>gi|26553504|ref|NP_757438.1| CTP synthetase [Mycoplasma penetrans HF-2] >gi|26453510|dbj|BAC43842.1| CTP synthetase [Mycoplasma penetrans HF-2] (535 aa)
Score = 2673, Expect = 0.0e+00, Identities = 534/535 (99%), Positives = 535/535 (100%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           +NDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI
  S:     1 MNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
>gi|171323802|ref|ZP_02912320.1| CTP synthase [Geobacillus sp. WCH70] >gi|171090113|gb|EDT36425.1| CTP synthase [Geobacillus sp. WCH70] (531 aa)
Score = 1349, Expect = 8.5e-147, Identities = 262/529 (49%), Positives = 359/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   I KER G +LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    ++KTKP QHSVK+L S GI PN+++VR++  +S  +KEKI+L   I+ + +    +   +Y +P  L+ QK+   +    K++         W      ++   +   +IA+VGKY +  DAY+S++ +L  + +   TD+ I++INS  +N+ N ++L S+ D ILVPGGFG R IEGKI AI+YARE  +PF GICLGMQLASIEFARNV+ + +A S EF+ NT +PII +L  +    +LGGTLRLG Y C+L +G+   E Y+ + I ERHRHRYEFN +Y  I E++GFVFSG + +  LVEIIEL++H +F+A QFHPEFTS+   P P+F  F+  S K
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSAVIKKERRGDYLGGTVQVIPHITNEIKERVFRAGQETNADVVITEIGGTVGDIESLPFLEAIRQIKSDVGRDNVMYIHCTLVPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPISQDMKEKIALFCDIDPKAVIEARDADTLYAVPLMLQEQKLDQIVCEHLKLDC-KEADMTEWKALVEKVRNLSR-TTKIALVGKYVELQDAYISVVEALRHAGYAFDTDIDIKWINSEHVNKENAADLLSDADGILVPGGFGDRGIEGKIEAIRYAREQKVPFLGICLGMQLASIEFARNVVGLKEAHSAEFDPNTPHPIIDLLPEQKDIEDLGGTLRLGLYPCKLSEGTLAYEAYQDEVIYERHRHRYEFNNQYRQIMEQYGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPEFTSRPTRPQPLFRDFIKASLK 530
>gi|126652582|ref|ZP_01724746.1| CTP synthetase [Bacillus sp. B14905] >gi|126590573|gb|EAZ84690.1| CTP synthetase [Bacillus sp. B14905] (530 aa)
Score = 1341, Expect = 7.4e-146, Identities = 263/529 (49%), Positives = 356/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKE-PKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G EV I KFDPY+N+D GTM+P QHGEVFVT DG E DLD+G+YERF++INL K S VT+GRVY   + KER G + G T+QV+PHIT  I  +I     +   D +I EVGGTVGDIES+PFLEA RQ++     + VM+IH   +  +    +LKTKP QHSVK+L S GI PN+++VR++  V   +KEK++L   ++   I    + +H+Y +P +L  Q + + + + F ME P     + W      +K  P K K  +A+VGKY +  DAY+S++ +L+ + +   +D+ I++IN+  +N +N++ L  + DAILVPGGFG R +EGKILA Q+ARENN+PF GICLGMQLA+IE+ARNVL +  A STE + NT  PII  L  +N   ++GGTLRLG Y C+LKDGSK  E Y ++ + ERHRHRYEFN +Y +  E  G VFSG + +  LVEIIEL  + FF+A QFHPE  S+   P P+F  F+  + K
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLEVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAEADLDLGHYERFIDINLGKHSTVTSGRVYQSVLQKERRGDYNGGTVQVIPHITNEIKDRIQRAGRETNADVVITEVGGTVGDIESLPFLEAIRQMKTNLGHNNVMYIHCTLIPYIKAAGELKTKPTQHSVKELRSLGIQPNIIVVRTEQEVPQDMKEKLALFCDVQPHEIIESRDAEHLYEVPLNLHAQDIDDIVLDHFGMEAP-EADMEEWRELVDKVKNLPNKRK--VALVGKYVELQDAYISVVEALKHAGYVYNSDIEIDWINAEHVNADNVTALLKDADAILVPGGFGDRGVEGKILATQFARENNVPFLGICLGMQLATIEYARNVLGLKGAHSTELDANTEYPIIDFLPDQNDSVDIGGTLRLGLYPCKLKDGSKASEAYGKELVYERHRHRYEFNNEYREAMEAAGLVFSGTSPDGKLVEIIELPENNFFVACQFHPELVSRPNRPQPLFRDFIGATFK 530
>gi|69245011|ref|ZP_00603169.1| CTP synthase [Enterococcus faecium DO] >gi|68196012|gb|EAN10444.1| CTP synthase [Enterococcus faecium DO] (536 aa)
Score = 1338, Expect = 1.7e-145, Identities = 264/527 (50%), Positives = 357/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT  I +KI+  +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  +  L    ++KTKP QHSVK+L   GI PN+L+VR++  VS  +K K++    +E E +    ++  +Y +P  L+ Q +   + +  K++ P       W      +   KK K RIA+VGKY + PDAY+S++ +L+ S F   +D+ I++I +  L   N+ E L + D ILVPGGFG R +EGKI AI+YAREN++PF GICLGMQ+A +EFARNV+ + DA S E N +TAN II ++  +    NLGGTLRLG Y C++K G+K  E Y    +V ERHRHRYEFN KY  +FE+ G VFSG++ +N LVEI+EL   KFF+  QFHPE  S+   P  +  +F+  S
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITNEIKEKIMRAAKMTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGTDNVMYIHTTLIPYLKAAGEMKTKPTQHSVKELRGLGIQPNILVVRTEQPVSQSVKNKLAQFCDVEPEAVIESPDVDTLYSIPLVLQAQGMDQIVCDHLKLDTP-EADMTEWKELEERVLNLKK-KVRIALVGKYVELPDAYISVVEALKHSGFAYNSDIEIDWIKAQELTRENVEERLKDADGILVPGGFGDRGVEGKIEAIRYARENDVPFLGICLGMQMACVEFARNVVGLEDASSAETNPDTANNIIDLMADQENIENLGGTLRLGLYPCKIKKGTKTAEAYDGADVVQERHRHRYEFNNKYRQLFEEQGLVFSGVSPDNRLVEIVELPEKKFFVGCQFHPELISRPNRPQKLIKAFVGAS 529
>gi|56421924|ref|YP_149242.1| CTP synthetase [Geobacillus kaustophilus HTA426] >gi|81346258|sp|Q5KUG2|PYRG_GEOKA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|56381766|dbj|BAD77674.1| CTP synthetase (UTP--ammonia ligase) [Geobacillus kaustophilus HTA426] (531 aa)
Score = 1337, Expect = 2.4e-145, Identities = 256/529 (48%), Positives = 357/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   I KER G +LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    ++KTKP QHSVK+L S GI PN+++VR++  +  ++KEKI+L   I+ + +    +   +Y +P  L+ QK+   +    ++          W      ++   K   +IA+VGKY + PDAY+S++ +L  + +   TD+ I++IN+  +  +N+++L  + D ILVPGGFG R +EGKI AI+YARE  +PF GICLGMQLASIEFAR+V+ +  A S+EF+ NT +PII +L  +    +LGGTLRLG Y C+L++G+     Y  + I ERHRHRYEFN +Y  I E+HGFVFSG + +  LVE+IEL++H +F+A QFHPEFTS+   P P+F  F+  S K
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSAVIRKERRGDYLGGTVQVIPHITNEIKERVFRAGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDVGRENVMYIHCTLVPYIKAAGEMKTKPTQHSVKELRSLGIQPNVIVVRTEMPMPQEMKEKIALFCDIDPKAVIEARDADTLYAVPLMLQEQKLDQIVCEHLRLNC-READMTEWKALVEKVRNLSK-TTKIALVGKYVELPDAYISVVEALRHAGYAFDTDIDIQWINAEHVTRDNVADLLKDADGILVPGGFGDRGVEGKIEAIRYAREQRVPFLGICLGMQLASIEFARHVVGLSGAHSSEFDPNTPHPIIDLLPEQKDVEDLGGTLRLGLYPCKLQEGTLAYAAYGDEVIYERHRHRYEFNNQYRPIMEEHGFVFSGTSPDGRLVEVIELKDHPWFVAAQFHPEFTSRPTRPQPLFREFVRASLK 530
>gi|138896965|ref|YP_001127418.1| CTP synthetase [Geobacillus thermodenitrificans NG80-2] >gi|196249783|ref|ZP_03148479.1| CTP synthase [Geobacillus sp. G11MC16] >gi|134268478|gb|ABO68673.1| CTP synthase [Geobacillus thermodenitrificans NG80-2] >gi|196210659|gb|EDY05422.1| CTP synthase [Geobacillus sp. G11MC16] (531 aa)
Score = 1332, Expect = 7.3e-145, Identities = 254/529 (48%), Positives = 357/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   I KER G +LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    ++KTKP QHSVK+L S GI PN+++VR++  +  ++K+KI+L   I+ + +    +   +Y +P  L+ QK+   +    ++          W      ++   K   +IA+VGKY + PDAY+S++ +L  + +   TD+ I+++N+  +  +N++EL  + D ILVPGGFG R +EGKI AI+YARE  +PF GICLGMQLASIEFAR+V+ +  A S EF+ NT +PII +L  +    +LGGTLRLG Y C+L++G+     Y  + I ERHRHRYEFN +Y ++ E+HGFVFSG + +  LVE+IEL++H +F+A QFHPEFTS+   P P+F  F+  S K
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSAVIRKERRGDYLGGTVQVIPHITNEIKERVFRAGKETNADVVITEIGGTVGDIESLPFLEAIRQIKSDVGRENVMYIHCTLVPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPMPQEMKDKIALFCDIDPKAVIESYDADTLYAVPLMLQEQKLDQIVCEHLRLNC-READMTEWKALVEKVRNLSK-TTKIALVGKYVELPDAYISVVEALRHAGYAFDTDIDIQWVNAEHVTRDNVAELLKDADGILVPGGFGDRGVEGKIEAIRYAREQRVPFLGICLGMQLASIEFARHVVGLTGAHSAEFDPNTPHPIIDLLPEQKDVEDLGGTLRLGLYPCKLQEGTLAHAAYGDEVIYERHRHRYEFNNQYRNLMEEHGFVFSGTSPDGRLVEVIELKDHPWFVAAQFHPEFTSRPTRPQPLFREFVKASLK 530
>gi|169826563|ref|YP_001696721.1| CTP synthase [Lysinibacillus sphaericus C3-41] >gi|168991051|gb|ACA38591.1| CTP synthase [Lysinibacillus sphaericus C3-41] (530 aa)
Score = 1330, Expect = 1.4e-144, Identities = 261/529 (49%), Positives = 355/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKE-PKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G EV I KFDPY+N+D GTM+P QHGEVFVT DG E DLD+G+YERF++INL K S VT+GRVY   + KER G + G T+QV+PHIT  I  +I     +   D +I EVGGTVGDIES+PFLEA RQ++     + VM+IH   +  +    +LKTKP QHSVK+L S GI PN+++VR++  V   +KEK++L   ++   I    + +H+Y +P +L  Q + + + + F +  P     + W      +K  P K K  +A+VGKY +  DAY+S++ +L+ + +   +D+ I++IN+  +N +N++ L  + DAILVPGGFG R +EGKILA Q+ARENN+PF GICLGMQLA+IE+ARNVL +  A STE + NT  PII  L  +N   ++GGTLRLG Y C+LKDGSK  E Y ++ + ERHRHRYEFN +Y +  E  G VFSG + +  LVEIIEL  + FF+A QFHPE  S+   P P+F  F+  + K
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLEVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAEADLDLGHYERFIDINLGKHSTVTSGRVYQSVLQKERRGDYNGGTVQVIPHITNEIKDRIQRAGRETNADVVITEVGGTVGDIESLPFLEAIRQMKTNLGHNNVMYIHCTLIPYIKAAGELKTKPTQHSVKELRSLGIQPNIIVVRTEQEVPQDMKEKLALFCDVQPHEIIESRDAEHLYEVPLNLHAQDIDDIVLDHFGITAP-EADMEEWRELVDKVKNLPNKRK--VALVGKYVELQDAYISVVEALKHAGYVYNSDIEIDWINAEHVNADNVAALLKDADAILVPGGFGDRGVEGKILATQFARENNVPFLGICLGMQLATIEYARNVLGLKGAHSTELDANTEYPIIDFLPDQNDSVDIGGTLRLGLYPCKLKDGSKASEAYGKELVYERHRHRYEFNNEYREAMEAAGLVFSGTSPDGKLVEIIELPENNFFVACQFHPELVSRPNRPQPLFRDFIGATFK 530
