDALSFIVHQDKAYTRARLLVEKLKEVIPRQMFEVALQAAIGSRIIARETIGAMRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKQIGRVEVPQEAFMAVL 599
>gi|114763051|ref|ZP_01442481.1| GTP-binding protein LepA [Roseovarius sp. HTCC2601] >gi|114544375|gb|EAU47383.1| GTP-binding protein LepA [Roseovarius sp. HTCC2601] (600 aa)
Score = 1738, Expect = 0.0e+00, Identities = 326/596 (54%), Positives = 447/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+M+ Q+LDSMDIERERGITIK N V++ Y   +D Q Y  +LIDTPGHVDF YEV+RS+ A EG+LLVVDA+QGVEAQTL+NVY A++ + EIVPV+NK+DLP+A+ DRVK+Q+ED IG+D  +A L+SAKTG+ I  ++EAI++++P P + D +KPL+A++ DS YD Y G +C+VRI +G +K G +IR M    T+ V  +GV  P + N + L  GE+G++ ASIK ++   VGDTIT +       LPG+K  +P+V+CGL+P+D+  +E  ++A+EK+ L+D+S T+E ETS ALGFG RCGFLGLLH++VIR+RL+RE+NI LI TAPSVIY +   DG   ++ + A +PD +    I+EP  KA I+VPD++LG+V++LCQ  RG  LDL  V   R    Y +PL E+++ F+D+LKS +KGYA+ DYE++ YR+ +LVK+ IL+N   VDAL+ ++HR+ A  R R +C KLKE IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD +RKKKLLE+QK GKK+++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMQEQLLDSMDIERERGITIKANTVRIEY-PAQDGQTYVLNLIDTPGHVDFAYEVARSMHAVEGSLLVVDATQGVEAQTLANVYTAIDADHEIVPVLNKVDLPAAEPDRVKEQIEDVIGIDSQDACLISAKTGVGIPDVLEAIVKRLPAPTEGDRDKPLKAMLVDSKYDQYLGVICIVRIIDGVLKKGDRIRMMKTGGTYDVDDVGVYRPAMTNVKELGPGEIGYLNASIKQVRDTRVGDTITHEKKQCAEPLPGFKPSVPVVFCGLFPVDANDFEDMRDAIEKLALNDASFTFEMETSAALGFGFRCGFLGLLHLEVIRDRLEREYNIELITTAPSVIYHLYTKDGERRDLHNPADMPDMSTVDHIEEPRIKATIMVPDEYLGDVLKLCQERRGLQLDLTYVGG-RAMTVYDLPLNEVVFDFYDRLKSVTKGYASFDYEMIGYREDNLVKMSILVNDEPVDALAMMVHRDRAEMRGRAMCEKLKELIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDASRKKKLLEKQKAGKKKMRQFGKVEIPQEAFISAL 596
>gi|157803497|ref|YP_001492046.1| GTP-binding protein LepA [Rickettsia canadensis str. McKiel] >gi|166224519|sp|A8EY28|LEPA_RICCK GTP-binding protein lepA >gi|157784760|gb|ABV73261.1| GTP-binding protein LepA [Rickettsia canadensis str. McKiel] (600 aa)
Score = 1738, Expect = 0.0e+00, Identities = 332/596 (55%), Positives = 445/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++KYIRNFSI+AHIDHGKSTL+DR+IE       REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+ENN EIVPV+NKIDLP+++ + VK+Q+ED IG+D S A L+SAK+G+ I+ ++EAI+ ++PPP +S D+  L+AL+ DS+YD Y G V LVRI +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G+  ASIK +    VGDTITD+  P   +LPG+K  LP+V+CG YP DS+++E  K++L K++L+DSS  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSVIYK+ + DG  LEI + A LP+    + I+EP+ KA IIVPD+FLG V+ LC   RG  LD   + + R ++ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+NG  VDALSTI+HR  A    R +C++LK+ IP  Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDITRK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     3 NQKYIRNFSIIAHIDHGKSTLADRLIEHCGGFQAREMSKQVLDSMDIEKERGITIKAQTVKLLY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYKAIENNHEIVPVLNKIDLPASEPEHVKQQIEDIIGIDASEALLISAKSGIGIDLVLEAIVNKLPPPKESSDDI-LKALLVDSWYDPYLGVVILVRIIDGALRKNMRIKMMATNSVYKVEHVGYFTPKKHIADVLYAGEIGFFTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGFYPTDSSEFEYLKDSLAKLHLNDSSFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVIYKIYMRDGESLEIYNPADLPNLQKIESIEEPWIKAIIIVPDEFLGAVLSLCTEKRGVQLDHSYI-ANRARIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYAPSELVKLGILVNGKAVDALSTIVHRSRAEQTGRALCVRLKDLIPIQQIDIVIQASIGSRIIARETIKALRKDVLSKCYGGDITRKRKLLEKQKIGKKRMRQYGNIEIPQSAFIAAL 595
>gi|163798276|ref|ZP_02192206.1| Elongation factor G, C-terminal:Elongation factor, GTP-binding:ATP/GTP-binding site motif A (P-loop):Ras [alpha proteobacterium BAL199] >gi|159176439|gb|EDP61024.1| Elongation factor G, C-terminal:Elongation factor, GTP-binding:ATP/GTP-binding site motif A (P-loop):Ras [alpha proteobacterium BAL199] (599 aa)
Score = 1738, Expect = 0.0e+00, Identities = 335/596 (56%), Positives = 447/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNF+I+AHIDHGKSTL+DR+I+    LT REMK Q+LDSMDIERERGITIK   V+LIY +  D + Y  +LIDTPGHVDF YEVSRSLAACEG++LVVDASQGVEAQTL+NVY A+E N EI+PV+NKIDLP+AD+ RVK+Q+ED IGLD S+A  +SAK+GL +  ++EAI++++PPP   D   P +A++ DS+YD Y G  CLVR+ +G +K G +++ M       V  +GV TPK +  EVL  GEVG++ A IK +    VGDTITD+   ATT+LPG++  + +V+CGL+P+D++ ++  +++LEK+ L+D+S ++E ETS ALGFG RCGFLGLLH+++++ERL+REF++ LI TAPSVIYK+ L DG  +E+ + A +PD    + I+EP+ KA I VPDD+LG V+ LC   RGE +DL    S R  V Y +PL E+++ F+D+LKS S+GYA+ DY++  YR+ DLVK+ I++N   VDALS I+HR  A  R R +C KLKE IP+  F+I IQA IGGK+IARETVSA+RK+V AKCYGGDITRKKKLLE+QKEGKKR++  G V +P   F+  L
  S:     3 DLSHIRNFAIIAHIDHGKSTLADRLIQMCGGLTNREMKEQVLDSMDIERERGITIKAQTVRLIY-DAADGKRYTLNLIDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYKAIEANHEIIPVLNKIDLPAADVARVKEQIEDVIGLDASDAIEISAKSGLGMEALLEAIVKRLPPP-KGDREAPTKAMMVDSWYDPYLGVTCLVRVHDGVLKKGQRVKMMQTGAVHPVERVGVLTPKGLEVEVLGPGEVGFLNAGIKTVADTKVGDTITDERRQATTALPGFQPSISVVFCGLFPVDASDFDHLRDSLEKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIVQERLEREFDLDLITTAPSVIYKIHLTDGRTIELHNPADMPDVMKIQSIEEPWIKATIFVPDDYLGAVLGLCTERRGEQVDLTYAGS-RAVVVYRLPLNEVVFDFYDRLKSISRGYASFDYQLDSYRESDLVKLSIMVNQEPVDALSMIVHRGQADPRGRTMCAKLKELIPRQLFKIAIQAAIGGKVIARETVSALRKDVTAKCYGGDITRKKKLLEKQKEGKKRMRQFGQVEIPQSAFIAAL 595
>gi|56751049|ref|YP_171750.1| GTP-binding protein LepA [Synechococcus elongatus PCC 6301] >gi|56686008|dbj|BAD79230.1| GTP-binding protein [Synechococcus elongatus PCC 6301] (637 aa)
Score = 1737, Expect = 0.0e+00, Identities = 329/592 (55%), Positives = 453/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  REMK Q LD+M++ERERGITIKL A ++ Y   +D + Y  +LIDTPGHVDF+YEVSRSL ACEGALLVVDASQGVEAQTL+NVYLALEN+LEI+PV NKIDLP AD +RVK+++E+ IGLDCS A   SAK+G+ I +I+E+I+  +PPP D+   +PL+AL+FDSYYD Y+G +   R+ +G V+ G +IR M++ + + +  LGV +P  V  E L AGEVG+IAASIK +    VGDTIT     AT  LPGY +  PMV+CGL+P DS +Y   ++ALEK+ LSD++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   DG +L +D+ +KLP     ++I+EP+ K EII P++++G +M+LCQ  RG ++D+  +   R  + Y +PLAE++  FFD++KS +KGYA+++Y ++ YR+ +LV++DIL+N   VD L+TI+HR+ A    + +  KLKE IP+HQF+IP+QA IG ++IA E++ A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:    42 IRNFCIIAHIDHGKSTLADRLLQETGTVQAREMKEQFLDNMELERERGITIKLQAARMNYR-AQDGEQYVLNLIDTPGHVDFSYEVSRSLQACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVPNKIDLPGADPERVKREIEEVIGLDCSGAIEASAKSGIGIGEILESIVHLVPPPSDTT-GEPLRALIFDSYYDPYRGVIVYFRVIDGTVRKGDRIRLMASGKEYEIDELGVLSPNQVQVEELHAGEVGYIAASIKAVADARVGDTITLARARATEPLPGYVEAKPMVFCGLFPTDSDRYPDLRDALEKLQLSDAALQYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVVYQVTTLDGEVLRLDNPSKLPPPQQREKIEEPYVKVEIITPENYVGALMDLCQTRRGIFIDMKYLTQERTTLIYEMPLAEVVTDFFDQMKSRTKGYASMEYSLIGYREGELVRMDILINSEPVDPLATIVHRDKAYYVGKALVEKLKELIPRHQFKIPLQAAIGSRVIASESIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKAIGTVDVPQEAFMAVL 631
>gi|168000252|ref|XP_001752830.1| predicted protein [Physcomitrella patens subsp. patens] >gi|162695993|gb|EDQ82334.1| predicted protein [Physcomitrella patens subsp. patens] (735 aa)
Score = 1737, Expect = 0.0e+00, Identities = 325/595 (54%), Positives = 450/595 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+D++++ T T+  REMK Q LD+MD+ERERGITIKL A ++ Y + +  + Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALE+NLEI+PV+NKIDLP AD +RV++++E+ IGLDCS A L SAK G+ I +I+ A++++IPPP D+   +PL+AL+FDSYYD+Y+G V   R+ +G+VK G  ++FM++   + V  +GV +P  +    L AGEVG+++ASIK++    VGDTIT  +  A  +LPGY+   PMV+CGL+PID+ Q+   +EALEK+ L+D++L +E ETS A+GFG RCGFLGLLHM++++ERL+RE+ + LI TAPSV+Y+V   DGTI E  + + LPD    K I+EP+ + E++ P D++G +MEL Q  RGE+ ++  +   R  + Y++PL E++  FFD+LKS SKGYA+++Y +  YR+  LVK+DI +N   VD L+ I+H++ A    R +  +LK+ IP+  F+IPIQA IG K+IA E ++AMRK+VLAKCYGGDI+RKKKLL++Q EGKKR+K++G V VP D F+ IL  E
  S:   139 IRNFSIIAHIDHGKSTLADKLLQTTGTVLAREMKEQFLDNMDLERERGITIKLQAARMRYVD-ETGEAYCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALESNLEIIPVLNKIDLPGADPERVRREIEEIIGLDCSEAILCSAKEGVGIPEILNAVVKKIPPPKDTA-AEPLRALIFDSYYDSYRGVVVYFRVMDGRVKKGDYVQFMNSKTEYQVDEVGVLSPIQMPVNELYAGEVGYLSASIKSVADARVGDTITTVSRKAAQALPGYQLATPMVFCGLFPIDADQFVELREALEKLQLNDAALQFEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYGLDLITTAPSVVYRVHCTDGTITECSNPSALPDAGKRKSIEEPYVRIELLTPKDYIGPLMELAQERRGEFKEMKFITENRASLVYMLPLGEMVGDFFDQLKSRSKGYASMEYSVKGYRESKLVKLDIRINDEAVDPLAVIVHQDKAYSVGRALTQQLKKLIPRQLFKIPIQACIGSKVIASENIAAMRKDVLAKCYGGDISRKKKLLKKQAEGKKRMKSLGRVDVPQDAFMAILRLE 731
>gi|157344893|emb|CAO71621.1| unnamed protein product [Vitis vinifera] (603 aa)
Score = 1735, Expect = 0.0e+00, Identities = 321/595 (53%), Positives = 453/595 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNF I+AHIDHGKSTL+D++++ T T+  REMK Q LD+MD+ERERGITIKL A ++ Y    +N+ Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+  RV +++E+ +GLDCS+A   SAK G+ I +I+ AI+++IPPP D+ + +PL+AL+FDSYYD Y+G +   R+ +G +K G +I FM++ + +    +GV +P  +  + L AGEVG++AASI+++    VGDTIT     A  SLPGY++  PMV+CGL+P+D+ ++   ++ALEK+ L+D++L +E ETS A+GFG RCGFLGLLHM++I+ERL+RE+N+ LI TAPSV+Y+V   +G  +E  + + LP+      I+EP+ K E++ P D++G +MEL Q+ RGE+ ++  +   R  +TY +PLAE++  FFD+LKS SKGYA+++Y  L Y++ +L+K+DI +NG +V+ L+TI+H++ A    R +  KLKE IP+  F++PIQA IG K+IA E++SA+RK+VL+KCYGGDITRKKKLL++Q EGKKR+KAIG V VP + F+ +L  E
  S:     8 IRNFCIIAHIDHGKSTLADKLLQMTGTVQKREMKEQFLDNMDLERERGITIKLQAARMRY--VFENEPYCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPVRVSQEIEEVVGLDCSDAIHCSAKEGIGITEILNAIVKRIPPPCDTAE-RPLRALIFDSYYDPYRGVIVYFRVIDGTIKKGDRIYFMASKKDYFADEIGVLSPNQLQADELYAGEVGYLAASIRSVADARVGDTITHYGRKAENSLPGYEEATPMVFCGLFPVDADKFPDLRDALEKLQLNDAALKFEPETSSAMGFGFRCGFLGLLHMEIIQERLEREYNLTLITTAPSVVYRVNCINGDTVECSNPSLLPEPGKRTSIEEPYVKIEMLTPKDYIGPLMELAQDRRGEFKEMKFITENRASITYELPLAEMVGDFFDQLKSRSKGYASMEYSFLGYKESELIKLDIQINGERVEPLATIVHKDKAYAVGRALTQKLKELIPRQMFKVPIQACIGAKVIASESLSAIRKDVLSKCYGGDITRKKKLLKKQAEGKKRMKAIGKVDVPQEAFMAVLKLE 599
>gi|67459392|ref|YP_247016.1| GTP-binding protein LepA [Rickettsia felis URRWXCal2] >gi|75536188|sp|Q4UKS2|LEPA_RICFE GTP-binding protein lepA >gi|67004925|gb|AAY61851.1| GTP-binding protein LepA [Rickettsia felis URRWXCal2] (600 aa)
Score = 1735, Expect = 0.0e+00, Identities = 328/596 (55%), Positives = 447/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+EN+ EIVPV+NKIDLP+++ ++VK+Q++D IG+D S A L+SAK+G+ I+ ++EAI+ ++PPP +S  +  L+AL+ DS+YD Y G V LVRI +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G+  ASIK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS ++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSV+YK+ + DG  LEI + A L D    + ++EP+ KA I+VPD+FLG V+ LC   RG  LD   + + R K+ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+NG +VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     3 NQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVPVLNKIDLPASEPEQVKQQIKDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPPKESSSDI-LKALLVDSWYDPYLGVVILVRIIDGTLRKNIRIKMMATNSVYTVENVGYFTPKKHISDVLHAGEIGFFTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRDGESLEIHNPADLSDLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGVQLDHSYI-ANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELVKLGILVNGEEVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 595
>gi|172039631|ref|YP_001806132.1| GTP-binding protein [Cyanothece sp. ATCC 51142] >gi|171701085|gb|ACB54066.1| GTP-binding protein [Cyanothece sp. ATCC 51142] (603 aa)
Score = 1732, Expect = 0.0e+00, Identities = 323/592 (54%), Positives = 456/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y + KD +DY  +LIDTPGHVDF+YEVSRSLAACEGALLVVD+SQGVEAQTL+NVYLALENNLEI+P++NKIDLP ++ +RV  ++E+ +GLDC+     SAK G+ +++I+E+I+  +PPP D+ D KPL+AL+FDSYYD Y+G +   R+ +G VK G ++R M++ + + +  LGV +P  +  E L AGEVG+ AA+IK ++   VGDTIT    PA   LPGY +  PMV+CGL+P D+ QYE  +EAL ++ L+D++L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSVIY+V   DG ++++D+ + LP     ++++EP+ + E+I P+ ++G +MELCQ+ RG + D+     +R  + Y +PLAE++  FFD+LKS S+GYA+++Y+++ YR+  LVK+DIL+NG+ VDAL+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:     9 IRNFCIIAHIDHGKSTLADRMLQMTETVAQRKMKEQFLDNMDLERERGITIKLQAARMNYRS-KDGEDYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDSSQGVEAQTLANVYLALENNLEIIPILNKIDLPGSEPERVANEIEEVVGLDCTGIIKASAKAGIGVDEILESIVHLVPPPSDTVD-KPLRALIFDSYYDPYRGVIVYFRVMDGTVKTGDRVRLMASGKEYEIDELGVLSPNQIEVESLHAGEVGYFAAAIKAVEDARVGDTITLAEAPAKEPLPGYTEAKPMVFCGLFPTDADQYEDLREALNRLKLNDAALSYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYDLDLITTAPSVIYRVTTIDGEVIQVDNPSLLPSPQEREKVEEPYIEVEMITPETYVGTLMELCQSRRGVFKDMRYFTLSRTSLVYELPLAEVVTDFFDQLKSRSRGYASMEYQLIGYRENPLVKLDILVNGDSVDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKAIGTVDVPQEAFMAVL 598
>gi|81299290|ref|YP_399498.1| GTP-binding protein LepA [Synechococcus elongatus PCC 7942] >gi|119371409|sp|Q31R08|LEPA_SYNP7 GTP-binding protein lepA >gi|81168171|gb|ABB56511.1| GTP-binding protein LepA [Synechococcus elongatus PCC 7942] (604 aa)
Score = 1729, Expect = 0.0e+00, Identities = 329/592 (55%), Positives = 454/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  REMK Q LD+M++ERERGITIKL A ++ Y   +D + Y  +LIDTPGHVDF+YEVSRSL ACEGALLVVDASQGVEAQTL+NVYLALEN+LEI+PV+NKIDLP AD +RVK+++E+ IGLDCS A   SAK+G+ I +I+E+I+  +PPP D+   +PL+AL+FDSYYD Y+G +   R+ +G V+ G +IR M++ + + +  LGV +P  V  E L AGEVG+IAASIK +    VGDTIT     AT  LPGY +  PMV+CGL+P DS +Y   ++ALEK+ LSD++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   DG +L +D+ +KLP     ++I+EP+ K EII P++++G +M+LCQ  RG ++D+  +   R  + Y +PLAE++  FFD++KS +KGYA+++Y ++ YR+ +LV++DIL+N   VD L+TI+HR+ A    + +  KLKE IP+HQF+IP+QA IG ++IA E++ A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:     9 IRNFCIIAHIDHGKSTLADRLLQETGTVQAREMKEQFLDNMELERERGITIKLQAARMNYR-AQDGEQYVLNLIDTPGHVDFSYEVSRSLQACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPGADPERVKREIEEVIGLDCSGAIEASAKSGIGIGEILESIVHLVPPPSDTT-GEPLRALIFDSYYDPYRGVIVYFRVIDGTVRKGDRIRLMASGKEYEIDELGVLSPNQVQVEELHAGEVGYIAASIKAVADARVGDTITLARARATEPLPGYVEAKPMVFCGLFPTDSDRYPDLRDALEKLQLSDAALQYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVVYQVTTLDGEVLRVDNPSKLPPPQQREKIEEPYVKVEIITPENYVGALMDLCQTRRGIFIDMKYLTQERTTLIYEMPLAEVVTDFFDQMKSRTKGYASMEYSLIGYREGELVRMDILINSEPVDPLATIVHRDKAYYVGKALVEKLKELIPRHQFKIPLQAAIGSRVIASESIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKAIGTVDVPQEAFMAVL 598
>gi|157828247|ref|YP_001494489.1| GTP-binding protein LepA [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165932948|ref|YP_001649737.1| GTP-binding protein LepA [Rickettsia rickettsii str. Iowa] >gi|166224520|sp|A8GRF6|LEPA_RICRS GTP-binding protein lepA >gi|189046451|sp|B0BWV5|LEPA_RICRO GTP-binding protein lepA >gi|157800728|gb|ABV75981.1| GTP-binding protein LepA [Rickettsia rickettsii str. 'Sheila Smith'] >gi|165908035|gb|ABY72331.1| GTP-binding protein [Rickettsia rickettsii str. Iowa] (600 aa)
Score = 1729, Expect = 0.0e+00, Identities = 326/595 (54%), Positives = 445/595 (74%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+EN+ EIV V+NK+DLP+++ ++VK+Q+ED IG+D S A L+SAK+G+ I+ ++EAI+ ++PPP +S  +  L+AL+ DS+YD Y G V LVR+ +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G+  A+IK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS+++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REFN+ LI TAPSV+YK+ + DG  LEI + A LPD    + ++EP+ KA I+VPD+FLG V+ LC   RG  LD   + + R K+ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+N   VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     4 QKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVLISAKSGIGIDLVLEAIVSKLPPPKESSSDI-LKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFTPKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPQLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFNLDLITTAPSVVYKIHMRDGENLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGMQLDHSYI-ANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELVKLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 595
>gi|114331758|ref|YP_747980.1| GTP-binding protein LepA [Nitrosomonas eutropha C91] >gi|122313491|sp|Q0AF67|LEPA_NITEC GTP-binding protein lepA >gi|114308772|gb|ABI60015.1| GTP-binding protein LepA [Nitrosomonas eutropha C91] (598 aa)
Score = 1729, Expect = 0.0e+00, Identities = 325/594 (54%), Positives = 454/594 (76%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++IRNFSI+AHIDHGKSTL+DRII+F   L+ REM+ Q+LDSMD+ERERGITIK     L Y+  KD  +Y  +LIDTPGHVDF+YEVSRSL+ACEGALLVVDASQGVEAQT++N Y A+E  +E++PV+NKIDLP+AD DRV  ++ED IG++  +A  +SAKTG  I++++E I+ +IPPP + + + PL+AL+ DS++D+Y G V LVR+ +G +K G+K+  MSN   ++   +GV  PK VN+E L AGEVG+I + IK++KS  VGDT+T   +PA+  L G+K+I P V+ GLYP++S QY+  + ALEK+ L+D+SL +E ETSQALGFG RCGFLGLLH+D+++ERL+RE+++ LI TAP+V+Y+V+L+DG I+EI++ ++LP+ +  +EI+EP   A I+VP++++G V+ LC   RG   ++  +   +  + Y +PL E++  FFDKLKS S+GYA+LDYE  ++R  DLVK+DIL+N  +VDALS I+HR  +  R R++  K++E IP+  F+I +QA IG  I+ARE V A+RKNVLAKCYGGDITRK+KLLE+QK GKKR+K +GNV +P   F+ IL
  S:     3 QHIRNFSIIAHIDHGKSTLADRIIQFCGGLSDREMEAQVLDSMDLERERGITIKAQTAAL-YYQAKDGVNYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIEQGVEVIPVLNKIDLPAADPDRVIAEIEDIIGIEARSALHISAKTGEGISEVLEMIVARIPPP-EGEIDAPLRALIIDSWFDSYVGVVMLVRVMDGILKPGSKLLLMSNKANYLCEEVGVFQPKAVNRESLSAGEVGFIISGIKDLKSAKVGDTVTLVDHPASEPLDGFKEIKPQVFAGLYPVESNQYDALRAALEKLRLNDASLHFEPETSQALGFGFRCGFLGLLHLDIVQERLEREYDMDLITTAPTVVYQVVLHDGKIVEIENPSRLPELSSIEEIREPVITATILVPEEYVGAVITLCTGKRGVQENMQYM-GRQVMLVYELPLNEVVMDFFDKLKSVSRGYASLDYEFKEFRVADLVKLDILINNERVDALSLIVHRASSQQRGRELAQKMRELIPRQMFDIAVQAAIGAHIVARENVKALRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKRVGNVEIPQAAFLAIL 593
>gi|148284680|ref|YP_001248770.1| GTP-binding protein LepA [Orientia tsutsugamushi str. Boryong] >gi|166224504|sp|A5CE57|LEPA_ORITB GTP-binding protein lepA >gi|146740119|emb|CAM80294.1| hypothetical protein [Orientia tsutsugamushi Boryong] (601 aa)
Score = 1728, Expect = 0.0e+00, Identities = 323/592 (54%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF+I+AHIDHGKSTL+DR+IE+ N L  REM  Q+LDSMDIE+ERGITIK   V+L+Y    D   Y+ +L+DTPGHVDF YEVSRSLAACE +LLVVDASQGVEAQTL+N+Y A++NN +I+ V+NKIDLP+A+  +V++Q+ED IG+D S+A ++SAK GL I  +++AI+ ++P P + D    L+AL+ DS+YD+Y G V LVR+ +G+++ G +IR  SNN  + V  +G  +PK     VL  GE+G++ A+IK +    VGDTITDD  P    LPG+K  LP+V+CGLYP D++Q+   K++L+K+ L+D+S  +E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ +I TAPSV+YKV LN G ++++ + A LP+    K + EP+ +A I +PD +LG ++ LC   RG  +DL  V+  R K+ YL+PL EI++ F+DKLKS SKGYA+ D++I  Y++ DL+K+ IL+NGN VDALSTI+HR  A  R R++C +LK+ IP H F+I IQA IG +IIARET+ A+RK+VLAKCYGGDITRK+KLLE+QK GKKR++ IGNV +P   F+  L
  S:     7 IRNFAIIAHIDHGKSTLADRLIEYCNALEAREMCQQVLDSMDIEKERGITIKAQTVRLVY-KADDGCVYHLNLMDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANLYQAVDNNHKILIVLNKIDLPAANPQQVQQQIEDVIGIDASDALMISAKIGLGIKDVLQAIVTKLPSP-NGDSQSQLKALLIDSWYDSYLGVVILVRVVDGKIEKGMRIRMCSNNAVYTVENVGFFSPKKQISGVLYTGEIGFVTAAIKQVADCRVGDTITDDKKPCAQILPGFKPNLPVVFCGLYPSDASQFNHLKDSLQKLRLNDASFEFEQESSGALGFGFRCGFLGLLHLEIIQERLEREFDLDMITTAPSVMYKVYLNTGKVIDVHNPADLPEMQKIKSMSEPWVEATIFIPDQYLGAILGLCTEKRGVQVDLTYVNG-RAKLVYLLPLNEIVFDFYDKLKSYSKGYASFDWQIDSYKQSDLIKLSILVNGNPVDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIARETIRALRKDVLAKCYGGDITRKRKLLEKQKAGKKRMRNIGNVEIPQSAFIAAL 595
>gi|84687496|ref|ZP_01015373.1| GTP-binding protein LepA [Rhodobacterales bacterium HTCC2654] >gi|84664521|gb|EAQ11008.1| GTP-binding protein LepA [Rhodobacterales bacterium HTCC2654] (599 aa)
Score = 1727, Expect = 0.0e+00, Identities = 327/596 (54%), Positives = 445/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ TNT+  R+MK Q+LD+MDIERERGITIK N V++ Y +  D Q Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV NKIDLP++DI RV +QVED IG+D S A  VSAKTG  I +++EAI+ ++P P   D + PL+A++ DS+YD Y G V LVR+ +G++K   ++ FM N     +  +GV  PK+ + + L  GE+G+I ASIK ++   VGDTIT +       LPG+   +P+V+CGL+P+DS ++E  ++A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++V+R+RL+RE++I LI TAPSV+Y + + DGT+ E+ + A +PD T    ++EP  KA I+VPD+FLG+V++LCQ+ RG  LDL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY I  YR+ +LVK+ IL+N   VDALS ++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRKKKLLE+QK GKK+++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQATNTVPDRDMKEQLLDAMDIERERGITIKANTVRIEY-DALDGQSYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDADHEIVPVFNKIDLPASDISRVAEQVEDVIGIDASGAIAVSAKTGEGIREVLEAIVHRLPAP-TGDADAPLKAMLVDSWYDPYLGVVVLVRVMDGKMKKNDRVMFMQNGTVHQIDKIGVFRPKMQDVKELGPGEIGFITASIKQVRDTKVGDTITHEKKGCEKPLPGFNPSIPVVFCGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVVRDRLEREYDIELITTAPSVVYNIYMKDGTMQELHNPADMPDLTYVDHVEEPRIKATIMVPDEFLGDVLKLCQDRRGIQLDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYSIEGYRQDNLVKMQILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQEAFISAL 595
>gi|99080519|ref|YP_612673.1| GTP-binding protein LepA [Silicibacter sp. TM1040] >gi|119371396|sp|Q1GIV5|LEPA_SILST GTP-binding protein lepA >gi|99036799|gb|ABF63411.1| GTP-binding protein LepA [Silicibacter sp. TM1040] (599 aa)
Score = 1727, Expect = 0.0e+00, Identities = 324/592 (54%), Positives = 450/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LD+MDIERERGITIK N V++ Y    D + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP+AD DRV +Q+ED IG+D ++A  VSAKTG+ I   +EAI++++P P   + N PL+A++ DS+YDAY G + LVRI +G +K G +I+ M  N  + V  +GV  P +   + L  GE+G+I ASIK ++   VGDTIT D   A T+LPG+K  +P+V+CGL+P+DS+++E  ++A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE+NI LI TAPSV+Y + + DG +LE+ + A +PD +    ++EP  KA I+VPD++LG+V++LCQ+ RG   DL +   +R  V Y +PL E+++ F+D+LKS +KGYA+ DY+++ YR  +LVK+ +L+N   VDALST++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRK+KLLE+QK GKK+++  G V +P + F+  L