>gi|23100462|ref|NP_693929.1| CTP synthetase [Oceanobacillus iheyensis HTE831] >gi|38372490|sp|Q8EM53|PYRG_OCEIH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|22778695|dbj|BAC14963.1| CTP synthase (UTP-ammonia ligase) [Oceanobacillus iheyensis HTE831] (535 aa)
Score = 1326, Expect = 4.0e-144, Identities = 260/527 (49%), Positives = 356/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SN+T G+VY   I KER G +LG T+QV+PHIT  I  ++         D +I E+GGTVGDIES+PFLEA RQ+++   R  VM++H   +  +    ++KTKP QHSVK+L S GI P+ +++R++ A+S  +KEKI+L   I+++++  + +   +Y +P +L+ +K+     N F ++ P     + W    + ++   K    I +VGKY + PDAYLS++ SL+ + +   TD+ I +INS  L+E  I  ELS+ D +LVPGGFG R I+GKI AI+YARENNIPFFGICLGMQLAS+EFARNV+ +  A S E N +T +P+I +L  +    +LGGTLRLG Y C+L DG+K  E Y    ++ ERHRHRYEFN  Y D   + GFVFSG + +  LVE IE+++H +F+A QFHPEFTS+      +F  F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVFVTQDGAETDLDLGHYERFIDINLNKYSNITTGKVYSSVIRKERRGDYLGGTVQVIPHITNEIKDQVFRAGEATGADVVITEIGGTVGDIESLPFLEAIRQIKSDVGRDSVMYVHCTLVPYIKAAGEMKTKPTQHSVKELRSLGIQPDAIVLRTEMAISKDMKEKIALFCDIDDKSVIEMRDADTLYQVPIALQEEKLDQITCNHFGLDCP-EADMEEWKGLVNKVRNLSK-TTHIGLVGKYVELPDAYLSVVESLKHAGYDYDTDVKIHWINSELLSEEQIKEELSKVDGVLVPGGFGDRGIDGKIEAIRYARENNIPFFGICLGMQLASVEFARNVVGLSQAHSAEINPHTPHPVIDLLPEQKDIEDLGGTLRLGAYPCKLVDGTKAKEAYDGADVIEERHRHRYEFNNVYRDQMAEKGFVFSGTSPDGRLVETIEVKDHPWFVACQFHPEFTSRPTRAQSLFKGFIGAS 529
>gi|20808954|ref|NP_624125.1| CTP synthetase [Thermoanaerobacter tengcongensis MB4] >gi|24212121|sp|Q8R720|PYRG_THETN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|20517618|gb|AAM25729.1| CTP synthase (UTP-ammonia lyase) [Thermoanaerobacter tengcongensis MB4] (537 aa)
Score = 1318, Expect = 3.3e-143, Identities = 254/523 (48%), Positives = 363/523 (69%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV SSLGKG+  +SLG +LK  G  V + KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF+++NL K SNVTAG++Y+  I KER G +LGAT+QV+PHIT+ I +++  ++ +   D +I E+GGTVGDIES+PFLEA RQ+  +  R  VMFIH   +  L    +LKTKP QHSVK+L S GI P++++ R++  +  +L+EKI+L   +  E +    +++ IY +P  LE QKV   +    ++ +P  +   K W  +    K P+ ++  +A+VGKY D  DAY+S++ +L+ +  Y KT ++I ++N+  +N+  + EL +  D ILVPGGFG R IEGKI AIQYAREN IP+ G+CLGMQ A IEFARNV  +  A+STEF+ NT +P+I ++  +      GGT+RLG Y C++ +G+K  E+YK + + ERHRHRYEFN +Y ++    G V SG++ +  LVEIIEL++H +F+A QFHPEF S+ L+P+P+F  F+
  S:     3 KYIFVTGGVVSSLGKGITAASLGRLLKSRGLSVAMQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDVNLTKNSNVTAGKIYWSVITKERKGDYLGATVQVIPHITDEIKERVYRVAKEKNVDVVITEIGGTVGDIESLPFLEAIRQVAIEQGRENVMFIHVTLVPHLGNTGELKTKPTQHSVKELRSIGIQPDMIVCRTELPLPQELREKIALFCNVSVEAVIENRDVESIYQVPLELERQKVDEYVIK--RLNLPLGQSDLKEWREYVEKEKNPE-HQVEVALVGKYVDLHDAYISVVEALKHAGVYHKTAVNIRWVNAEKVNDKTVDELLKGADGILVPGGFGDRGIEGKIRAIQYARENKIPYLGLCLGMQCAVIEFARNVAGLKGANSTEFDPNTPHPVIDLMPEQKDIDEKGGTMRLGVYPCKVIEGTKAYEVYKDELVYERHRHRYEFNNQYRELLTSKGLVISGLSPDERLVEIIELKDHPYFVATQFHPEFKSRPLNPHPLFRDFV 525
>gi|163762317|ref|ZP_02169382.1| methyl-accepting chemotaxis sensory transducer [Bacillus selenitireducens MLS10] >gi|160357056|gb|EDP83704.1| methyl-accepting chemotaxis sensory transducer [Bacillus selenitireducens MLS10] (538 aa)
Score = 1309, Expect = 3.6e-142, Identities = 253/527 (48%), Positives = 349/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SN+T G+VY   I KER G +LG T+QV+PHIT  I  ++   + +  PD +I E+GGTVGDIES+PFLEA RQ++ A     VM+IH   +  L    ++K+KP QHSVK+L S GI PN+++VR++  V   +K+KI+L   I    +    + + +Y +P  L+ QK+   + +   +          W     L+K   K+  RIA+VGKY   PDAYLS++ +L+ S + +  D+ +++++S  L  +N+ E L + D ILVPGGFG R +EGKI AI+YARE  +PF GICLGMQLAS+EFAR+VL +  A S E + +T  P+I +L  +    + GGTLRLG Y C+LK+G++    Y  + I ERHRHRYEFN +Y +  E  GF+FSG++ +  L EIIEL +H +FIA QFHPEF S+   P P+F  F+  +
  S:     2 TKFIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSKYSNITTGKVYSSVIKKERRGDYLGGTVQVIPHITNEIKDRVFQAAKEGNPDVVITEIGGTVGDIESLPFLEAIRQIKGAAGAENVMYIHCTLIPYLAAAGEMKSKPTQHSVKELRSLGIQPNVIVVRTERPVPEDMKDKIALFCDINKNAVIEARDAETLYEVPLDLQAQKLDQFVCDHLGLNC-GEANMVEWKELVKLVKN-LKHSIRIALVGKYVALPDAYLSVVEALKHSGYQVDADIEVDWVDSEELTADNVKERLKDADGILVPGGFGDRGVEGKIEAIRYAREERVPFLGICLGMQLASVEFARHVLGLKGAHSAELDPSTPYPVIDLLPEQKDVEDFGGTLRLGLYPCKLKEGTQAYASYSEQVIYERHRHRYEFNNEYREQMEAKGFIFSGLSPDGRLAEIIELNDHPYFIASQFHPEFVSRPTRPQPLFRDFIGTA 528
>gi|195978818|ref|YP_002124062.1| CTP synthase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] >gi|195975523|gb|ACG63049.1| CTP synthase [Streptococcus equi subsp. zooepidemicus str. MGCS10565] (534 aa)
Score = 1309, Expect = 3.9e-142, Identities = 255/527 (48%), Positives = 360/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S+ VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++ V   +K K++    +  E +    +++H+Y +P +L+ Q +   + +  K++VP +     W      +   KK   RIA+VGKY + PDAYLS++ +L+ S +   T + +++IN++ L   N  E L   D I+VPGGFG+R  EGKI AI+YARE+++P  GICLGMQL  +EFAR+VL M  A+S E + +TA PII I+  +    ++GGTLRLG Y C+LK GS+    Y  + +V+ RHRHRYEFN K+   FE  GFVFSG++ +N LVEI+EL   KFF+A Q+HPE  S+   P  ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIKNKLAQFCDVNPEAVIESRDVEHLYQIPLNLQAQSMDQIVCDHLKLDVP-QADMTEWSAMVDKVMNLKK-TTRIALVGKYVELPDAYLSVVEALKHSGYANDTAIELDWINANDLTAENAKELLGAADGIIVPGGFGQRGTEGKIQAIRYAREHDVPMLGICLGMQLTCVEFARHVLGMEKANSFELDPDTAYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKAGSRAAAAYNNQEVVQRRHRHRYEFNNKFRQDFEAAGFVFSGVSPDNRLVEIVELPEKKFFVAAQYHPELQSRPNRPEELYTAFITAA 529
>gi|52787641|ref|YP_093470.1| CTP synthetase [Bacillus licheniformis ATCC 14580] >gi|163119688|ref|YP_081040.2| CTP synthetase [Bacillus licheniformis ATCC 14580] >gi|52350143|gb|AAU42777.1| PyrG [Bacillus licheniformis DSM 13] >gi|145903199|gb|AAU25402.2| CTP synthetase [Bacillus licheniformis ATCC 14580] (535 aa)
Score = 1308, Expect = 4.7e-142, Identities = 254/529 (48%), Positives = 356/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  SSLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G +LG T+QV+PHIT  I  ++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  +S  +K+KI+L   I+ + +    +   +Y +P  L+ Q + + + +  K++       + W      +K   K    IA+VGKY + PDAY+S++ SL  + +    D+ +++IN+  + E+N+++L +  D ILVPGGFG R +EGKI  ++YARE  IPFFGICLGMQ+ASIE+ARNVL +  A S E + +T  PII +L  +    +LGGTLRLG Y C+L++GSK  + Y+ + + ERHRHRYEFN ++    E+ GFVFSG + +  LVEIIEL++H +F+A QFHPEFTS+   P  +F  F++ S K
  S:     2 TKYIFVTGGVVSSLGKGITASSLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSTVLKKERRGDYLGGTVQVIPHITNEIKDRVFRAGKETHADVVITEIGGTVGDIESLPFLEAIRQIKSDVGRDNVMYIHCTLVPYLKAAGEMKTKPTQHSVKELRSLGIQPNVIVVRTEMPISQDMKDKIALFCDIDPKAVIEAGDADTLYSIPLDLQKQGLDSLVCSHLKLDC-READMEEWKELVKKVKNLSK-TVTIALVGKYVELPDAYISVVESLRHAGYAFDADIQVKWINAEEVTEDNVADLVQNADGILVPGGFGDRGVEGKITTVKYAREQKIPFFGICLGMQVASIEYARNVLGLEGAHSAEIDPSTPYPIIDLLPEQKDIEDLGGTLRLGLYPCKLQEGSKAYQAYENEVVYERHRHRYEFNNEFRQQMEEAGFVFSGTSPDGRLVEIIELKDHPWFVASQFHPEFTSRPTRPQALFRDFVHASLK 530
>gi|16080768|ref|NP_391596.1| CTP synthetase [Bacillus subtilis subsp. subtilis str. 168] >gi|131733|sp|P13242|PYRG_BACSU CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|143597|gb|AAA16801.1| CTP synthetase >gi|853762|emb|CAA89870.1| CTP synthase [Bacillus subtilis] >gi|2636252|emb|CAB15743.1| CTP synthetase [Bacillus subtilis subsp. subtilis str. 168] (535 aa)
Score = 1308, Expect = 4.8e-142, Identities = 254/527 (48%), Positives = 354/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G +LG T+QV+PHIT  +  ++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    +LKTKP QHSVK+L S GI PN+++VR++  +S  +K+KI+L   I+ + +    +  ++Y +P  L+ Q +   +    K+          W    + +    +    I +VGKY + PDAY+S++ SL  + +   TD+ +++IN+  + ENNI+EL S  D I+VPGGFG R +EGKI+A +YARENNIPF GICLGMQ+ASIE+ARNVL +  A S E + +T  PII +L  +    +LGGTLRLG Y C+L++G+K  E+Y+ + + ERHRHRYEFN ++    E+ GFVFSG + +  LVEIIEL++H +F+A QFHPEF S+   P P+F  F+  S
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKFSNVTTGKIYSTVLKKERRGDYLGGTVQVIPHITNELKDRVYRAGKETNADVVITEIGGTVGDIESLPFLEAIRQMKSDIGRENVMYIHCTLVPYIKAAGELKTKPTQHSVKELRSLGIQPNIIVVRTEMPISQDMKDKIALFCDIDTKAVIECEDADNLYSIPLELQKQGLDKLVCEHMKLAC-KEAEMSEWKELVNKVSNLSQ-TITIGLVGKYVELPDAYISVVESLRHAGYAFDTDVKVKWINAEEVTENNIAELTSGTDGIIVPGGFGDRGVEGKIVATKYARENNIPFLGICLGMQVASIEYARNVLGLKGAHSAEIDPSTQYPIIDLLPEQKDVEDLGGTLRLGLYPCKLEEGTKAFEVYQDEVVYERHRHRYEFNNEFRQQMEEQGFVFSGTSPDGRLVEIIELKDHPWFVASQFHPEFKSRPTRPQPLFKGFIGAS 528