  S:     7 IRNFSIVAHIDHGKSTLADRLIQSTGTVQDRDMKEQLLDAMDIERERGITIKANTVRIDYE-ADDGERYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDADHEIVPVLNKIDLPAADCDRVAEQIEDVIGIDATDAIRVSAKTGIGIKDTLEAIVKRLPAP-TGERNAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGDQIKMMQTNARYGVDRIGVFRPAMQVVDELGPGEIGFITASIKQVRDTKVGDTITHDKKGAETALPGFKPSVPVVFCGLFPVDSSEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYNIELITTAPSVVYHIFMKDGEMLELHNPADMPDLSKVDHLEEPRIKATILVPDEYLGDVLKLCQDRRGIQQDL-SYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYRADNLVKMSVLVNDEPVDALSTMVHRDRAEQRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGRVEIPQEAFISAL 595
>gi|189183641|ref|YP_001937426.1| GTP-binding protein LepA [Orientia tsutsugamushi str. Ikeda] >gi|189180412|dbj|BAG40192.1| GTP-binding protein LepA [Orientia tsutsugamushi str. Ikeda] (601 aa)
Score = 1727, Expect = 0.0e+00, Identities = 322/592 (54%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF+I+AHIDHGKSTL+DR+IE+ N L  REM  Q+LDSMDIE+ERGITIK   V+L+Y    D   Y+ +L+DTPGHVDF YEVSRSLAACE +LLVVDASQGVEAQTL+N+Y A++NN +I+ V+NKIDLP+A+  +V++Q+ED IG+D S+A ++SAK GL I  +++AI+ ++P P + D    L+AL+ DS+YD+Y G V LVR+ +G+++ G +IR  SNN  + V  +G  +PK     VL  GE+G++ A+IK +    VGDTITDD  P    LPG+K  LP+V+CGLYP D++Q+   K++L+K+ L+D+S  +E E+S ALGFG RCGFLGLLH+++I+ERL+REF++ +I TAPSV+YKV LN G ++++ + A LP+    K + EP+ +A I +PD +LG ++ LC   RG  +DL  V+  R K+ YL+PL EI++ F+DKLKS SKGYA+ D+++  Y++ DL+K+ IL+NGN VDALSTI+HR  A  R R++C +LK+ IP H F+I IQA IG +IIARET+ A+RK+VLAKCYGGDITRK+KLLE+QK GKKR++ IGNV +P   F+  L
  S:     7 IRNFAIIAHIDHGKSTLADRLIEYCNALEAREMCQQVLDSMDIEKERGITIKAQTVRLVY-KADDGCVYHLNLMDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANLYQAVDNNHKILIVLNKIDLPAANPQQVQQQIEDVIGIDASDALMISAKIGLGIKDVLQAIVTKLPSP-NGDSQSQLKALLIDSWYDSYLGVVILVRVVDGKIEKGMRIRMCSNNAVYTVENVGFFSPKKQISGVLYTGEIGFVTAAIKQVADCRVGDTITDDKKPCAQILPGFKPNLPVVFCGLYPSDASQFNHLKDSLQKLRLNDASFEFEQESSGALGFGFRCGFLGLLHLEIIQERLEREFDLDMITTAPSVMYKVYLNTGKVIDVHNPADLPEMQKIKSMSEPWVEATIFIPDQYLGAILGLCTEKRGVQVDLTYVNG-RAKLVYLLPLNEIVFDFYDKLKSYSKGYASFDWQMNSYKQSDLIKLSILVNGNPVDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIARETIRALRKDVLAKCYGGDITRKRKLLEKQKAGKKRMRNIGNVEIPQSAFIAAL 595
>gi|95929131|ref|ZP_01311875.1| Small GTP-binding protein domain [Desulfuromonas acetoxidans DSM 684] >gi|95134629|gb|EAT16284.1| Small GTP-binding protein domain [Desulfuromonas acetoxidans DSM 684] (599 aa)
Score = 1727, Expect = 0.0e+00, Identities = 329/597 (55%), Positives = 457/597 (76%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M++K IRNFSI+AHIDHGKSTL+DR++E T T++ RE  +Q LD MD+ERERGITIK  AV L Y    + +DY  +LIDTPGHVDF+YEVSRSL ACEGALLVVDASQGVEAQTL+NVYLAL+ +LEI PV+NK+DLP A+ +RVK+++ED IGLD S+A + SAK G+ I+ I+E +++Q+P P   D + PL+AL+FDS+YD+Y+G V +VRI +G++K G KI  M++  ++ V  +GV +P  V +  L AGEVG++ A IK ++   VGDTIT     A  +LPG++++ PMV+ GLYPID+++Y+L ++ALEK+ L+D+S++YE E S ALGFG RCGFLGLLHM++I+ERL+REFNI LI TAP+V+Y+V      ++ +DSA KLP+      I+EPF  A I VP++F+G+++ LC+  RG   ++  +  TR  + Y +PL EI+  F+D+LKS S+GYA+LDYE LDYR   LV++++++NG+ VDALS I+H++ A  R R++  K+KE IP+ Q+ + IQA +GGKIIARETV A+RK+V AKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P + F+ IL
  S:     1 MNQKNIRNFSIIAHIDHGKSTLADRLLEDTGTVSDREKTDQFLDKMDLERERGITIKAQAVCLKYR-ADNGEDYTLNLIDTPGHVDFSYEVSRSLTACEGALLVVDASQGVEAQTLANVYLALDEDLEIFPVLNKVDLPGAEPERVKEEIEDIIGLDTSDAIVASAKEGIGIHDILERVVQQVPAP-QGDVDAPLKALIFDSWYDSYQGVVVMVRIVDGEIKKGDKIYLMASKGSYEVLKVGVFSPGAVPQSSLKAGEVGFVVAGIKVVQDAKVGDTITHFHKRADNALPGFQEVKPMVFSGLYPIDTSEYDLLRDALEKLQLNDASISYEPENSVALGFGFRCGFLGLLHMEIIQERLEREFNIDLITTAPTVVYQVTTVKNELIHVDSANKLPEVQYIDRIEEPFILASIHVPNEFVGSILALCEEKRGIQREIKYLTETRVMIVYELPLNEIVMDFYDRLKSISRGYASLDYEPLDYRPSKLVRMNVMINGDTVDALSLIVHQDKAQARGRELVSKMKEFIPRQQYVVAIQAAVGGKIIARETVKALRKDVTAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVELPQEAFLAIL 595
>gi|119371353|sp|Q39US7|LEPA_GEOMG GTP-binding protein lepA (599 aa)
Score = 1726, Expect = 0.0e+00, Identities = 330/600 (55%), Positives = 447/600 (74%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           M  + IRNFSI+AHIDHGKSTL+DR++E+T  L+ RE ++Q LD MD+ERERGITIK   V+L Y    D +DY  +LIDTPGHVDFTYEVSRSLAACEG LLVVDASQGVEAQTL+NVYLA++NNLE+ PV+NKIDLP+A+ +RVK ++E+ IGLD  +A L SAK G+   +I+E I+++IPPP + D   PL+AL+FDS+YD Y+G + L R+ +G +K G KI+ +S   ++    +GV  P +     L AGEVG++ A IK++    +GDT+T    P TT L G+K++ PMV+ GLYPID++QYE  ++AL K+ L+DSS +YE ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ LI TAP+V+Y+V    G ++ I+SA +LP       ++EPF  A I  P++F+G ++ LC+  RG   ++  +  TR  + Y +PL E++  F+D+LKS +KGYA+LDYE LDYR+ +LV+++I++NG  VDALS I+HR+ A  R R +  K+KE IP+  FE+ IQA IG K+IARETV A+RK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL  E
  S:     1 MKIENIRNFSIIAHIDHGKSTLADRLLEYTGALSERERQDQFLDKMDLERERGITIKAQTVRLNYR-ADDGKDYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLAIDNNLEVFPVLNKIDLPAAEPERVKHEIEEIIGLDAHDAVLASAKEGIGTREILEEIVKKIPPP-EGDPAAPLKALLFDSWYDQYQGVIILARLIDGILKKGDKIQLVSTGRSYEALKVGVFAPVMREVPQLSAGEVGFVIAGIKDVADAKIGDTVTHTLKPCTTPLGGFKEVKPMVFSGLYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLEREFNLDLITTAPTVVYRVHRIKGDMISIESANQLPPTQEIDYVEEPFILASIHTPNEFVGGILALCEEKRGVQREIKYLTPTRVMIIYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRRSELVRMNIMINGEVVDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGAKVIARETVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598
>gi|78222975|ref|YP_384722.1| GTP-binding protein LepA [Geobacter metallireducens GS-15] >gi|78194230|gb|ABB31997.1| GTP-binding protein LepA [Geobacter metallireducens GS-15] (629 aa)
Score = 1726, Expect = 0.0e+00, Identities = 330/600 (55%), Positives = 447/600 (74%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           M  + IRNFSI+AHIDHGKSTL+DR++E+T  L+ RE ++Q LD MD+ERERGITIK   V+L Y    D +DY  +LIDTPGHVDFTYEVSRSLAACEG LLVVDASQGVEAQTL+NVYLA++NNLE+ PV+NKIDLP+A+ +RVK ++E+ IGLD  +A L SAK G+   +I+E I+++IPPP + D   PL+AL+FDS+YD Y+G + L R+ +G +K G KI+ +S   ++    +GV  P +     L AGEVG++ A IK++    +GDT+T    P TT L G+K++ PMV+ GLYPID++QYE  ++AL K+ L+DSS +YE ETS ALGFG RCGFLGLLHM++I+ERL+REFN+ LI TAP+V+Y+V    G ++ I+SA +LP       ++EPF  A I  P++F+G ++ LC+  RG   ++  +  TR  + Y +PL E++  F+D+LKS +KGYA+LDYE LDYR+ +LV+++I++NG  VDALS I+HR+ A  R R +  K+KE IP+  FE+ IQA IG K+IARETV A+RK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL  E
  S:    31 MKIENIRNFSIIAHIDHGKSTLADRLLEYTGALSERERQDQFLDKMDLERERGITIKAQTVRLNYR-ADDGKDYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLAIDNNLEVFPVLNKIDLPAAEPERVKHEIEEIIGLDAHDAVLASAKEGIGTREILEEIVKKIPPP-EGDPAAPLKALLFDSWYDQYQGVIILARLIDGILKKGDKIQLVSTGRSYEALKVGVFAPVMREVPQLSAGEVGFVIAGIKDVADAKIGDTVTHTLKPCTTPLGGFKEVKPMVFSGLYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLEREFNLDLITTAPTVVYRVHRIKGDMISIESANQLPPTQEIDYVEEPFILASIHTPNEFVGGILALCEEKRGVQREIKYLTPTRVMIIYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRRSELVRMNIMINGEVVDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGAKVIARETVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 628
>gi|84702096|ref|ZP_01016671.1| GTP-binding protein LepA [Parvularcula bermudensis HTCC2503] >gi|84691342|gb|EAQ17182.1| GTP-binding protein LepA [Parvularcula bermudensis HTCC2503] (599 aa)
Score = 1726, Expect = 0.0e+00, Identities = 331/596 (55%), Positives = 442/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ T  L+ REMK Q+LD+M++ERERGITIK   V L Y   ++ + Y  +LIDTPGHVDF YEV+RSLAA EG+LLVVDASQGVEAQTL+NVY A+E + EIVPV+NKIDLP+A+ +R+K+Q+ED IGLD S A L+SAKTGL I  ++EAI+ ++PPP + D    L+A++ DS+YD Y G V LVR+ +G +K G +IR M+   T+ V  +G  TP     E L  GE+G+I ASIK +   +VGDTITD+  PA T+LPG++   P+V+CGL+P+DS ++E  ++A+ K+ L+D+S  +E ETS ALGFG RCGFLGLLH+++IRERL+REFNI LI TAPSV+Y +   DG + E+ + A +PD      I+EP+ KA I+VPDD+LG V++LC+  RG   DL      R  V Y +PL E+++ F+D+LKS +KGYA+ DY+I+ YR+ DLV++ IL+N   VDAL+ I+HR  A  R R +C KLKE IP+H F+IPIQA IGG++IARET+ AMRK+V AKCYGGD TRK+KLLE+QK GKK+++  G V +P D F+  L
  S:     3 DLSHIRNFSIVAHIDHGKSTLADRLIQVTGGLSDREMKEQVLDNMELERERGITIKAQTVSLSY-TARNGKTYQLNLIDTPGHVDFAYEVNRSLAAVEGSLLVVDASQGVEAQTLANVYQAIEVDHEIVPVLNKIDLPAAEPERIKEQIEDVIGLDASEAVLISAKTGLGIEDVLEAIVNRLPPP-EGDREAALKAMLVDSWYDPYLGVVVLVRVVDGSLKKGQRIRMMAAKATYTVDNVGKFTPHRQMVETLGPGEIGFITASIKEVADTNVGDTITDEKRPAETALPGFRPSQPVVFCGLFPVDSAEFEDLRDAIGKLRLNDASFEFEMETSAALGFGFRCGFLGLLHLEIIRERLEREFNIDLITTAPSVVYHMYRTDGEMEELHNPADMPDPVHIDHIEEPWIKATILVPDDYLGAVLKLCEERRGIQQDLTYA-GNRAMVVYELPLNEVVFDFYDRLKSITKGYASFDYQIIGYRQDDLVRMQILVNEEPVDALAIIVHRSKAEARGRVMCEKLKELIPRHLFKIPIQAAIGGRVIARETIGAMRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGRVEIPQDAFINAL 595
>gi|157825494|ref|YP_001493214.1| GTP-binding protein LepA [Rickettsia akari str. Hartford] >gi|166224517|sp|A8GMT1|LEPA_RICAH GTP-binding protein lepA >gi|157799452|gb|ABV74706.1| GTP-binding protein LepA [Rickettsia akari str. Hartford] (600 aa)
Score = 1726, Expect = 0.0e+00, Identities = 326/596 (54%), Positives = 448/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM+ Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+E++ EIVPV+NKIDLP+++ ++VK+Q+ED IG+D S A L+SAK+G+ I+ ++EAI+ ++ PP +S  +  L+AL+ DS+YD Y G V LVRI +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G++ ASIK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS+++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSV+YK+ +  G  LEI + A LPD    + ++EP+ KA I+VPD+FLG V+ LC   RG  LD   + + R K+ Y +PL EI+Y F+D+LKSCSKGYA+ +++I  Y   +LVK+ IL+NG  +DALSTI+HR  A  R + +C++LK+ IP+ Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     3 NQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMRTQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEHDHEIVPVLNKIDLPASEPEQVKQQIEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLHPPKESSTDI-LKALLVDSWYDPYLGVVILVRIIDGTLRKNMRIKMMATNSVYTVENVGFFTPKKHISDVLYAGEIGFVTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRYGESLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGVQLDHSYI-ANRAKIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQIDVYEPSELVKLGILVNGEVIDALSTIVHRSRAEQRGKVLCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 595
>gi|163732729|ref|ZP_02140174.1| GTP-binding protein LepA [Roseobacter litoralis Och 149] >gi|161394089|gb|EDQ18413.1| GTP-binding protein LepA [Roseobacter litoralis Och 149] (599 aa)
Score = 1726, Expect = 0.0e+00, Identities = 325/593 (54%), Positives = 449/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ TNT+  R+MK Q+LDSMDIERERGITIK   V++ Y   ++ ++Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP++D DRV +Q+ED IG+D S A  VSAKTG  I + +E+I++ +P P  + D  PL+A++ DS+YD+Y G + LVRI +G +K G +IR +SNN T  V  +GV  P +   + L  GE+G++ ASIK ++   VGDTIT +    T +LPG+K   P+V+CGL+P+DS+++E  ++++EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY V + DG+++E+ + A +PD TL   ++EP  KA I+VPDD+LG+V++LCQ+ RG   DL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY ++ YR   LVK+ IL+N   VDALST++HR+ A  R R +  KLK+ IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P + F+  L
  S:     6 HIRNFSIVAHIDHGKSTLADRLIQSTNTVADRDMKEQMLDSMDIERERGITIKAQTVRINY-TAQNGEEYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYHAIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIQVSAKTGQGIMETLESIVQNLPAPKGTRD-APLKAMLVDSWYDSYLGVIVLVRIMDGVLKKGDRIRMLSNNSTHGVDRIGVFRPAMTEIDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGTTDALPGFKPAQPVVFCGLFPVDSSEFEELRDSIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIELITTAPSVIYHVYMKDGSMIELHNPADMPDLTLVDHLEEPRIKATILVPDDYLGDVLKLCQDRRGIQQDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYAMIGYRTDSLVKMSILVNDEPVDALSTMVHRDRAEGRGRAMVEKLKDLIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|34580695|ref|ZP_00142175.1| GTP-binding protein lepA [Rickettsia sibirica 246] >gi|28262080|gb|EAA25584.1| GTP-binding protein lepA [Rickettsia sibirica 246] (600 aa)
Score = 1726, Expect = 0.0e+00, Identities = 326/595 (54%), Positives = 445/595 (74%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+EN+ EIV V+NK+DLP+++ ++VK+Q+ED IG+D S A L+SAK+G+ I+ ++EAI+ ++PPP +S  +  L+AL+ DS+YD Y G V LVR+ +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G+  A+IK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS+++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSV+YK+ + DG  LEI S A LPD    + ++EP+ KA I+VPD+FLG V+ LC   RG  LD   + + R K+ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+N   VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     4 QKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVLISAKSGIGIDLVLEAIVNKLPPPKESSSDI-LKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFTPKKHIADVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRDGENLEIHSPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGMQLDHSYI-ANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELVKLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 595
>gi|15892292|ref|NP_360006.1| GTP-binding protein LepA [Rickettsia conorii str. Malish 7] >gi|24211924|sp|Q92IQ1|LEPA_RICCN GTP-binding protein lepA >gi|15619433|gb|AAL02907.1| GTP-binding protein lepA [Rickettsia conorii str. Malish 7] (600 aa)
Score = 1725, Expect = 0.0e+00, Identities = 325/595 (54%), Positives = 446/595 (74%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD  +YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+EN+ EIV V+NK+DLP+++ ++VK+Q+ED IG+D S A L+SAK+G+ I+ ++EAI+ ++PPP +S  +  L+AL+ DS+YD Y G V LVR+ +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G+  A+IK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS+++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSV+YK+ + DG  LEI + A LPD    + ++EP+ KA I+VPD+FLG V+ LC   RG  LD   + + R K+ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+N   VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     4 QKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNNYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVLISAKSGIGIDLVLEAIVNKLPPPKESSSDI-LKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFTPKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRDGENLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGMQLDHSYI-ANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELVKLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 595
>gi|114769302|ref|ZP_01446928.1| GTP-binding protein LepA [alpha proteobacterium HTCC2255] >gi|114550219|gb|EAU53100.1| GTP-binding protein LepA [alpha proteobacterium HTCC2255] (599 aa)
Score = 1725, Expect = 0.0e+00, Identities = 331/596 (55%), Positives = 450/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D   IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+M  Q+LD+MDIERERGITIK N+V++ Y    D + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVDASQGVEAQTL+NVY ALE + EIVPV+NK+DLP+AD DRV +Q+ED IG+D ++A  +SAKTG+ I  ++EAI+ ++P P  + D  PL+A++ DS+YDAY G V LVRI +GQ+K G KIR M+ N T+ V  +GV TPK+   +VL AGE+G++ ASIK +    VGDTIT +      +LPG+    P+V+CGL+P+D+ Q+E  +EA+ K+ L+D+S + E ETS ALGFG RCGFLGLLH++VIR+RL+RE++I LI TAPSVIY + + DG+++E+ + A +PD T  + I+EP  KA I+VPD++LG+V++LCQ+ RG  +DL     TR  V Y +PL E+++ F+D+LKS +KGYA+ DY +  YR+  L K+ IL+N   VDALST++H + A  R R +  KLKE IP+HQF+IPIQA IGG+IIARET+SA+RK+V AKCYGGD++RK+KLL++QK GKKR++  G+V +P + F+  L
  S:     3 DINKIRNFSIVAHIDHGKSTLADRLIQSTGTVADRDMAAQLLDTMDIERERGITIKANSVRIEY-KANDGEIYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYHALEADHEIVPVLNKVDLPAADPDRVSEQIEDVIGIDATDAIHISAKTGVGIPDVLEAIVTRLPAPETTAD-APLKAMLVDSWYDAYLGVVVLVRIIDGQLKKGDKIRMMNTNATYPVDRIGVFTPKMTPIDVLSAGEMGFLTASIKQVSDTRVGDTITHEKKGCEKALPGFAPAQPVVFCGLFPVDNAQFEDLREAISKLSLNDASFSTEMETSAALGFGFRCGFLGLLHLEVIRDRLEREYDINLITTAPSVIYHIHMRDGSMIELHNPADMPDLTHVEHIEEPRIKATILVPDEYLGDVLKLCQDRRGIQIDLTYA-GTRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYSMEGYREDRLQKMQILVNEEPVDALSTMVHTDRADTRGRAMVEKLKELIPQHQFKIPIQAAIGGRIIARETLSALRKDVTAKCYGGDVSRKRKLLDKQKAGKKRMRQFGSVDIPQEAFISAL 595
>gi|90185214|sp|Q5N390|LEPA_SYNP6 GTP-binding protein lepA (604 aa)
Score = 1725, Expect = 0.0e+00, Identities = 329/592 (55%), Positives = 453/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  REMK Q LD+M++ERERGITIKL A ++ Y   +D + Y  +LIDTPGHVDF+YEVSRSL ACEGALLVVDASQGVEAQTL+NVYLALEN+LEI+PV NKIDLP AD +RVK+++E+ IGLDCS A   SAK+G+ I +I+E+I+  +PPP D+   +PL+AL+FDSYYD Y+G +   R+ +G V+ G +IR M++ + + +  LGV +P  V  E L AGEVG+IAASIK +    VGDTIT     AT  LPGY +  PMV+CGL+P DS +Y   ++ALEK+ LSD++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   DG +L +D+ +KLP     ++I+EP+ K EII P++++G +M+LCQ  RG ++D+  +   R  + Y +PLAE++  FFD++KS +KGYA+++Y ++ YR+ +LV++DIL+N   VD L+TI+HR+ A    + +  KLKE IP+HQF+IP+QA IG ++IA E++ A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:     9 IRNFCIIAHIDHGKSTLADRLLQETGTVQAREMKEQFLDNMELERERGITIKLQAARMNYR-AQDGEQYVLNLIDTPGHVDFSYEVSRSLQACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVPNKIDLPGADPERVKREIEEVIGLDCSGAIEASAKSGIGIGEILESIVHLVPPPSDTT-GEPLRALIFDSYYDPYRGVIVYFRVIDGTVRKGDRIRLMASGKEYEIDELGVLSPNQVQVEELHAGEVGYIAASIKAVADARVGDTITLARARATEPLPGYVEAKPMVFCGLFPTDSDRYPDLRDALEKLQLSDAALQYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVVYQVTTLDGEVLRLDNPSKLPPPQQREKIEEPYVKVEIITPENYVGALMDLCQTRRGIFIDMKYLTQERTTLIYEMPLAEVVTDFFDQMKSRTKGYASMEYSLIGYREGELVRMDILINSEPVDPLATIVHRDKAYYVGKALVEKLKELIPRHQFKIPLQAAIGSRVIASESIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKAIGTVDVPQEAFMAVL 598
>gi|126659870|ref|ZP_01730995.1| GTP-binding protein LepA [Cyanothece sp. CCY0110] >gi|126618833|gb|EAZ89577.1| GTP-binding protein LepA [Cyanothece sp. CCY0110] (603 aa)
Score = 1723, Expect = 0.0e+00, Identities = 322/592 (54%), Positives = 455/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y + KD Q+Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVD+SQGVEAQTL+NVYLALENNLEI+P++NKIDLP ++ +RV  ++E+ +GLDC+     SAK G+ +++I+E+I+  +PPP D+ D KPL+AL+FDSYYD Y+G +   R+ +G VK G ++R M++ + + +  LGV +P  +  + L AGEVG+ AA+IK ++   VGDTIT    PA   LPGY +  PMV+CGL+P D+ QYE  +EAL ++ L+D++L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSVIY+V   DG + ++D+ + LP     ++++EP+ + E+I P+ ++G +MELCQ+ RG + D+     +R  + Y +PLAE++  FFD+LKS S+GYA+++Y+++ YR+  LVK+DIL+NG+ VDAL+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L
  S:     9 IRNFCIIAHIDHGKSTLADRMLQMTETVAQRKMKEQFLDNMDLERERGITIKLQAARMNYRS-KDGQEYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDSSQGVEAQTLANVYLALENNLEIIPILNKIDLPGSEPERVANEIEEVVGLDCTGIIKASAKAGIGVDEILESIVHLVPPPSDTVD-KPLRALIFDSYYDPYRGVIVYFRVMDGTVKTGDRVRLMASGKEYEIDELGVLSPNQIQLDSLHAGEVGYFAAAIKAVEDARVGDTITLAEAPAKEPLPGYTEAKPMVFCGLFPTDADQYEDLREALNRLKLNDAALSYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYDLDLITTAPSVIYRVTTIDGEMTQVDNPSLLPPPQEREKVEEPYIEVEMITPETYVGTLMELCQSRRGVFKDMRYFTLSRTSLIYELPLAEVVTDFFDQLKSRSRGYASMEYQLIGYRENPLVKLDILVNGDSVDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGSKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKAIGTVDVPQEAFMAVL 598
>gi|160944934|ref|ZP_02092161.1| hypothetical protein FAEPRAM212_02450 [Faecalibacterium prausnitzii M21/2] >gi|158444118|gb|EDP21122.1| hypothetical protein FAEPRAM212_02450 [Faecalibacterium prausnitzii M21/2] (603 aa)
Score = 1723, Expect = 0.0e+00, Identities = 335/597 (56%), Positives = 448/597 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALG-VNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           M +  IRNF I+AHIDHGKSTLSDRI+E T ++  R M++QILD+MDIERERGITIK  AV + Y   KD + Y F+LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QGVEAQTL+N Y+ALE++LE+VP++NKIDLPSA  D V ++VED IGL C +AP VSAKTGLN++Q++E ++  IP P   D + PL+AL+FDS YD+YKG +  +R+  G VK G  IR M+    F +  +G +    +     L AGEVG++ ASIK ++   VGDT+T    P   +LPGY+++ PMV+CG+YP D  +Y   K+ALEK+ L+D+SLT+E ETS ALGFG RCGFLGLLHM++I ERL+REF++ +I T PSV Y++ L DGT+  ID+ +  PD +   + +EPF    +  P+D++G +M+LCQ+ RG  +D+  +D  R  + Y +PL EI+Y FFD +KS S+GYA+ DYE  +YR+ DLVK+D LLNG+ VDALS I+ R+ A  + R+IC KL+++IP++ FEIP+QA IGGKIIARETV AMRK+VLAKCYGGDI+RKKKLLE+QKEGKK+++ +G+VS+P + F  +L
  S:     1 MARDNIRNFCIIAHIDHGKSTLSDRILELTKSVDERTMEDQILDNMDIERERGITIKARAVTMNY-TAKDGKTYEFNLIDTPGHVDFAYEVSRSLAACEGAILVVDATQGVEAQTLANTYMALEHDLELVPILNKIDLPSAHPDEVAQEVEDVIGLPCMDAPRVSAKTGLNVDQVLERVVSDIPAP-TGDPDAPLKALIFDSIYDSYKGVIVYIRVFEGSVKPGDTIRMMATGAEFTLVEVGHMGATSLTPCAQLQAGEVGYLTASIKTVQDTRVGDTVTLAERPTAEALPGYRQVKPMVFCGIYPADGAKYPDLKDALEKLQLNDASLTFELETSAALGFGFRCGFLGLLHMEIITERLEREFDLDIITTTPSVRYRLTLTDGTVEMIDNPSSYPDPSNIVKQEEPFVDVHLYTPNDYVGGLMDLCQSKRGVLIDMKYLDDVRVDLHYALPLGEIVYDFFDAIKSRSRGYASYDYEFKEYRESDLVKLDFLLNGDPVDALSMIVFRDNAYAKGRRICEKLRDNIPRNLFEIPVQAAIGGKIIARETVKAMRKDVLAKCYGGDISRKKKLLEKQKEGKKKMRQLGSVSLPSEAFTAVL 596
>gi|114775468|ref|ZP_01451036.1| GTP-binding protein LepA [Mariprofundus ferrooxydans PV-1] >gi|114553579|gb|EAU55960.1| GTP-binding protein LepA [Mariprofundus ferrooxydans PV-1] (608 aa)
Score = 1723, Expect = 0.0e+00, Identities = 327/595 (54%), Positives = 443/595 (74%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMS--NNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + YIRNFSI+AHIDHGKSTL+DR+IE T  LT R+MK Q+LDSMD+E+ERGITIK     L Y   KD   Y  ++IDTPGHVDFTYEVSRSL ACEGALL+VDA+QGVEAQTL+NVYLA+EN+LEI+PVINKIDLPSAD++  K+Q+ED IGLD S A  VSAKTG  I  ++EAI++ IPPP + DD KPL+ALV DS++D+Y GAV L+RI  G VK G + R MS     ++ V  LG   P   +   L +G VG++   IK +  + VGDT+T   N A+  LPGY++   MV+ GLYP+DS  Y   +++LEK++++D + T+E ETS ALG G RCGFLG+LHM++++ERL+RE+++ LI TAPSV+Y++  NDGTI+EI + ++ P+      I+EP   A I +P++F+G +++LCQ+ RG   D+  +   R  +TY +PLAE+   F+DKLKS S+GYA++DYEI ++   D+VK+D+L++   VDALS I+HR  A  R R +  KL+E IP+HQF++P+QA IG +I+ARETV  +RKNV AKCYGGDI+RK+KLLE+QK GKKR+K+IG+V+VP + F+ +L
  S:     8 QHYIRNFSIIAHIDHGKSTLADRLIEETGALTERQMKKQVLDSMDLEQERGITIKAQTATLNY-PAKDGHIYQLNMIDTPGHVDFTYEVSRSLQACEGALLIVDAAQGVEAQTLANVYLAMENDLEIIPVINKIDLPSADVEEAKRQIEDVIGLDASFALPVSAKTGEGIIDVLEAIVKYIPPPKNHDD-KPLRALVVDSWFDSYVGAVALIRIFEGTVKKGDRFRLMSMPTAASYEVQDLGYFVPTPFSTSHLSSGAVGFLIGGIKKLADLKVGDTVTTLRNGASEPLPGYREPKAMVFSGLYPVDSADYNDLRDSLEKLHMNDPAFTFEPETSSALGLGFRCGFLGMLHMEIVQERLEREYDLDLITTAPSVVYRIYKNDGTIIEISNPSEFPEPQEIDRIEEPTVLANIFMPEEFVGTIIKLCQDRRGMQQDMKFIGQGRVMLTYSLPLAEMAIDFYDKLKSVSRGYASMDYEISEFAVSDVVKLDVLVHAEPVDALSLIVHRSIAESRGRDLVKKLRELIPRHQFDVPLQAAIGSRILARETVKGVRKNVTAKCYGGDISRKRKLLEKQKAGKKRMKSIGSVNVPQEAFLAVL 602
>gi|114800355|ref|YP_758873.1| GTP-binding protein LepA [Hyphomonas neptunium ATCC 15444] >gi|119371358|sp|Q0C5X0|LEPA_HYPNA GTP-binding protein lepA >gi|114740529|gb|ABI78654.1| GTP-binding protein LepA [Hyphomonas neptunium ATCC 15444] (604 aa)
Score = 1722, Expect = 0.0e+00, Identities = 317/592 (53%), Positives = 435/592 (73%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+    LT REM  Q+LDSMDIE+ERGITIK   V+L Y    D + Y  +L+DTPGHVDF YEVSR LAACEG+LLVVDASQGVEAQTL+NVY A++ N EIVPV+NKIDLP+AD+DRVK+Q+E+ IGLD S+A  +SAKTGL I  ++EAI+ ++PPP   D   PL+A + D+YYD Y G V +VR+  G +K    IR M     + +  +G   PK+   + L  GEVG+  ASIK +   S+GDTIT+D  P   +LPGYK + P+V+CGL+P+D+  ++  + A+ K+ L+D+S T+E ETS ALG G RCGFLGLLH+++I+ERL REF++ LIATAPSV+Y++ + DGT +E+ + A +PD     EI+EP+  A I  PD++LG++++LCQ+ RG  ++L  V   R  V Y +PL E+++ F+D+LKS S+GYA+ DY ++ +R ++LVK+ IL+N   VDAL+ ++HR+ A  R R++C +LKE IP+  F+IPIQA IGG+++ARET+SAMRK+V AKCYGGD TRK+KLL++Q  GKKR++  G V +P + FV  L
  S:    10 IRNFSIIAHIDHGKSTLADRLIQACGGLTDREMSEQVLDSMDIEKERGITIKAQTVRLSY-TASDGETYTLNLMDTPGHVDFAYEVSRCLAACEGSLLVVDASQGVEAQTLANVYQAIDQNHEIVPVLNKIDLPAADVDRVKEQIEEIIGLDASDAVQISAKTGLGIPDVLEAIVNRLPPPRGGDHTAPLKAALVDAYYDPYLGVVVIVRVHEGILKKKQTIRMMRTGGVYEIDKVGTFNPKLTEADALGPGEVGYFVASIKEVGDCSIGDTITEDKRPTDKALPGYKDVQPVVFCGLFPMDAGDFDDLRAAMGKLRLNDASFTWEMETSAALGMGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYEMSMTDGTEIELHNPADMPDVVRITEIREPWIAATIYTPDEYLGSILKLCQDRRGIQIELSYVGG-RACVKYELPLNEVVFDFYDRLKSISRGYASFDYTLIGHRAENLVKLQILVNEEPVDALAMLVHRDRAESRGRQMCERLKELIPRQMFKIPIQAAIGGRVVARETISAMRKDVTAKCYGGDATRKRKLLDKQAAGKKRMRQFGKVEIPQEAFVAAL 599
>gi|85707161|ref|ZP_01038248.1| GTP-binding protein LepA [Roseovarius sp. 217] >gi|85668320|gb|EAQ23194.1| GTP-binding protein LepA [Roseovarius sp. 217] (599 aa)
Score = 1722, Expect = 0.0e+00, Identities = 326/596 (54%), Positives = 444/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LD+MDIERERGITIK N V++ Y   +D + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++   EIVP++NKIDLP+++ DRV +Q+ED IG+D S A  VSAKTG+ I + +EAI++ +P P   D+  PL+A++ DS+YDAY G V LVRI +G++K G +I  M    T+ V  +GV  P++   E L  GE+G+I ASIK ++   VGDTIT +  P   +LPG+K  +P+V+CGL+P+DS ++E  + A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY + + DGT  ++ + A +PD T    I+EP  KA I+VPD++LG+V++LCQ+ RG  +DL      R  V Y +PL E+++ F+D+LKS +KGYA+ DY++  YR+  LVK+ IL+N   VDALS ++HR+ A  R R +  KLK+ IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD TRKKKLLE+QK GKKR++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQSTGTVQDRDMKEQMLDAMDIERERGITIKANTVRIDY-KAQDGEIYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDAGHEIVPILNKIDLPASECDRVAEQIEDVIGIDASGAIRVSAKTGVGIAETLEAIVKHLPAP-KGDEAAPLKAMLVDSWYDAYLGVVVLVRIMDGRMKKGDRIHMMQTEATYNVERIGVFRPQMEKVESLGPGEIGFITASIKQVRDTKVGDTITHEKRPCAKALPGFKPSVPVVFCGLFPVDSNEFEDLRNAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIDLITTAPSVIYHLFMKDGTRADLHNPADMPDLTYVSHIEEPRIKATILVPDEYLGDVLKLCQDRRGIQMDLTYA-GNRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLQGYREDSLVKMSILVNDEPVDALSMMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKRMRQFGKVDIPQEAFISAL 595
>gi|67925685|ref|ZP_00518999.1| Small GTP-binding protein domain:GTP-binding protein LepA [Crocosphaera watsonii WH 8501] >gi|67852468|gb|EAM47913.1| Small GTP-binding protein domain:GTP-binding protein LepA [Crocosphaera watsonii WH 8501] (603 aa)
Score = 1722, Expect = 0.0e+00, Identities = 324/595 (54%), Positives = 457/595 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNF I+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y + KD +DY  +LIDTPGHVDF+YEVSRSLAACEGALLVVD+SQGVEAQTL+NVYLALENNLEI+P++NKIDLP ++ +RV  ++E+ +GLDCS+    SAK G+ +N+I+E+I+  +PPP D+ + +PL+AL+FDSYYD Y+G +   RI +G +  G +IR M++ + + +  LGV +P  +  + L AGEVG+++A+IK +++  VGDTIT     A   LPGY +  PMV+CGL+P DS QYE  +EAL ++ L+D++L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSVIY+V   DG ++EID+ + LP     ++I+EP+ + E+I P+ ++G +MELCQ+ RG + D+     +R  + Y +PLAE++  FFD+LKS S+GYA+++Y+++ YR   LVK+D+L+NG+ VDAL+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+KAIG V VP + F+ +L  E
  S:     9 IRNFCIIAHIDHGKSTLADRMLQMTETVAQRQMKEQFLDNMDLERERGITIKLQAARMNYRS-KDGEDYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDSSQGVEAQTLANVYLALENNLEIIPILNKIDLPGSEPERVASEIEEVVGLDCSDIIKASAKAGIGVNEILESIVHLVPPPEDTVE-QPLRALIFDSYYDPYRGVIVYFRIMDGTINTGDRIRLMASGKEYEIDELGVLSPDQIQVDSLHAGEVGYLSAAIKTVENARVGDTITLAEEQAKEPLPGYTEAKPMVFCGLFPTDSDQYEDLREALNRLKLNDAALSYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYDLDLITTAPSVIYRVTNLDGEVMEIDNPSLLPPPQEREKIEEPYIEVEMITPETYVGTLMELCQSRRGVFKDMRYFTLSRTALIYELPLAEVVTDFFDQLKSRSRGYASMEYQLIGYRANPLVKLDLLVNGDGVDALAMIVHRDKAYYVGRALTEKLKELIPRHQFKVPIQAAIGAKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKAIGTVDVPQEAFMAVLKLE 601
>gi|188996689|ref|YP_001930940.1| GTP-binding protein LepA [Sulfurihydrogenibium sp. YO3AOP1] >gi|188931756|gb|ACD66386.1| GTP-binding protein LepA [Sulfurihydrogenibium sp. YO3AOP1] (595 aa)
Score = 1722, Expect = 0.0e+00, Identities = 327/595 (54%), Positives = 441/595 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AH+DHGKSTL+DR+IEFT  L  REMK Q+LD++DIERERGITIKL AV+L Y      +DY  HLIDTPGHVDF YEVSRSLAACEGALL++DA+QG+EAQT++  + AL  NLEI+PVINKIDLPSAD++R+K Q+ + +GLD   A L S K G+ I  I+EAI+++IPPP   D+NKPL+AL+FDSYYD Y+GAV  +R+ +G+VKVGT+IR MS  + F V+ +G  TPK+   + L AG+VG++AA+IK+++ I VGDTITD   P    + G++   PMVY GLYP  +T +E  ++ALE+  ++DS+LTYE E+S ALG G RCGFLGLLH+++++ERL+RE+ I LI TAP+VIYKV+   G  +E+ + ++LP+     +I EP+ +A II P++++G++M+L Q  RG       +D     + Y IPL E+++ F DKLK+ S+GYA+ DYE + YR+ DLVK+DIL+NG  VDALS I+HR+ A    R +  K+KE IP+  FE+ IQA IG KIIA   V+ +R +VLAKCYGGDITRK+KLLE+QKEGKKR+K  G V +P + F+ IL  +
  S:     8 IRNFSIIAHVDHGKSTLADRLIEFTGGLEKREMKEQLLDTLDIERERGITIKLQAVRLKY------KDYTLHLIDTPGHVDFGYEVSRSLAACEGALLLIDATQGIEAQTIATFWQALNLNLEIIPVINKIDLPSADVERIKTQIAEVLGLDPEGAILASGKAGIGIEDILEAIVKRIPPP-KGDENKPLKALIFDSYYDPYRGAVAFIRVIDGEVKVGTRIRLMSTGKEFEVTEVGAQTPKMTKLDSLKAGDVGYVAAAIKDVRDIRVGDTITDAKRPTDKPVEGFRPAKPMVYAGLYPTGNTTFEDMRDALERYSINDSALTYEVESSPALGMGFRCGFLGLLHLEIVQERLEREYGIELITTAPNVIYKVITTKGEEVEVRNPSQLPNPNEIDKILEPYIEASIITPNEYVGSIMQLVQEKRGIQKGFEYIDQKTVLLRYEIPLGEVLFDFHDKLKTVSRGYASFDYEFIGYREGDLVKMDILINGEPVDALSFIVHRDKAYRVGRNLVDKMKEVIPRQLFEVKIQAAIGSKIIASNRVAPLRSDVLAKCYGGDITRKRKLLEKQKEGKKRMKQFGKVELPQEAFLSILKAD 595
>gi|86747595|ref|YP_484091.1| GTP-binding protein LepA [Rhodopseudomonas palustris HaA2] >gi|86570623|gb|ABD05180.1| GTP-binding protein LepA [Rhodopseudomonas palustris HaA2] (644 aa)
Score = 1722, Expect = 0.0e+00, Identities = 337/592 (56%), Positives = 446/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  ++ REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ D+VK+Q+ED IGLD S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V LVR+ +G +K G +IR M  N  + +  +G  TPK+ + + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DGT +EI +   +PD     EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + +Y+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:    50 IRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQTVRLNYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIVTRLPPP-QGDRSAQLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERVGYFTPKMTSVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMTLTDGTEMEIHNPVDMPDVVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTEYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 640
>gi|56695884|ref|YP_166235.1| GTP-binding protein LepA [Silicibacter pomeroyi DSS-3] >gi|81558662|sp|Q5LUS0|LEPA_SILPO GTP-binding protein lepA >gi|56677621|gb|AAV94287.1| GTP-binding protein LepA [Silicibacter pomeroyi DSS-3] (599 aa)
Score = 1722, Expect = 0.0e+00, Identities = 323/596 (54%), Positives = 449/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LD+MDIERERGITIK N V++ Y    D Q Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVP++NKIDLP+++ DRV +Q+ED IG+D S A  VSAKTG+ I++ +EAI++ +P P  + D  PL+A++ DS+YD+Y G + LVRI +G +K G +++FMSN     V  +GV  P +   + L  GE+G++ ASIK ++   VGDTIT+D N    +LPG+K   P+V+CGL+P+DS ++E  ++A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+RL+RE++I LI TAPSV+Y V + DG + E+ + A +PD +    I+EP  KA I+VPD++LG+V++LCQ+ RG   DL +   +R  V Y +PL E+++ F+D+LKS +KGYA+ DY++  YR+  LVK+ IL+N   VDALST++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQETGTVQDRDMKEQLLDAMDIERERGITIKANTVRIDY-TADDGQAYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDADHEIVPILNKIDLPASECDRVAEQIEDVIGIDASGAIRVSAKTGVGIHETLEAIVKHLPAPKGTRD-APLKAMLVDSWYDSYLGVIVLVRIMDGVLKKGMRVKFMSNGTLHHVDRIGVFRPAMQMIDSLGPGEIGFLTASIKQVRDTRVGDTITNDRNGTEVALPGFKPAQPVVFCGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRLEREYDIELITTAPSVVYHVFMKDGEMRELHNPADMPDLSKVDHIEEPRIKATILVPDEYLGDVLKLCQDRRGIQQDL-SYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLTGYREDSLVKMSILVNDEPVDALSTMVHRDRAEARGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|89068542|ref|ZP_01155939.1| GTP-binding protein LepA [Oceanicola granulosus HTCC2516] >gi|89045961|gb|EAR52021.1| GTP-binding protein LepA [Oceanicola granulosus HTCC2516] (600 aa)
Score = 1722, Expect = 0.0e+00, Identities = 323/596 (54%), Positives = 445/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LDSMDIERERGITIK N V++ Y   KD   Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVDA+QGVEAQTL+NVY A+E + EIVPV+NKIDLP+A+ +R+ +Q+ED IG++  +A ++SAKTGL I  ++EAI+ ++PPP       PL+AL+ DS YD Y G V +VRI +G +K G +IR M    T+ V  +GV  P + +   L  GE+G++ ASIK ++   VGDTIT +     T LPG+K  +P+V+CGL+P+D++++E  ++A+EK+ L+D+S ++E ETS ALGFG RCGFLGLLH++VIR+R++RE+NI LI TAPSV+Y + + DG + E+ + A +PD T    I+EP  KA I+VPDD+LG+V++LCQ+ RG   +L    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY+++ YR+ +LVK+ IL+N   VDALS ++HR+ A  R R +C KLKE IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQLLDSMDIERERGITIKANTVRIDY-PAKDGHTYVLNLIDTPGHVDFGYEVSRSMQAVEGSLLVVDATQGVEAQTLANVYTAIEADHEIVPVLNKIDLPAAEPERIIEQIEDVIGIEAHDACMISAKTGLGIPDVLEAIVTRLPPPKGGSREAPLKALLVDSKYDPYLGVVVIVRIIDGVLKKGQRIRMMKTGGTYDVDRVGVYRPAMQDVAELGPGEIGFLTASIKQVRDTRVGDTITTEKKGTDTPLPGFKPSIPVVFCGLFPVDTSEFEDLRDAIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYNIELITTAPSVVYHLYMKDGEMRELHNPADMPDPTYVAHIEEPRIKATILVPDDYLGDVLKLCQDRRGIQQELTYAGS-RPLVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYREDNLVKMSILVNDEPVDALSMMVHRDRAEQRGRAMCEKLKELIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 596
>gi|157964349|ref|YP_001499173.1| GTP-binding protein LepA [Rickettsia massiliae MTU5] >gi|157844125|gb|ABV84626.1| GTP-binding protein LepA [Rickettsia massiliae MTU5] (604 aa)
Score = 1721, Expect = 0.0e+00, Identities = 324/596 (54%), Positives = 445/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+EN+ EIV V+NK+DLP+++  +VK+Q+ED IG+D S A L+SAK+G+ I+ ++EAI+ ++PPP +S  +  L+AL+ DS+YD Y G V LVR+ +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G+  A+IK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS+++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSV+YK+ + DG  LEI + A LPD    + ++EP+ KA I+VPD+FLG V+ LC   RG  LD   + + R K+ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+N   VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA +G +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     7 NQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIENDHEIVLVLNKLDLPASEPAQVKQQIEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPPKESSSDI-LKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFTPKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMRDGESLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGGQLDHSYI-ANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELVKLGILVNAEAVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASMGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 599
>gi|190570916|ref|YP_001975274.1| GTP-binding protein LepA [Wolbachia pipientis] >gi|190357188|emb|CAQ54604.1| GTP-binding protein LepA [Wolbachia pipientis] (598 aa)
Score = 1721, Expect = 0.0e+00, Identities = 323/592 (54%), Positives = 453/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNV-DSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF+I+AHIDHGKSTL+DR+IE  N L TREM NQ+LDSMDIERERGITIK   V+L Y     N+ Y  +L+DTPGHVDF+YEVSRSLAACEG+LLVVD+SQGVEAQTL+NVY A++NN EI+ V+NK+DLP+AD +R+K Q+E+ IG+D + + L+SAKTGL I  ++EAI+ ++P P   D N PLQA++ DS+YD Y G V LVR+KNG +K G +I  MSNN T+ V  +G+ TPK V    L AGEVG+I AS+K +    VGDTIT++  P + +LPG+K++ P+V+C ++P ++  ++  +EALEK++L+D+S T++ ETS ALG+G RCGFLG+LH++VI+ERL+REF++ L ATAPSVIYKV   +G +L I + + +PD T  + ++EP+  A I+VPD +LG ++ LC+  RGE  DL  V ++T   + Y +PL+E+++ F+D+LKS SKGYA+LD+EI DY++  + K+  L+NG  VDAL+ I+H+  A  R R+IC +LK+ IP+ Q++I IQA +GGKIIARET++  RK+V AK YGGD+TR+ KLLE+QK+GKKRL ++GN+++P + F++ L
  S:     4 IRNFAIIAHIDHGKSTLADRLIEECNGLETREMTNQVLDSMDIERERGITIKAQTVRLNYTANNGNK-YCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSSQGVEAQTLANVYKAIDNNHEIIVVLNKVDLPAADPERIKLQIEEVIGIDATESILISAKTGLGIKDVLEAIVTKLPAP-QGDTNAPLQAILVDSWYDPYLGVVILVRVKNGVLKKGMRIVMMSNNATYQVDNIGIFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPCSKALPGFKEVHPVVFCSIFPNNTDDFKYLREALEKLHLNDASFTFDAETSNALGYGFRCGFLGMLHLEVIQERLEREFDLDLTATAPSVIYKVETQNGKVLNIHNPSDMPDPTKIEIVEEPWITATIMVPDQYLGEILSLCEERRGEQQDLSYVGNTTTALLKYKLPLSEVVFDFYDRLKSISKGYASLDWEISDYQESQIDKLSFLVNGEPVDALACIVHKSRAEKRGREICARLKDLIPRQQYKIAIQAAVGGKIIARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLHSVGNINIPQNAFIEAL 594
>gi|152978259|ref|YP_001343888.1| GTP-binding protein LepA [Actinobacillus succinogenes 130Z] >gi|171704260|sp|A6VLV6|LEPA_ACTSZ GTP-binding protein lepA >gi|150839982|gb|ABR73953.1| GTP-binding protein LepA [Actinobacillus succinogenes 130Z] (597 aa)
Score = 1721, Expect = 0.0e+00, Identities = 332/594 (55%), Positives = 447/594 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K IRNFSI+AHIDHGKSTLSDR+I+    L+ REM+ Q+LDSMD+ERERGITIK  +V L Y   KD + Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E NLE+VPV+NKIDLP+AD +RV +++ED +G+D   A   SAKTGL I +++E I+ +IP P + D N PLQAL+ DS++D Y G V LVR+KNG +K G KI+ MS  + + V  LG+ TPK V++  L  GEVGW+  +IK+I    VGDT+T   NPAT +LPG+KK+ P VY GL+P+ S  YE F++AL K+ L+D+SL YE ETS ALGFG RCGFLGLLHM++I+ERL+RE+++ LI TAP+V+Y+V L +G ++ +DS +KLP      +I+EP A+  ++VP ++LGNV+ LC   RG   ++V     +  +TY IP+ E++  FFD+LKS S+GYA+LDY    ++  ++V+VDI++NG++VDAL+ I+H++ A  R R++  K+KE IP+ QF+I IQA IG ++IAR TV  +RKNVLAKCYGGD++RKKKLL++QKEGKKR+K +GNV VP + F+ IL
  S:     2 KNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDSMDLERERGITIKAQSVTLDY-KAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPVLNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSAKTGLGIEEVLEEIVHKIPAP-EGDPNAPLQALIIDSWFDNYLGVVSLVRVKNGMLKKGDKIKVMSTGQAYNVDRLGIFTPKQVDRTELTTGEVGWVVCAIKDILGAPVGDTLTHQHNPATAALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPETSSALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVELTNGEVVYVDSPSKLPPLNNIGDIREPIAECNMLVPQEYLGNVITLCVEKRGVQTNMV-YHGNQIALTYDIPMGEVVLDFFDRLKSTSRGYASLDYSFKRFQSANMVRVDIMINGDRVDALALIVHKDNAVYRGRELVEKMKELIPRQQFDIAIQAAIGNQVIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKRMKQLGNVEVPQEAFLAIL 592
>gi|110678419|ref|YP_681426.1| GTP-binding protein LepA [Roseobacter denitrificans OCh 114] >gi|119371389|sp|Q16BA3|LEPA_ROSDO GTP-binding protein lepA >gi|109454535|gb|ABG30740.1| GTP-binding protein LepA [Roseobacter denitrificans OCh 114] (599 aa)
Score = 1720, Expect = 0.0e+00, Identities = 324/593 (54%), Positives = 448/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ TNT+  R+MK Q+LDSMDIERERGITIK   V++ Y   ++ ++Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP++D DRV +Q+ED IG+D S A  VSAKTG  I + +E+I++ +P P   D + PL+A++ DS+YD+Y G + LVRI +G +K G +IR +SNN T  V  +GV  P++   + L  GE+G++ ASIK ++   VGDTIT +      +LPG+K   P+V+CGL+P+DS+++E  ++++EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY V + DG ++E+ + A +PD TL   ++EP  KA I+VPDD+LG+V++LCQ+ RG   DL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY ++ YR  +LVK+ IL+N   VDALS ++HRE A  R R +  KLK+ IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P + F+  L
  S:     6 HIRNFSIVAHIDHGKSTLADRLIQSTNTVADRDMKEQMLDSMDIERERGITIKAQTVRINY-TAQNGEEYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYHAIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIQVSAKTGQGIMETLESIVQNLPAP-KGDRDAPLKAMLVDSWYDSYLGVIVLVRIMDGVLKKGDRIRMLSNNSTHNVDRIGVFRPEMTAIDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGTEVALPGFKPSQPVVFCGLFPVDSSEFEELRDSIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIELITTAPSVIYHVYMKDGAMIELHNPADMPDLTLVDHLEEPRIKATILVPDDYLGDVLKLCQDRRGIQQDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYAMIGYRTDNLVKMSILVNDEPVDALSIMVHRERAEGRGRAMVEKLKDLIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|149915960|ref|ZP_01904484.1| GTP-binding protein LepA [Roseobacter sp. AzwK-3b] >gi|149810283|gb|EDM70129.1| GTP-binding protein LepA [Roseobacter sp. AzwK-3b] (599 aa)
Score = 1720, Expect = 0.0e+00, Identities = 323/593 (54%), Positives = 444/593 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ T+T+  R+MK Q+LDSMDIERERGITIK N V++ +   +D Q Y  +LIDTPGHVDF+YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ N E++PV+NKIDLP++D+DRV +Q+E+ IG+D S A  VSAKTG  I +++EAI+  +P P    D  PL+A++ DS YD Y G V LVRI +G +K G +I  +    T+ V  +GV  P +   + L  GE+G+I ASIK ++   VGDTIT D     T+LPG+K  +P+V+CGL+P+DS ++E  ++A+EK+ L+D+S +YE E S ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSV+Y + + DG++ E+ + A +PD T    I+EP  KA I+VPD++LG+V++LCQ+ RG  +DL    S R    Y +PL E+++ F+D+LKS +KGYA+ DYEI+ YR+  LVK+ +L+N   VDALS ++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD+TRKKKLLE+QK GKK+++  G V +P   F+  L
  S:     6 HIRNFSIVAHIDHGKSTLADRLIQMTDTVAERDMKEQLLDSMDIERERGITIKANTVRIDF-TAEDGQQYVLNLIDTPGHVDFSYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDANHELIPVLNKIDLPASDLDRVAEQIEEVIGIDASGAIPVSAKTGQGIREVLEAIVAHLPAPKGHRD-APLKAMLVDSKYDPYLGVVVLVRIMDGVMKKGDRIHMLQTAATYNVDRIGVFRPAMTVVDELGPGEIGFITASIKQVRDTKVGDTITHDRRRCETALPGFKPSVPVVFCGLFPVDSAEFESLRDAIEKLALNDASFSYEMENSAALGFGFRCGFLGLLHLEVIRDRIEREYDIELITTAPSVVYHIFMKDGSMKELHNPADMPDLTYVDHIEEPRIKATILVPDEYLGDVLKLCQDRRGIQMDLTYAGS-RAMAVYDLPLNEVVFDFYDRLKSVTKGYASFDYEIMGYRQDYLVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDVTRKKKLLEKQKAGKKKMRQFGKVEIPQQAFISAL 595
>gi|83951669|ref|ZP_00960401.1| GTP-binding protein LepA [Roseovarius nubinhibens ISM] >gi|83836675|gb|EAP75972.1| GTP-binding protein LepA [Roseovarius nubinhibens ISM] (599 aa)
Score = 1720, Expect = 0.0e+00, Identities = 327/593 (55%), Positives = 445/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ TNT+  R+MK Q+LDSMDIERERGITIK N V++ Y   +D + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A+E + +++PV+NKIDLP++D DRV +Q+ED IG+D S A  VSAKTG  I + +EAI++ +P P   D + PL+A++ DS+YD+Y G V LVRI +G +K G +IR M     + V  +GV  P +   + L  GE+G+I ASIK ++   VGDTIT D  PA   LPG+K   P+V+CGL+P+DS ++E  ++A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY V + DGT  ++ + A +PD T    I+EP  KA I+VPD++LG+V++LCQ+ RG  LDL    + R  V Y +PL E+++ F+D+LKS +KGYA+ DY++  YR+ +LVK+ IL+N   VDALS ++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRK+KLLE+QK GKK+++  G V +P + F+  L
  S:     6 HIRNFSIVAHIDHGKSTLADRLIQQTNTVAERDMKAQLLDSMDIERERGITIKANTVRIDYL-AQDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYHAIEADHDLIPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIAVSAKTGQGITETLEAIVKHLPAP-KGDRDAPLKAMLVDSWYDSYLGVVVLVRIMDGVLKKGDQIRMMQTGARYGVDRIGVFRPAMQVVDELGPGEIGFINASIKQVRDTKVGDTITHDKKPADKPLPGFKPSQPVVFCGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIELITTAPSVIYHVFMKDGTQQDLHNPADMPDLTYVDHIEEPRIKATILVPDEYLGDVLKLCQDRRGIQLDLTYAGA-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMEGYRQDNLVKMSILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFISAL 595
>gi|163744428|ref|ZP_02151788.1| GTP-binding protein LepA [Oceanibulbus indolifex HEL-45] >gi|161381246|gb|EDQ05655.1| GTP-binding protein LepA [Oceanibulbus indolifex HEL-45] (599 aa)
Score = 1719, Expect = 0.0e+00, Identities = 327/592 (55%), Positives = 443/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LDSMDIERERGITIK   V++ Y    D QDY  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP+AD DRV +Q+ED IG+D S A  VSAKTG+ I + +EAI+ ++P P  S D  PL+A++ DS+YD+Y G + LVRI +GQ+K G ++R M N     V  +GV  P +   +VL  GE+G++ ASIK ++   VGDTIT +      +LPG+K   P+V+CGL+P+D+ ++E  ++++EK+ L+D+S ++E ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY + + DGT+ ++ + A +PD T    I+EP  KA I+VPD++LG+V++LCQ+ RG  LDL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY ++ YR   LVK+ IL+N   VDALST++HR+ A  R R +  KLK+ IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD TRKKKLLE+QK GKK+++  G V +P + F+  L
  S:     7 IRNFSIVAHIDHGKSTLADRLIQSTKTVADRDMKEQMLDSMDIERERGITIKAQTVRINY-TADDGQDYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYHAIDADHEIVPVLNKIDLPAADCDRVAEQIEDVIGIDASEAIRVSAKTGIGIKETLEAIVTRLPAPKGSLD-APLKAMLVDSWYDSYLGVIVLVRIMDGQLKKGDRVRMMQNGSVHHVDRIGVFRPAMTEIDVLGPGEIGFLTASIKQVRDTRVGDTITHEKKGTDKALPGFKPAQPVVFCGLFPVDAAEFEDLRDSIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIDLITTAPSVIYDIHMKDGTVEQLHNPADMPDLTYVDHIEEPRIKATILVPDEYLGDVLKLCQDRRGMQLDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYAMIGYRTDALVKMSILVNDEPVDALSTMVHRDRAETRGRAMVEKLKDLIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|148556081|ref|YP_001263663.1| GTP-binding protein LepA [Sphingomonas wittichii RW1] >gi|166224528|sp|A5VB59|LEPA_SPHWW GTP-binding protein lepA >gi|148501271|gb|ABQ69525.1| GTP-binding protein LepA [Sphingomonas wittichii RW1] (607 aa)