>gi|25010181|ref|NP_734576.1| CTP synthetase [Streptococcus agalactiae NEM316] >gi|76788516|ref|YP_328831.1| CTP synthetase [Streptococcus agalactiae A909] >gi|81457887|sp|Q8E7P8|PYRG_STRA3 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391185|sp|Q3K3S2|PYRG_STRA1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|23094532|emb|CAD45751.1| Unknown [Streptococcus agalactiae NEM316] >gi|76563573|gb|ABA46157.1| CTP synthase [Streptococcus agalactiae A909] (534 aa)
Score = 1305, Expect = 1.0e-141, Identities = 249/527 (47%), Positives = 359/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PH+T+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   +++ HIY +P +++ Q +   + +  K+E P       W      +   +K K +IA+VGKY + PDAYLS++ +L+ S +     + ++++N++ + E+NI EL  + D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  +EFARNVLK+H A+S E +  T  PII I+  +    ++GGTLRLG Y C+LK GS+    Y  + +V+ RHRHRYEFN K+ + FE  GFVFSG++ +N L+E++EL   KFF+A Q+HPE  S+      ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLKKERRGEYLGATVQVIPHVTDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQSIKNKLAQFCDVAPEAVIESLDVDHIYQIPLNMQAQNMDQIVCDHLKLETP-AADMTEWSAMVDKVMNLEK-KVKIALVGKYVELPDAYLSVVEALKHSGYVNDVAIDLKWVNAAEVTEDNIKELVGDADGIIVPGGFGQRGSEGKIEAIRYARENDVPMLGVCLGMQLTCVEFARNVLKLHGANSAELDPKTPFPIIDIMRDQIDIEDMGGTLRLGLYPCKLKAGSRAAAAYNNQEVVQRRHRHRYEFNTKFREQFEAAGFVFSGVSPDNRLMEVVELPEKKFFVAAQYHPELQSRPNHAEELYTAFVTAA 529
>gi|29375723|ref|NP_814877.1| CTP synthetase [Enterococcus faecalis V583] >gi|81437070|sp|Q836G5|PYRG_ENTFA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|29343184|gb|AAO80947.1| CTP synthase [Enterococcus faecalis V583] (536 aa)
Score = 1304, Expect = 1.3e-141, Identities = 257/527 (48%), Positives = 357/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT  I +KI+  +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  +  L    ++KTKP QHSVK+L S GI PN+L+VR++  VS   K K++    +  E +    +++ +Y +P +L+ Q +   + +  K++ P       W      +   KK K +IA+VGKY + PDAY+S++ +L+ + F   +D+ I++++S  L   N++E +   D ILVPGGFG R IEGKI AI++AREN++PF GICLGMQ+A +EF RNV+ + DA S E N +  N II ++  +    NLGGTLRLG Y C+LK G+K    Y  + +V ERHRHRYEFN KY  +FE++G VFSG++ +N LVEI+E+   +FF+A QFHPE  S+   P  +   F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITNEIKEKIMRAAKMTDADVIITEVGGTVGDIESLPFLEALRQMKADMGSDNVMYIHTTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNILVVRTELPVSQNTKNKLAQFCDVNPEAVIESRDVETLYSIPLALQAQNMDQIVCDHLKLDAP-AADMTEWRALEEKVLNLKK-KTKIALVGKYVELPDAYISVVEALKHAGFDFDSDIEIDWVDSQELTAENVAERIGSADGILVPGGFGDRGIEGKIEAIRFARENDVPFLGICLGMQMACVEFGRNVVGLEDAGSAETNPDVTNNIIDLMADQENIENLGGTLRLGLYPCKLKKGTKTAAAYGNEDVVQERHRHRYEFNNKYRQLFEENGLVFSGVSPDNRLVEIVEIPEKQFFVACQFHPELISRPNRPQRLIKGFVGAA 529
>gi|30023369|ref|NP_835000.1| CTP synthetase [Bacillus cereus ATCC 14579] >gi|38372442|sp|Q814T2|PYRG_BACCR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|29898930|gb|AAP12201.1| CTP synthase [Bacillus cereus ATCC 14579] (535 aa)
Score = 1304, Expect = 1.6e-141, Identities = 253/527 (48%), Positives = 353/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W    + ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVNKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVKELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLAEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKEGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRAS 528
>gi|168143975|ref|ZP_02587204.1| CTP synthetase [Bacillus cereus G9842] (535 aa)
Score = 1303, Expect = 1.7e-141, Identities = 253/527 (48%), Positives = 353/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W    + ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTELPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVNKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLSEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKEGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRAS 528
>gi|166984401|ref|ZP_02255750.1| CTP synthetase [Bacillus cereus AH187] >gi|168161088|ref|ZP_02596321.1| CTP synthetase [Bacillus cereus H3081.97] (535 aa)
Score = 1303, Expect = 1.9e-141, Identities = 253/527 (48%), Positives = 352/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W      ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVEKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLAEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRAS 528
>gi|163943026|ref|YP_001647910.1| CTP synthetase [Bacillus weihenstephanensis KBAB4] >gi|163865223|gb|ABY46282.1| CTP synthase [Bacillus weihenstephanensis KBAB4] (535 aa)
Score = 1303, Expect = 1.9e-141, Identities = 253/527 (48%), Positives = 354/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W    + ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F++ S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTELPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTDWTALVNKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVKELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLAEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIIELQDHPWFVAAQFHPELVSRPNRPQPLFHDFVSAS 528
>gi|42784513|ref|NP_981760.1| CTP synthetase [Bacillus cereus ATCC 10987] >gi|81408391|sp|Q72XB0|PYRG_BACC1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|42740445|gb|AAS44368.1| CTP synthase [Bacillus cereus ATCC 10987] (535 aa)
Score = 1303, Expect = 2.0e-141, Identities = 252/527 (47%), Positives = 352/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W      ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEI+EL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVEKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLAEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIVELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRAS 528
>gi|49480419|ref|YP_039331.1| CTP synthetase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118480372|ref|YP_897523.1| CTP synthetase [Bacillus thuringiensis str. Al Hakam] >gi|196036547|ref|ZP_03103942.1| CTP synthase [Bacillus cereus W] >gi|196040969|ref|ZP_03108266.1| CTP synthase [Bacillus cereus NVH0597-99] >gi|196045569|ref|ZP_03112800.1| CTP synthase [Bacillus cereus 03BB108] >gi|81394168|sp|Q6HAU5|PYRG_BACHK CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|49331975|gb|AAT62621.1| CTP synthase [Bacillus thuringiensis serovar konkukian str. 97-27] >gi|118419597|gb|ABK88016.1| CTP synthase [Bacillus thuringiensis str. Al Hakam] >gi|195990880|gb|EDX54853.1| CTP synthase [Bacillus cereus W] >gi|196023776|gb|EDX62452.1| CTP synthase [Bacillus cereus 03BB108] >gi|196028137|gb|EDX66747.1| CTP synthase [Bacillus cereus NVH0597-99] (535 aa)
Score = 1303, Expect = 2.1e-141, Identities = 253/527 (48%), Positives = 352/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W      ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVEKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLSEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKEGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVKAS 528
>gi|52140223|ref|YP_086607.1| CTP synthetase [Bacillus cereus E33L] >gi|166997234|ref|ZP_02263693.1| CTP synthetase [Bacillus cereus AH820] >gi|81685331|sp|Q630R0|PYRG_BACCZ CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|51973692|gb|AAU15242.1| CTP synthase [Bacillus cereus E33L] (535 aa)
Score = 1302, Expect = 2.2e-141, Identities = 253/527 (48%), Positives = 352/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W      ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVEKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLSEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRAS 528