Score = 1719, Expect = 0.0e+00, Identities = 321/592 (54%), Positives = 446/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLN-----DGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+ T  LT REM  Q+LD+MDIE+ERGITIK   V+L Y   KD QDY  +L+DTPGHVDF YEVSRSLAACEGALLVVDA+QGVEAQTL+NVY ++E++ EIVPVINKIDLP+A+ D+VK ++ED IGL   +A L SAK+G+ I++I+EAI+ +IP P   D   PL+A++ DS+YD Y G V L+R+  G ++ G +I+FM  +   +V  +G   PKI     +  GE+G+I A IK +   +VGDTITD   P    LPG+K++ P+V+CGL+P+D+  +E  +E+L K+ L+D+S ++E E+S ALGFG RCGFLGLLH+++I+ERL RE+++ LI TAPSV+Y++ L+     D  ++E+ + A +PD      I+EP+ +A I VPD++LG++++LCQ+ RG   +L  V   R ++TY +PL E+++ F+D+LKS S+GYA+ DY  + YR+ DLVK+ I++NG  VDALS I+HR  A  R R +C +LK+ IP+H F+IP+QA IGGK+IARET++AMRK+V AKCYGGD TRK+KLLE+QKEGKKR++  GNV++P + F+  L
  S:     8 IRNFSIIAHIDHGKSTLADRLIQRTGGLTDREMSAQVLDNMDIEKERGITIKAQTVRLDY-KAKDGQDYVLNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQSIEHDHEIVPVINKIDLPAAEPDKVKAEIEDIIGLPADDAVLASAKSGIGIDEILEAIVARIPAP-KGDPAAPLKAMLVDSWYDPYLGVVILIRVVEGTIRKGQQIKFMQADTVHLVDRVGCFRPKIEQLGEMGPGEIGFITAQIKEVSQTAVGDTITDARKPTAEPLPGFKEVQPVVFCGLFPVDAADFEKLRESLYKLRLNDASFSFEAESSAALGFGFRCGFLGLLHLEIIQERLTREYDLDLITTAPSVVYRLHLSHSKTEDAKVIELHNPADMPDPNRIDMIEEPWIEATIYVPDEYLGSLLKLCQDRRGIQKNLTYVGG-RAQITYELPLNEVVFDFYDRLKSISRGYASFDYHQIGYREGDLVKMSIMVNGEPVDALSMIVHRAAAEARGRHMCERLKDLIPRHLFKIPVQAAIGGKVIARETIAAMRKDVTAKCYGGDATRKRKLLEKQKEGKKRMREYGNVNIPQEAFIAAL 601
>gi|195952478|ref|YP_002120768.1| GTP-binding protein LepA [Hydrogenobaculum sp. Y04AAS1] >gi|195932090|gb|ACG56790.1| GTP-binding protein LepA [Hydrogenobaculum sp. Y04AAS1] (599 aa)
Score = 1719, Expect = 0.0e+00, Identities = 327/595 (54%), Positives = 446/595 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKV-LLNDGTILEIDSAAKLPDK-TLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AH+DHGKSTL+DR+IEF   +T RE K+Q+LD++DIERERGITIKL AV++ YH+   N+D+  HLIDTPGHVDF+YEVSRSLAACEGALL++DASQG+EAQT++N + A+E NL I+PVINKIDLP+AD DR+K Q+ D +GLD   A L SAK G+ I +I+EAI ++IPPP   D+N PL+AL+FDSYYD Y+GAV  VRI +G +KVG +I+  S  + F V+ +G  TPK+    +L AG+VG+IAASIK+++ I VGDTIT  +NP   ++PG+K   PMV+ GLYP + + +E  ++ALEK  ++D+++TYE ETS A+G G RCGFLGLLHM++++ERL RE+NI +I TAPSV+Y++ L N   ILE+ S+  +PD   L + I+EP+  A II P D++GN++ +CQ+ RG  +    +D     + Y +PL EI+  F DK+KS SKGYA+ DYE L Y++ DLVK+ I++N   VDALS ++H++ A  ++R +  +LKE IP+  FEI +QA IG KIIA E +  MR NV AKCYGGDI+RK+KLLE+QKEGKKR+K  G VS+P + F+ +L  +
  S:     4 IRNFSIIAHVDHGKSTLADRLIEFCGAITDREKKDQMLDTLDIERERGITIKLQAVKINYHSKIQNKDFTLHLIDTPGHVDFSYEVSRSLAACEGALLLIDASQGIEAQTVANFWKAVEQNLVIIPVINKIDLPAADPDRIKLQIRDILGLDPDEAILASAKEGIGIEEILEAITKRIPPP-KGDENAPLKALIFDSYYDPYRGAVAFVRIFDGSLKVGDRIKLFSTGKEFEVTEVGAQTPKMTKLPILKAGDVGYIAASIKDVRDIRVGDTITLKSNPTKEAIPGFKTAKPMVFAGLYPTEDSDFEELRDALEKYSINDAAITYEPETSPAIGMGFRCGFLGLLHMEIVQERLSREYNIDVITTAPSVVYRLKLKNRSDILEVKSSNDIPDNFGLIEYIEEPYVLATIITPKDYVGNIINICQDKRGIQVKFSYLDQNTALLEYEMPLQEIIVDFHDKIKSASKGYASFDYEFLGYKESDLVKLTIMINKEPVDALSFLVHKDKAYRKARALVEQLKETIPRQLFEINVQAAIGSKIIASERIPPMRANVTAKCYGGDISRKRKLLEKQKEGKKRMKQFGKVSLPQEAFLSVLKAQ 599
>gi|77462641|ref|YP_352145.1| GTP-binding protein LepA [Rhodobacter sphaeroides 2.4.1] >gi|90185206|sp|Q3J4P0|LEPA_RHOS4 GTP-binding protein lepA >gi|77387059|gb|ABA78244.1| GTP-binding protein LepA [Rhodobacter sphaeroides 2.4.1] (599 aa)
Score = 1718, Expect = 0.0e+00, Identities = 323/592 (54%), Positives = 440/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK QILDSMDIERERGITIK N V++ Y   KD + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NKIDLP+A+ +RVK Q+ED IGLD S+A L+SAK+GL I  ++EAI+ ++PPP   D   PL+A++ DS+YDAY G V ++R+ +G ++ G +++ M     + +  L V  P++V+   L  GE+G + ASIK ++   VGDTIT +       LPG+K   P+V+CGL+P+D+  +E  +EA+EK+ L+D+S TYE ETS ALGFG RCGFLGLLH++V+R+RL+RE+++ LI TAPSV+Y++ + DGT+ E+ +   +PD T    I+EP  +A I+VPD++LG+V++LCQ+ RG  LDL +    R  V Y +PL E+++ F+D+LKS +KGYA+ DY+I  YR+  LVK+ IL+N   VDALS ++HR+ A  R R +  KLKE IP+H F+IPIQA IGG++IARET+SAMRK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P   F+  L
  S:     7 IRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMDIERERGITIKANTVRIDY-PAKDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQALDAGHEIVPVLNKIDLPAAEPERVKSQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVHRLPPP-KGDREAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDRLAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCAAPLPGFKPAQPVVFCGLFPVDANDFEALREAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLEREYDLDLITTAPSVVYQIYMKDGTLQELHNPTDMPDLTYVDHIEEPRIRATIMVPDEYLGDVLKLCQDRRGIQLDL-SYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYREDFLVKMSILVNDEPVDALSMMVHRDRADMRGRAMVEKLKELIPRHMFKIPIQAAIGGRVIARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINAL 595
>gi|149203597|ref|ZP_01880566.1| GTP-binding protein LepA [Roseovarius sp. TM1035] >gi|149142714|gb|EDM30756.1| GTP-binding protein LepA [Roseovarius sp. TM1035] (599 aa)
Score = 1718, Expect = 0.0e+00, Identities = 323/596 (54%), Positives = 447/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LD+MDIERERGITIK N V++ Y   ++ + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++   EIVP++NKIDLP+++ DRV +Q+ED IG+D S A  VSAKTG+ I + +EAI++ +P P   D+N PL+A++ DS+YDAY G V LVRI +G++K G +I  +    T+ V  +GV  P++   E L  GE+G+I ASIK ++   VGDTIT +  P   +LPG+K  +P+V+CGL+P+DS ++E  ++A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE+NI LI TAPSVIY + + DG+  ++ + A +PD T    I+EP  KA I+VPD++LG+V++LCQ+ RG  +DL    + R  V Y +PL E+++ F+D+LKS +KGYA+ DY +  YR+  LVK+ +L+N   VDALS ++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRKKKLLE+QK GKK+++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQSTGTVQDRDMKAQMLDAMDIERERGITIKANTVRIDY-KAQNGELYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDAGHEIVPILNKIDLPASECDRVAEQIEDVIGIDASGAIRVSAKTGVGIAETLEAIVKHLPAP-KGDENAPLKAMLVDSWYDAYLGVVVLVRIMDGRMKRGDRIHMIQTEATYNVERIGVFRPQMEKVESLGPGEIGFITASIKQVRDTKVGDTITHEKRPCDKALPGFKPSVPVVFCGLFPVDSNEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYNIELITTAPSVIYHLYMKDGSRRDLHNPADMPDLTYVGHIEEPRIKATILVPDEYLGDVLKLCQDRRGIQMDLTYAGA-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYHLEGYREDSLVKMQVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|91974853|ref|YP_567512.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB5] >gi|91681309|gb|ABE37611.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB5] (644 aa)
Score = 1717, Expect = 0.0e+00, Identities = 337/592 (56%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  ++ REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ D+VK+Q+ED IGLD S+A ++SAKTGL +  ++EAI+ ++PPP   D    L+AL+ DS+YD Y G V LVR+ +G +K G +IR M     + V  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ LNDG+ +EI +   +PD     EI+EP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:    50 IRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQTVRLNYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIVTRLPPP-KGDRGATLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTGAAYDVERVGFFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVKIAEIEEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 640
>gi|186681988|ref|YP_001865184.1| GTP-binding protein LepA [Nostoc punctiforme PCC 73102] >gi|186464440|gb|ACC80241.1| GTP-binding protein LepA [Nostoc punctiforme PCC 73102] (603 aa)
Score = 1717, Expect = 0.0e+00, Identities = 328/592 (55%), Positives = 454/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y   KD Q Y  +LIDTPGHVDF+YEVSRSL ACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+ +RV  ++E+ IGLDCS A L SAK GL I++I+EA++E+IPPP ++  N+ L+AL+FDSYYD+Y+G +   R+ +G V+ G +I  M++ + F +  LGV +P     E L AGEVG++ A+I+ +    VGDTIT     A + LPGY +  PMVYCG++PID+ Q+E  +EALEK+ L+D++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+YKV+   G  L ID+ ++LP     + I+EP+ + E+I P+ ++G++MEL QN RG + D+  +   R  +TY +PLAE++  FFD++KS S+GYA+++Y ++ YR+  LVK+DI++NG+ VD+L+ I+HR+ A +  R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+K++G V VP + F+ +L
  S:     9 IRNFCIIAHIDHGKSTLADRLLQATGTVEDRKMKEQFLDNMDLERERGITIKLQAARMNY-TAKDGQQYVLNLIDTPGHVDFSYEVSRSLVACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPERVIGEIEEIIGLDCSGAILASAKEGLGIDEILEAVVERIPPPPNTI-NERLRALIFDSYYDSYRGVIVYFRVMDGTVRKGDRIHLMASGKEFEIDELGVLSPTQKQVEELHAGEVGYLGAAIRAVADARVGDTITLSKAKAESPLPGYAEANPMVYCGMFPIDADQFEDLREALEKLELNDAALHYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLIITAPSVVYKVITLKGEELYIDNPSRLPSPNDRQRIEEPYVQVEMITPETYVGSLMELSQNRRGIFKDMKYLAQGRTTLTYELPLAEVVTDFFDQMKSRSRGYASMEYHLIGYRENPLVKLDIMINGDPVDSLAMIVHRDKAYNVGRAMAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKSVGTVDVPQEAFMAVL 598
>gi|21230727|ref|NP_636644.1| GTP-binding protein LepA [Xanthomonas campestris pv. campestris str. ATCC 33913] >gi|24211901|sp|Q8PB55|LEPA_XANCP GTP-binding protein lepA >gi|21112320|gb|AAM40568.1| GTP binding protein [Xanthomonas campestris pv. campestris str. ATCC 33913] (601 aa)
Score = 1717, Expect = 0.0e+00, Identities = 326/594 (54%), Positives = 452/594 (76%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + IRNFSI+AH+DHGKSTL+DRII+    L  REM+ Q+LDS  IERERGITIK  +V L Y   KD Q Y+ + IDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQ+++N Y A+E  LE+VPV+NKIDLP+ADI+R K ++E  IG+D  +A  VSAKTGLNI+ ++EAI+ +IPPP   D +K LQAL+ DS++D Y G V LVR+  G++K G+KI+ MS   T +V  +GV TPK      L AGEVGWI ASIK++    VGDT+T  A+PA  +LPG++++ P V+ GL+P+D+  Y   +EAL+K+ L+D++L +E E+S+A+GFG RCGFLG+LHM++++ERL+RE+N+ LI+TAP+V+Y+VL  DGTI+ +D+ +KLP     +EI+EP  +A I+ P D++GN++ LC+  RG  +  +N   ++ +++Y +P+AE++  FFDKLKS S+GYA+LDY  L ++    V+VD L+NG+KVDALS I+HR +A  R R++C K+KE IP+  F++ IQA +G +II+R TV AMRKNVLAKCYGGD++RKKKLLE+QKEGKKR+K +G V +P + F+ +L
  S:     7 RNIRNFSIIAHVDHGKSTLADRIIQLCGGLQAREMEAQVLDSNPIERERGITIKAQSVSLPY-TAKDGQTYFLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAVEQGLEVVPVLNKIDLPTADIERAKAEIEAVIGIDAEDAVAVSAKTGLNIDLVLEAIVHRIPPPKPRDTDK-LQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKIQVMSTGRTHLVDKVGVFTPKRKELVALGAGEVGWINASIKDVHGAPVGDTLTLAADPAPHALPGFQEMQPRVFAGLFPVDAEDYPDLREALDKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERLEREYNLNLISTAPTVVYEVLKTDGTIIPMDNPSKLPPLNHVEEIREPIIRANILTPPDYVGNIITLCEEKRGSQIG-INYLGSQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFLRFQVGPFVRVDTLINGDKVDALSIIVHRSYADRRGRELCEKMKELIPRQMFDVAIQAAVGSQIISRSTVKAMRKNVLAKCYGGDVSRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVL 597
>gi|153005058|ref|YP_001379383.1| GTP-binding protein LepA [Anaeromyxobacter sp. Fw109-5] >gi|166223164|sp|A7HCF3|LEPA_ANADF GTP-binding protein lepA >gi|152028631|gb|ABS26399.1| GTP-binding protein LepA [Anaeromyxobacter sp. Fw109-5] (601 aa)
Score = 1717, Expect = 0.0e+00, Identities = 323/596 (54%), Positives = 442/596 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +IRNFSI+AHIDHGKSTL+DR++E T T++ R  + Q LD+M++ERERGITIK   V++ Y   +D  DY  +LIDTPGHVDF YEVSRSLAACEGA+LVVDA+QGVEAQTL+NVY AL+++LEI+PVINK+DLPSAD+  V+ ++E+ IGLD S A   SAK G+ I  I+E I+ ++PPP   D   PL+A++FDS+YD+Y+G V LVR+  G +    KI+ +SN + F V  LG+  P     + L AGEVG + A++K ++   VGDT+T+   P     PG+K + PMV+ G++PI++  YE  ++ALEK+ L+DS+ T+E ETS ALGFG RCG+LGLLHM++++ERL+RE+N++LI TAPSV+Y+V    G ++EID+ AKLP      +++EP     I    D +G +++LCQ+ RG   DL  + + R ++TY IPLAE+++ FFDKLKS S+GYA+LDYE+  Y + DLVK+DIL+NG  VDALS I+HRE A  R R++C KL+E IPK  +E+ IQA IG KIIARETV A RK+V+AKCYGGDI+RK+KLLE+QKEGKKR+K +G+V +P + F+ +L  E
  S:     7 HIRNFSIIAHIDHGKSTLADRLLEHTGTVSERHAQAQFLDNMELERERGITIKAQTVRMRYR-ARDGVDYELNLIDTPGHVDFAYEVSRSLAACEGAILVVDATQGVEAQTLANVYQALDHDLEIIPVINKVDLPSADVPGVRAEIEEVIGLDASEAVPASAKEGIGIGDILEQIVRKVPPP-KGDPEAPLKAIIFDSWYDSYRGVVMLVRVFEGTLAPKQKIQLVSNRKKFEVQELGIFAPFAKPVQRLTAGEVGIVVANVKEVQDAKVGDTVTEADRPTEDPFPGFKVVKPMVFSGVFPIEAKDYEQLRDALEKLRLNDSAFTFEPETSTALGFGFRCGYLGLLHMEIVQERLEREYNLSLITTAPSVVYRVTDTQGEVVEIDNPAKLPPVQRIAKLEEPHLTCHIHARTDDVGAILQLCQDRRGVQRDLKYLGTKRVQITYDIPLAEVVFDFFDKLKSVSRGYASLDYELKGYEEADLVKLDILINGEPVDALSVIVHRERAYHRGRELCQKLREVIPKQMYEVAIQAAIGAKIIARETVKAFRKDVIAKCYGGDISRKRKLLERQKEGKKRMKQVGSVEIPQEAFLAVLKVE 600
>gi|90185156|sp|Q5FUC2|LEPA_GLUOX GTP-binding protein lepA (600 aa)
Score = 1717, Expect = 0.0e+00, Identities = 325/592 (54%), Positives = 440/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+    LT REMKNQ+LDSM++E+ERGITIK   V+L Y   KD + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+ N EIVPV+NKIDLP+A+ +RV+ Q+ED +G+   +A  +SAKTG+NI  ++EA+++++P P   D   PLQAL+ DS+YDAY G + LVRIK+G++K G +IR M    T+ V  +GV  PK+ + E L  GE+G+I A+IK +   +VGDT+T D  PA  +LPG+K  +P+V+CGL+PID+  +E  +++L K+ L+D+S  +E ETS ALGFG RCGFLGLLH+++I+ERL REFN+ LIATAPSV+YK+ + DGT+ E+ + A +P+ +  + I+EP+ KA I+V D++LG V+ LC   RG  +DL  V   R    Y +PL E+++ F+D+LKS S+GYA+ DY++  Y + DLV++ IL+N   VDALS I HR  A  R R IC KLK+ IPK  F+I IQA IG K+IARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKKR++  G V +P   F+  L
  S:     9 IRNFSIIAHIDHGKSTLADRLIQACGALTAREMKNQVLDSMELEQERGITIKAQTVRLTY-PAKDGKVYTLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDANHEIVPVLNKIDLPAAEPERVRAQIEDVVGIPADDAVEISAKTGINIEGVLEALVQRLPAP-TGDAEAPLQALLVDSWYDAYLGVIILVRIKDGRLKRGDRIRMMQTGATYHVDQVGVFLPKMQSVESLGPGEMGYINAAIKTVADCNVGDTVTLDKRPAEKALPGFKPSIPVVWCGLFPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLSREFNLDLIATAPSVVYKMHMTDGTVEELHNPADMPELSKIEMIEEPWIKATIMVQDEYLGPVLTLCSERRGIQVDLTYV-GNRAMAVYRLPLNEVVFDFYDRLKSISRGYASFDYQMDGYEESDLVRISILVNHEPVDALSFISHRTVAEQRGRSICAKLKDLIPKQLFKIAIQAAIGSKVIARETIGALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQSAFLAAL 597
>gi|58038716|ref|YP_190680.1| GTP-binding protein LepA [Gluconobacter oxydans 621H] >gi|58001130|gb|AAW60024.1| GTP-binding elongation factor LepA [Gluconobacter oxydans 621H] (616 aa)
Score = 1716, Expect = 0.0e+00, Identities = 325/592 (54%), Positives = 440/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+I+    LT REMKNQ+LDSM++E+ERGITIK   V+L Y   KD + Y  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+ N EIVPV+NKIDLP+A+ +RV+ Q+ED +G+   +A  +SAKTG+NI  ++EA+++++P P   D   PLQAL+ DS+YDAY G + LVRIK+G++K G +IR M    T+ V  +GV  PK+ + E L  GE+G+I A+IK +   +VGDT+T D  PA  +LPG+K  +P+V+CGL+PID+  +E  +++L K+ L+D+S  +E ETS ALGFG RCGFLGLLH+++I+ERL REFN+ LIATAPSV+YK+ + DGT+ E+ + A +P+ +  + I+EP+ KA I+V D++LG V+ LC   RG  +DL  V   R    Y +PL E+++ F+D+LKS S+GYA+ DY++  Y + DLV++ IL+N   VDALS I HR  A  R R IC KLK+ IPK  F+I IQA IG K+IARET+ A+ K+V AKCYGGDI+RK+KLL++QKEGKKR++  G V +P   F+  L
  S:    25 IRNFSIIAHIDHGKSTLADRLIQACGALTAREMKNQVLDSMELEQERGITIKAQTVRLTY-PAKDGKVYTLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQALDANHEIVPVLNKIDLPAAEPERVRAQIEDVVGIPADDAVEISAKTGINIEGVLEALVQRLPAP-TGDAEAPLQALLVDSWYDAYLGVIILVRIKDGRLKRGDRIRMMQTGATYHVDQVGVFLPKMQSVESLGPGEMGYINAAIKTVADCNVGDTVTLDKRPAEKALPGFKPSIPVVWCGLFPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLSREFNLDLIATAPSVVYKMHMTDGTVEELHNPADMPELSKIEMIEEPWIKATIMVQDEYLGPVLTLCSERRGIQVDLTYV-GNRAMAVYRLPLNEVVFDFYDRLKSISRGYASFDYQMDGYEESDLVRISILVNHEPVDALSFISHRTVAEQRGRSICAKLKDLIPKQLFKIAIQAAIGSKVIARETIGALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQSAFLAAL 613
>gi|66769277|ref|YP_244039.1| GTP-binding protein LepA [Xanthomonas campestris pv. campestris str. 8004] >gi|188992428|ref|YP_001904438.1| GTP-binding protein LepA [Xanthomonas campestris pv. campestris] >gi|81304764|sp|Q4USF4|LEPA_XANC8 GTP-binding protein lepA >gi|66574609|gb|AAY50019.1| GTP binding protein [Xanthomonas campestris pv. campestris str. 8004] >gi|167734188|emb|CAP52396.1| GTP-binding protein LepA [Xanthomonas campestris pv. campestris] (601 aa)
Score = 1716, Expect = 0.0e+00, Identities = 326/594 (54%), Positives = 451/594 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + IRNFSI+AH+DHGKSTL+DRII+    L  REM+ Q+LDS  IERERGITIK  +V L Y   KD Q Y+ + IDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQ+++N Y A+E  LE+VPV+NKIDLP+ADI+R K ++E  IG+D  +A  VSAKTGLNI+ ++EAI+ +IPPP   D +K LQAL+ DS++D Y G V LVR+  G++K G+KI+ MS   T +V  +GV TPK      L AGEVGWI ASIK++    VGDT+T  A+PA  +LPG++++ P V+ GL+P+D+  Y   +EAL+K+ L+D++L +E E+S+A+GFG RCGFLG+LHM++++ERL+RE+N+ LI+TAP+V+Y+VL  DGTI+ +D+ +KLP     +EI+EP  +A I+ P D++GN++ LC+  RG  +  +N   ++ +++Y +P+AE++  FFDKLKS S+GYA+LDY  L +     V+VD L+NG+KVDALS I+HR +A  R R++C K+KE IP+  F++ IQA +G +II+R TV AMRKNVLAKCYGGD++RKKKLLE+QKEGKKR+K +G V +P + F+ +L
  S:     7 RNIRNFSIIAHVDHGKSTLADRIIQLCGGLQAREMEAQVLDSNPIERERGITIKAQSVSLPY-TAKDGQTYFLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAVEQGLEVVPVLNKIDLPTADIERAKAEIEAVIGIDAEDAVAVSAKTGLNIDLVLEAIVHRIPPPKPRDTDK-LQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKIQVMSTGRTHLVDKVGVFTPKRKELVALGAGEVGWINASIKDVHGAPVGDTLTLAADPAPHALPGFQEMQPRVFAGLFPVDAEDYPDLREALDKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERLEREYNLNLISTAPTVVYEVLKTDGTIIPMDNPSKLPPLNHVEEIREPIIRANILTPPDYVGNIITLCEEKRGSQIG-INYLGSQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFLRFDAGPFVRVDTLINGDKVDALSIIVHRSYADRRGRELCEKMKELIPRQMFDVAIQAAVGSQIISRSTVKAMRKNVLAKCYGGDVSRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVL 597
>gi|189424679|ref|YP_001951856.1| GTP-binding protein LepA [Geobacter lovleyi SZ] >gi|189420938|gb|ACD95336.1| GTP-binding protein LepA [Geobacter lovleyi SZ] (600 aa)
Score = 1716, Expect = 0.0e+00, Identities = 332/597 (55%), Positives = 443/597 (74%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           MD   IRNFSI+AHIDHGKSTL+DR++E+T  LT REM++Q LD MD+ERERGITIK   V+L Y    D   Y  +LIDTPGHVDFTYEVSRSLAACEG LLVVDASQGVEAQTL+NVYLAL+N+LE+ PV+NKIDLP+A+ +RVK ++E+ IG+D  +A L SAK G+   +I+E I+++IP P   D   PL+AL+FDS+YD Y+G + LVR+  G +K G KI+ MS N+ +    +GV +P +V    L AGEVG++ A IK++    VGDT+T         L G+K++ PMV+ GLYPID+ QYE  ++AL K+ L+DSS ++E ETS ALGFG RCGFLGLLHM++I+ERL+REF + LI TAP+V+Y+V   +G +  I SA ++P+    + ++EPF  A I VP+D++G V+ LC++ RG   ++  +  TR  + Y +PL EI+  F+D+LKS +KGYA+LDYE L+YR+ DLV++++L+NG  VDALS I+HR+ A  R R +  K+KE I +  FE+ IQA IG KIIARETV AMRK+VLAKCYGGDITRK+KLLE+QKEGKKR+K +GNV +P + F+ IL
  S:     1 MDISKIRNFSIIAHIDHGKSTLADRLLEYTGALTAREMQSQFLDKMDLERERGITIKAQTVRLNY-TADDGNTYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLALDNDLEVFPVLNKIDLPAAEPERVKHEIEEIIGIDAHDAVLASAKEGIGTREILEEIVKKIPAP-QGDVAAPLKALLFDSWYDQYQGVIILVRLFEGSLKKGDKIQLMSTNKAYEALKVGVFSPVMVEVPQLTAGEVGFVIAGIKDVADAKVGDTVTLLHRQCAEMLGGFKEVKPMVFSGLYPIDTAQYEQLRDALAKLKLNDSSFSFEPETSVALGFGFRCGFLGLLHMEIIQERLEREFGLDLITTAPTVVYRVHKMNGDVYSIQSANQMPELQSTEYLEEPFILAHIHVPNDYVGGVLALCEDKRGVQREIKYLTPTRVMIIYELPLNEIVLDFYDRLKSITKGYASLDYEHLEYRRSDLVRMNVLINGEVVDALSLILHRDKAYFRGRDLVSKMKELISRQMFEVAIQAAIGSKIIARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAIL 595
>gi|39933429|ref|NP_945705.1| GTP-binding protein LepA [Rhodopseudomonas palustris CGA009] >gi|192288786|ref|YP_001989391.1| GTP-binding protein LepA [Rhodopseudomonas palustris TIE-1] >gi|46396182|sp|P60793|LEPA_RHOPA GTP-binding protein lepA >gi|39647275|emb|CAE25796.1| possible GTP-binding protein LepA [Rhodopseudomonas palustris CGA009] >gi|192282535|gb|ACE98915.1| GTP-binding protein LepA [Rhodopseudomonas palustris TIE-1] (603 aa)
Score = 1715, Expect = 0.0e+00, Identities = 337/592 (56%), Positives = 446/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  ++ REM  K Q+LDSMDIERERGITIK   V+L Y    D +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ +++K+Q+ED IGLD S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V LVR+ +G +K G +IR M     + V  +G  TPK+VN E L  GEVG+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DGT +EI +   +PD     EI+EP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F+IPIQA IGGK+IARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQTVRLKYR-AHDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPEKIKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIVTRLPPP-KGDRDATLKALLVDSWYDVYLGVVVLVRVVDGVLKKGQRIRMMGTGAAYDVERVGYFTPKMVNVEELGPGEVGFITAAIKEVADTRVGDTITDDKKPVTDMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVIYKMKLTDGTEMEIHNPVDMPDVVKIAEIEEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 599
>gi|119371384|sp|Q2J2Y0|LEPA_RHOP2 GTP-binding protein lepA (603 aa)
Score = 1715, Expect = 0.0e+00, Identities = 337/592 (56%), Positives = 446/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  ++ REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ D+VK+Q+ED IGLD S+A ++SAKTGL +  ++EAI+ ++PPP   D +  L+AL+ DS+YD Y G V LVR+ +G +K G +IR M  N  + +  +G  TPK+ + + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ L DGT +EI +   +PD     EIQEP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + +Y+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQTVRLNYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIVTRLPPP-QGDRSAQLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERVGYFTPKMTSVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMTLTDGTEMEIHNPVDMPDVVKIAEIQEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTEYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 599
>gi|126461533|ref|YP_001042647.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17029] >gi|126103197|gb|ABN75875.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17029] (602 aa)
Score = 1715, Expect = 0.0e+00, Identities = 322/592 (54%), Positives = 440/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK QILDSM+IERERGITIK N V++ Y   KD + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NKIDLP+A+ +RVK Q+ED IGLD S+A L+SAK+GL I  ++EAI+ ++PPP   D   PL+A++ DS+YDAY G V ++R+ +G ++ G +++ M     + +  L V  P++V+   L  GE+G + ASIK ++   VGDTIT +       LPG+K   P+V+CGL+P+D+  +E  +EA+EK+ L+D+S TYE ETS ALGFG RCGFLGLLH++V+R+RL+RE+++ LI TAPSV+Y++ + DGT+ E+ +   +PD T    I+EP  +A I+VPD++LG+V++LCQ+ RG  LDL +    R  V Y +PL E+++ F+D+LKS +KGYA+ DY+I  YR+  LVK+ IL+N   VDALS ++HR+ A  R R +  KLKE IP+H F+IPIQA IGG++IARET+SAMRK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P   F+  L