>gi|30265362|ref|NP_847739.1| CTP synthetase [Bacillus anthracis str. Ames] >gi|47530904|ref|YP_022253.1| CTP synthetase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49188173|ref|YP_031426.1| CTP synthetase [Bacillus anthracis str. Sterne] >gi|65317316|ref|ZP_00390275.1| COG0504: CTP synthase (UTP-ammonia lyase) [Bacillus anthracis str. A2012] >gi|165871280|ref|ZP_02215929.1| CTP synthase [Bacillus anthracis str. A0488] >gi|167640382|ref|ZP_02398646.1| CTP synthase [Bacillus anthracis str. A0193] >gi|170688134|ref|ZP_02879345.1| CTP synthase [Bacillus anthracis str. A0465] >gi|170708086|ref|ZP_02898534.1| CTP synthase [Bacillus anthracis str. A0389] >gi|177651918|ref|ZP_02934501.1| CTP synthase [Bacillus anthracis str. A0174] >gi|190569093|ref|ZP_03021992.1| CTP synthase [Bacillus anthracis Tsiankovskii-I] >gi|38372449|sp|Q81JW1|PYRG_BACAN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|30260040|gb|AAP29225.1| CTP synthase [Bacillus anthracis str. Ames] >gi|47506052|gb|AAT34728.1| CTP synthase [Bacillus anthracis str. 'Ames Ancestor'] >gi|49182100|gb|AAT57476.1| CTP synthase [Bacillus anthracis str. Sterne] >gi|164712947|gb|EDR18475.1| CTP synthase [Bacillus anthracis str. A0488] >gi|167511602|gb|EDR86984.1| CTP synthase [Bacillus anthracis str. A0193] >gi|170127059|gb|EDS95938.1| CTP synthase [Bacillus anthracis str. A0389] >gi|170667827|gb|EDT18579.1| CTP synthase [Bacillus anthracis str. A0465] >gi|172082622|gb|EDT67686.1| CTP synthase [Bacillus anthracis str. A0174] >gi|190559761|gb|EDV13747.1| CTP synthase [Bacillus anthracis Tsiankovskii-I] (535 aa)
Score = 1302, Expect = 2.4e-141, Identities = 253/527 (48%), Positives = 352/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W      ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVEKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLSEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVKAS 528
>gi|163789895|ref|ZP_02184331.1| CTP synthetase [Carnobacterium sp. AT7] >gi|159874835|gb|EDP68903.1| CTP synthetase [Carnobacterium sp. AT7] (532 aa)
Score = 1301, Expect = 3.2e-141, Identities = 258/527 (48%), Positives = 355/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+A +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL + SNVT G++Y E I KER G++LGAT+QV+PHIT  I +KI+        D +I EVGGTVGDIES+PFLEA RQ+++   +  VM+IHT  +  L    ++KTKP QHSVK+L   GI PNLL++R++  V   LK+K++    +  E +    ++  +Y +P +L+ Q +   + +  K++ P       W      +    K K +IA+VGKY + PDAYLS+I SL  + + + +++ +E+IN+  ++  N+ S+L   D ILVPGGFG R +EGKILAIQYAREN +PF GICLGMQLA +EFARNV  +  A S E + +T   II ++  +    N+GGTLRLG Y C+LK GS   + Y    +V ERHRHRYEFN +Y  + E+ G VFSG++ +N LVEI+EL +H F++A QFHPEF S+   P  +F  F+  +
  S:     2 TKYIFVTGGVVSSIGKGIAAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNQYSNVTTGKIYSEVIRKERKGEYLGATVQVIPHITNEIKEKIMRAGQTTDSDIVITEVGGTVGDIESLPFLEALRQMKSDVGADNVMYIHTTLIPYLGAAGEMKTKPTQHSVKELRGLGIQPNLLVIRTEKPVPQSLKDKLASFCDVNPEAVIESRDVDTLYSIPLNLQKQNMDQIVCDHLKIDAPP-ADMSEWIALEQKVLHLSK-KTKIALVGKYVELPDAYLSVIESLNHAGYAVDSEIEVEWINAEEVSPENVESKLKNADGILVPGGFGDRGLEGKILAIQYARENKVPFLGICLGMQLACVEFARNVAGLEGAHSAETDPDTPYNIIDLMLNQKDVVNMGGTLRLGLYPCKLKPGSVTAQAYDNVDVVQERHRHRYEFNNEYRTMLEEKGLVFSGVSPDNRLVEIVELSDHPFYVACQFHPEFVSRPNRPQKLFLGFVKAA 529
>gi|22536292|ref|NP_687143.1| CTP synthetase [Streptococcus agalactiae 2603V/R] >gi|77412045|ref|ZP_00788372.1| CTP synthase [Streptococcus agalactiae CJB111] >gi|81455460|sp|Q8E290|PYRG_STRA5 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|22533114|gb|AAM99015.1|AE014196_11 CTP synthase [Streptococcus agalactiae 2603V/R] >gi|77161902|gb|EAO72886.1| CTP synthase [Streptococcus agalactiae CJB111] (534 aa)
Score = 1301, Expect = 3.4e-141, Identities = 248/527 (47%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PH+T+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   +++ HIY +P +++ Q +   + +  K+E P       W      +   +K K +IA+VGKY + PDAYLS++ +L+ S +     + ++++N++ + E+NI EL  + D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  +EFARNVL +H A+S E +  T  PII I+  +    ++GGTLRLG Y C+LK GS+    Y  + +V+ RHRHRYEFN K+ + FE  GFVFSG++ +N L+E++EL   KFF+A Q+HPE  S+      ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLKKERRGEYLGATVQVIPHVTDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQSIKNKLAQFCDVAPEAVIESLDVDHIYQIPLNMQAQNMDQIVCDHLKLETP-AADMTEWSAMVDKVMNLEK-KVKIALVGKYVELPDAYLSVVEALKHSGYVNDVAIDLKWVNAAEVTEDNIKELVGDADGIIVPGGFGQRGSEGKIEAIRYARENDVPMLGVCLGMQLTCVEFARNVLNLHGANSAELDPKTPFPIIDIMRDQIDIEDMGGTLRLGLYPCKLKSGSRAAAAYNNQEVVQRRHRHRYEFNTKFREQFEAAGFVFSGVSPDNRLMEVVELPEKKFFVAAQYHPELQSRPNHAEELYTAFVTAA 529
>gi|39939097|ref|NP_950863.1| CTP synthetase [Onion yellows phytoplasma OY-M] >gi|81402278|sp|Q6YPW4|PYRG_ONYPE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|39722206|dbj|BAD04696.1| CTP synthase [Onion yellows phytoplasma OY-M] (540 aa)
Score = 1300, Expect = 3.8e-141, Identities = 269/528 (50%), Positives = 370/528 (70%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHG-FVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + +TGGV SSLGKG+  +S+G +LK  G +V I K DPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERFL+ N+ K+SNVTAG++Y   I KER+GK+LG T+QV+PHITE I QK+I ++  ++ D +IVE+GGTVGDIES PFLEA RQ++  +    V+++HT  +  L    ++KTKP QHSVK+L + GI P +L++RS+  ++ + K KI+    I  + I+  +++  +Y +  +L +Q + + I   FK+   +    + W    + I+  +K K  IA+VGKY    DAYLSII +L+ +S+     L I++I++  +  +NIS L E +D ILVP GFG R IEGKILAI YAR NNIPFFGICLGMQLA IE+ARNVL +  A+S E +E T +P+IT    K  ++NLGGTLRLG+Y C LK  +K   IY ++ I ERHRHR+E NP Y+ +FEK+  FV SGIN+E  L EI+EL++H +FIAVQFHPEF S+ L P+P+F  F+  S
  S:     7 KTKFIFITGGVVSSLGKGITAASIGQILKNRGLKVSIQKLDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFLDENMSKKSNVTAGQIYQSVINKEREGKYLGKTVQVIPHITEEIKQKLIDVALFHKSDVVIVEIGGTVGDIESSPFLEAIRQVRFDFGYHNVLYLHTTLVPYLKKAQEIKTKPTQHSVKELRALGIQPQILVLRSEVPINPETKNKIAALCDINPQAIFEALDVDILYQMILNLHHQGIDDFILQHFKLTNFSNADLQSWKQLITRIQNLEK-KVVIALVGKYIVLHDAYLSIIEALKHASYQYNCKLEIKWIDAEKVTPDNISSLLEDYDGILVPYGFGNRAIEGKILAINYARTNNIPFFGICLGMQLAVIEYARNVLHLQGANSLEVDEKTPHPVIT---KKIVDSNLGGTLRLGSYPCHLKANTKSKAIYNQEIIYERHRHRFEMNPHYVALFEKNNDFVVSGINQEQKLCEIVELKSHPWFIAVQFHPEFLSRPLKPHPLFKGFVEAS 533
>gi|77409774|ref|ZP_00786427.1| CTP synthase [Streptococcus agalactiae COH1] >gi|77171614|gb|EAO74830.1| CTP synthase [Streptococcus agalactiae COH1] (534 aa)
Score = 1300, Expect = 4.2e-141, Identities = 248/527 (47%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PH+T+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   +++ HIY +P +++ Q +   + +  K+E P       W      +   +K K +IA+VGKY + PDAYLS++ +L+ S +     + ++++N++ + E+NI EL  + D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  +EFARNVL +H A+S E +  T  PII I+  +    ++GGTLRLG Y C+LK GS+    Y  + +V+ RHRHRYEFN K+ + FE  GFVFSG++ +N L+E++EL   KFF+A Q+HPE  S+      ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLKKERRGEYLGATVQVIPHVTDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQSIKNKLAQFCDVAPEAVIESLDVDHIYQIPLNMQAQNMDQIVCDHLKLETP-AADMTEWSAMVDKVMNLEK-KVKIALVGKYVELPDAYLSVVEALKHSGYVNDVAIDLKWVNAAEVTEDNIKELVGDADGIIVPGGFGQRGSEGKIEAIRYARENDVPMLGVCLGMQLTCVEFARNVLXLHGANSAELDPKTPFPIIDIMRDQIDIEDMGGTLRLGLYPCKLKAGSRAAAAYNNQEVVQRRHRHRYEFNTKFREQFEAAGFVFSGVSPDNRLMEVVELPEKKFFVAAQYHPELQSRPNHAEELYTAFVTAA 529
>gi|56965644|ref|YP_177378.1| CTP synthetase [Bacillus clausii KSM-K16] >gi|81364954|sp|Q5WB43|PYRG_BACSK CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|56911890|dbj|BAD66417.1| CTP synthase [Bacillus clausii KSM-K16] (534 aa)
Score = 1299, Expect = 4.8e-141, Identities = 247/523 (47%), Positives = 348/523 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL + SN+T GRVY   + KER G +LG T+QV+PH+T  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++      V+++H   +  L    ++K+KP QHSVK+L S GI PN+++VR++  V   +K+KI+L   I+ E +    +   +Y +P  L+ Q +   + +  ++  P       W    + +    + K RIA+VGKY +  DAYLS+  +L  + +++  D+ I+++ +  +N+ N+ EL ++ D ILVPGGFG R IEGKI AI+YAREN +PF GICLGMQLAS+EFAR VL +  A+S E N  T  PII +L  +    +LGGTLRLG Y C+L++G+     Y  + + ERHRHRYEFN +Y +  EK GFVFSG + +  LVE+IE+ +H FF+A QFHPEF S+   P P+F  F+
  S:     4 KYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSQNSNITTGRVYSTVLKKERRGDYLGGTVQVIPHVTNEIKERVFRAGRETGADVVITEIGGTVGDIESLPFLEAIRQIKSDVGMENVLYLHCTLIPYLKAAGEMKSKPTQHSVKELRSLGIQPNVIVVRTERKVPQDMKDKIALFCDIKKEAVIEAWDADTLYQVPLDLQAQNLDQIVCDHLQLNCP-EANMTEWKELVNRVSHLSE-KVRIAIVGKYVELQDAYLSVAEALRHAGYHVDADIDIDWVYAEQVNDENVDELLNKADGILVPGGFGDRGIEGKITAIRYARENKVPFLGICLGMQLASVEFARTVLGLKGANSAELNPQTPYPIIDLLPEQKDVEDLGGTLRLGLYPCKLQEGTAARAAYGEEVVYERHRHRYEFNNEYREQMEKAGFVFSGTSPDGRLVEVIEVTDHPFFVASQFHPEFVSRPTRPQPLFREFV 526
>gi|47569763|ref|ZP_00240435.1| CTP synthase [Bacillus cereus G9241] >gi|47553559|gb|EAL11938.1| CTP synthase [Bacillus cereus G9241] (535 aa)
Score = 1299, Expect = 5.8e-141, Identities = 253/527 (48%), Positives = 351/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +     +  K++ P       W      ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIACDHLKLDNP-AADMTEWTALVEKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLSEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVRAS 528
>gi|167635786|ref|ZP_02394096.1| CTP synthase [Bacillus anthracis str. A0442] >gi|167528895|gb|EDR91652.1| CTP synthase [Bacillus anthracis str. A0442] (535 aa)
Score = 1299, Expect = 6.0e-141, Identities = 252/527 (47%), Positives = 352/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K +NVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++ P       W      ++   K K +IA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L + +     Y    + ERHRHRYEFN ++    EK GFVFSG + +  LVEIIEL++H +F+A QFHPE  S+   P P+F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYNNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVYRSGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDTKAVIEARDADTLYAVPLSLQEQNMDQIVCDHLKLDNP-AADMTEWTALVEKVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYSFDTDVEVKWVNAEHVTAENVQELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLSEETNAYNAYNEPVVYERHRHRYEFNNQFRPDMEKAGFVFSGTSPDGRLVEIIELKDHPWFVAAQFHPELVSRPNRPQPLFHDFVKAS 528
>gi|171777509|ref|ZP_02919231.1| hypothetical protein STRINF_00060 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171283219|gb|EDT48643.1| hypothetical protein STRINF_00060 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (534 aa)
Score = 1298, Expect = 6.5e-141, Identities = 249/527 (47%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   +++ HIY +P +++ Q +   + +  K++VP +     W      I   KK   +IA+VGKY + PDAYLS+I +L+ S +     + ++++N++ L  +N+ E L + D I+VPGGFG+R  EGKI AI+YARE ++P  GICLGMQL  +EFAR+VL M  A+S E +  T  PII I+  +    ++GGTLRLG Y C+LK GS+  + Y  + +V+ RHRHRYEFN K+ + FE  GFVFSG++ +N L+E++EL   KFF+A Q+HPE  S+   P  ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEKPAGQGIKNKLAQFCDVAPEAVIESLDVDHIYQIPLNMQAQNMDQIVCDHLKLDVP-KADMSEWSAMVDKIMNLKK-STKIALVGKYVELPDAYLSVIEALKHSGYVNDAAIDLKWVNANDLTADNVEEVLGDADGIIVPGGFGQRGTEGKIEAIRYAREKDVPMLGICLGMQLTCVEFARHVLNMEGANSAELDPETKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSRAAQAYNNQEVVQRRHRHRYEFNTKFREQFEAAGFVFSGVSPDNRLMEVVELPEKKFFVAAQYHPELQSRPNRPEELYTAFVTAA 529
>gi|77407076|ref|ZP_00784080.1| CTP synthase [Streptococcus agalactiae H36B] >gi|77174318|gb|EAO77183.1| CTP synthase [Streptococcus agalactiae H36B] (534 aa)
Score = 1298, Expect = 7.0e-141, Identities = 248/527 (47%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PH+T+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   +++ HIY +P +++ Q +   + +  K+E P       W      +   +K K +IA+VGKY + PDAYLS++ +L+ S +     + ++++N++ + E+NI EL  + D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  +EFARNVLK+H A+S E +  T  PII I+  +    ++GGTLRLG Y C+LK GS+    Y  + +V+ RH HRYEFN K+ + FE  GFVFSG++ +N L+E++EL   KFF+A Q+HPE  S+      ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLKKERRGEYLGATVQVIPHVTDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQSIKNKLAPFCDVAPEAVIESLDVDHIYQIPLNMQAQNMDQIVCDHLKLETP-AADMTEWSAMVDKVMNLEK-KVKIALVGKYVELPDAYLSVVEALKHSGYVNDVAIDLKWVNAAEVTEDNIKELVGDADGIIVPGGFGQRGSEGKIEAIRYARENDVPMLGVCLGMQLTCVEFARNVLKLHGANSAELDXKTPFPIIDIMRDQIDIEDMGGTLRLGLYPCKLKAGSRAAAAYNNQEVVQRRHXHRYEFNTKFREQFEAAGFVFSGVSPDNRLMEVVELPEKKFFVAAQYHPELQSRPNHAEELYTAFVTAA 529
>gi|171853997|emb|CAM11962.1| CTP synthase [Candidatus Phytoplasma australiense] (547 aa)
Score = 1297, Expect = 8.3e-141, Identities = 268/528 (50%), Positives = 374/528 (70%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHG-FVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K+K + +TGGV SSLGKG+  +S+G +LK  G +V I K DPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERFL+ N+ K SN+TAG++Y   I KER+GK+LG T+QV+PHITE I +KII  +  +Q D +IVE+GGTVGDIES PFLEA RQ + +     V+++HT  +  L    ++KTKP QHSVK+L + GI P +L++RS+ +++ ++K KI+    I  + I+  +++  +Y +  +L  Q++ + I N F++    +I  K W +  + I+  K+ K  I +VGKY    DAYLSI+ SL+ +++Y  +D+ I++I+S  LN  N+   L++ D ILVP GFG R IEGKILAIQYARE  IPFFGIC GMQLA +E+ARNVL +  A+STE +E T +P+IT    K + +NLGGTLRLG+Y C L+  SK   IY++ +I ERHRHR+E NP Y+ +FEK+  F+ SG N E NL EIIEL+NH +F+AVQFHPEF S+ L P+P+F SF+  +
  S:     7 KSKFIFITGGVVSSLGKGITAASIGNILKNRGFKVSIQKLDPYINIDPGTMSPYQHGEVFVTNDGAETDLDLGHYERFLDENMSKSSNITAGQIYQSVINKEREGKYLGKTVQVIPHITEEIKKKIIKAAIVHQSDIVIVEIGGTVGDIESAPFLEAIRQFRYEVGYHNVLYLHTTLVPYLKKAQEIKTKPTQHSVKELRALGIQPQILVLRSEISINKEIKNKIASLCDINPQAIFEALDVDILYQIILNLFEQRIDHFILNHFQLPNNIQIDLKDWRSLINCIQNLKE-KVVIGLVGKYVILHDAYLSIVESLKHAAYYYNSDIEIKWIDSEKLNSTNVKTLLNDCDGILVPHGFGPRAIEGKILAIQYAREQKIPFFGICFGMQLAVVEYARNVLFLDGANSTEIDEKTPHPVIT---KKIKNSNLGGTLRLGSYRCCLQKNSKSEAIYQQTTIYERHRHRFEMNPSYVSLFEKNNDFLVSGFNPEKNLAEIIELKNHPWFMAVQFHPEFLSRPLKPHPLFKSFVEAA 533
>gi|167036578|ref|YP_001664156.1| CTP synthetase [Thermoanaerobacter pseudethanolicus ATCC 33223] >gi|166855412|gb|ABY93820.1| CTP synthase [Thermoanaerobacter pseudethanolicus ATCC 33223] (533 aa)
Score = 1297, Expect = 9.7e-141, Identities = 253/524 (48%), Positives = 358/524 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY+  I KER G +LGAT+QV+PHIT  I +++  ++ +   D +I E+GGTVGDIES+PFLEA RQ+  +  +  VMFIH   +  L    +LKTKP QHSVK+L S GI P++++ R++ +++  LKEKI+L   ++ E +    +++ IY +P   E QKV   +    ++ +P  +   K W  +    K P K +  +A+VGKY D  DAY+S++ +L+ +  Y    ++I ++N+  +N+  +  L +  D ILVPGGFG R +EGKI AIQYAREN IP+ G+CLGMQ A IEFARNV  +  A+STEF+ NT+ P+I ++  +      GGT+RLG Y C++ +G+K  + Y+ + + ERHRHRYEFN +Y ++    G V SG++ +  LVEIIEL++H +F+A QFHPEF S+ L P+P+F  F+
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKSRGISVAIQKFDPYINVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDINLTKNSNVTAGKVYWSVITKERKGDYLGATVQVIPHITNEIKERVYRVAKEKNVDVVITEIGGTVGDIESLPFLEAIRQVAIEQGKDNVMFIHVTLVPHLGNTGELKTKPTQHSVKELRSIGIQPDMIVCRTELSLTQDLKEKIALFCNVDVEAVIENRDVESIYEVPLEFEKQKVDEYVLR--RLNLPLGQSDLKEWREYVEREKNPIK-EVEVALVGKYVDLHDAYISVVEALKHAGVYHSAAVNIRWVNAEHVNDETVETLLKGADGILVPGGFGDRGVEGKIRAIQYARENKIPYLGLCLGMQCAVIEFARNVAGLKGANSTEFDPNTSYPVIDLMPEQKDIDEKGGTMRLGVYPCKVIEGTKAYQAYQDELVYERHRHRYEFNNQYRELLTSKGLVLSGLSPDERLVEIIELKDHPYFVASQFHPEFKSRPLKPHPLFRDFI 525
>gi|119391074|sp|Q2NK04|PYRG_AYWBP CTP synthase (UTP--ammonia ligase) (CTP synthetase) (536 aa)
Score = 1296, Expect = 1.2e-140, Identities = 269/528 (50%), Positives = 366/528 (69%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHG-FVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + +TGGV SSLGKG+  +S+G +LK  G +V I K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERFL+ N+ K+SNVTAG++Y   I KER+GK+LG T+QV+PHITE I QK+   +  ++ D +IVE+GGTVGDIES PFLEA RQ++  +    V+++HT  +  L    ++KTKP QHS K+L + GI P +L++RS+  ++ + K KIS    I ++ I+  +++  +Y +  +L +Q + + I   FK+        + W    + I+  +K K  IA+VGKY    DAYLSI+ +L+ +S+     L I++I++  +  +NIS   E  D ILVP GFG R IEGKILAI YAR NNIPFFGICLGMQLA IE+ARNVL + DA+S E +E T +P+IT    K  + NLGGTLRLG+Y+C LK  +K   IY ++ I ERHRHR+E NP Y+ +FEK+  FV SGIN E NL EI+EL++H +FIAVQFHPEF S+ L P+P+F  F+  S
  S:     7 KTKFIFITGGVVSSLGKGITAASIGQILKNRGLKVSIQKLDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFLDENMSKKSNVTAGQIYQSVINKEREGKYLGKTVQVIPHITEEIKQKLTDAALFHKSDVVIVEIGGTVGDIESSPFLEAIRQVRFDFGYRNVLYLHTTLVPYLKKTKEIKTKPTQHSFKELRALGIQPQILVLRSEVPINQETKNKISALCDINSQAIFEALDVDILYQMILNLNHQGIDDFILQHFKLTNFPTADLQAWQQLITRIQNLEK-KVVIALVGKYIVLHDAYLSIVEALKHASYQYNCKLEIKWIDAEKVTSDNISSFFEDCDGILVPYGFGNRAIEGKILAINYARTNNIPFFGICLGMQLAVIEYARNVLHLQDANSLEVDEKTPHPVIT---KKIVDINLGGTLRLGSYSCHLKANTKSKAIYNQEIIYERHRHRFEMNPHYVSLFEKNNDFVVSGINPEQNLCEIVELKSHPWFIAVQFHPEFLSRPLKPHPLFKGFVEAS 533
>gi|73662067|ref|YP_300848.1| CTP synthetase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] >gi|82581534|sp|Q49Z73|PYRG_STAS1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|72494582|dbj|BAE17903.1| CTP synthase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] (536 aa)