  S:    10 IRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMEIERERGITIKANTVRIDY-PAKDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQALDAGHEIVPVLNKIDLPAAEPERVKSQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVHRLPPP-KGDREAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDRLAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCAAPLPGFKPAQPVVFCGLFPVDANDFEALREAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLEREYDLDLITTAPSVVYQIYMKDGTLQELHNPTDMPDLTYVDHIEEPRIRATIMVPDEYLGDVLKLCQDRRGIQLDL-SYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYREDFLVKMSILVNDEPVDALSMMVHRDRADMRGRAMVEKLKELIPRHMFKIPIQAAIGGRVIARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINAL 598
>gi|167471492|ref|ZP_02336196.1| GTP-binding protein LepA [Rickettsia africae ESF-5] (600 aa)
Score = 1714, Expect = 0.0e+00, Identities = 323/595 (54%), Positives = 445/595 (74%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   KD   YY +L+DTPGHVDF YEVSRSLAACEG+LLVVD++QGV AQTL+NVY A+EN+ EIV V+NK+DLP+++ ++VK+Q+ED IG+D S+A L+SAK+G+ I+ ++EAI+ ++PPP +S  +  L+AL+ DS+YD Y G V LVR+ +G ++   +I+ M+ N  + V  +G  TPK    +VL AGE+G+  A+IK +    VGDTITD+  P   +LPG+K  LP+V+CGLYP DS+++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REF++ LI TAPSV+YK+ + DG  LEI + A LP+    + ++EP+ KA I+VPD+FLG V+ LC   RG  LD   + + R K+ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   +LVK+ IL+N   VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA IG +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKKR++  GN+ +P   F+  L
  S:     4 QKYIRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVAAQTLANVYQAIENDHEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSDAVLISAKSGIGIDLVLEAIVNKLPPPKESSSDI-LKALLVDSWYDQYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFTPKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYPTDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDLDLITTAPSVVYKIHMQDGENLEIHNPADLPNLQKIESMEEPWIKATIMVPDEFLGAVLSLCTEKRGMQLDHSYI-ANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELVKLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAAL 595
>gi|146279148|ref|YP_001169307.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17025] >gi|166224516|sp|A4WX88|LEPA_RHOS5 GTP-binding protein lepA >gi|145557389|gb|ABP72002.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17025] (599 aa)
Score = 1714, Expect = 0.0e+00, Identities = 322/592 (54%), Positives = 442/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK QILDSM+IERERGITIK N V++ Y   KD + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NKIDLP+A+ DRV+ Q+ED IGLD S+A L+SAK+GL I  ++EAI+ ++PPP   +   PL+A++ DS+YDAY G V ++R+ +G ++ G +++ M     + +  L V  P++V+   L  GE+G + ASIK ++   VGDTIT +       LPG+K   P+V+CGL+P+D+  +E  +EA+EK+ L+D+S TYE ETS ALGFG RCGFLGLLH++V+R+RL+RE+++ LI TAPSV+Y++ + DGT+ E+ +   +PD TL   I+EP  +A I+VPD++LG+V++LCQ+ RG  LDL +   +R  V Y +PL E+++ F+D+LKS +KGYA+ DY+I  YR+  LVK+ IL+N   VDALS ++HR+ A  R R +  KLKE IP+H F+IPIQA IGG++IARET+SAMRK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P   F+  L
  S:     7 IRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMEIERERGITIKANTVRIEY-PAKDGKTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQALDAGHEIVPVLNKIDLPAAEPDRVRTQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVTRLPPP-KGNREAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDRLAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCEAPLPGFKPAQPVVFCGLFPVDANDFEGLREAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLEREYDLDLITTAPSVVYQIYMRDGTVQELHNPTDMPDLTLVDHIEEPRIRATIMVPDEYLGDVLKLCQDRRGIQLDL-SYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYREDFLVKMSILVNDEPVDALSMMVHRDRADLRGRAMVEKLKELIPRHMFKIPIQAAIGGRVIARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINAL 595
>gi|163813330|ref|ZP_02204903.1| GTP-binding protein LepA [Dehalococcoides sp. VS] >gi|157403040|gb|EDO69187.1| GTP-binding protein LepA [Dehalococcoides sp. VS] (597 aa)
Score = 1713, Expect = 0.0e+00, Identities = 328/595 (55%), Positives = 452/595 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AH+DHGKSTL+DRII+    L  REM+ Q+LDS  IERERGITIK  +V L Y   KD   Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQ+++N Y A+E  LE+VPV+NKIDLP+ADI+R K ++E  IG+D  +A  +SAKTGLN++ ++EAI+++IPPP   D +K LQAL+ DS++D Y G V LVR+  G++K G+KI  MS   T  V  +GV TPK      L AGEVGWI ASIK++    VGDT+T  A+PA T LPG++++ P V+ GL+P+D+  Y   +EALEK+ L+D++L +E E+S+A+GFG RCGFLG+LHM++++ERL+RE+++ LI+TAP+VIY+VL  DGT++ +D+ AKLP   +  EI+EP  +A I+ P D++GNV++LC+  RG  + +  + +++ +++Y +P+AE++  FFDKLKS S+GYA+LDY  L +++   V+VD L+NG+KVDALS I+HR  A  R R++C K+K+ IP+  F++ IQA IG +IIAR TV AMRKNVLAKCYGGDI+RKKKLLE+QKEGKKR+K +G V +P + F+ +LS +
  S:     4 IRNFSIIAHVDHGKSTLADRIIQLCGGLEAREMEAQVLDSNPIERERGITIKAQSVSLPY-KAKDGNTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAVEQGLEVVPVLNKIDLPTADIERAKTEIEAVIGIDAEDAVAISAKTGLNVDLVLEAIVQRIPPPKPRDTDK-LQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKILVMSTGRTHQVDKVGVFTPKRKELAKLGAGEVGWINASIKDVHGAPVGDTLTLAADPAPTPLPGFQEMQPRVFAGLFPVDAEDYPALREALEKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERLEREYDLNLISTAPTVIYEVLKTDGTVIPMDNPAKLPQLNMVAEIREPVIRANILTPPDYIGNVIKLCEEKRGVQIGITYM-ASQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFLRFQEGPFVRVDTLINGDKVDALSIIVHRSHADRRGRELCEKMKDLIPRQMFDVAIQAAIGSQIIARSTVKAMRKNVLAKCYGGDISRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVLSTD 595
>gi|37522332|ref|NP_925709.1| GTP-binding protein LepA [Gloeobacter violaceus PCC 7421] >gi|46396308|sp|Q7NGX4|LEPA_GLOVI GTP-binding protein lepA >gi|35213332|dbj|BAC90704.1| glr2763 [Gloeobacter violaceus PCC 7421] (602 aa)
Score = 1713, Expect = 0.0e+00, Identities = 337/595 (56%), Positives = 460/595 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+DR+++ T T++ R M  Q LD+MD+ERERGITIKL A ++ Y    D + Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTL+NVYLA+ENNLEI+PV+NKIDLP A+ +RV  ++E+ IGL+ + A   SAK G+ I+ I+EAI+ +IPPP D+   +PLQAL+FDSYYDAY+G +   R+ +G VK G KIRFM++ + F +  +GV  P  V  + L AGEVG+IAA+IK ++   VGDTIT  +NPA T LPGY++ +P+V+CGLYP DS Q+E  +EAL+K+ L+D++L +E E+S ALGFG RCGFLGLLHM+V++ERL+RE+++ L+ TAPSV+Y+V   DGT+LE+ + A LP   L   I+EP+ K E+I P +F+G +MEL Q  RG + D+  +  TR  + Y IPLAE++  FFD++KS S+GYA+++Y+++ +R+ +LV++DI+LNG  VD+LS I H + A +  R++  KLKE IP+ QF++PIQA IG K++ARE ++ +RKNVLAKCYGGDI+RKKKLLE+QK+GKKR+K+IG+V VP + F+ +L  E
  S:     9 IRNFSIIAHIDHGKSTLADRLLQVTGTVSDRNMTAQYLDNMDLERERGITIKLQAARMEY-VADDGEKYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLAIENNLEIIPVLNKIDLPGAEPERVLDEIEEIIGLERTGAIRASAKEGIGIHDILEAIVHRIPPPADTV-AEPLQALIFDSYYDAYRGVIVYFRVMSGSVKKGNKIRFMASGKEFEIDEIGVLKPFQVPVDELHAGEVGYIAAAIKLVQDARVGDTITLVSNPAATPLPGYQEAMPVVFCGLYPTDSDQFEDLREALDKLSLNDAALHFEPESSGALGFGFRCGFLGLLHMEVVQERLEREYDLDLVTTAPSVVYRVNKTDGTVLEVQNPADLPPSQLRTSIEEPYVKVELITPQEFVGTLMELSQGRRGIFKDMRYLTPTRTTLIYEIPLAEVITDFFDQMKSRSRGYASMEYQLIGFREGNLVRLDIVLNGEPVDSLSCITHADKAPEVGRQLTAKLKELIPRQQFQVPIQAAIGSKVVARENIAPLRKNVLAKCYGGDISRKKKLLEKQKKGKKRMKSIGSVDVPQEAFMAVLKLE 601
>gi|196185814|gb|EDX80790.1| GTP-binding protein LepA [Brevundimonas sp. BAL3] (589 aa)
Score = 1713, Expect = 0.0e+00, Identities = 324/587 (55%), Positives = 438/587 (74%)
  Q:    11 IVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +VAHIDHGKSTLSDR+I+FT  LT REM  Q+LD+MDIE+ERGITIK   V+L Y   KD QDY  +L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY A++NN EIVPV+NK+DLP+A+ +RV+ Q+ED IG+D S A L SAK+G+ I  ++EAI+ ++P P   D + PL+A++ D++YD Y G V LVR+ +G +K G +++ M N  T ++  +GV  PK    + L  GEVG+I A IK +   +VGDTITD+  P    L G+K++  +V+CGL+P+D+  +E  + A+ K+ L+D+S TYE E+S ALGFG RCGFLGLLH+++I+ERL REFN+ LIATAPSV+YK+ L DG+ +++ + A LPD    + I EP+ KA I+ PD++LG+V++LCQ+ RG+ ++L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DYEI +Y+  DLVK++IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V +KCYGGD TRKKKLLE+QK GKK+++  G V +P + F+  L
  S:     1 MVAHIDHGKSTLSDRLIQFTGGLTAREMSEQVLDNMDIEKERGITIKAQTVRLNYR-AKDGQDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVPVLNKVDLPAAEPERVRAQIEDVIGIDASEAVLCSAKSGIGIEDVLEAIVTKLPAP-KGDPDAPLKAMLVDAWYDPYLGVVVLVRVFDGVLKTGMRVKMMRNGSTHLIDRVGVFLPKNTPVDQLGPGEVGFITAQIKEVAHAAVGDTITDEKKPTAEPLKGFKEVQSVVFCGLFPVDAADFEDLRAAIGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLSREFNLDLIATAPSVVYKIGLRDGSEIDLHNPADLPDVMQIETISEPWIKATILTPDEYLGSVIKLCQDRRGQQIELSYVGA-RAMVVYELPLNEVVFDFYDRLKSISKGYASFDYEITEYKVGDLVKMNILVNAEPVDALSMLVHRARAETRGRGMVEKMKELIPPHLFVIPIQAAIGGKIIARETVRALRKDVTSKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQEAFIAAL 584
>gi|52424426|ref|YP_087563.1| GTP-binding protein LepA [Mannheimia succiniciproducens MBEL55E] >gi|52306478|gb|AAU36978.1| LepA protein [Mannheimia succiniciproducens MBEL55E] (660 aa)
Score = 1713, Expect = 0.0e+00, Identities = 332/594 (55%), Positives = 444/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K IRNFSI+AHIDHGKSTLSDR+I+    L+ REM+ Q+LDSMD+ERERGITIK  +V L Y   K+ + Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E NLE+VP++NKIDLP+AD +RV +++ED +G+D   A   SAKTG+ I  ++E I+ +IP P   D N PLQAL+ DS++D Y G V LVR+KNG ++ G KI+ MS  +T+ V  LG+ TPK V+K  L  GEVGW+  +IK+I    VGDT+T   NPA++ LPG+KK+ P VY GL+P+ S  YE F++AL K+ L+D+SL YE ETS ALGFG RCGFLGLLHM++I+ERL+RE+++ LI TAP+V+Y+V L +G ++ +DS +KLP      EI+EP A+  ++VP ++LGNV+ LC   RG   ++V     +  +TY IP+ E++  FFD+LKS S+GYA+LDY    ++  D+V+VDI++NG +VDAL+ I+H++ A  R R++  K+KE IP+ QF+I IQA IG  IIAR TV  +RKNVLAKCYGGD++RKKKLL++QKEGKKR+K +GNV VP + F+ IL
  S:    63 KNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDSMDLERERGITIKAQSVTLNY-KAKNGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVAKIPAP-KGDPNAPLQALIIDSWFDNYLGVVSLVRVKNGVLRKGDKIKVMSTGQTYNVDRLGIFTPKQVDKNELECGEVGWVVCAIKDILGAPVGDTLTSQHNPASSVLPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPETSTALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVELTNGDVIYVDSPSKLPPLNNISEIREPIAECNMLVPQEYLGNVITLCVEKRGVQTNMV-YHGNQIALTYEIPMGEVVLDFFDRLKSTSRGYASLDYSFKRFQAADMVRVDIMINGERVDALALIVHKDNAPYRGRELVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKRMKQLGNVEVPQEAFLAIL 653
>gi|115522852|ref|YP_779763.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisA53] >gi|122297548|sp|Q07TF1|LEPA_RHOP5 GTP-binding protein lepA >gi|115516799|gb|ABJ04783.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisA53] (603 aa)
Score = 1713, Expect = 0.0e+00, Identities = 336/592 (56%), Positives = 445/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  +T REM  K Q+LDSMDIERERGITIK   V+L YH  KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ + +K+Q+ED IGLD S+A ++SAKTG  + +++EAI+ ++PPP   D    L+AL+ DS+YD Y G V LVR+ +G +K G +IR M  N  + +  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ LNDG+ +EI +   +PD    +EI EP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V AKCYGGD+TRK+KLLE+QKEGKK+L+  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQITGGMTDREMAGKEQVLDSMDIERERGITIKAQTVRLNYH-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPEMIKQQIEDVIGLDASDAVMISAKTGFGVPEVLEAIVTRLPPP-KGDRTASLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERVGYFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVRIQEIDEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKKLRQFGKVDIPQEAFIAAL 599
>gi|21674272|ref|NP_662337.1| GTP-binding protein LepA [Chlorobium tepidum TLS] >gi|25008701|sp|Q8KCH0|LEPA_CHLTE GTP-binding protein lepA >gi|21647442|gb|AAM72679.1| GTP-binding protein LepA [Chlorobium tepidum TLS] (605 aa)
Score = 1713, Expect = 0.0e+00, Identities = 320/593 (53%), Positives = 448/593 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKN-QILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNF I+AHIDHGKSTL+DR++E T+TL   +M   Q+LD MD+ERERGITIK +AVQ+ Y   KD QDY  +LIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQT++N+YLA+E  LEI+PVINKIDLPS+D++ V +Q+ D IG++      VSAK G+ ++ +MEAI+ ++P P D +   PL+AL+FDS +DAY+GA+  +RI +G +K G ++RF +N++ F+   +G  + K    ++L AG VG++  SIK++K   VGDT+T   NPA   L GYK + PMV+ GLYP++S ++E  +E+LEK+ L+D+SL Y  ETS ALGFG RCGFLGLLHM++I+ERL+RE+ + +I T P+V Y+V++  G  +E+D+ +K+P+ T    I+EP+   +II   +++GN+M+L    RGEY +   +D++R  + +  PL E+++ F DKLKS SKGYA++DYE + YR+ DLVK+D+LLNG  VDALS+I+HR  + +  RK+C KLK  IP+  +E+ IQA IG ++IARE++SAMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G V VP + F+ +L+
  S:    11 IRNFCIIAHIDHGKSTLADRLLEVTHTLERNQMSTAQVLDDMDLERERGITIKSHAVQMRY-TAKDGQDYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTIANLYLAIEAGLEIIPVINKIDLPSSDVEGVARQIIDLIGVNRDEILRVSAKNGIGVDDLMEAIVARVPAPAD-NRQMPLRALIFDSVFDAYRGAIAYIRIVDGVLKKGDRVRFFANDKIFMADEIGTMSLKRNPVDILEAGNVGYLICSIKDVKDAKVGDTVTLVENPAAERLAGYKDVKPMVFSGLYPVESNEFEDLRESLEKLSLNDASLVYTPETSAALGFGFRCGFLGLLHMEIIQERLEREYGVNIITTVPNVEYRVIMTSGETVEVDNPSKMPETTKINWIEEPYVSMQIITMSEYIGNIMKLGMERRGEYKNTDYLDTSRVNIHFEFPLGEVVFDFHDKLKSISKGYASMDYEYIGYRRSDLVKLDVLLNGEPVDALSSIVHRSKSYEWGRKLCQKLKGIIPRQMYEVAIQAAIGSRVIARESISAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGRVEVPQEAFLAVLN 602
>gi|58698989|ref|ZP_00373841.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534494|gb|EAL58641.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila ananassae] (598 aa)
Score = 1713, Expect = 0.0e+00, Identities = 326/592 (55%), Positives = 446/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNV-DSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF+I+AHIDHGKSTL+DR+IE  N L  REM NQILDSMDIERERGITIK   V+L Y    D   Y  +L+DTPGHVDF+YEVSRSLAACEG+LLVVD+SQGVEAQTL+NVY A++NN EI+ V+NK+DLP+AD ++VK QVE+ IG+D S + L+SAKTGL I  ++EAI+ ++P P   D N PLQA++ DS+YD Y G V LVR+KNG +K G KI  MSNN T+ +  +G+ TPK V    L AGEVG+I AS+K +    VGDTIT++  P + +LPG+K++ P+V+C ++P  +  ++  +EALEK++L+D+S T+E ETS ALG+G RCGFLG+LH++VI+ERL+REF++ L ATAPSVIY+V    G IL I + + +PD T  + ++EP+  A I+VPD +LG ++ LC+  RGE  DL  + ++T   + Y +PL+E+++ F+D+LKS SKGYA+LD+EI  Y    + K+  L+NG  VDAL+ I+H+  A  R R+IC +LK+ IP+ Q++I IQA +GGKIIARET++  RK+V AK YGGD+TR+ KLLE+QK+GKKRL +IGNV++P + F++ L
  S:     4 IRNFAIIAHIDHGKSTLADRLIEECNGLEAREMINQILDSMDIERERGITIKAQTVKLNY-TANDGNQYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSSQGVEAQTLANVYKAIDNNHEIIVVLNKVDLPAADPEKVKLQVEEVIGIDASESVLISAKTGLGIKDVLEAIVAKLPAP-QGDVNAPLQAILVDSWYDTYLGVVILVRVKNGVLKKGMKIVMMSNNATYQIDNIGIFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPCSEALPGFKEVHPVVFCSIFPHKTDDFKYLREALEKLHLNDASFTFEAETSNALGYGFRCGFLGMLHLEVIQERLEREFDLDLTATAPSVIYRVTTRSGEILNIHNPSDMPDPTKIEIVEEPWITATIMVPDQYLGEILSLCEERRGEQEDLSYIGNTTTALLRYKLPLSEVVFDFYDRLKSISKGYASLDWEISSYLVSQIDKLSFLINGEPVDALACIVHKSRAEKRGREICARLKDLIPRQQYKIAIQAAVGGKIIARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLHSIGNVNIPQNAFIQAL 594
>gi|22326669|ref|NP_196482.2| GTP-binding protein LepA, putative [Arabidopsis thaliana] (681 aa)
Score = 1713, Expect = 0.0e+00, Identities = 321/595 (53%), Positives = 452/595 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+D++++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y    ++  +  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+ ++V +++E+ IGLDCS A   SAK G+ I +I++AI+++IP PLD+   KPL+AL+FDSYYD Y+G +   R+ +G+VK G +I FM++ + +    +GV +P  +  + L AGEVG+IAAS++++    VGDTIT  +  A +SLPGY++  PMV+CGL+P+D+ Q+   ++ALEK+ L+D++L +E ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   +G      + ++LPD    K ++EP+ K E++ P D++G +MEL Q  RGE+ ++  +   R  + Y +PLAE++  FFD+LKS +KGYA+++Y ++ YR+ DL+K+DIL+N   V+ LSTI+HR+ A    R +  KLKE IP+  F++PIQA IG K+IA E +SA+RK+VLAKCYGGDI+RKKKLL++Q  GKKR+KAIG V VP + F+ +L  E
  S:    86 IRNFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKEQFLDNMDLERERGITIKLQAARMRY--VYEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPEKVLREIEEVIGLDCSKAIFCSAKEGIGITEILDAIVQRIPAPLDTA-GKPLRALIFDSYYDPYRGVIVYFRVIDGKVKKGDRIFFMASGKDYFADEVGVLSPNQIQVDELYAGEVGYIAASVRSVADARVGDTITHYSRKAESSLPGYEEATPMVFCGLFPVDADQFPDLRDALEKLQLNDAALKFEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLNLITTAPSVVYRVNSVNGDTTLCSNPSRLPDPGQRKSVEEPYVKIELLTPKDYIGALMELAQERRGEFKEMKYIAENRASILYELPLAEMVGDFFDQLKSRTKGYASMEYSVIGYRESDLIKLDILINAEMVEPLSTIVHRDKAYSVGRALTQKLKELIPRQMFKVPIQACIGSKVIASEALSAIRKDVLAKCYGGDISRKKKLLKKQAAGKKRMKAIGRVDVPQEAFMAVLKLE 677
>gi|149926458|ref|ZP_01914719.1| GTP-binding protein LepA [Limnobacter sp. MED105] >gi|149824821|gb|EDM84035.1| GTP-binding protein LepA [Limnobacter sp. MED105] (599 aa)
Score = 1713, Expect = 0.0e+00, Identities = 326/600 (54%), Positives = 442/600 (73%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           M  ++IRNFSI+AHIDHGKSTL+DR+I+    L+ REM +Q+LDSMDIERERGITIK     L Y   KD   Y  +LIDTPGHVDF+YEVSRSL+ACEGALLVVDASQGVEAQT++N Y AL+  +E++PV+NKIDLP AD +  K ++ED IG+D S A  +SAKTGL ++ ++E I+ ++PP   S D  PLQAL+ DS++D Y G V LVR+ NG +    KI+ M+  +T+I   +GV TPK V ++ L AGEVG+I A IK ++S  VGDT+T    PA   LPG+K++   V+ GL+P++S QYE  +EAL+K+ L+D++L YE E SQALGFG RCGFLG+LHMD+++ERL+REF++ LI TAP+V+Y++   DGTIL +D+ +K+PD +   EI+EP     +++P +++G+VM LC   RG   ++V     + ++T+ +P+AEI+  FFDKLKS S+GYA++DY   +YR  D+VKVD+L+NG KVDALS ++HR  A  R R +  K++E I +  F++ IQA IG  IIARETV A+RKNVLAKCYGGDI+RKKKLLE+QK GKKR+K +GNV +P + F+ IL  E
  S:     1 MQMQHIRNFSIIAHIDHGKSTLADRLIQKCGGLSDREMDSQVLDSMDIERERGITIKAQTAALTY-KAKDGNTYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTALDLGVEVLPVLNKIDLPQADPENAKSEIEDVIGIDASEAIAISAKTGLGVDDVLELIVNKVPPARGSRD-APLQALIIDSWFDNYVGVVMLVRVINGVLNRKDKIKLMATGDTYIADDVGVFTPKSVARDSLSAGEVGYINAGIKLLESAKVGDTVTLAGKPADKPLPGFKEVQSQVFAGLFPVESNQYEALREALDKLRLNDAALNYEPEVSQALGFGFRCGFLGMLHMDIVQERLEREFDMDLITTAPTVVYEIKQRDGTILRVDNPSKMPDLSKVDEIREPIVVVNLLMPQEYVGSVMTLCTGRRGTQTNMV-YHGRQVRITFEMPMAEIVLDFFDKLKSTSRGYASMDYAFKEYRPADIVKVDMLINGEKVDALSIMVHRSNAVYRGRAVAGKMREIISRQMFDVAIQAAIGANIIARETVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAILQVE 597
>gi|9759359|dbj|BAB10014.1| GTP-binding protein LepA homolog [Arabidopsis thaliana] (675 aa)
Score = 1712, Expect = 0.0e+00, Identities = 321/595 (53%), Positives = 452/595 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+D++++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y    ++  +  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+ ++V +++E+ IGLDCS A   SAK G+ I +I++AI+++IP PLD+   KPL+AL+FDSYYD Y+G +   R+ +G+VK G +I FM++ + +    +GV +P  +  + L AGEVG+IAAS++++    VGDTIT  +  A +SLPGY++  PMV+CGL+P+D+ Q+   ++ALEK+ L+D++L +E ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSV+Y+V   +G      + ++LPD    K ++EP+ K E++ P D++G +MEL Q  RGE+ ++  +   R  + Y +PLAE++  FFD+LKS +KGYA+++Y ++ YR+ DL+K+DIL+N   V+ LSTI+HR+ A    R +  KLKE IP+  F++PIQA IG K+IA E +SA+RK+VLAKCYGGDI+RKKKLL++Q  GKKR+KAIG V VP + F+ +L  E
  S:    80 IRNFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKEQFLDNMDLERERGITIKLQAARMRY--VYEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPEKVLREIEEVIGLDCSKAIFCSAKEGIGITEILDAIVQRIPAPLDTA-GKPLRALIFDSYYDPYRGVIVYFRVIDGKVKKGDRIFFMASGKDYFADEVGVLSPNQIQVDELYAGEVGYIAASVRSVADARVGDTITHYSRKAESSLPGYEEATPMVFCGLFPVDADQFPDLRDALEKLQLNDAALKFEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLNLITTAPSVVYRVNSVNGDTTLCSNPSRLPDPGQRKSVEEPYVKIELLTPKDYIGALMELAQERRGEFKEMKYIAENRASILYELPLAEMVGDFFDQLKSRTKGYASMEYSVIGYRESDLIKLDILINAEMVEPLSTIVHRDKAYSVGRALTQKLKELIPRQMFKVPIQACIGSKVIASEALSAIRKDVLAKCYGGDISRKKKLLKKQAAGKKRMKAIGRVDVPQEAFMAVLKLE 671
>gi|21242075|ref|NP_641657.1| GTP-binding protein LepA [Xanthomonas axonopodis pv. citri str. 306] >gi|24211903|sp|Q8PMV3|LEPA_XANAC GTP-binding protein lepA >gi|21107481|gb|AAM36193.1| GTP binding protein [Xanthomonas axonopodis pv. citri str. 306] (601 aa)
Score = 1712, Expect = 0.0e+00, Identities = 323/594 (54%), Positives = 452/594 (76%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + IRNFSI+AH+DHGKSTL+DRII+    L  REM+ Q+LDS  IERERGITIK  +V L Y   KD Q Y+ + IDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQ+++N Y A+E  LE+VPV+NKIDLP+AD+DR K ++E  IG+D  +A  VSAKTGLNI+ ++EAI+ +IPPP   D +K LQAL+ DS++D Y G V LVR+  G++K G+KI  MS   T +V  +GV TPK      L AGEVGWI ASIK++    VGDT+T   +PA  +LPG++++ P V+ GL+P+D+  Y   +EAL+K+ L+D++L +E E+S+A+GFG RCGFLG+LHM++++ERL+RE+N+ LI+TAP+V+Y+VL  DGT++ +D+ AKLP   L +EI+EP  +A ++ P++++GN+++LC+  RG  +  +N   ++ +++Y +P+AE++  FFDKLKS S+GYA+LDY  + +     V+VD+L+NG+KVDALS I+HR  A  R R++C K+K+ IP+  F++ IQA IG +II+R TV AMRKNVLAKCYGGD++RKKKLLE+QKEGKKR+K +G V +P + F+ +L
  S:     7 RNIRNFSIIAHVDHGKSTLADRIIQLCGGLQAREMEAQVLDSNPIERERGITIKAQSVSLPY-TAKDGQTYHLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAVEQGLEVVPVLNKIDLPTADVDRAKAEIEAVIGIDAEDAVAVSAKTGLNIDLVLEAIVHRIPPPKPRDTDK-LQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKILVMSTGRTHLVDKVGVFTPKRKELPALGAGEVGWINASIKDVHGAPVGDTLTLAGDPAPHALPGFQEMQPRVFAGLFPVDAEDYPDLREALDKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERLEREYNLDLISTAPTVVYEVLKTDGTVINMDNPAKLPQLNLVQEIREPIIRANVLTPEEYIGNIIKLCEEKRGTQIG-INYLGSQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFVRFDAGPFVRVDVLINGDKVDALSLIVHRGHADRRGRELCEKMKDLIPRQMFDVAIQAAIGSQIISRSTVKAMRKNVLAKCYGGDVSRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVL 597
>gi|119489820|ref|ZP_01622575.1| GTP-binding protein LepA [Lyngbya sp. PCC 8106] >gi|119454248|gb|EAW35399.1| GTP-binding protein LepA [Lyngbya sp. PCC 8106] (604 aa)
Score = 1712, Expect = 0.0e+00, Identities = 325/592 (54%), Positives = 456/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DR+++ T T+  REMK Q LDSMD+ERERGITIKL A ++ Y   KD   Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+ +RVK+++E+ IGLDCS+A L SAK G+ IN+I+E+I++ +PPP D+   K L+AL+FDSYYD+Y+G +   R+ +G +K G +IR M++ + + +  +G+  P     + L AGEVG++AA+IK ++   VGDTIT   + A   LPGYK+  PMV+CGL+P DS Q+   +EAL+K+ L+DS+L+YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI T+PSV+Y+V    G +L ID+ A LP+    ++I+EP+ + E+I P++++G +M+L Q  RG++ D+  +   R  + Y +PLAE++  FFD++KS S+GYA+++Y ++ YR   LVK+D+++NG+ VD+LS I+HR+ A    R +  KLKE IP+HQF++P+QA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL +Q +GKKR+K++G+V VP + F+ +L