Score = 1296, Expect = 1.2e-140, Identities = 257/527 (48%), Positives = 354/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHW----DTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY   + KER G +LG T+QV+PHIT  I ++++L       D +I E+GGT GDIES+PF+EA RQ+++   R  VM++H   L  +    ++KTKP QHSVK+L   GI P+L++VR++  ++  LK+KI+L   I+  ++    +   +Y +P  L  Q + + +    ++          W    DT  SL       K  I +VGKY    DAYLS++ SL+ + +  K D+ +++I+SS + + N++E L+E D ILVPGGFG R  EGKI AI+YARENN+P+FGICLGMQLA++EFARNV+ + DA S E + NT +PII +L  +    +LGGTLRLG Y C +K+G+    IY    I ERHRHRYEFN +Y +  E +G VFSG + +  LVE++E+ ++ FF+A QFHPEF S+   P PIF +F+  S
  S:     2 TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLKVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITNEIKERLLLAGESTNADVVITEIGGTTGDIESLPFIEAIRQIRSDLGRENVMYVHCTLLPYIKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYELTQDLKDKIALFCDIDKASVIECRDADSLYEIPLQLSKQDMDDIVIKRLELNPKYETQLDEWQYLLDTVNSL-----DGKITIGLVGKYVSLQDAYLSVVESLKHAGYPFKKDIEVKWIDSSEVTDENVAEILAEVDGILVPGGFGFRASEGKISAIKYARENNVPYFGICLGMQLATVEFARNVIGLDDAHSAELDPNTPHPIIDLLPEQKDIEDLGGTLRLGLYPCHIKEGTLADSIYNETEIEERHRHRYEFNNEYREQLEANGMVFSGTSPDGRLVEMVEIPSNDFFVACQFHPEFLSRPNRPQPIFKAFIEAS 529
>gi|157150403|ref|YP_001451018.1| CTP synthetase [Streptococcus gordonii str. Challis substr. CH1] >gi|157075197|gb|ABV09880.1| CTP synthase [Streptococcus gordonii str. Challis substr. CH1] (537 aa)
Score = 1296, Expect = 1.4e-140, Identities = 249/527 (47%), Positives = 361/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+  KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++  V   +K K++    +  E +   ++++H+Y +P +L+ QK+   + +  K++VP       W      +   KK +  IA+VGKY + PDAY+S++ +L+ + +    ++ I++I+++ +   N++E L   D I+VPGGFG+R  EGKI AI+YARE ++P  GICLGMQL  +EFAR+VL++ DA+S E N +T  PII ++  +    +LGGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKDKIKRAARTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPVGQNIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQKMDQIVCDHLKLDVP-VADMTEWSAMVEKVMNLKK-QVHIALVGKYVELPDAYISVVEALKHAGYANNAEVKIDWIDANRVTAENVAELLGSADGIIVPGGFGQRGTEGKIQAIRYAREQDVPMLGICLGMQLTCVEFARHVLELADANSAELNPDTPYPIIDLMRDQIDVEDLGGTLRLGLYPSKLKHGSKAAAAYDHQEVVQRRHRHRYEFNNDFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEGLYTAFITAA 530
>gi|154687830|ref|YP_001422991.1| CTP synthetase [Bacillus amyloliquefaciens FZB42] >gi|154353681|gb|ABS75760.1| PyrG [Bacillus amyloliquefaciens FZB42] (535 aa)
Score = 1295, Expect = 1.4e-140, Identities = 251/527 (47%), Positives = 354/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL + SNVT G++Y   + KER G +LG T+QV+PHIT  +  ++     +   D +I E+GGTVGDIES+PFLEA RQ+++      VM+IH   +  +    +LKTKP QHSVK+L S GI PN+++VR++  +S  +K+KI+L   I+ + +    +  ++Y +P +L+ Q +   + +  K+E  +      W    + +K   K    I++VGKY +  DAY+S++ SL  + +    D+ I++IN+  + E+NI EL+   D I+VPGGFG R +EGKI+A +YAREN IPFFGICLGMQ+ASIE+ARNVL +  A S E + +T  PII +L  +    +LGGTLRLG Y C+L++ +K  E Y  + + ERHRHRYEFN +Y    E++GFVFSG + +  LVEIIEL++H +++A QFHPEF S+   P P+F  F+  S
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGMSVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNRFSNVTTGKIYSAVLKKERRGDYLGGTVQVIPHITNELKDRVYRAGKETNADVVITEIGGTVGDIESLPFLEAIRQMKSDIGHENVMYIHCTLVPYIKAAGELKTKPTQHSVKELRSLGIQPNIIVVRTEMPISQDMKDKIALFCDIDTKAVIECEDADNLYSIPLNLQEQGLDKLVCDHMKLECKDP-DMTEWKDLVTKVKNLSK-TITISLVGKYVELQDAYISVVESLRHAGYAFDADVKIKWINAEEVTESNIQELTGGTDGIIVPGGFGDRGVEGKIIAAKYARENKIPFFGICLGMQIASIEYARNVLGLEGAHSAEIDPSTPYPIIDLLPEQKDVEDLGGTLRLGLYPCKLQEDTKAFEAYADEVVYERHRHRYEFNNEYRQQMEENGFVFSGTSPDGRLVEIIELKDHPWYVACQFHPEFKSRPTRPQPLFKDFIGAS 528
>gi|85057402|ref|YP_456318.1| CTP synthetase [Aster yellows witches'-broom phytoplasma AYWB] >gi|84789507|gb|ABC65239.1| CTP synthase [Aster yellows witches'-broom phytoplasma AYWB] (562 aa)
Score = 1295, Expect = 1.6e-140, Identities = 269/528 (50%), Positives = 366/528 (69%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHG-FVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + +TGGV SSLGKG+  +S+G +LK  G +V I K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERFL+ N+ K+SNVTAG++Y   I KER+GK+LG T+QV+PHITE I QK+   +  ++ D +IVE+GGTVGDIES PFLEA RQ++  +    V+++HT  +  L    ++KTKP QHS K+L + GI P +L++RS+  ++ + K KIS    I ++ I+  +++  +Y +  +L +Q + + I   FK+        + W    + I+  +K K  IA+VGKY    DAYLSI+ +L+ +S+     L I++I++  +  +NIS   E  D ILVP GFG R IEGKILAI YAR NNIPFFGICLGMQLA IE+ARNVL + DA+S E +E T +P+IT    K  + NLGGTLRLG+Y+C LK  +K   IY ++ I ERHRHR+E NP Y+ +FEK+  FV SGIN E NL EI+EL++H +FIAVQFHPEF S+ L P+P+F  F+  S
  S:    33 KTKFIFITGGVVSSLGKGITAASIGQILKNRGLKVSIQKLDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFLDENMSKKSNVTAGQIYQSVINKEREGKYLGKTVQVIPHITEEIKQKLTDAALFHKSDVVIVEIGGTVGDIESSPFLEAIRQVRFDFGYRNVLYLHTTLVPYLKKTKEIKTKPTQHSFKELRALGIQPQILVLRSEVPINQETKNKISALCDINSQAIFEALDVDILYQMILNLNHQGIDDFILQHFKLTNFPTADLQAWQQLITRIQNLEK-KVVIALVGKYIVLHDAYLSIVEALKHASYQYNCKLEIKWIDAEKVTSDNISSFFEDCDGILVPYGFGNRAIEGKILAINYARTNNIPFFGICLGMQLAVIEYARNVLHLQDANSLEVDEKTPHPVIT---KKIVDINLGGTLRLGSYSCHLKANTKSKAIYNQEIIYERHRHRFEMNPHYVSLFEKNNDFVVSGINPEQNLCEIVELKSHPWFIAVQFHPEFLSRPLKPHPLFKGFVEAS 559
>gi|188036457|gb|ACD45983.1| CTP synthetase [Anoxybacillus gonensis] (530 aa)
Score = 1294, Expect = 1.9e-140, Identities = 251/527 (47%), Positives = 355/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGS-DLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G +LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ++A    Q   +H+  L+  +  + ++KTKP QHSVK+L S GI PN+++VR++  +S  +K+KI+L   I+ + +    +   +Y +P  L+ QK+   +    K+   N      W      ++     K  IA+VGKY +  DAY+S++ +L  + +    D+ I +INS  ++ NN+++L +  + ILVPGGFG R IEGKI AI+YARE  IPF GICLGMQLAS+EFAR+V+ +  A S E + +T +PII +L  +    +LGGTLRLG Y C+L +G+K  + Y+ + + ERHRHRYEFN +Y  + E++GFVFSG + +  LVEI+EL++H +F+A QFHPEFTS+   P P+F  F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSTVLKKERRGDYLGGTVQVIPHITNEIKERVFRAGRETNADVVITEIGGTVGDIESLPFLEAIRQIKAMSSRQCD-VHSCTLVPYIKAAGEMKTKPTQHSVKELRSLGIQPNVIVVRTEMPMSQDMKDKIALFCDIDPKAVIEARDADTLYAVPLMLQEQKLDQIVCEHLKLNC-NEADMTEWVALVEKVRNLSN-KTTIALVGKYVELQDAYISVVEALRHAGYAFDADIDIRWINSEHVDRNNVAQLLQGVNGILVPGGFGDRGIEGKIEAIRYAREQRIPFLGICLGMQLASVEFARHVVGLKGAHSAEIDPSTPHPIIDLLPEQKDIEDLGGTLRLGLYPCKLVEGTKAYDAYQDEVVYERHRHRYEFNNEYRTMMEENGFVFSGTSPDGRLVEIVELKDHPWFVAAQFHPEFTSRPTRPQPLFREFIRAS 527
>gi|167040918|ref|YP_001663903.1| CTP synthetase [Thermoanaerobacter sp. X514] >gi|166855158|gb|ABY93567.1| CTP synthase [Thermoanaerobacter sp. X514] (533 aa)
Score = 1294, Expect = 1.9e-140, Identities = 253/524 (48%), Positives = 357/524 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + VTGGV SSLGKG+  +SLG +LK  G  V + KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY+  I KER G +LG T+QV+PHIT  I +++  ++ +   D +I E+GGTVGDIES+PFLEA RQ+  +  R  VMFIH   +  L    +LKTKP QHSVK+L S GI P++++ R++ +++  LKEKI+L   +  E +    +++ IY +P  LE QKV   +    ++ +P  +   K W  +    K P K +  +A+VGKY D  DAY+S++ +L+ +  Y    ++I ++N+  +N+  +  L +  D ILVPGGFG R IEGKI AIQYAREN IP+ G+CLGMQ A IEFARNV  +  A+STEF+ NT+ P+I ++  +      GGT+RLG Y C++ +G+K  + Y+ + + ERHRHRYEFN +Y ++    G V SG++ +  LVEIIEL++H +F+A QFHPEF S+ L P+P+F  F+
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKSRGISVAVQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDINLTKNSNVTAGKVYWSVITKERKGDYLGITVQVIPHITNEIKERVYRVAKEKNVDVVITEIGGTVGDIESLPFLEAIRQVAIEQGRENVMFIHVTLVPHLGKTGELKTKPTQHSVKELRSIGIQPDMIVCRTELSLTQDLKEKIALFCNVSVEAVIENRDVESIYEVPLELERQKVDEYVLK--RLNLPLGQSDLKEWREYVEREKNPIK-EVEVALVGKYVDLHDAYISVVEALKHAGVYHSAAVNIRWVNAEHVNDETVETLLKGADGILVPGGFGDRGIEGKIRAIQYARENKIPYLGLCLGMQCAVIEFARNVAGLKGANSTEFDPNTSYPVIDLMPEQKDIDEKGGTMRLGVYPCKVIEGTKAYQAYQDELVYERHRHRYEFNNQYRELLTSKGLVLSGLSPDERLVEIIELKDHPYFVASQFHPEFKSRPLKPHPLFRDFI 525
>gi|71904261|ref|YP_281064.1| CTP synthetase [Streptococcus pyogenes MGAS6180] >gi|119391190|sp|Q48RF1|PYRG_STRPM CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|71803356|gb|AAX72709.1| CTP synthase [Streptococcus pyogenes MGAS6180] (534 aa)
Score = 1294, Expect = 1.9e-140, Identities = 252/529 (47%), Positives = 363/529 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   ++    D +I EVGGTVGDIES+PFLEA RQ++A   S+ VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++ V   +K K++    + +E +    N++H+Y +P +L+ Q +   + +  K+  P +     W      +   +K   +IA+VGKY + PDAYLS++ +L+ S +   T + ++++N++ +  +N ++ L + D I+VPGGFG+R  EGKI AI+YAREN++P  GICLGMQL  +EFAR+VL M  A+S E   +T  PII I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN K+   FE  GFVFSG++ +N LVEI+EL+  KFF+A Q+HPE  S+   P  ++ +F+  + K