  S:     9 IRNFSIIAHIDHGKSTLADRLLQDTGTVAQREMKEQFLDSMDLERERGITIKLQAARMDY-TAKDGNQYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPERVKEEIEEIIGLDCSDAILASAKEGIGINEILESIVKLVPPPEDTVSQK-LRALIFDSYYDSYRGVIVYFRVMDGTLKKGDRIRLMASKKEYEIDEIGILCPTQKPVDELHAGEVGYVAAAIKAVEDARVGDTITLAKDAAEKPLPGYKEAKPMVFCGLFPTDSDQFPDLREALDKLKLNDSALSYEPETSTAMGFGFRCGFLGLLHMEIVQERLEREYNLDLIVTSPSVVYQVTTLKGEVLMIDNPANLPEPNYREKIEEPYVRVEMITPEEYVGTLMDLGQTRRGDFKDMKYLTLGRTTLVYEVPLAEVVTDFFDQMKSRSRGYASMEYHLIGYRANPLVKLDLMINGDPVDSLSMIVHRDKAYGVGRGMVEKLKELIPRHQFKVPLQATIGSKVIASEHIPALRKDVLAKCYGGDISRKKKLLAKQAKGKKRMKSLGSVDVPQEAFMAVL 598
>gi|196191160|gb|EDX86124.1| GTP-binding protein LepA [Synechococcus sp. PCC 7335] (601 aa)
Score = 1712, Expect = 0.0e+00, Identities = 327/592 (55%), Positives = 458/592 (77%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +RNFSI+AHIDHGKSTL+DR+++ T T++ R+MK Q LDSMDIERERGITIKL A ++ Y   KD + Y  +LIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTL+NVYLA+EN+LE++PV+NK+DLP AD +RVK+++E+ +GLDCSNA + SAK G+ I +I+E+I   +P P D +   P++AL+FDSYYD+Y+G +   R+ +G ++   +IR M++ + + +  LGV +P  V  + L AGEVG+IAASIK+++   VGDTIT    PA   L GY +  PMV+CGL+P DS QYE  +EAL+K+ L+D++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+N+ LI TAPSVIY+V    G ++E+D+ + LP+    ++I+EP+ K +II P++F+G +MELCQ  RG++ D+  +   R  + Y +PLAE++  FFD++KS S+GYA+++Y+++ YR+ +LVK+D+ +NG+ VD L+ I+HR+ A    R +  KLKE IP+HQF+IP+QA IG +IIA E++ A+RK+VLAKCYGGDI+RKKKLL++Q +GKKRLK+IG V VP + F+ +L
  S:     9 LRNFSIIAHIDHGKSTLADRLLQETGTVSARDMKAQFLDSMDIERERGITIKLQAARMRY-TAKDGEQYVLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLAIENDLEVIPVLNKVDLPGADPERVKQEIEEVVGLDCSNAVMASAKEGIGITEILESITYLVPSPAD-NTQAPVRALIFDSYYDSYRGVIVYFRVMDGAIRSRDRIRLMASGKEYDIDELGVLSPNQVPVDELHAGEVGYIAASIKSVEDARVGDTITLVKTPAEEPLAGYIEAKPMVFCGLFPTDSDQYEDLREALDKLRLNDAALQYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYNLDLITTAPSVIYRVYTVQGEVIEVDNPSLLPEPQYREKIEEPYVKVDIITPEEFVGTLMELCQTRRGDFQDMKYLTPGRTTLVYELPLAEVVTDFFDQMKSRSRGYASMEYQLIGYRENNLVKLDVKINGDTVDPLAAIVHRDKAYYVGRALTEKLKELIPRHQFKIPVQASIGSRIIASESIPALRKDVLAKCYGGDISRKKKLLKKQAKGKKRLKSIGTVDVPQEAFMAVL 598
>gi|17230000|ref|NP_486548.1| GTP-binding protein LepA [Nostoc sp. PCC 7120] >gi|24211917|sp|Q8YU48|LEPA_ANASP GTP-binding protein lepA >gi|17131600|dbj|BAB74207.1| GTP-binding elongation factor [Nostoc sp. PCC 7120] (603 aa)
Score = 1712, Expect = 0.0e+00, Identities = 328/592 (55%), Positives = 450/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y   KD Q Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALE+NLEI+PV+NKIDLP A+ DRV  ++E+ IGLDCS A L SAK G+ IN+I+EA++E++PPP ++ D + L+AL+FDSYYD Y+G +   R+ +G VK G ++  M++ + + +  LGV +P       L AGEVG+  A+IK +    VGDTIT     AT +LPGY +  PMV+CG++PID+ Q+E  +EALEK+ L+D++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSV+YKV+   G  L ID+ + LP     + I+EP+ K E+I P+ ++G +MEL QN RG + D+  +   R  +TY IPLAE++  FFD++KS S+GYA+++Y ++ YR+  LVK+DI++NG+ VD+L+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+K++G V VP + F+ +L
  S:     9 IRNFCIIAHIDHGKSTLADRLLQATGTVDERQMKEQFLDNMDLERERGITIKLQAARMNYQ-AKDGQQYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALEHNLEIIPVLNKIDLPGAEPDRVVGEIEEIIGLDCSGAILASAKEGIGINEILEAVVERVPPPPNTVDQR-LRALIFDSYYDIYRGVIVYFRVMDGTVKKGDRVYLMASEKEYEIDELGVLSPTQKPVNELHAGEVGYFGAAIKAVADARVGDTITLCNAKATEALPGYTEANPMVFCGMFPIDADQFEDLREALEKLRLNDAALQYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYDLDLIITAPSVVYKVITTKGEELYIDNPSHLPAPNDRERIEEPYVKVEMITPETYVGTLMELSQNRRGIFKDMKYLTQGRTTLTYEIPLAEVVTDFFDQMKSRSRGYASMEYHLIGYRENPLVKLDIMINGDPVDSLAMIVHRDKAYGMGRSMAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKSVGTVDVPQEAFMAVL 598
>gi|78046929|ref|YP_363104.1| GTP-binding protein LepA [Xanthomonas campestris pv. vesicatoria str. 85-10] >gi|90185217|sp|Q3BVV9|LEPA_XANC5 GTP-binding protein lepA >gi|78035359|emb|CAJ23004.1| GTP-binding protein LepA [Xanthomonas campestris pv. vesicatoria str. 85-10] (596 aa)
Score = 1711, Expect = 0.0e+00, Identities = 322/594 (54%), Positives = 452/594 (76%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + IRNFSI+AH+DHGKSTL+DRII+    L  REM+ Q+LDS  IERERGITIK  +V L Y   KD Q Y+ + IDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQ+++N Y A+E  LE+VPV+NKIDLP+AD+DR K ++E  IG+D  +A  VSAKTGLNI+ ++EAI+ +IPPP   + +K LQAL+ DS++D Y G V LVR+  G++K G+KI  MS   T +V  +GV TPK      L AGEVGWI ASIK++    VGDT+T   +PA  +LPG++++ P V+ GL+P+D+  Y   +EAL+K+ L+D++L +E E+S+A+GFG RCGFLG+LHM++++ERL+RE+N+ LI+TAP+V+Y+VL  DGT++ +D+ AKLP   L +EI+EP  +A ++ P++++GN+++LC+  RG  +  +N   ++ +++Y +P+AE++  FFDKLKS S+GYA+LDY  + +     V+VD+L+NG+KVDALS I+HR  A  R R++C K+K+ IP+  F++ IQA IG +II+R TV AMRKNVLAKCYGGD++RKKKLLE+QKEGKKR+K +G V +P + F+ +L
  S:     2 RNIRNFSIIAHVDHGKSTLADRIIQLCGGLQAREMEAQVLDSNPIERERGITIKAQSVSLPY-TAKDGQTYHLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAVEQGLEVVPVLNKIDLPTADVDRAKAEIEAVIGIDAEDAVAVSAKTGLNIDLVLEAIVHRIPPPKPRETDK-LQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKILVMSTGRTHLVDKVGVFTPKRKELPALGAGEVGWINASIKDVHGAPVGDTLTLAGDPAPHALPGFQEMQPRVFAGLFPVDAEDYPDLREALDKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERLEREYNLDLISTAPTVVYEVLKTDGTVINMDNPAKLPQLNLVQEIREPIIRANVLTPEEYIGNIIKLCEEKRGTQIG-INYLGSQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFVRFDAGPFVRVDVLINGDKVDALSLIVHRSHADRRGRELCEKMKDLIPRQMFDVAIQAAIGSQIISRSTVKAMRKNVLAKCYGGDVSRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVL 592
>gi|119371386|sp|Q13E78|LEPA_RHOPS GTP-binding protein lepA (603 aa)
Score = 1711, Expect = 0.0e+00, Identities = 337/592 (56%), Positives = 444/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREM--KNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSIVAHIDHGKSTL+DR+I+ T  ++ REM  K Q+LDSMDIERERGITIK   V+L Y   KD +DY F+L+DTPGHVDF YEVSRSLAACEG+LLVVDASQGVEAQTL+NVY AL+   EIVPV+NK+DLP+A+ D+VK+Q+ED IGLD S+A ++SAKTGL +  ++EAI+ ++PPP   D    L+AL+ DS+YD Y G V LVR+ +G +K G +IR M     + V  +G  TPK+   + L  GE+G+I A+IK +    VGDTITDD  P T  LPG+K  +P+V+CGL+P+D+  +E  + A+ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL REF++ LIATAPSVIYK+ LNDG+ +EI +   +PD     EI+EP+ +A I+ PD++LG+V++LCQ+ RG   +L  V + R  V Y +PL E+++ F+D+LKS SKGYA+ DY + DY+  DLVK+ IL+N   VDALS ++HR  A  R R +  K+KE IP H F IPIQA IGGKIIARETV A+RK+V AKCYGGDITRK+KLLE+QKEGKK+++  G V +P + F+  L
  S:     9 IRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQTVRLNYR-AKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIVTRLPPP-KGDRGATLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTGAAYDVERVGFFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSREFDLNLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVKIAEIEEPWIEATILTPDEYLGSVLKLCQDRRGNQKELTYVGA-RAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAAL 599
>gi|42520346|ref|NP_966261.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila melanogaster] >gi|99034720|ref|ZP_01314653.1| hypothetical protein Wendoof_01000531 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] >gi|60390052|sp|Q73HR8|LEPA_WOLPM GTP-binding protein lepA >gi|42410084|gb|AAS14195.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila melanogaster] (598 aa)
Score = 1711, Expect = 0.0e+00, Identities = 324/592 (54%), Positives = 447/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNV-DSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF+I+AHIDHGKSTL+DR+IE  N L  REM NQILDSMDIERERGITIK   V+L Y    D   Y  +L+DTPGHVDF+YEVSRSLAACEG+LLVVD+SQGVEAQTL+NVY A++NN EI+ V+NK+DLP+AD ++VK QVE+ IG+D S + L+SAKTGL I  ++EAI+ ++P P   D N PLQA++ DS+YD Y G V LVR+KNG +K G +I  MSNN T+ +  +G+ TPK V    L AGEVG+I AS+K +    VGDTIT++  P + +LPG+K++ P+V+C ++P  +  ++  +EALEK++L+D+S T+E ETS ALG+G RCGFLG+LH++VI+ERL+REF++ L ATAPSVIY+V    G +L I + + +PD T  + ++EP+  A I+VPD +LG+++ LC+  RGE  DL  + ++T   + Y +PL+E+++ F+D+LKS SKGYA+LD+EI  Y    + K+  L+NG  VDAL+ I+H+  A  R R+IC +LK+ IP+ Q++I IQA +GGKIIARET++  RK+V AK YGGD+TR+ KLLE+QK+GKKRL +IGNV++P + F++ L
  S:     4 IRNFAIIAHIDHGKSTLADRLIEECNGLEAREMINQILDSMDIERERGITIKAQTVKLNY-TANDGNQYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSSQGVEAQTLANVYKAIDNNHEIIVVLNKVDLPAADPEKVKLQVEEVIGIDASESVLISAKTGLGIKDVLEAIVAKLPAP-QGDVNAPLQAILVDSWYDTYLGVVILVRVKNGVLKKGMRIVMMSNNATYQIDNIGIFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPCSEALPGFKEVHPVVFCSIFPHKTDDFKYLREALEKLHLNDASFTFEAETSNALGYGFRCGFLGMLHLEVIQERLEREFDLDLTATAPSVIYRVTTRSGEVLNIHNPSDMPDPTKIEIVEEPWITATIMVPDQYLGDILSLCEERRGEQEDLSYIGNTTTALLRYKLPLSEVVFDFYDRLKSISKGYASLDWEISSYLVSQIDKLSFLINGEPVDALACIVHKSRAEKRGREICARLKDLIPRQQYKIAIQAAVGGKIIARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLHSIGNVNIPQNAFIQAL 594
>gi|153166897|ref|ZP_01927353.1| GTP-binding protein LepA [Listeria monocytogenes FSL N1-017] >gi|133727243|gb|EBA28941.1| GTP-binding protein LepA [Listeria monocytogenes FSL N1-017] (574 aa)
Score = 1710, Expect = 0.0e+00, Identities = 326/539 (60%), Positives = 428/539 (79%)
  Q:     3 KKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKI 541
           +K IRNFSI+AHIDHGKSTL+DRI+E T  LT REMKNQ+LDSMD+ERERGITIKLNAVQL Y   KD + Y FHLIDTPGHVDFTYEVSRSLAACEGA+LVVDA+QG+EAQTL+NVYLAL+N+LEI+PVINKIDLP+AD +RV++++ED IGLD S+A L SAK+G+ I  I+E I+E++P P   D NKPL+AL+FDS +DAY+G +  +RI +G VK G +I+ MSN + F V+ +GV +PK   ++ L+ G+VG++ A+IKN+    VGDTIT   NPA  +L GY+K+ PMVYCGLYPIDS++Y   ++ALEK+ L+DS+L +E ETSQALGFG RCGFLGLLHM++I+ER++REFNI LI TAPSVIY V L DG+ + +D+ A++P+  + + ++EP+ KA ++VP+D++G VMEL QN RG ++ +  +D  R  + Y IPL+EI+Y FFD+LKS +KGYA+ DYE++ Y+   LVK+DILLN  KVDALS I+HR+FA +R + I  KLKE IP+ QFE+PIQA I  K+
  S:    10 QKKIRNFSIIAHIDHGKSTLADRILEQTGALTHREMKNQLLDSMDLERERGITIKLNAVQLKY-KAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVREEIEDVIGLDASDAVLASAKSGIGIEDILEQIVEKVPEP-SGDVNKPLKALIFDSVFDAYRGVIANIRIMDGVVKAGDRIKMMSNGKEFEVTEVGVFSPKATPRDELLVGDVGYLTAAIKNVGDTRVGDTITLANNPAEEALDGYRKLNPMVYCGLYPIDSSKYNDLRDALEKLELNDSALQFEAETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDLITTAPSVIYHVNLTDGSNIVVDNPAEMPEPGVIESVEEPYVKATVMVPNDYVGAVMELAQNKRGNFITMEYLDDIRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKASKLVKMDILLNAEKVDALSFIVHRDFAYERGKIIVEKLKELIPRQQFEVPIQAAIATKL 546
>gi|117619540|ref|YP_855341.1| GTP-binding protein LepA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|166223162|sp|A0KGF0|LEPA_AERHH GTP-binding protein lepA >gi|117560947|gb|ABK37895.1| GTP-binding protein LepA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (597 aa)
Score = 1710, Expect = 0.0e+00, Identities = 322/594 (54%), Positives = 442/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K+IRNFSI+AHIDHGKSTLSDR+I+    L+ REM+ Q+LDSMD+ERERGITIK  +V L Y   +D   Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E +LE+VPV+NKIDLP+A+ +RV +++ED +G+D  +A   SAKTGL ++ ++E I+ +IP P + D + PLQAL+ DS++D+Y G V LVRIKNG +K   KI+ MS  + + V  +G+ TPK V+   L  GEVGW+   IK+I    VGDT+T   N A  +L G+KK+ P VY GL+PI S  YE F++AL+K+ L+D+SL +E E+S ALGFG RCGFLG+LHM++I+ERL+RE+++ LI TAP+V+Y++ L DGT + IDS A++P  T  KE++EP A+  I++P +++GNV+ LC   RG   ++V     +  +TY IP+AE++  FFD+LKS S+GYA+LDY    +   D+V++DI++NG +VDAL+ I H+E A  R R++  K++E IP+  F+I IQA IG +IIAR TV A+RK+V AKCYGGD++RKKKLL +QKEGKKR+K++G V VP + F+ IL
  S:     2 KHIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMQAQVLDSMDLERERGITIKAQSVTLNYQ-AQDGNTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAAEPERVAEEIEDIVGIDAVDAVRCSAKTGLGVDLVLEEIVARIPAP-EGDPDAPLQALIIDSWFDSYLGVVSLVRIKNGSLKKNDKIKVMSTGQVWGVDRIGIFTPKQVDTMGLGCGEVGWVVCGIKDIHGAPVGDTLTQAKNGAEKALAGFKKVKPQVYAGLFPISSDDYESFRDALDKLSLNDASLFFEPESSTALGFGFRCGFLGMLHMEIIQERLEREYDLDLITTAPTVVYEIELTDGTTIHIDSPAQMPVITSIKEMREPIAECHILLPQEYMGNVITLCIEKRGVQTNMV-YHGKQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYGFKRFETSDMVRLDIMINGERVDALAIITHKENAQYRGRQVVEKMRELIPRQMFDIAIQAAIGNQIIARSTVKALRKDVTAKCYGGDVSRKKKLLNKQKEGKKRMKSLGRVDVPQEAFLAIL 592
>gi|94498500|ref|ZP_01305056.1| Small GTP-binding protein domain protein [Sphingomonas sp. SKA58] >gi|94422043|gb|EAT07088.1| Small GTP-binding protein domain protein [Sphingomonas sp. SKA58] (601 aa)
Score = 1710, Expect = 0.0e+00, Identities = 324/596 (54%), Positives = 443/596 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D   IRNFSI+AHIDHGKSTL+DR+I+ T  LT REM  Q+LD+MDIE+ERGITIK   V+L Y   KD Q Y  +L+DTPGHVDF YEVSRSLAACEGALLVVDA+QGVEAQTL+NVY ++E++ EIVPVINKIDLP+A+ ++VK ++E+ IGLD S A L SAK+G+ I+ I+EAI+ +IP P   D + PL+A++ DS+YD Y G V LVR+ NG +K G  I+FM      ++  +G   PKI     L  GE+G+I A IK+I    VGDTIT   NPAT  LPG+K++  +V+CGL+P+D+  +E  ++++ K+ L+D+S ++E ETS ALGFG RCGFLGLLH+++I+ERL RE+++ LI TAPSV+Y + + DGT+  + + A +PD    + I+EP+ +A I  PD++LG++++LCQ+ RG   +L  V   R +VTY +PL E+++ F+D+LKS S+GYA+ DY  +  R+ DLVK+ IL+N   VDALS I+HR  A  R R +C +LK+ IP+H F+IPIQA IGGK+IARET++AMRK+V AKCYGGDI+RKKKLL++QKEGKKR++  G+V +P + F+  L
  S:     3 DLSQIRNFSIIAHIDHGKSTLADRLIQRTGGLTDREMSAQVLDNMDIEKERGITIKAQTVRLDY-VAKDGQTYALNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQSIEHDHEIVPVINKIDLPAAEPEKVKAEIEEVIGLDASEAVLASAKSGIGIDDILEAIVTKIPAP-KGDRDAPLEAMLVDSWYDPYLGVVILVRVMNGVIKKGQNIKFMIGGTEHLIDRVGCFRPKIEQLAELGPGEIGFITAQIKDISQTRVGDTITTVKNPATKPLPGFKEVQSVVFCGLFPVDANDFEKLRDSIGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLTREYDLDLITTAPSVVYDMHMKDGTVRHLHNPADMPDPNHIEMIEEPWIEAVIYCPDEYLGSILKLCQDRRGIQKNLTYVGG-RAQVTYELPLNEVVFDFYDRLKSISRGYASFDYHQIGTREGDLVKMSILVNNEPVDALSMIVHRSAAEARGRHMCERLKDLIPRHLFKIPIQAAIGGKVIARETIAAMRKDVTAKCYGGDISRKKKLLDKQKEGKKRMREYGSVQIPQEAFIAAL 595
>gi|119357655|ref|YP_912299.1| GTP-binding protein LepA [Chlorobium phaeobacteroides DSM 266] >gi|166223184|sp|A1BHJ8|LEPA_CHLPD GTP-binding protein lepA >gi|119355004|gb|ABL65875.1| GTP-binding protein LepA [Chlorobium phaeobacteroides DSM 266] (605 aa)
Score = 1709, Expect = 0.0e+00, Identities = 325/594 (54%), Positives = 451/594 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKN-QILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           +IRNF I+AHIDHGKSTL+DR++E TNTL   +M + Q+LD MD+ERERGITIK +AVQ+ Y    D  DY  +LIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQT++N+YLAL+  LEI+PVINKIDLPS+D++ V +Q+ D IG+       VSAK G+ + +++EAI++++P P D + + PL+AL+FDS +D Y+G V  +RI +G +K G K+RF +NN+ F+   +G  + K     VL AG+VG++  SIK++K   VGDT+T   +PA  +L GYK++ PMV+ GLYP++S ++E  +E+LEK+ L+D+SL Y  ETS ALGFG RCGFLGLLHM++I+ERL+RE+ + +I T P+V Y+V+L +G ++ +D+ +K+PD +   +++EP+   +II   D++GN+M+L    RGEY +   +DSTR  + +  PLAEI++ F DKLKS SKGYA++DYE +DYR+ DLVK+D+LLN   VDALS I+HR  A +  RK+C KLK  IPK  +E+ IQA IG ++I+RET+SAMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G V +P + F+ IL+
  S:    10 HIRNFCIIAHIDHGKSTLADRLLEITNTLDRSQMSSAQVLDDMDLERERGITIKSHAVQMKYR-ASDGLDYTLNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTIANLYLALDAGLEIIPVINKIDLPSSDVEGVARQIIDLIGIKRDEILQVSAKAGIGVYELIEAIVKRVPAPSD-NKHLPLRALIFDSVFDIYRGTVAYLRIVDGVLKKGDKVRFFANNKVFLADEIGTMSLKRQPSAVLEAGDVGYLICSIKDVKDAKVGDTVTLSDSPALEALAGYKEVKPMVFSGLYPVNSNEFEDLRESLEKLALNDASLIYTPETSVALGFGFRCGFLGLLHMEIIQERLEREYGVNIITTVPNVEYRVILTNGDVVIVDNPSKMPDTSRIGDVEEPYVSMQIITLSDYIGNIMKLGMERRGEYKNTDYLDSTRVNMHFEFPLAEIVFDFHDKLKSISKGYASMDYEYIDYRQSDLVKLDVLLNAEPVDALSIIVHRSKAYEWGRKLCTKLKGIIPKQMYEVAIQAAIGSRVISRETISAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGRVEIPQEAFLAILT 602
>gi|83954626|ref|ZP_00963337.1| GTP-binding protein LepA [Sulfitobacter sp. NAS-14.1] >gi|83840910|gb|EAP80081.1| GTP-binding protein LepA [Sulfitobacter sp. NAS-14.1] (599 aa)
Score = 1709, Expect = 0.0e+00, Identities = 321/593 (54%), Positives = 447/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ TNT++ R+MK Q+LDSMDIERERGITIK   V++ Y   ++ ++Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP++D DRV +Q+ED IG+D S A  VSAKTG  I + +EAI+ ++P P  + D  PL+A++ DS+YD+Y G + LVRI +GQ+K G +IR M N     V  +GV  P +   + L  GE+G++ ASIK ++   VGDTIT +     T LPG+K   P+V+CGL+P+D+ ++E  ++++EK+ L+D+S ++E ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY + + DGT+ ++ + A +PD T    I+EP  KA I+VPDD+LG+V++LCQ+ RG  +DL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY+++ YR+  LVK+ IL+N   VDALST++HR+ A  R R +  KLK+ IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD +RK+KLL++QK GKK+++  G V +P + F+  L
  S:     6 HIRNFSIVAHIDHGKSTLADRLIQETNTVSLRDMKAQMLDSMDIERERGITIKAQTVRINY-TAQNGEEYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYHAIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIVETLEAIVHKLPAPTGTQD-APLKAMLVDSWYDSYLGVIVLVRIMDGQLKKGDRIRMMQNGSVHHVDRIGVFRPAMTEIDSLNPGEIGFLTASIKQVRDTRVGDTITHEKKGTETPLPGFKPAQPVVFCGLFPVDAAEFEDLRDSIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIDLITTAPSVIYDIHMKDGTVEQLHNPADMPDLTFVDHIEEPRIKATILVPDDYLGDVLKLCQDRRGIQMDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYRQDALVKMSILVNDEPVDALSTMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|193213193|ref|YP_001999146.1| GTP-binding protein LepA [Chlorobaculum parvum NCIB 8327] >gi|193086670|gb|ACF11946.1| GTP-binding protein LepA [Chlorobaculum parvum NCIB 8327] (605 aa)
Score = 1709, Expect = 0.0e+00, Identities = 322/593 (54%), Positives = 447/593 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKN-QILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNF I+AHIDHGKSTL+DR++E T TL   +M   Q+LD MD+ERERGITIK +AVQ+IY +  D ++Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQT++N+YLA+E  LEI+PVINKIDLPS+D++ V +Q+ D IG++      VSAK G+ I ++MEAI+++IP P D +   PL+AL+FDS +DAY+GAV  +RI +G +K   K+RF +N + F    +G  + K   K VL AG VG++  SIK++K   VGDT+T   NPA+  L GYK + PMV+ GLYP++S  +E  +E+LEK+ L+D+SL Y  ETS ALGFG RCGFLGLLHM++I+ERL+RE+ + +I T P+V Y+V++  G  +E+D+ +++P+ T    I+EP+   +II   +++GN+M+L  + RGEY +   +D++R  + +  PL E+++ F DKLKS SKGYA++DYE + YR+ DLVK+D+LLNG  VDALS+I+HR  + +  RK+C KLK  IP+  +E+ IQA IG ++IARET+SAMRKNVLAKCYGGDI+RK+KL+E+QKEGKKR+K +G V VP + F+ +L+
  S:    11 IRNFCIIAHIDHGKSTLADRLLEATQTLARNQMSTAQVLDDMDLERERGITIKSHAVQMIYKS-SDGKEYTLNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTIANLYLAIEAGLEIIPVINKIDLPSSDVEGVARQIIDLIGVNRDEILQVSAKAGIGIGELMEAIVQRIPAPAD-NRQLPLRALIFDSVFDAYRGAVAYIRIVDGVLKKDDKVRFFANGKEFYADEIGTMSLKRQPKNVLEAGNVGYLICSIKDVKDAKVGDTVTLVENPASERLAGYKDVKPMVFSGLYPVESNDFENLRESLEKLSLNDASLVYTPETSAALGFGFRCGFLGLLHMEIIQERLEREYGVNIITTVPNVEYRVVMTSGETVEVDNPSQMPESTKVNWIEEPYVSMQIITMSEYIGNIMKLGMDRRGEYKNTDYLDTSRVSMHFEFPLGEVVFDFHDKLKSISKGYASMDYEYIGYRRSDLVKLDVLLNGEPVDALSSIVHRSKSYEWGRKLCSKLKGIIPRQMYEVAIQAAIGSRVIARETISAMRKNVLAKCYGGDISRKRKLIEKQKEGKKRMKQVGRVEVPQEAFLAVLN 602
>gi|42522423|ref|NP_967803.1| GTP-binding protein LepA [Bdellovibrio bacteriovorus HD100] >gi|39574955|emb|CAE78796.1| GTP-binding protein LepA [Bdellovibrio bacteriovorus HD100] (613 aa)
Score = 1708, Expect = 0.0e+00, Identities = 323/600 (53%), Positives = 454/600 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           MD KYIRNFSI+AHIDHGKSTL+D ++  T +L+ RE K+Q LD+M++ERERGITIK   V L + + KD   Y  +LIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+NVYLA+ENNLEI+PV+NKIDLPSAD + V KQ+EDT+GLDC+     SAK  + I  I+EAI+E++PPP  +D +   +AL+FDS++DAY+G V LVR+ +G +K G KI+FM+ +  + V  +G   P  + ++VL AGEVG+I   IK+I+ + VGDT+T   +PAT  L G+++I PMV+ G++P+ +++YE  K+AL+K+ L+DSSLT+E E S ALGFG RCGFLGLLHM++++ERL+REFN+ LI TAP+V+Y++   DGT + +++ + +P +T   + +EP+ K  +  P D++G +++LC++ RG    +  V   +  + Y +P+ E++  F+D+LKS SKGYA+L+YE + + + DLVK+DIL+NG  +DALS I+HR  A +R R +  K+KE IP+  +++ IQA IG KIIARET+ A+RK+V AKCYGGDI+RK+KLLE+QKEGKKR+KAIG+V VP + F+ IL  E
  S:    15 MDPKYIRNFSIIAHIDHGKSTLADGLLSATGSLSDREKKDQFLDNMELERERGITIKAQTVCLDFKS-KDGNMYQINLIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTLANVYLAMENNLEIIPVLNKIDLPSADPEGVAKQIEDTVGLDCTGIIHASAKEKIGITDILEAIVEKVPPP-KADRSLTPRALIFDSWFDAYQGVVVLVRMVDGVIKKGDKIKFMATDRDYEVLRMGKYKPFPLMQDVLEAGEVGFIVCGIKDIRDVQVGDTVTSAKHPATQPLAGFQRIKPMVFAGIFPVVASEYENLKDALDKLCLNDSSLTFEVEKSAALGFGYRCGFLGLLHMEIVQERLEREFNLDLITTAPTVVYRITKTDGTEMMLENPSGMPVETQIAKFEEPYVKVTLHTPTDYIGGILKLCEDKRGIQQKMEYVTDKKVIIEYKLPMNEMVMDFYDRLKSISKGYASLEYEFVGFEESDLVKLDILINGEAIDALSLIVHRSKAQNRGRLLAEKMKELIPRQMYQVAIQAAIGAKIIARETLGAIRKDVTAKCYGGDISRKRKLLEKQKEGKKRMKAIGHVEVPQEAFLAILKVE 612
>gi|82702874|ref|YP_412440.1| GTP-binding protein LepA [Nitrosospira multiformis ATCC 25196] >gi|119371373|sp|Q2Y873|LEPA_NITMU GTP-binding protein lepA >gi|82410939|gb|ABB75048.1| GTP-binding protein LepA [Nitrosospira multiformis ATCC 25196] (597 aa)
Score = 1708, Expect = 0.0e+00, Identities = 324/594 (54%), Positives = 449/594 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++IRNFSI+AHIDHGKSTL+DRII     L+ REM+ Q+LDSM++ERERGITIK     L Y + +D   Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQT++N Y A+E  +E++PV+NKIDLP+A+ +RV K++ED IG++  +A   SAKTG+ +  I+EA+I +IPPP   +   PL+AL+ DS++D Y G V LVR+ +G +K   +I  M++  T +   +GV TPK  N+E L AGEVG+I + IK +KS  VGDT+T    PA   L G+K+I P V+ GLYP++S QY+  ++ALEK+ L+DSSL YE ETSQALGFG RCGFLGLLH+D+++ERL+RE+++ LI TAP+V+Y+V+L DG+++EI++ ++LPD +  ++I+EP   A I+VP +++G+V+ LC + RG   ++  +   +  +TY IPL E++  FFD+LKS S+GYA+LDYE  ++R  DLVK+DIL+NG +VDALS I+HR  +  R R++  K++E IP+  F+I +QA IG  IIARE++ A+RKNVLAKCYGGDITRK+KLLE+QK GKKR+K +GNV +P + F+ IL
  S:     2 QHIRNFSIIAHIDHGKSTLADRIIHLCGGLSDREMEEQVLDSMELERERGITIKAQTAALEYKS-RDGSSYLLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTVANCYTAIEQGVEVIPVLNKIDLPAAEPERVIKEIEDIIGIEAQDAVRASAKTGVGVEDILEAVISRIPPP-KGNPEAPLKALIIDSWFDNYVGVVMLVRVMDGVLKPKDRILLMASKTTHLCEQVGVFTPKSRNRESLSAGEVGFIISGIKELKSAKVGDTVTLVDRPAPQPLLGFKEIKPQVFAGLYPVESNQYDALRDALEKLKLNDSSLQYEPETSQALGFGFRCGFLGLLHLDIVQERLEREYDMNLITTAPTVVYQVVLRDGSVIEIENPSRLPDLSKIEQIREPIITATILVPQEYVGSVITLCISKRGIQKNMQYM-GRQVMLTYEIPLNEVVMDFFDRLKSTSRGYASLDYEFKEFRASDLVKLDILINGERVDALSLIVHRASSQYRGRELAQKMRELIPRQMFDIAVQAAIGSHIIARESIKALRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKQVGNVEIPQEAFLAIL 592
>gi|193216197|ref|YP_001997396.1| GTP-binding protein LepA [Chloroherpeton thalassium ATCC 35110] >gi|193089674|gb|ACF14949.1| GTP-binding protein LepA [Chloroherpeton thalassium ATCC 35110] (606 aa)
Score = 1708, Expect = 0.0e+00, Identities = 324/593 (54%), Positives = 440/593 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           IRNF I+AHIDHGKSTL+DR+IE T T+  REM NQ+LD MD+ERERGITIK +A+Q+ Y   +  + Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQT++N+YLA++  LEI+PVINKIDLPSADI +V  Q+ + IG         SAK+G+ I +++EAI+ ++P P   +  KPL+AL+FDS +D Y+GA+  +RI  G ++ G K+RF++ ++ F    +G  + K    EVL AG VG++  SIK++K   VGDT+T    PA   LPGY ++ PMV+ GLYP++S ++E  +++LEK+ L+D+SL +  ETS ALGFG RCGFLGLLHM++I+ERL+RE+N+ +I T P+V YK+    G  + +D+ +K+PD +    ++EPF K +II   +++GN+M+L    RGEY D   +D TR  + Y  PL+EI++ F DKLKS SKGYA++DYE   YR+ DLVK+D+LLNG  VDALS+I+HR  A D  RK+CLKLK  IP+  +E+ IQA IG ++IARET+SAMRKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G V VP + F+ +L+
  S:    12 IRNFCIIAHIDHGKSTLADRLIEVTKTVEQREMMNQLLDDMDLERERGITIKSHAIQMNY-VAQSGESYTLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTIANLYLAIDAGLEIIPVINKIDLPSADIPKVSSQIVELIGSREDEIVHASAKSGIGIEEVLEAIVARVPAP-SGEKQKPLRALIFDSVFDIYRGAIAYIRIVEGSLRKGEKVRFLATDKEFYAEEIGTLSMKKQPVEVLAAGNVGYLICSIKDVKDTKVGDTVTSAERPAQKPLPGYMEVKPMVFSGLYPVNSDEFEDLRDSLEKLSLNDASLIFTPETSAALGFGFRCGFLGLLHMEIIQERLEREYNMNIITTVPNVEYKIWTTGGEEILVDNPSKMPDVSKINLVEEPFIKMQIITVTEYIGNIMKLAVERRGEYKDTKYLDPTRASLHYEFPLSEIIFDFHDKLKSTSKGYASMDYEYAGYRESDLVKLDVLLNGETVDALSSIVHRSKAYDWGRKLCLKLKGIIPRQMYEVAIQAAIGNRVIARETISAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGRVEVPQEAFLAVLN 602
>gi|51473472|ref|YP_067229.1| GTP-binding protein LepA [Rickettsia typhi str. Wilmington] >gi|60389957|sp|Q68X95|LEPA_RICTY GTP-binding protein lepA >gi|51459784|gb|AAU03747.1| GTP-binding protein LepA [Rickettsia typhi str. Wilmington] (600 aa)
Score = 1708, Expect = 0.0e+00, Identities = 323/596 (54%), Positives = 439/596 (73%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           ++KYIRNFSI+AHIDHGKSTL+DR+IE    L  REM  Q+LDSMDIE+ERGITIK   V+L+Y   K+   YY +L+DTPGHVDF+YEVSRSLAACEG+LLVVD++QGVEAQTL+NVY A+ N+ EIVPV+NKIDL +++ + VKKQ+ED IG+D S A L+SAK G+ I+ ++EAII ++P P +S  +  L+AL+ DS+YD Y G V LVRI +G ++   +++ +  N  + V  +G  TPK    +VL AGE+G+  ASIK +    VGDTITD+      +LPG+K  +P+V+CG YP DS ++E  K++L K+ L+D+S  YE E+S ALG G RCGFLGLLH+++I+ERL REFN+ LI TAPSVIYK+ + DG  LEI + A LPD      ++EP+ KA I+VPD+F+G V+ LC+  RG  LD   + S R K+ Y +PL EI+Y F+D+LKSCSKGYA+ ++++  Y   DLV + IL+NG  VDALSTI+HR  A  R R +C++LK+ IP+ Q +I IQA +G +IIARET+ A+RK+VL+KCYGGDI+RK+KLLE+QK GKK+++  GN+ +P   F+  L
  S:     3 NQKYIRNFSIIAHIDHGKSTLADRLIEHCGGLNAREMSQQVLDSMDIEKERGITIKAQTVRLVY-KAKNGNTYYLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIANDHEIVPVLNKIDLAASEPEHVKKQIEDIIGIDASEAVLISAKNGIGIDSVLEAIINKLPSPKESSTDT-LKALLVDSWYDPYLGVVILVRIIDGTLRKNMRVKMIGTNSVYTVEHVGFFTPKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEKKSCEQALPGFKPNIPVVFCGFYPTDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFNLDLITTAPSVIYKIYMLDGESLEIHNPADLPDLQKIASMEEPWIKATIMVPDEFIGTVLSLCKEKRGIQLDHSYI-SNRAKIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYELSDLVNLRILVNGEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASVGNRIIARETIKALRKDVLSKCYGGDISRKRKLLEKQKAGKKKMRQYGNIEIPQSAFIAAL 595
>gi|77963372|ref|ZP_00827182.1| COG0481: Membrane GTPase LepA [Yersinia mollaretii ATCC 43969] (599 aa)
Score = 1708, Expect = 0.0e+00, Identities = 328/594 (55%), Positives = 443/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K+IRNFSI+AHIDHGKSTLSDRII+    L+ REM  Q+LDSMD+ERERGITIK  +V L YH  KD Q Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E NLE+VPV+NKIDLP+AD +RV +++ED +G+D ++A   SAKTG+ +  I+E ++  IPPP   D   PLQAL+ DS++D Y G V L+RIKNG ++ G K++ MS  +++    LG+ TPK ++++VL  GEVGW+  +IK+I    VGDT+T   NPA  SLPG+KK+ P VY GL+PI S  YE F++AL K+ L+D+SL YE E+S ALGFG RCGFLGLLHM++I+ERL+RE+++ LI TAP+V+Y+V+  +   + +DS +KLP     +E++EP A+  +++P ++LGNV+ LC   RG   ++V     +  +TY IP+AE++  FFD+LKS S+GYA+LDY    ++  D+V+VD+L+N  +VDAL+ I HR+ A  R R +  K+KE IP+ QF+I IQA IG  IIAR TV  +RKNVLAKCYGGD++RKKKLL++QK+GKKR+K +GNV +P + F+ IL
  S:     2 KHIRNFSIIAHIDHGKSTLSDRIIQICGGLSEREMAAQVLDSMDLERERGITIKAQSVTLDYH-AKDGQTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMNLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVRCSAKTGVGVPDILERLVRDIPPP-KGDPEGPLQALIIDSWFDNYLGVVSLIRIKNGSLRKGDKVKVMSTGQSYNAERLGIFTPKRIDRDVLNCGEVGWLVCAIKDILGAPVGDTLTLTRNPAEKSLPGFKKVKPQVYAGLFPISSDDYEAFRDALGKLSLNDASLFYEPESSTALGFGFRCGFLGLLHMEIIQERLEREYDLELITTAPTVVYEVITTNQETVYVDSPSKLPALNNIEELREPIAECHMLLPQEYLGNVITLCIEKRGMQTNMV-YHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQTSDMVRVDVLINNERVDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKDGKKRMKQVGNVELPQEAFLAIL 592
>gi|194334374|ref|YP_002016234.1| GTP-binding protein LepA [Prosthecochloris aestuarii DSM 271] >gi|194312192|gb|ACF46587.1| GTP-binding protein LepA [Prosthecochloris aestuarii DSM 271] (604 aa)
Score = 1708, Expect = 0.0e+00, Identities = 324/597 (54%), Positives = 445/597 (74%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           D   IRNF I+AHIDHGKSTL+DR++E T TL   +M  Q+LD MD+ERERGITIK +A+Q+ +H   D + Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQT++N+YLA+E  LEI+PVINKIDLPSAD++ V +Q+ D IG+D      VSAK G+ I+ +++A+I ++P P D   + PL+AL+FDS +DAY+GAV  +RI +G ++ G ++RF +N++ F+   +G    K     VL AG VG++  SIK++K   VGDT+T   N A   L GYK + PMV+ GLYP+DS ++E  +E+LEK+ L+D+SL Y  ETS ALGFG RCGFLGLLHM++I+ERL+RE+ + +I T P+V Y+VL  +G  + +D+ +K+P+  L  E++EP+ + +II   D++GNVM+L    RGEY +   +D+ R  + +  PLAEI++ F DKLKS SKGYA++DYE + YR+ DLVK+D+LLNG  VDALST++HR  A +  RK+C KLK  IPK  +E+ IQA IG ++I+RET+SA+RKNVLAKCYGGDI+RK+KLLE+QKEGKKR+K +G V VP + F+ +L+
  S:     7 DVDAIRNFCIIAHIDHGKSTLADRLLEVTGTLQHNQMTAQVLDDMDLERERGITIKSHAIQM-HHKAGDGRAYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTIANLYLAVEAGLEIIPVINKIDLPSADVEGVAQQIIDLIGVDREEIVEVSAKAGIGIDSLLDAVISRVPAPADHR-SMPLRALIFDSVFDAYRGAVVYLRIVDGVLRKGDRVRFFANDKIFVADEIGTMGLKRQPNTVLEAGNVGYLICSIKDVKDAKVGDTVTLADNSAKERLSGYKDVKPMVFSGLYPVDSDEFEDLRESLEKLSLNDASLVYTPETSAALGFGFRCGFLGLLHMEIIQERLEREYKVNIITTVPNVEYRVLRTNGETILVDNPSKMPEAGLISEVEEPYVRIQIITMADYIGNVMKLSMERRGEYKNTDYLDTLRVNLHFEFPLAEIVFDFHDKLKSVSKGYASMDYEYIGYRRSDLVKLDVLLNGEPVDALSTVVHRSKAYEWGRKLCQKLKTIIPKQMYEVAIQAAIGSRVISRETISAIRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGRVEVPQEAFLAVLN 601
>gi|20260118|gb|AAM12957.1| GTP-binding protein LepA homolog [Arabidopsis thaliana] >gi|22136082|gb|AAM91119.1| GTP-binding protein LepA-like protein [Arabidopsis thaliana] (681 aa)
Score = 1707, Expect = 0.0e+00, Identities = 320/595 (53%), Positives = 451/595 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           IRNFSI+AHIDHGKSTL+D++++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y    ++  +  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALENNLEI+PV+NKIDLP A+ ++V +++E+ IGLDCS A   SAK G+ I +I++AI+++IP PLD+   KPL+A++FDSYYD Y+G +   R+ +G+VK G +I FM++ + +    +GV +P  +  + L AGEVG+IAAS++++    VGDTIT  +  A +SLPGY++  PMV+CGL+P+D+ Q+   ++ALEK+ L+D++L +E ETS A+GFG RCGFLGLLHM+ ++ERL+RE+N+ LI TAPSV+Y+V   +G      + ++LPD    K ++EP+ K E++ P D++G +MEL Q  RGE+ ++  +   R  + Y +PLAE++  FFD+LKS +KGYA+++Y ++ YR+ DL+K+DIL+N   V+ LSTI+HR+ A    R +  KLKE IP+  F++PIQA IG K+IA E +SA+RK+VLAKCYGGDI+RKKKLL++Q  GKKR+KAIG V VP + F+ +L  E
  S:    86 IRNFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKEQFLDNMDLERERGITIKLQAARMRY--VYEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPGAEPEKVLREIEEVIGLDCSKAIFCSAKEGIGITEILDAIVQRIPAPLDTA-GKPLRAIIFDSYYDPYRGVIVYFRVIDGKVKKGDRIFFMASGKDYFADEVGVLSPNQIQVDELYAGEVGYIAASVRSVADARVGDTITHYSRKAESSLPGYEEATPMVFCGLFPVDADQFPDLRDALEKLQLNDAALKFEPETSSAMGFGFRCGFLGLLHMETVQERLEREYNLNLITTAPSVVYRVNSVNGDTTLCSNPSRLPDPGQRKSVEEPYVKIELLTPKDYIGALMELAQERRGEFKEMKYIAENRASILYELPLAEMVGDFFDQLKSRTKGYASMEYSVIGYRESDLIKLDILINAEMVEPLSTIVHRDKAYSVGRALTQKLKELIPRQMFKVPIQACIGSKVIASEALSAIRKDVLAKCYGGDISRKKKLLKKQAAGKKRMKAIGRVDVPQEAFMAVLKLE 677
>gi|163740713|ref|ZP_02148106.1| GTP-binding protein LepA [Phaeobacter gallaeciensis 2.10] >gi|161385704|gb|EDQ10080.1| GTP-binding protein LepA [Phaeobacter gallaeciensis 2.10] (604 aa)
Score = 1707, Expect = 0.0e+00, Identities = 325/596 (54%), Positives = 447/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLN-----DGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ T T+  R+MK Q+LDSMDIERERGITIK N V++ Y    D + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD+SQGVEAQTL+NVY AL+ + EIVPV+NKIDLP++D DRV +Q+ED IG+D S A  VSAKTG  I + +EAI++ +P P  + D  PL+A++ DS+YDAY G + LVRI +G +K G +++FMSNN    V  +GV  P +   + L  GE+G++ ASIK ++   VGDTIT+D N    +LPG+K   P+V+CGL+P+DS ++E  ++A++K+ L+D+S ++E ETS ALGFG RCGFLGLLH++VIR+R++RE+NI LI TAPSV+Y V +      +G ++E+ + A +PD +    +QEP  KA I+VPD++LG+V++LCQ+ RG   DL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY++  YR+  LVK+ +L+N   VDALS ++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET+SA+RK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQETGTVEDRDMKEQLLDSMDIERERGITIKANTVRIDY-KADDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSSQGVEAQTLANVYHALDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIRETLEAIVQHLPAPTGTRD-APLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGMRVKFMSNNTLHHVDRIGVFRPAMQVVDQLEPGEIGFLTASIKQVRDTRVGDTITNDRNGTEVALPGFKPAQPVVFCGLFPVDSAEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYNIELITTAPSVVYHVYMKGKEGVEGEMIELHNPADMPDMSKVDHLQEPRIKATILVPDEYLGDVLKLCQDRRGIQEDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMTGYREDALVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 600
>gi|90185158|sp|Q65VN2|LEPA_MANSM GTP-binding protein lepA (599 aa)
Score = 1707, Expect = 0.0e+00, Identities = 332/594 (55%), Positives = 444/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K IRNFSI+AHIDHGKSTLSDR+I+    L+ REM+ Q+LDSMD+ERERGITIK  +V L Y   K+ + Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E NLE+VP++NKIDLP+AD +RV +++ED +G+D   A   SAKTG+ I  ++E I+ +IP P   D N PLQAL+ DS++D Y G V LVR+KNG ++ G KI+ MS  +T+ V  LG+ TPK V+K  L  GEVGW+  +IK+I    VGDT+T   NPA++ LPG+KK+ P VY GL+P+ S  YE F++AL K+ L+D+SL YE ETS ALGFG RCGFLGLLHM++I+ERL+RE+++ LI TAP+V+Y+V L +G ++ +DS +KLP      EI+EP A+  ++VP ++LGNV+ LC   RG   ++V     +  +TY IP+ E++  FFD+LKS S+GYA+LDY    ++  D+V+VDI++NG +VDAL+ I+H++ A  R R++  K+KE IP+ QF+I IQA IG  IIAR TV  +RKNVLAKCYGGD++RKKKLL++QKEGKKR+K +GNV VP + F+ IL
  S:     2 KNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDSMDLERERGITIKAQSVTLNY-KAKNGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVAKIPAP-KGDPNAPLQALIIDSWFDNYLGVVSLVRVKNGVLRKGDKIKVMSTGQTYNVDRLGIFTPKQVDKNELECGEVGWVVCAIKDILGAPVGDTLTSQHNPASSVLPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPETSTALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVELTNGDVIYVDSPSKLPPLNNISEIREPIAECNMLVPQEYLGNVITLCVEKRGVQTNMV-YHGNQIALTYEIPMGEVVLDFFDRLKSTSRGYASLDYSFKRFQAADMVRVDIMINGERVDALALIVHKDNAPYRGRELVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKRMKQLGNVEVPQEAFLAIL 592
>gi|84499539|ref|ZP_00997827.1| GTP-binding protein LepA [Oceanicola batsensis HTCC2597] >gi|84392683|gb|EAQ04894.1| GTP-binding protein LepA [Oceanicola batsensis HTCC2597] (599 aa)
Score = 1706, Expect = 0.0e+00, Identities = 323/596 (54%), Positives = 447/596 (75%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           D  +IRNFSIVAHIDHGKSTL+DR+I+ TNT++ REMK Q+LD+MDIERERGITIK N V++ Y   KD + Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP+++ DRVK+Q+ED IG+D S A LVSAK+G+ I + +EAII ++P P + + + PL+A++ DS+YD Y G V LVRI +G +K G +I+ M     + V  +GV  P +   + L  GE+G++ A IK ++   VGDTIT +     T LPG+K  +P+V+CGL+P+DS ++E  ++A+EK+ L+D+S +YE ETS ALGFG RCGFLGLLH++VIR+R++RE+ I LI TAPSVIY V + DG  +++ + A +PD T    ++EP  KA I+VPDD+LG+V++LCQ+ RG  LDL  V   R    Y +PL E+++ F+D+LKS +KGYA+ DY++  YR+ +LVK+ IL+N   VDALS ++HR+ A  R R +C KLK+ IP+H F+IPIQA IGGK+IARET++A+RK+V AKCYGGD TRK+KLL++QK GKK+++  G V +P + F+  L
  S:     3 DLAHIRNFSIVAHIDHGKSTLADRLIQSTNTVSAREMKEQLLDAMDIERERGITIKANTVRIEY-IAKDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQAIDADHEIVPVLNKIDLPASEPDRVKEQIEDVIGIDASEALLVSAKSGIGIEETLEAIIARLPAP-EGERDAPLKAMLVDSWYDPYLGVVVLVRIMDGVLKKGDQIKMMQTGAKYSVDRIGVFRPAMQVVDELAPGEIGFLTAQIKQVRDTKVGDTITTEKKGCETPLPGFKPSVPVVFCGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYAIELITTAPSVIYHVYMRDGEKIDLHNPADMPDPTHVDHVEEPRIKATIMVPDDYLGDVLKLCQDRRGIQLDLTYVGG-RAMAVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLEGYRQDNLVKMQILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKVIARETLAALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|166712836|ref|ZP_02244043.1| GTP-binding protein LepA [Xanthomonas oryzae pv. oryzicola BLS256] >gi|188577285|ref|YP_001914214.1| GTP-binding protein LepA [Xanthomonas oryzae pv. oryzae PXO99A] >gi|188521737|gb|ACD59682.1| GTP-binding protein LepA [Xanthomonas oryzae pv. oryzae PXO99A] (596 aa)
Score = 1706, Expect = 0.0e+00, Identities = 323/594 (54%), Positives = 450/594 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + IRNFSI+AH+DHGKSTL+DRII+    L  REM+ Q+LDS  IERERGITIK  +V L Y   KD Q Y+ + IDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQ+++N Y A+E  LE+VPV+NKIDLP+AD+DR K ++E  IG+D  +A  VSAKTGLNI+ ++EAI+ +IPPP   D +K LQAL+ DS++D Y G V LVR+  G++K G+KI  MS   T +V  +GV TPK      L AGEVGWI ASIK++    VGDT+T  A+PA  +LPG++++ P V+ GL+P+D+  Y   +EAL+K+ L+D++L +E E+S+A+GFG RCGFLG+LHM++++ERL+RE+N+ LI+TAP+V+Y+VL  DG+++ +D+ +KLP     +EI+EP  +A I+ P D++GN++ LC+  RG  +  +N   ++ +++Y +P+AE++  FFDKLKS S+GYA+LDY  L +     V+VD L+NG+KVDALS I+HR +A  R R++C K+K+ IP+  F++ IQA +G +II+R TV AMRKNVLAKCYGGD++RKKKLLE+QKEGKKR+K +G V +P + F+ +L
  S:     2 RNIRNFSIIAHVDHGKSTLADRIIQLCGGLQAREMEAQVLDSNPIERERGITIKAQSVSLPY-TAKDGQVYHLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAVEQGLEVVPVLNKIDLPTADVDRAKAEIEAVIGIDAEDAVAVSAKTGLNIDLVLEAIVHRIPPPTPRDTDK-LQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKILVMSTGRTHLVDKVGVFTPKRKELSALGAGEVGWINASIKDVHGAPVGDTLTLAADPAPHALPGFQEMQPRVFAGLFPVDAEDYPDLREALDKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERLEREYNLNLISTAPTVVYEVLKTDGSVIPMDNPSKLPPLNNVEEIREPIIRANILTPPDYVGNIITLCEEKRGSQIG-INYLGSQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFLRFDPGPFVRVDTLINGDKVDALSIIVHRSYADRRGRELCEKMKDLIPRQMFDVAIQAAVGSQIISRSTVKAMRKNVLAKCYGGDVSRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVL 592
>gi|58581475|ref|YP_200491.1| GTP-binding protein LepA [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84623405|ref|YP_450777.1| GTP-binding protein LepA [Xanthomonas oryzae pv. oryzae MAFF 311018] >gi|75508235|sp|Q5H1R5|LEPA_XANOR GTP-binding protein lepA >gi|119371417|sp|Q2P4M4|LEPA_XANOM GTP-binding protein lepA >gi|58426069|gb|AAW75106.1| GTP binding protein [Xanthomonas oryzae pv. oryzae KACC10331] >gi|84367345|dbj|BAE68503.1| GTP-Binding protein lepA [Xanthomonas oryzae pv. oryzae MAFF 311018] (601 aa)
Score = 1706, Expect = 0.0e+00, Identities = 323/594 (54%), Positives = 450/594 (75%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           + IRNFSI+AH+DHGKSTL+DRII+    L  REM+ Q+LDS  IERERGITIK  +V L Y   KD Q Y+ + IDTPGHVDF+YEVSRSLAACEGALLVVDA+QGVEAQ+++N Y A+E  LE+VPV+NKIDLP+AD+DR K ++E  IG+D  +A  VSAKTGLNI+ ++EAI+ +IPPP   D +K LQAL+ DS++D Y G V LVR+  G++K G+KI  MS   T +V  +GV TPK      L AGEVGWI ASIK++    VGDT+T  A+PA  +LPG++++ P V+ GL+P+D+  Y   +EAL+K+ L+D++L +E E+S+A+GFG RCGFLG+LHM++++ERL+RE+N+ LI+TAP+V+Y+VL  DG+++ +D+ +KLP     +EI+EP  +A I+ P D++GN++ LC+  RG  +  +N   ++ +++Y +P+AE++  FFDKLKS S+GYA+LDY  L +     V+VD L+NG+KVDALS I+HR +A  R R++C K+K+ IP+  F++ IQA +G +II+R TV AMRKNVLAKCYGGD++RKKKLLE+QKEGKKR+K +G V +P + F+ +L
  S:     7 RNIRNFSIIAHVDHGKSTLADRIIQLCGGLQAREMEAQVLDSNPIERERGITIKAQSVSLPY-TAKDGQVYHLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAVEQGLEVVPVLNKIDLPTADVDRAKAEIEAVIGIDAEDAVAVSAKTGLNIDLVLEAIVHRIPPPAPRDTDK-LQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKILVMSTGRTHLVDKVGVFTPKRKELSALGAGEVGWINASIKDVHGAPVGDTLTLAADPAPHALPGFQEMQPRVFAGLFPVDAEDYPDLREALDKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERLEREYNLNLISTAPTVVYEVLKTDGSVIPMDNPSKLPPLNNVEEIREPIIRANILTPPDYVGNIITLCEEKRGSQIG-INYLGSQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFLRFDPGPFVRVDTLINGDKVDALSIIVHRSYADRRGRELCEKMKDLIPRQMFDVAIQAAVGSQIISRSTVKAMRKNVLAKCYGGDVSRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVL 597
>gi|187601020|ref|ZP_02987250.1| GTP-binding protein LepA [Chloroflexus sp. Y-400-fl] >gi|187486848|gb|EDU24819.1| GTP-binding protein LepA [Chloroflexus sp. Y-400-fl] (639 aa)
Score = 1705, Expect = 0.0e+00, Identities = 316/597 (52%), Positives = 441/597 (73%)
  Q:     2 DKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILS 598
           D+ +IRNFSI+AH+DHGK+TLSDR++E T T++ RE + Q+LDS+D+ERE+GITIKL  V++ Y    D Q Y  +LIDTPGHVDF+YEV+RSLAACEGALLVVDASQG+EAQTL+N YLALEN+L I+PV+NKIDLP A  + V +++E  IG+   +A + SAK G+ I +I+EAI+ +IPPP      +P +AL+FDS+YD YKG +  VR+ +G      ++RFM          LG+  P +     LVAGEVG+IA  +K++    VGDTIT    PA   LPGY+   PMV+ GLYPIDS  Y   +EALE++ L+D++L+++ E+S ALGFG RCGFLGLLHM+++RERL+RE+ + L+ TAPSV Y+VLL+DG I+ + + +++PD++  + I+EP  +  +I P  ++G +MEL    RG ++ +  +D TR  + Y +PLAEI+  F+D+LKS ++GYA+LDY +  Y++ DLVK+DIL+NG  VDALS I+HR+FA  R R +  +L++ IP+  FE+PIQA IG K+IARET+ A+RK+VLAKCYGGD+TRK+KLLE+QKEGKKR+K +G+V +P + F+ ILS
  S:    35 DQLHIRNFSIIAHVDHGKTTLSDRLLEATRTISEREQREQLLDSLDLEREKGITIKLKPVRMEYR-AADGQLYQLNLIDTPGHVDFSYEVNRSLAACEGALLVVDASQGIEAQTLANTYLALENDLVIIPVVNKIDLPGAHPEEVAQEIETVIGIPAEDAIMASAKEGIGIAEILEAIVRRIPPP-RGQRQQPARALIFDSHYDPYKGVIAYVRVVDGAFTSRDRVRFMGTGAQAETLELGIFRPAMTPLNELVAGEVGYIATGLKSVADCQVGDTITLADAPAAEPLPGYRPAKPMVFAGLYPIDSNAYPELREALERLKLNDAALSFQPESSAALGFGFRCGFLGLLHMEIVRERLEREYKLDLLITAPSVEYQVLLSDGEIVTVANPSEMPDQSRVEAIEEPVVEISVIAPVRYIGTIMELVTTRRGTFISMDYLDPTRVLLKYRMPLAEIVIDFYDQLKSRTQGYASLDYHLAGYQEADLVKLDILVNGQPVDALSLIVHRDFAYQRGRDLVERLRQLIPRQMFEVPIQAAIGSKVIARETIRALRKDVLAKCYGGDVTRKRKLLEKQKEGKKRMKMVGSVEIPQEAFMAILS 629
>gi|60416415|sp|P60930|LEPA_BDEBA GTP-binding protein lepA (599 aa)
Score = 1705, Expect = 0.0e+00, Identities = 323/600 (53%), Positives = 454/600 (75%)
  Q:     1 MDKKYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           MD KYIRNFSI+AHIDHGKSTL+D ++  T +L+ RE K+Q LD+M++ERERGITIK   V L + + KD   Y  +LIDTPGHVDF+YEVSRSLAACEGA+LVVDA+QGVEAQTL+NVYLA+ENNLEI+PV+NKIDLPSAD + V KQ+EDT+GLDC+     SAK  + I  I+EAI+E++PPP  +D +   +AL+FDS++DAY+G V LVR+ +G +K G KI+FM+ +  + V  +G   P  + ++VL AGEVG+I   IK+I+ + VGDT+T   +PAT  L G+++I PMV+ G++P+ +++YE  K+AL+K+ L+DSSLT+E E S ALGFG RCGFLGLLHM++++ERL+REFN+ LI TAP+V+Y++   DGT + +++ + +P +T   + +EP+ K  +  P D++G +++LC++ RG    +  V   +  + Y +P+ E++  F+D+LKS SKGYA+L+YE + + + DLVK+DIL+NG  +DALS I+HR  A +R R +  K+KE IP+  +++ IQA IG KIIARET+ A+RK+V AKCYGGDI+RK+KLLE+QKEGKKR+KAIG+V VP + F+ IL  E
  S:     1 MDPKYIRNFSIIAHIDHGKSTLADGLLSATGSLSDREKKDQFLDNMELERERGITIKAQTVCLDFKS-KDGNMYQINLIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTLANVYLAMENNLEIIPVLNKIDLPSADPEGVAKQIEDTVGLDCTGIIHASAKEKIGITDILEAIVEKVPPP-KADRSLTPRALIFDSWFDAYQGVVVLVRMVDGVIKKGDKIKFMATDRDYEVLRMGKYKPFPLMQDVLEAGEVGFIVCGIKDIRDVQVGDTVTSAKHPATQPLAGFQRIKPMVFAGIFPVVASEYENLKDALDKLCLNDSSLTFEVEKSAALGFGYRCGFLGLLHMEIVQERLEREFNLDLITTAPTVVYRITKTDGTEMMLENPSGMPVETQIAKFEEPYVKVTLHTPTDYIGGILKLCEDKRGIQQKMEYVTDKKVIIEYKLPMNEMVMDFYDRLKSISKGYASLEYEFVGFEESDLVKLDILINGEAIDALSLIVHRSKAQNRGRLLAEKMKELIPRQMYQVAIQAAIGAKIIARETLGAIRKDVTAKCYGGDISRKRKLLEKQKEGKKRMKAIGHVEVPQEAFLAILKVE 598
>gi|167750751|ref|ZP_02422878.1| hypothetical protein EUBSIR_01729 [Eubacterium siraeum DSM 15702] >gi|167656186|gb|EDS00316.1| hypothetical protein EUBSIR_01729 [Eubacterium siraeum DSM 15702] (598 aa)
Score = 1705, Expect = 0.0e+00, Identities = 342/592 (57%), Positives = 446/592 (75%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIV-NKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DRI+E T T+  REM+ QILD+MD+ERERGITIK  AV+L Y    D + Y F+LIDTPGHVDF YEVSRSL ACEGA+LVVDA+QG+EAQTL+N YLA+E +LE+VPVINKIDLPSA  D VK+++E  IG+    APL+SAK G+NI ++ME +++ +P P   D N PL+AL+FDSYYDAYKG +  VRIK+G +K G +IR M+    F V  +G    K + N + L AGEVG+IAASIK+I    VGDT+T  +NPA  +L GY+ + PMVY G+YP D  +Y   ++ALEK+ L+D+SLT+E ETS ALGFG RCGFLGLLHM++I+ERL+RE+N+ L+ TAPSV+YK+   DG  + ID+    PD +  +  +EP  KA I  P +++G++M+LCQ  RG + D+  +D  R ++ Y +PL EI+Y FFD LKS +KGYA+ DYE+  +    LVK+DILLNG  VDALS ++H + A  R+RKI  KLK++IP+  FE+PIQA +GGKIIARETV AMRK+VLAKCYGGDITRKKKLLE+QKEGKKR++ +G+V VP + F+ +L
  S:     4 IRNFCIIAHIDHGKSTLADRILEQTETVAHREMEEQILDNMDLERERGITIKARAVRLRY-KADDGETYVFNLIDTPGHVDFNYEVSRSLNACEGAILVVDATQGIEAQTLANTYLAIEQDLELVPVINKIDLPSAHPDEVKEEIETVIGIPADEAPLISAKMGINIKEVMEQVVKNVPAP-KGDPNAPLKALIFDSYYDAYKGVIVYVRIKDGTLKPGDRIRMMATGAEFDVVDVGYMGAKALENAKELRAGEVGYIAASIKSIGDTKVGDTVTLVSNPAKEALAGYRNVNPMVYSGIYPADGAKYGDLRDALEKLQLNDASLTFEPETSIALGFGFRCGFLGLLHMEIIQERLEREYNLDLVTTAPSVVYKITKTDGETIFIDNPTNYPDPSEIEVAEEPMVKANIYTPSEYVGSIMDLCQERRGTFKDMKYLDLNRVEMHYDLPLNEIVYDFFDALKSRTKGYASYDYEMSGFVPSRLVKLDILLNGEVVDALSFVVHADKAYARARKIAEKLKDNIPRQLFEVPIQAAVGGKIIARETVKAMRKDVLAKCYGGDITRKKKLLEKQKEGKKRMRQLGSVEVPQEAFMAVL 594
>gi|71907654|ref|YP_285241.1| GTP-binding protein LepA [Dechloromonas aromatica RCB] >gi|90185151|sp|Q47EG0|LEPA_DECAR GTP-binding protein lepA >gi|71847275|gb|AAZ46771.1| GTP-binding protein LepA [Dechloromonas aromatica RCB] (596 aa)