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIKNKLAQFCDVNSEAVIESRNVEHLYQIPLNLQAQSMDQIVCDHLKLNAP-QADMTEWSAMVDKVMNLRK-TTKIALVGKYVELPDAYLSVVEALKHSGYANDTAIDLKWVNANDVTVDNAADLLGDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGICLGMQLTCVEFARHVLNMEGANSFELEPSTKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAMAYNNQEVVQRRHRHRYEFNNKFRPEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAAIK 531
>gi|152977524|ref|YP_001377041.1| CTP synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98] >gi|152026276|gb|ABS24046.1| CTP synthase [Bacillus cereus subsp. cytotoxis NVH 391-98] (535 aa)
Score = 1293, Expect = 3.1e-140, Identities = 251/527 (47%), Positives = 350/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME-VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  L    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+K++L   I+ + +    +   +Y +P SL+ Q +   + +  K++  P  +    W      ++   K K RIA+VGKY +  DAY+S++ +L  + +   TD+ ++++N+  +   N+ EL  + D ILVPGGFG R +EGKI+AIQYAREN +PF GICLGMQLASIEFARNVL +  A+S+E N +T   II +L  +    +LGGTLRLG Y C+L   +     Y    + ERHRHRYEFN ++    E  GF+FSG + +  LVEI+EL++H +F+A QFHPE  S+   P P+F  F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSSVLQKERRGEYLGGTVQVIPHITNEIKERVFRAGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYLKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEMPVSQDMKDKLALFCDIDPKAVIEAADADTLYAVPLSLQEQNMDQIVCDHLKLDNAPADM--TEWKALVDKVRNLSK-KTRIALVGKYVELQDAYISVVEALRHAGYTFDTDVEVKWVNAEHVTAENVKELVGDTDGILVPGGFGDRGVEGKIVAIQYARENKVPFLGICLGMQLASIEFARNVLGLEGANSSEINPDTPYAIIDLLPEQKDVEDLGGTLRLGLYPCKLTPETNAYRAYNEPVVYERHRHRYEFNNQFRQEMENAGFIFSGTSPDGRLVEIVELQDHPWFVAAQFHPELVSRPNRPQPLFRDFVQAS 528
>gi|15616354|ref|NP_244659.1| CTP synthetase [Bacillus halodurans C-125] >gi|24212161|sp|Q9K6D7|PYRG_BACHD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|10176417|dbj|BAB07511.1| CTP synthetase [Bacillus halodurans C-125] (532 aa)
Score = 1292, Expect = 3.5e-140, Identities = 253/527 (48%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYR-SQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G +LG T+QV+PH+T  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++      VM+IH   +  L    ++K+KP QHSVK+L S GI PN+++VR++  V  ++KEKI+L   I  +++    +   +Y +P  L+ Q +   + +   +          W +    +K       +IA+VGKY   PDAYLS+  +L  + +    D++I++++S  +   N++E L   D ILVPGGFG R IEGKI AI+YARE  IPF GICLGMQLASIEFARNVL +  A S E N +T +PII +L  +    ++GGTLRLG Y C+LK+G+     Y  + I ERHRHRYEFN +Y +  E  GF+FSG + +  LVEI+EL +H FFIA QFHPEF S+   P P+F  F+  S
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGMKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKNSNVTTGKIYSSVLKKERRGDYLGGTVQVIPHVTNEIKERVFRAGRETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGVDNVMYIHCTLIPYLAAAGEMKSKPTQHSVKELRSLGIQPNVIVVRTEKPVPEEMKEKIALFCDIRKDSVIEARDADTLYEVPLDLQAQNLDEIVCDHLNLSC-QEADMTEWKSLVEKVKNLSGL-VKIALVGKYVALPDAYLSVAEALRHAGYAFDADINIKWVDSEDVTAENVAEQLQGVDGILVPGGFGDRGIEGKIEAIRYAREQKIPFLGICLGMQLASIEFARNVLGLEGAHSAEINPDTPHPIIDLLPEQKDVEDMGGTLRLGLYPCKLKNGTLAQSAYNDQVIYERHRHRYEFNNQYREQMEAKGFMFSGTSPDGRLVEIVELGDHPFFIASQFHPEFVSRPTRPQPLFREFIQAS 529
>gi|27468643|ref|NP_765280.1| CTP synthetase [Staphylococcus epidermidis ATCC 12228] >gi|57867610|ref|YP_189298.1| CTP synthetase [Staphylococcus epidermidis RP62A] >gi|38258082|sp|Q8CNI2|PYRG_STAES CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|81673826|sp|Q5HM95|PYRG_STAEQ CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|27316190|gb|AAO05324.1|AE016749_270 CTP synthase [Staphylococcus epidermidis ATCC 12228] >gi|57638268|gb|AAW55056.1| CTP synthase [Staphylococcus epidermidis RP62A] (535 aa)
Score = 1292, Expect = 4.0e-140, Identities = 257/527 (48%), Positives = 352/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY   + KER G +LG T+QV+PHIT  I ++++L       D +I E+GGT GDIES+PFLEA RQ+++   R  VM++H   L  +    ++KTKP QHSVK+L   GI P+L++VR++  ++  LK+KI+L   I+ E++    +   +Y +P  L  Q + + +    ++          W    + +      K  I +VGKY    DAYLS++ SL+ + +  K D+ +++I+SS +N++N+ + LS+ D ILVPGGFG R  EGKI AI+YARENNIPFFGICLGMQLA++EFAR+VL    A S E + +T  PII +L  +    +LGGTLRLG Y C +K+G+   +IY +  I ERHRHRYEFN ++ +  E +G VFSG + +  LVEIIE+  + FFIA QFHPEF S+   P PIF SF+  +
  S:     2 TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLKVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITNEIKERLLLAGESTNADVVITEIGGTTGDIESLPFLEAIRQIRSDLGRENVMYVHCTLLPYIKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIALFCDIKKESVIECRDADSLYEIPLQLSKQNMDDIVIQRLQLNAKYETQLDEWKHLLNTVNNLDG-KITIGLVGKYVSLQDAYLSVVESLKHAGYPFKKDVVVKWIDSSEVNDDNVEAYLSDVDGILVPGGFGFRASEGKIAAIRYARENNIPFFGICLGMQLATVEFARHVLGYEGAHSAELDPSTPYPIIDLLPEQKDIEDLGGTLRLGLYPCHIKEGTLAEKIYNKNDIEERHRHRYEFNNEFREQLESNGMVFSGTSPDGRLVEIIEIPKNDFFIACQFHPEFLSRPNRPQPIFKSFVEAA 529
>gi|116496002|ref|YP_807736.1| CTP synthetase [Lactobacillus casei ATCC 334] >gi|191639481|ref|YP_001988647.1| CTP synthase (UTP--ammonia ligase) (CTP synthetase) [Lactobacillus casei] >gi|116106152|gb|ABJ71294.1| CTP synthase [Lactobacillus casei ATCC 334] >gi|190713783|emb|CAQ67789.1| CTP synthase (UTP--ammonia ligase) (CTP synthetase) [Lactobacillus casei BL23] (534 aa)
Score = 1291, Expect = 4.2e-140, Identities = 252/527 (47%), Positives = 355/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKR-KSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G ++ I KFDPY+NVD GTM P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + +ER G++LGAT+QV+PHIT  I +KI+  +     D +I E+GGTVGDIES+PFLEA RQ++    S+ V +IH   +  L    ++KTKP QHSVK+L S GI PN+L+VR++  ++  +K+KI+L T +    +    + K +Y +P +L+ Q +   + + F  +VP+    + W      ++    +  +IA+VGKY    DAY+S+  +L+ + +Y  +D+ ++   +  +N++N+  L + FD ILVPGGFG R +EGKI AI+YAREN+IPF GICLGMQ+AS+EFAR+VL + DA +TE   +  +PII ++  +    NLGGTLRLG Y C LK GS   + Y     I +RHRHRYEFN KY    E HG VFSG++ +N L+EIIE   +KFF+A Q+HPEF S+   P  +F +F+  +
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKITIQKFDPYINVDPGTMNPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLQRERRGEYLGATVQVIPHITNMIKEKIMRAAKHSDSDVIITEIGGTVGDIESLPFLEAIRQMKRDVGSENVFYIHASLVPYLRAADEMKTKPTQHSVKELRSIGIQPNMLVVRTEKPITEDMKKKIALFTDVPENAVIESRDAKTLYSIPLALQAQGMDQIVVDHFGFDVPD-ADMRAWTQLEHKVQH-LTHTTKIALVGKYVALKDAYISVAEALKHAGYYWDSDIDLQMFQAEDVNDDNVESLLQGFDGILVPGGFGDRGLEGKIAAIRYARENDIPFLGICLGMQMASVEFARDVLGLKDAGTTETQPDIKDPIIDLMRDQVGVKNLGGTLRLGLYPCVLKPGSVAAKAYDNAHEIQKRHRHRYEFNTKYRQAMEDHGLVFSGVSPDNRLMEIIEYPKNKFFVAPQYHPEFQSRPNKPEGLFKAFIQAA 529
>gi|94995061|ref|YP_603159.1| CTP synthetase [Streptococcus pyogenes MGAS10750] >gi|119391189|sp|Q1J4X1|PYRG_STRPF CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|94548569|gb|ABF38615.1| CTP synthase [Streptococcus pyogenes MGAS10750] (534 aa)
Score = 1291, Expect = 4.2e-140, Identities = 251/529 (47%), Positives = 363/529 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   ++    D +I EVGGTVGDIES+PFLEA RQ++A   S+ VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++ V   +K K++    + +E +    +++H+Y +P +L+ Q +   + +  K+  P +     W      +   +K   +IA+VGKY + PDAYLS++ +L+ S +   T + ++++N++ +  +N ++ L + D I+VPGGFG+R  EGKI AI+YAREN++P  GICLGMQL  +EFAR+VL M  A+S E   +T  PII I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN K+   FE  GFVFSG++ +N LVEI+EL+  KFF+A Q+HPE  S+   P  ++ +F+  + K
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIKNKLAQFCDVNSEAVIESRDVEHLYQIPLNLQAQSMDQIVCDHLKLNAP-QADMTEWSAMVDKVMNLRK-TTKIALVGKYVELPDAYLSVVEALKHSGYANDTAIDLKWVNANDVTVDNAADLLGDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGICLGMQLTCVEFARHVLNMEGANSFELEPSTKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAMAYNNQEVVQRRHRHRYEFNNKFRSEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAAIK 531