Score = 1704, Expect = 0.0e+00, Identities = 331/593 (55%), Positives = 447/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSI+AHIDHGKSTL+DRII     L+ REM+ Q+LDSMDIERERGITIK     L Y   +D + Y  +LIDTPGHVDF+YEVSRSL+ACEGALLVVDASQGVEAQT++N Y ALE ++E+VPV+NKIDLPSAD +  ++++ED IG+D S A L SAKTGL +  I+EA++ +IPPP  + D  PL+AL+ DS++D Y G V LVR+ +G +K   K+ FM+     +   +GV  PK   +++L AGEVG++ + IK +K+  VGDTIT     AT +LPG+K+I P V+ GLYP++S QY+  +E+LEK+ L+D+SL YE E SQALGFG RCGFLGLLHM++++ERL+REF+  LI TAP+V+Y+V++ DG+I+E+++ AKLPD T  +E++EP   A I VP D+LGNV+ LC   RG  +D+ +    + K+ Y +P+AE++  FFDKLKSCSKGYA+LDY+  +YR  D+VK+DIL+N  KVDALS I+HR  A  R R++  K++E IP+  +++ IQA IG  II+RE V AMRK+VLAKCYGGDI+RKKKLLE+QK GKKR+K +G+V +P + F+ +L
  S:     3 HIRNFSIIAHIDHGKSTLADRIIHLCGGLSDREMEAQVLDSMDIERERGITIKAQTAALSY-KARDGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTALELDVEVVPVLNKIDLPSADPENARQEIEDVIGIDASEAVLASAKTGLGVEDILEAVVARIPPPKGNPD-APLKALIIDSWFDNYVGVVMLVRVVDGVIKPKDKLLFMATEAEQLCEQVGVFAPKSEKRDMLRAGEVGFVISGIKELKAAKVGDTITTMDRKATEALPGFKEIKPQVFAGLYPVESNQYDSLRESLEKLKLNDASLQYEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFDQDLITTAPTVVYQVVMRDGSIIEVENPAKLPDVTKMEEVREPIITATIFVPQDYLGNVITLCNQKRGNQVDM-HYHGRQVKLVYEMPMAEVVMDFFDKLKSCSKGYASLDYDFKEYRAADVVKLDILINSEKVDALSLIVHRANAQYRGRELASKMRELIPRQMYDVAIQAAIGSHIISRENVKAMRKDVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAVL 592
>gi|154482569|ref|ZP_02025017.1| hypothetical protein EUBVEN_00236 [Eubacterium ventriosum ATCC 27560] >gi|149736594|gb|EDM52480.1| hypothetical protein EUBVEN_00236 [Eubacterium ventriosum ATCC 27560] (573 aa)
Score = 1704, Expect = 0.0e+00, Identities = 326/568 (57%), Positives = 427/568 (75%)
  Q:    30 TNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALG-VNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           T  LT REM+ Q+LD+M++ERERGITIK  AV+ IY   KD ++Y F+LIDTPGHVDF YEVSRSLAAC+GA+LVVDA+QGVEAQTL+NVYLAL+++LE+ PVINKIDLPSAD DRVK ++ED IGL+  +APL+SAKTGLN   ++EAI+E+IP P + D N PLQAL+FDS YDAYKG +   RIK G VK G  I+ M+   T  V  +G     + +  + L AG VG+I ASIKN+    VGDT+TD  NPA   LPGYK++ PMVYCGLYP D  +Y   ++ALEK+ L+D++L +E ETS ALGFG RCGFLGLLH+++I+ERL+RE+N+ L+ TAPSVIYK+   +G ++++ +   LPD +  + ++EP   AEI+V  +F+G +MELCQ  RG Y+ +  V+ +R  + Y IPL EI+Y FFD LKS S+GYA+ DYE+  Y +  LVK+DIL+N  +VDALS I+    A +R RK+C KLK  IP+  FE+PIQA +G K+IARETV AMRK+VLAKCYGGDI+RK+KLLE+QKEGKKR++ +GNV +P   F+ +L
  S:     2 TGLLTNREMQAQVLDNMELERERGITIKSQAVRTIY-KAKDGEEYIFNLIDTPGHVDFNYEVSRSLAACDGAVLVVDAAQGVEAQTLANVYLALDHDLEVFPVINKIDLPSADPDRVKAEIEDVIGLEAHDAPLISAKTGLNCEDVLEAIVEKIPAP-EGDANAPLQALIFDSLYDAYKGVIIFCRIKEGTVKPGMNIKMMATGATANVVEVGYFGAGQFIPCDELPAGMVGYITASIKNVSDTKVGDTVTDADNPADAPLPGYKEVNPMVYCGLYPADGAKYPDLRDALEKLQLNDAALKFEPETSIALGFGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPSVIYKIYKENGEVIDLTNPTNLPDPSEIEHMEEPIVSAEIMVTTEFIGAIMELCQQRRGRYISMEYVEGSRALLKYDIPLNEIIYDFFDALKSRSRGYASFDYELKGYEQAKLVKLDILINKEEVDALSFIVPEASAYERGRKMCEKLKTEIPRQLFEVPIQAAVGSKVIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMRQVGNVEIPQSAFMAVL 568
>gi|78065716|ref|YP_368485.1| GTP-binding protein LepA [Burkholderia sp. 383] >gi|90185145|sp|Q39I75|LEPA_BURS3 GTP-binding protein lepA >gi|77966461|gb|ABB07841.1| GTP-binding protein LepA [Burkholderia sp. 383] (597 aa)
Score = 1704, Expect = 0.0e+00, Identities = 318/596 (53%), Positives = 444/596 (74%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           +IRNFSI+AHIDHGKSTL+DRII+    L  REM+ Q+LDSMDIERERGITIK     L Y   +D + Y  +LIDTPGHVDF+YEVSRSL+ACEGALLVVDASQGVEAQT++N Y A+E  +E+VPV+NKIDLP+A+ +   +++ED IG+D ++A   SAKTGL +  ++E++I ++PPP   D   PLQAL+ DS++D Y G V LVRI NG ++   KI+ M+    + V  +GV TPK  N E L AG+VG+I A IK + +  VGDT+T     A   LPG+K++ P V+ GLYP+++ QY+  +E+LEK+ L+D+SL YE E SQALGFG RCGFLGLLHM++++ERL+REF++ LI TAP+V+Y+V+++DG I+++++ AK+P+    +EI+EP     + +P D++G+V+ LC+  RG  +++      + ++TY IP+AEI+  FFD+LKS S+GYA++DYE  +YR  D+VKVD+L+NG+KVDALS I+HR  +  R R++  K++E IP+  +++ IQA IG  IIARE + A+RKNVLAKCYGGDI+RKKKLLE+QK GKKR+K +G+V +P + F+ IL  E
  S:     3 HIRNFSIIAHIDHGKSTLADRIIQVCGGLADREMEAQVLDSMDIERERGITIKAQTAALSYR-ARDGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPAANPENAIEEIEDVIGIDATDATRCSAKTGLGVEDVLESLIAKVPPP-KGDPAAPLQALIIDSWFDNYVGVVMLVRIVNGTLRPKDKIKLMATGAQYPVEHIGVFTPKSRNLETLSAGQVGFIIAGIKELTAAKVGDTVTHATKAAVEPLPGFKEVKPQVFAGLYPVEANQYDALRESLEKLKLNDASLQYEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFDMDLITTAPTVVYEVMMSDGAIIKVENPAKMPEPPRIEEIREPIVTVNLYMPQDYVGSVITLCEQKRGSQINM-QYHGRQVQLTYEIPMAEIVLDFFDRLKSVSRGYASMDYEFKEYRAADVVKVDMLINGDKVDALSVIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQATIGAHIIARENIKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAILRVE 595
>gi|33593417|ref|NP_881061.1| GTP-binding protein LepA [Bordetella pertussis Tohama I] >gi|34978364|sp|P56865|LEPA_BORPE GTP-binding protein lepA >gi|33572773|emb|CAE42705.1| GTP-binding protein [Bordetella pertussis Tohama I] (597 aa)
Score = 1704, Expect = 0.0e+00, Identities = 320/597 (53%), Positives = 445/597 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           ++IRNFSI+AHIDHGKSTL+DR+I     L  REM  Q+LDSMDIERERGITIK     L Y + +D   Y  +LIDTPGHVDF+YEVSRSL+ACEGALLVVDASQGVEAQT++N Y A+E  +E++PV+NK+DLP AD +  +++VED IG+D S A L SAKTG+ I++I+E+I+ ++PPP   D + PLQAL+ DS++D Y G V LVRI NG +K   KI  M+++ T +   +GV TPK   +  L AGEVG++ A IK ++   VGDTIT    PA   LPG+K++ P V+ GLYP++S++Y+  +++LEK+ L+D++L +E E SQALGFG RCGFLGLLHM++++ERL+REF++ +I TAPSV+Y+V   DGT++ I+S +++P+     +I+EP  K  + +P +++G VM LC N RG  L++ +    +  +TY IPLAEI+  FFDKLKS S+GYA++DYE ++YR  D+VKVD+L+NG++VDAL+ I HR  A  R+R++  +++  IP+  F++ IQA IG ++IARE V A+RKNVLAKCYGGDI+RKKKLLE+QK GKKR+K +G+V +P + F+ IL  E
  S:     2 QHIRNFSIIAHIDHGKSTLADRLIHRCGGLAEREMSAQVLDSMDIERERGITIKAQTASLQYKS-QDGTVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGMEVLPVLNKMDLPQADPEAARQEVEDVIGIDASEAVLASAKTGMGIDEILESIVARVPPP-KGDPSAPLQALIIDSWFDNYVGVVMLVRIVNGVLKPKDKILLMASHATHLCEQIGVFTPKSQPRPELSAGEVGFVIAGIKELEHAKVGDTITLAGKPAAEPLPGFKEVKPQVFAGLYPVESSEYDQLRDSLEKLKLNDAALMFEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFDMDIITTAPSVVYEVEQRDGTVVTIESPSRMPEIAKIADIREPIVKVTLFMPQEYVGPVMTLCNNKRGVQLNM-SYHGRQVHLTYEIPLAEIVLDFFDKLKSVSRGYASMDYEFVEYRSADVVKVDLLINGDRVDALAMIAHRNNARYRAREVVSRMRGLIPRQMFDVAIQAAIGAEVIARENVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAILQVE 595
>gi|15601928|ref|NP_245000.1| GTP-binding protein LepA [Pasteurella multocida subsp. multocida str. Pm70] >gi|13431616|sp|P57806|LEPA_PASMU GTP-binding protein lepA >gi|12720271|gb|AAK02147.1| LepA [Pasteurella multocida subsp. multocida str. Pm70] (598 aa)
Score = 1703, Expect = 0.0e+00, Identities = 330/594 (55%), Positives = 443/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K IRNFSI+AHIDHGKSTLSDR+I+    L+ REM+ Q+LDSMD+ERERGITIK  +V L Y   KD + Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E NLE+VP++NKIDLP+AD +RV +++ED +G+D   A   SAKTG+ I  ++E I+ +IP P + D N PLQAL+ DS++D Y G V LVRIKNG ++ G KI+ MS  +++ V  LG+ TPK V+  +L  GEVGW+  +IK+I    VGDT+T   NPA++ LPG+KK+ P VY GL+PI S  YE F++AL K+ L+D+SL YE E S ALGFG RCGFLGLLHM++I+ERL+RE+++ LI TAP+V+Y+V   DG ++ +DS +KLP      EI+EP A+  +++P  +LGNV+ LC   RG   ++V     +  +TY IP+ E++  FFD+LKS S+GYA+LDY    ++  D+V+VDI++NG +VDAL+ I+H++ A  R R++  K++E IP+ QF+I IQA IG  IIAR TV  +RKNVLAKCYGGD++RKKKLL++QKEGKKR+K++GNV VP + F+ IL
  S:     2 KNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDSMDLERERGITIKAQSVTLNY-KAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVHKIPAP-EGDPNAPLQALIIDSWFDNYLGVVSLVRIKNGTLRKGDKIKVMSTGQSYNVDRLGIFTPKQVDTTILNCGEVGWVVCAIKDILGAPVGDTLTSHNNPASSVLPGFKKVKPQVYAGLFPISSDDYEAFRDALGKLSLNDASLFYEPENSTALGFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVEKTDGEVIYVDSPSKLPPLNNITEIREPIAECNMLLPQTYLGNVITLCVEKRGVQTNMV-YHGNQVALTYEIPMGEVVLDFFDRLKSTSRGYASLDYGFKRFQAADMVRVDIMINGERVDALALIVHKDNAPYRGRELVEKMRELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKRMKSLGNVEVPQEAFLAIL 592
>gi|83943643|ref|ZP_00956101.1| GTP-binding protein LepA [Sulfitobacter sp. EE-36] >gi|83845323|gb|EAP83202.1| GTP-binding protein LepA [Sulfitobacter sp. EE-36] (599 aa)
Score = 1703, Expect = 0.0e+00, Identities = 320/593 (53%), Positives = 447/593 (75%)
  Q:     5 YIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           +IRNFSIVAHIDHGKSTL+DR+I+ TNT++ R+MK Q+LDSMDIERERGITIK   V++ Y   ++ ++Y  +LIDTPGHVDF YEVSRS+ A EG+LLVVD++QGVEAQTL+NVY A++ + EIVPV+NKIDLP++D DRV +Q+ED IG+D S A  VSAKTG  I + +EAI+ ++P P  + D  PL+A++ DS+YD+Y G + LVRI +GQ+K G +IR M N     V  +GV  P +   + L  GE+G++ ASIK ++   VGDTIT +     T LPG+K   P+V+CGL+P+D+ ++E  ++++EK+ L+D+S ++E ETS ALGFG RCGFLGLLH++VIR+R++RE++I LI TAPSVIY + + DGT+ ++ + A +PD T    I+EP  KA I+VPD++LG+V++LCQ+ RG  +DL    S R  V Y +PL E+++ F+D+LKS +KGYA+ DY+++ YR+  LVK+ IL+N   VDALST++HR+ A  R R +  KLK+ IP+H F+IPIQA IGGK+IARET+SAMRK+V AKCYGGD +RK+KLL++QK GKK+++  G V +P + F+  L
  S:     6 HIRNFSIVAHIDHGKSTLADRLIQETNTVSLRDMKAQMLDSMDIERERGITIKAQTVRINY-TAQNGEEYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYHAIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIVETLEAIVHKLPAPKGTQD-APLKAMLVDSWYDSYLGVIVLVRIMDGQLKKGDRIRMMQNGSVHHVDRIGVFRPAMTEIDSLNPGEIGFLTASIKQVRDTRVGDTITHEKKGTETPLPGFKPAQPVVFCGLFPVDAAEFEDLRDSIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIEREYDIDLITTAPSVIYDIHMKDGTVEQLHNPADMPDLTFVDHIEEPRIKATILVPDEYLGDVLKLCQDRRGIQMDLTYAGS-RAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYRQDALVKMSILVNDEPVDALSTMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKVIARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL 595
>gi|16122920|ref|NP_406233.1| GTP-binding protein LepA [Yersinia pestis CO92] >gi|22125195|ref|NP_668618.1| GTP-binding protein LepA [Yersinia pestis KIM] >gi|45442302|ref|NP_993841.1| GTP-binding protein LepA [Yersinia pestis biovar Microtus str. 91001] >gi|51597208|ref|YP_071399.1| GTP-binding protein LepA [Yersinia pseudotuberculosis IP 32953] >gi|108808444|ref|YP_652360.1| GTP-binding protein LepA [Yersinia pestis Antiqua] >gi|108811367|ref|YP_647134.1| GTP-binding protein LepA [Yersinia pestis Nepal516] >gi|149365392|ref|ZP_01887427.1| putative GTP-binding elongation factor [Yersinia pestis CA88-4125] >gi|153947197|ref|YP_001400115.1| GTP-binding protein LepA [Yersinia pseudotuberculosis IP 31758] >gi|162420712|ref|YP_001607933.1| GTP-binding protein LepA [Yersinia pestis Angola] >gi|165925398|ref|ZP_02221230.1| GTP-binding protein LepA [Yersinia pestis biovar Orientalis str. F1991016] >gi|165937189|ref|ZP_02225754.1| GTP-binding protein LepA [Yersinia pestis biovar Orientalis str. IP275] >gi|166008420|ref|ZP_02229318.1| GTP-binding protein LepA [Yersinia pestis biovar Antiqua str. E1979001] >gi|166212316|ref|ZP_02238351.1| GTP-binding protein LepA [Yersinia pestis biovar Antiqua str. B42003004] >gi|167399414|ref|ZP_02304938.1| GTP-binding protein LepA [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167421259|ref|ZP_02313012.1| GTP-binding protein LepA [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423519|ref|ZP_02315272.1| GTP-binding protein LepA [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|167470279|ref|ZP_02334983.1| GTP-binding protein LepA [Yersinia pestis FV-1] >gi|170023433|ref|YP_001719938.1| GTP-binding protein LepA [Yersinia pseudotuberculosis YPIII] >gi|186896305|ref|YP_001873417.1| GTP-binding protein LepA [Yersinia pseudotuberculosis PB1/+] >gi|166987758|sp|A7FFT7|LEPA_YERP3 GTP-binding protein lepA >gi|24211920|sp|Q8ZD74|LEPA_YERPE GTP-binding protein lepA >gi|60389945|sp|Q667U9|LEPA_YERPS GTP-binding protein lepA >gi|119371418|sp|Q1C557|LEPA_YERPA GTP-binding protein lepA >gi|119371419|sp|Q1CKE6|LEPA_YERPN GTP-binding protein lepA >gi|21958060|gb|AAM84869.1|AE013732_1 GTP-binding elongation factor [Yersinia pestis KIM] >gi|45437166|gb|AAS62718.1| putative GTP-binding elongation factor [Yersinia pestis biovar Microtus str. 91001] >gi|51590490|emb|CAH22130.1| putative GTP-binding elongation factor [Yersinia pseudotuberculosis IP 32953] >gi|108775015|gb|ABG17534.1| GTP-binding protein LepA [Yersinia pestis Nepal516] >gi|108780357|gb|ABG14415.1| GTP-binding protein LepA [Yersinia pestis Antiqua] >gi|115348399|emb|CAL21335.1| putative GTP-binding elongation factor [Yersinia pestis CO92] >gi|149291805|gb|EDM41879.1| putative GTP-binding elongation factor [Yersinia pestis CA88-4125] >gi|152958692|gb|ABS46153.1| GTP-binding protein LepA [Yersinia pseudotuberculosis IP 31758] >gi|162353527|gb|ABX87475.1| GTP-binding protein LepA [Yersinia pestis Angola] >gi|165915052|gb|EDR33664.1| GTP-binding protein LepA [Yersinia pestis biovar Orientalis str. IP275] >gi|165923005|gb|EDR40156.1| GTP-binding protein LepA [Yersinia pestis biovar Orientalis str. F1991016] >gi|165992802|gb|EDR45103.1| GTP-binding protein LepA [Yersinia pestis biovar Antiqua str. E1979001] >gi|166206247|gb|EDR50727.1| GTP-binding protein LepA [Yersinia pestis biovar Antiqua str. B42003004] >gi|166960748|gb|EDR56769.1| GTP-binding protein LepA [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051918|gb|EDR63326.1| GTP-binding protein LepA [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057689|gb|EDR67435.1| GTP-binding protein LepA [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169749967|gb|ACA67485.1| GTP-binding protein LepA [Yersinia pseudotuberculosis YPIII] >gi|186699331|gb|ACC89960.1| GTP-binding protein LepA [Yersinia pseudotuberculosis PB1/+] (599 aa)
Score = 1703, Expect = 0.0e+00, Identities = 327/594 (55%), Positives = 445/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K+IRNFSI+AHIDHGKSTLSDRII+    L+ REM  Q+LDSMD+ERERGITIK  +V L YH+ KD Q Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E +LE+VPV+NKIDLP+AD +RV +++ED +G+D ++A   SAKTG+ +  ++E ++  IP P + D N PLQAL+ DS++D Y G V L+RIKNG ++ G K++ MS  +++    LG+ TPK V+++VL  GEVGW+  +IK+I    VGDT+T   NPA  SLPG+KK+ P VY GL+PI S  YE F++AL K+ L+D+SL YE E+S ALGFG RCGFLGLLHM++I+ERL+RE+++ LI TAP+V+Y+V+  +   + +DS +KLP     +E++EP A+  +++P ++LGNV+ LC   RG   ++V     +  +TY IP+AE++  FFD+LKS S+GYA+LDY    ++  D+V+VD+L+N  +VDAL+ I HR+ A  R R +  K+KE IP+ QF+I IQA IG  IIAR TV  +RKNVLAKCYGGD++RKKKLL++QK+GKKR+K +GNV +P + F+ IL
  S:     2 KHIRNFSIIAHIDHGKSTLSDRIIQICGGLSEREMAAQVLDSMDLERERGITIKAQSVTLDYHS-KDGQTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAIRCSAKTGVGVPDVLERLVRDIPAP-EGDPNGPLQALIIDSWFDNYLGVVSLIRIKNGSLRKGDKVKVMSTGQSYNADRLGIFTPKRVDRDVLNCGEVGWLVCAIKDILGAPVGDTLTLTRNPAEKSLPGFKKVKPQVYAGLFPISSDDYESFRDALGKLSLNDASLFYEPESSTALGFGFRCGFLGLLHMEIIQERLEREYDLELITTAPTVVYEVITTNQETVYVDSPSKLPALNNIEELREPIAECHMLLPQEYLGNVITLCIEKRGTQTNMV-YHGKQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQTSDMVRVDVLINNERVDALALITHRDNAQYRGRDLVEKMKELIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKDGKKRMKQVGNVELPQEAFLAIL 592
>gi|75906665|ref|YP_320961.1| GTP-binding protein LepA [Anabaena variabilis ATCC 29413] >gi|119371329|sp|Q3MG20|LEPA_ANAVT GTP-binding protein lepA >gi|75700390|gb|ABA20066.1| GTP-binding protein LepA [Anabaena variabilis ATCC 29413] (603 aa)
Score = 1703, Expect = 0.0e+00, Identities = 327/592 (55%), Positives = 450/592 (76%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNF I+AHIDHGKSTL+DR+++ T T+  R+MK Q LD+MD+ERERGITIKL A ++ Y   KD Q Y  +LIDTPGHVDF+YEVSRSLAACEGALLVVDASQGVEAQTL+NVYLALE+NLEI+PV+NKIDLP A+ DRV  ++E+ IGLDCS A L SAK G+ I++I+EA++E+IPPP ++ D + L+AL+FDSYYD Y+G +   R+ +G VK G ++  M++ + + +  LGV +P     + L AGEVG+  A+IK +    VGDTIT     A  +LPGY +  PMV+CG++PID+ Q+E  +EALEK+ L+D++L YE ETS A+GFG RCGFLGLLHM++++ERL+RE+++ LI TAPSV+YKV+   G  L ID+ + LP     + I+EP+ K E+I P+ ++G +MEL QN RG + D+  +   R  +TY IPLAE++  FFD++KS S+GYA+++Y ++ YR+  LVK+DI++NG+ VD+L+ I+HR+ A    R +  KLKE IP+HQF++PIQA IG K+IA E + A+RK+VLAKCYGGDI+RKKKLL++Q +GKKR+K++G V VP + F+ +L
  S:     9 IRNFCIIAHIDHGKSTLADRLLQATGTVDERQMKEQFLDNMDLERERGITIKLQAARMNYQ-AKDGQQYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALEHNLEIIPVLNKIDLPGAEPDRVIGEIEEIIGLDCSGAILASAKEGIGISEILEAVVERIPPPPNTVDQR-LRALIFDSYYDIYRGVIVYFRVMDGTVKKGDRVYLMASEKEYEIDELGVLSPTQKPVDELHAGEVGYFGAAIKAVADARVGDTITLCNAKAAEALPGYTEANPMVFCGMFPIDADQFEDLREALEKLRLNDAALQYEPETSSAMGFGFRCGFLGLLHMEIVQERLEREYDLDLIITAPSVVYKVITTKGEELYIDNPSHLPAPNDRERIEEPYVKVEMITPETYVGTLMELSQNRRGIFKDMKYLTQGRTTLTYEIPLAEVVTDFFDQMKSRSRGYASMEYHLIGYRENPLVKLDIMINGDPVDSLAMIVHRDKAYGVGRSMAEKLKELIPRHQFKVPIQASIGSKVIASEHIPALRKDVLAKCYGGDISRKKKLLQKQAKGKKRMKSVGTVDVPQEAFMAVL 598
>gi|152981046|ref|YP_001353057.1| GTP-binding protein LepA [Janthinobacterium sp. Marseille] >gi|166223203|sp|A6SXR0|LEPA_JANMA GTP-binding protein lepA >gi|151281123|gb|ABR89533.1| GTP-binding protein LepA [Janthinobacterium sp. Marseille] (597 aa)
Score = 1703, Expect = 0.0e+00, Identities = 318/592 (53%), Positives = 443/592 (74%)
  Q:     6 IRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           IRNFSI+AHIDHGKSTL+DRII+    L+ REM+ Q+LDSMDIERERGITIK     L+Y   +D Q Y  +LIDTPGHVDF+YEVSRSL+ACEGALLVVDASQGVEAQT++N Y AL+  +E+VPV+NKIDLPSAD      ++E+ IG+D S A   SAKTGL +  ++E++I ++PPP   D   PLQAL+ DS++D Y G V LVR+ NG ++   KI  M++    +V ++GV TPK ++++ L AG+VG+I A IK +K+  VGDT+T  + PA   LPG+K++ P V+ GL+P+++ QY+  +++LEK+ L+D++L YE E SQALGFG RCGFLGLLHM++++ERL+REF++ LI TAP+VIY+V+L DG+IL +D+ +K+PD +  +EI+EP     + +P +++G+V+ LC   RG  +D+ +    + K+ Y +P+AEI+  FFDKLKS S+GYA++DYE  +YR  D+VKVD+L+N  KVDAL+ I+HR  +  R R +  K++E IP+  F++ IQA IG  II+RE V A+RKNVLAKCYGGDI+RK+KLLE+QK GKKR+K +G+V +P + F+ IL
  S:     4 IRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDIERERGITIKAQTAALMY-KARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTALDLGVEVVPVLNKIDLPSADPANAIAEIEEVIGIDASEAVHCSAKTGLGVQDVLESLITKVPPP-KGDATAPLQALIVDSWFDNYVGVVMLVRVMNGTLRPKDKILLMASESQHLVESVGVFTPKSISRDTLTAGQVGFIIAGIKELKAAKVGDTVTLASRPAAEPLPGFKEVQPQVFAGLFPVEANQYDALRDSLEKLKLNDAALMYEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFDMDLITTAPTVIYEVVLRDGSILMVDNPSKMPDPSKIEEIREPIVTVNLYMPQEYVGSVITLCTQKRGIQMDM-SYHGKQVKLIYEMPMAEIVLDFFDKLKSTSRGYASMDYEFKEYRSSDVVKVDMLINSEKVDALAIIVHRANSQYRGRAVAAKMRELIPRQMFDVAIQAAIGANIISRENVKALRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAIL 592
>gi|145300363|ref|YP_001143204.1| GTP-binding protein LepA [Aeromonas salmonicida subsp. salmonicida A449] >gi|166223163|sp|A4SRD4|LEPA_AERS4 GTP-binding protein lepA >gi|142853135|gb|ABO91456.1| GTP-binding protein LepA [Aeromonas salmonicida subsp. salmonicida A449] (597 aa)
Score = 1702, Expect = 0.0e+00, Identities = 319/594 (53%), Positives = 442/594 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKIL 597
           K+IRNFSI+AHIDHGKSTLSDR+I+    L++REM+ Q+LDSMD+ERERGITIK  +V L Y   +D   Y  + IDTPGHVDF+YEVSRSLAACEGALLVVDA QGVEAQTL+N Y A+E  LE+VPV+NKIDLP+A+ +RV +++ED +G+D  +A   SAKTGL ++ ++E I+ +IP P+  D + PLQAL+ DS++D+Y G V LVRIKNG +K   KI+ MS  + + V  +G+ TPK V+ + L  GEVGW+   IK+I    VGDT+T   N A  +L G+KK+ P VY GL+PI S  YE F++AL+K+ L+D+SL +E E+S ALGFG RCGFLG+LHM++I+ERL+RE+++ LI TAP+V+Y++ LNDG+ + IDS + +P     KE++EP A+  I++P +++GNV+ LC   RG   ++V     +  +TY IP+AE++  FFD+LKS S+GYA+LDY    +   ++V++DI++NG +VDAL+ I H+E A  R R++  K++E IP+  F+I IQA IG +IIAR TV A+RK+V AKCYGGD++RKKKLL +QKEGKKR+K++G V VP + F+ IL
  S:     2 KHIRNFSIIAHIDHGKSTLSDRLIQTCGGLSSREMQAQVLDSMDLERERGITIKAQSVTLNYQ-AQDGNTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMELEVVPVLNKIDLPAAEPERVAEEIEDIVGIDAIDAVRCSAKTGLGVDLVLEEIVARIPAPV-GDPDAPLQALIIDSWFDSYLGVVSLVRIKNGSLKKNDKIKVMSTGQVWGVDRIGIFTPKQVDTQGLGCGEVGWVVCGIKDIHGAPVGDTLTQAKNGAEKALAGFKKVKPQVYAGLFPISSDDYESFRDALDKLSLNDASLFFEPESSTALGFGFRCGFLGMLHMEIIQERLEREYDLDLITTAPTVVYEIELNDGSTIHIDSPSAMPPVNNIKEMREPIAECNILLPQEYMGNVITLCIEKRGVQTNMV-YHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYGFKRFETSEMVRLDIMINGERVDALAIITHKENAQYRGRQVVEKMRELIPRQMFDIAIQASIGNQIIARSTVKALRKDVTAKCYGGDVSRKKKLLNKQKEGKKRMKSLGRVDVPQEAFLAIL 592
>gi|33597821|ref|NP_885464.1| GTP-binding protein LepA [Bordetella parapertussis 12822] >gi|33602723|ref|NP_890283.1| GTP-binding protein LepA [Bordetella bronchiseptica RB50] >gi|46396343|sp|Q7W5J4|LEPA_BORPA GTP-binding protein lepA >gi|46396344|sp|Q7WD30|LEPA_BORBR GTP-binding protein lepA >gi|33574250|emb|CAE38582.1| GTP-binding protein [Bordetella parapertussis] >gi|33577165|emb|CAE35722.1| GTP-binding protein [Bordetella bronchiseptica RB50] (597 aa)
Score = 1702, Expect = 0.0e+00, Identities = 320/597 (53%), Positives = 445/597 (74%)
  Q:     4 KYIRNFSIVAHIDHGKSTLSDRIIEFTNTLTTREMKNQILDSMDIERERGITIKLNAVQLIYHNPKDNQDYYFHLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLSNVYLALENNLEIVPVINKIDLPSADIDRVKKQVEDTIGLDCSNAPLVSAKTGLNINQIMEAIIEQIPPPLDSDDNKPLQALVFDSYYDAYKGAVCLVRIKNGQVKVGTKIRFMSNNETFIVSALGVNTPKIVNKEVLVAGEVGWIAASIKNIKSISVGDTITDDANPATTSLPGYKKILPMVYCGLYPIDSTQYELFKEALEKIYLSDSSLTYEYETSQALGFGIRCGFLGLLHMDVIRERLDREFNIALIATAPSVIYKVLLNDGTILEIDSAAKLPDKTLYKEIQEPFAKAEIIVPDDFLGNVMELCQNYRGEYLDLVNVDSTRKKVTYLIPLAEIMYSFFDKLKSCSKGYATLDYEILDYRKQDLVKVDILLNGNKVDALSTIMHREFASDRSRKICLKLKEHIPKHQFEIPIQAVIGGKIIARETVSAMRKNVLAKCYGGDITRKKKLLEQQKEGKKRLKAIGNVSVPHDTFVKILSEE 600
           ++IRNFSI+AHIDHGKSTL+DR+I     L  REM  Q+LDSMDIERERGITIK     L Y + +D   Y  +LIDTPGHVDF+YEVSRSL+ACEGALLVVDASQGVEAQT++N Y A+E  +E++PV+NK+DLP AD +  +++VED IG+D S A L SAKTG+ I++I+E+I+ ++PPP   D + PLQAL+ DS++D Y G V LVRI NG +K   KI  M+++ T +   +GV TPK   +  L AGEVG++ A IK ++   VGDTIT    PA   LPG+K++ P V+ GLYP++S++Y+  +++LEK+ L+D++L +E E SQALGFG RCGFLGLLHM++++ERL+REF++ +I TAPSV+Y+V   DGT++ I+S +++P+     +I+EP  K  + +P +++G VM LC N RG  L++ +    +  +TY I