>gi|15675707|ref|NP_269881.1| CTP synthetase [Streptococcus pyogenes M1 GAS] >gi|21911168|ref|NP_665436.1| CTP synthetase [Streptococcus pyogenes MGAS315] >gi|28895146|ref|NP_801496.1| CTP synthetase [Streptococcus pyogenes SSI-1] >gi|50914964|ref|YP_060936.1| CTP synthetase [Streptococcus pyogenes MGAS10394] >gi|94989243|ref|YP_597344.1| CTP synthetase [Streptococcus pyogenes MGAS9429] >gi|94993130|ref|YP_601229.1| CTP synthetase [Streptococcus pyogenes MGAS2096] >gi|139473120|ref|YP_001127835.1| CTP synthetase [Streptococcus pyogenes str. Manfredo] >gi|54038962|sp|P65926|PYRG_STRP3 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|54041769|sp|P65925|PYRG_STRP1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|73913716|sp|Q5XA10|PYRG_STRP6 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391186|sp|Q1J9X6|PYRG_STRPB CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391187|sp|Q1JK23|PYRG_STRPC CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|13622924|gb|AAK34602.1| putative CTP synthetase [Streptococcus pyogenes M1 GAS] >gi|21905379|gb|AAM80239.1| putative CTP synthetase [Streptococcus pyogenes MGAS315] >gi|28810391|dbj|BAC63329.1| putative CTP synthetase [Streptococcus pyogenes SSI-1] >gi|50904038|gb|AAT87753.1| CTP synthase [Streptococcus pyogenes MGAS10394] >gi|94542751|gb|ABF32800.1| CTP synthase [Streptococcus pyogenes MGAS9429] >gi|94546638|gb|ABF36685.1| CTP synthase [Streptococcus pyogenes MGAS2096] >gi|134271366|emb|CAM29586.1| putative CTP synthase [Streptococcus pyogenes str. Manfredo] (534 aa)
Score = 1290, Expect = 5.6e-140, Identities = 251/529 (47%), Positives = 363/529 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   ++    D +I EVGGTVGDIES+PFLEA RQ++A   S+ VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++ V   +K K++    + +E +    +++H+Y +P +L+ Q +   + +  K+  P +     W      +   +K   +IA+VGKY + PDAYLS++ +L+ S +   T + ++++N++ +  +N ++ L + D I+VPGGFG+R  EGKI AI+YAREN++P  GICLGMQL  +EFAR+VL M  A+S E   +T  PII I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN K+   FE  GFVFSG++ +N LVEI+EL+  KFF+A Q+HPE  S+   P  ++ +F+  + K
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIKNKLAQFCDVNSEAVIESRDVEHLYQIPLNLQAQSMDQIVCDHLKLNAP-QADMTEWSAMVDKVMNLRK-TTKIALVGKYVELPDAYLSVVEALKHSGYANDTAIDLKWVNANDVTVDNAADLLGDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGICLGMQLTCVEFARHVLNMEGANSFELEPSTKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAMAYNNQEVVQRRHRHRYEFNNKFRPEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAAIK 531
>gi|19746815|ref|NP_607951.1| CTP synthetase [Streptococcus pyogenes MGAS8232] >gi|24212109|sp|Q8NZF8|PYRG_STRP8 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|19749051|gb|AAL98450.1| putative CTP synthetase [Streptococcus pyogenes MGAS8232] (534 aa)
Score = 1290, Expect = 6.7e-140, Identities = 252/529 (47%), Positives = 361/529 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLN-ENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   ++    D +I EVGGTVGDIES+PFLEA RQ++A   S+ VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++ V   +K K++    + +E +    +++H+Y +P +L+ Q +   + +  K+  P +     W      +   +K   +IA+VGKY + PDAYLS++ +L+ S +   T + ++++N++ +  EN    L + D I+VPGGFG+R  EGKI AI+YAREN++P  GICLGMQL  +EFAR+VL M  A+S E   +T  PII I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN K+   FE  GFVFSG++ +N LVEI+EL+  KFF+A Q+HPE  S+   P  ++ +F+  + K
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIKNKLAQFCDVNSEAVIESRDVEHLYQIPLNLQAQSMDQIVCDHLKLNAP-QADMTEWSAMVDKVMNLRK-TTKIALVGKYVELPDAYLSVVEALKHSGYANDTAIDLKWVNANDVTVENAADLLGDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGICLGMQLTCVEFARHVLNMEGANSFELEPSTKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAMAYNNQEVVQRRHRHRYEFNNKFRSEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAAIK 531
>gi|149182445|ref|ZP_01860920.1| CTP synthetase [Bacillus sp. SG-1] >gi|148849838|gb|EDL64013.1| CTP synthetase [Bacillus sp. SG-1] (533 aa)
Score = 1289, Expect = 7.5e-140, Identities = 248/529 (46%), Positives = 348/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G +V   KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K S+VT G++Y   + KER G +LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ++    R  VM+IH   +  +    ++KTKP QHSVK+L S GI P +++VR++  ++  +K+KI+L   I+   +   ++   +Y +P +L+ QK+        K++         W+     ++   K K +IA+VGKY +  DAY+S++ +L  + +    D+ ++++NS  +N  N+ EL S+ D ILVPGGFG R +EGKI+  +YAREN +PF GICLGMQLAS+E+AR+VL    A S E N  T  PII +L  +    +LGGTLRLG Y C+L  G+K  E Y  + + ERHRHRYEFN  + D  E  GF+FSG + +  LVEI+EL +H +F+A QFHPEFTS+   P P+F  F+N + K
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTTQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSSVTTGKIYSTVLKKERRGDYLGGTVQVIPHITNEIKERVFRAGRETNADIVITEIGGTVGDIESLPFLEAIRQIKNDVGRDNVMYIHCTLVPYIKAAGEMKTKPTQHSVKELRSLGIQPTVIVVRTEMPMTQDMKDKIALFCDIDQRAVIEAMDADTLYAVPLALQEQKLDQLTCEHLKLDC-GEADMTEWNELLHRVRNLSK-KTKIALVGKYVELQDAYISVVEALRHAGYNFDADVEVKWLNSELVNAENVDELMSDVDGILVPGGFGDRGVEGKIVVTKYARENKVPFLGICLGMQLASVEYARHVLGYETAHSAELNPETPYPIIDLLPEQKDVEDLGGTLRLGLYPCKLIPGTKAYEAYAGEVVYERHRHRYEFNNHFRDEMEAAGFIFSGTSPDGRLVEIVELADHPWFVASQFHPEFTSRPTRPQPLFRDFINAALK 530
>gi|157694110|ref|YP_001488572.1| CTP synthetase [Bacillus pumilus SAFR-032] >gi|194016515|ref|ZP_03055129.1| CTP synthase [Bacillus pumilus ATCC 7061] >gi|157682868|gb|ABV64012.1| CTP synthase [Bacillus pumilus SAFR-032] >gi|194011988|gb|EDW21556.1| CTP synthase [Bacillus pumilus ATCC 7061] (535 aa)
Score = 1288, Expect = 1.0e-139, Identities = 248/527 (47%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y   + KER G +LG T+QV+PHIT  I  ++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    +LKTKP QHSVK+L S GI PN+++VR++  ++  +K+KI+L   I+ + +    +   +Y +P  L+ Q +   +    K++  +      W      ++   K +  I +VGKY +  DAY+S++ SL  + +    D+ I++IN+  +   N+++ ++  D I+VPGGFG R +EGKI+A QYAREN +PFFGICLGMQ+ASIE+ARNVL +  A S E +  TA PII +L  +    +LGGTLRLG Y C+L + SK    Y  + + ERHRHRYEFN ++    E  GFVFSG + +  LVEIIEL++H +F+A QFHPEF S+   P P+F  F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGMDVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSTVLKKERRGDYLGGTVQVIPHITNEIKDRVYRAGKETGADVVITEIGGTVGDIESLPFLEAIRQMKSDIGRENVMYIHCTLVPYIRAAGELKTKPTQHSVKELRSLGIQPNVIVVRTEMPMTQDMKDKIALFCDIDTKAVIECQDADTLYSIPLDLQKQGLDKLVCEHMKLDCQD-ADMTEWTALVDKVQNLSK-QVTIGLVGKYVELQDAYISVVESLRHAGYAFDADVQIKWINAEEVTAENMADFAQDVDGIIVPGGFGDRGVEGKIIATQYARENKVPFFGICLGMQVASIEYARNVLGLEGAHSAEIDPETAFPIIDLLPEQKDVDDLGGTLRLGLYPCKLNEDSKAFAAYNDEVVYERHRHRYEFNNEFRQQMEAAGFVFSGTSPDGRLVEIIELKDHPWFLASQFHPEFVSRPTRPQPLFRDFVGAS 528
>gi|153007155|ref|YP_001381480.1| CTP synthetase [Anaeromyxobacter sp. Fw109-5] >gi|152030728|gb|ABS28496.1| CTP synthase [Anaeromyxobacter sp. Fw109-5] (555 aa)
Score = 1287, Expect = 1.3e-139, Identities = 250/530 (47%), Positives = 353/530 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           KTK L VTGGV SSLGKG+A +S+GA+L+  G EV  +K DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF +  + +++N T GR+Y   I +ER G++LG T+QV+PHIT+ I  K ++       D LIVEVGGTVGDIES+PFLEA RQ++        ++ H   +  +    +LKTKP QHSVK+L   GI P+LLL RS   ++ ++K+KI+L   ++   +++ +++K IY +P SL  + + + +   F +    P       W+     +K PK  + R+ VVGKY +  ++Y S+  +L          +   FI+S+ L E ++SEL++ DAILVPGGFG R  EGKILA+++ARE+ IPFFGICLG+Q+A IEF R+VL +  A+S EF+E T +P++T++E +    + GGT+RLG Y C LKDG+K  E+Y    + ERHRHRYEFN  Y   +E  G VFSG N E NLVE+IEL NH  F+  QFHPEF SK  +P+P+F  F++ +++
  S:     7 KTKYLFVTGGVVSSLGKGLAAASIGALLENRGLEVTHLKLDPYINVDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFTSAKMTRKNNYTTGRIYSNVIQRERRGEYLGKTVQVIPHITDEI--KAVIREAAGGVDILIVEVGGTVGDIESLPFLEAIRQMKYDVGEENAVYAHLTLVPFIAAAGELKTKPTQHSVKELREIGIQPDLLLCRSDREIAREMKDKIALFCNVDPSAVFTALDVKSIYEVPLSLHKEGLDDKLAELFNIWSRAPR---LDKWEQIVQKVKAPKHGEVRVGVVGKYVELHESYKSLNEALVHGGIGADVRVKQVFIDSTKLEEGDLSELNQVDAILVPGGFGVRGTEGKILAVRHAREHKIPFFGICLGLQMAVIEFGRSVLGLERANSLEFDEQTPHPVVTLMEAQKAVADKGGTMRLGTYPCALKDGTKARELYGVDLVQERHRHRYEFNNAYRAQYEGAGMVFSGTNPELNLVEMIELNNHPHFVGCQFHPEFKSKPFAPHPLFAGFVHAARE 534
>gi|24378619|ref|NP_720574.1| CTP synthetase [Streptococcus mutans UA159] >gi|81452683|sp|Q8DWG1|PYRG_STRMU CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|24376475|gb|AAN57880.1|AE014861_8 CTP synthetase (UTP-ammonia lyase) [Streptococcus mutans UA159] (536 aa)
Score = 1287, Expect = 1.3e-139, Identities = 246/527 (46%), Positives = 357/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   +++ H+Y +P +L+ Q +   + +  K++VP       W      +   KK K +IA+VGKY + PDAYLS++ +L+ S +   T + + +IN++ +    +++ L + D I+VPGGFG R  EGKI AI+YAREN++P  GICLGMQL  +E+AR+VL +  A+S E + +T  P+I I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN  +   FE+ GFVFSG++ +N LVE++EL + KFF+A Q+HPE  S+   P  ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAATTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQGIKNKLAQFCDVAPEAVIESLDVDHLYQIPLNLQAQNMDQIVCDHLKLDVP-VADMTEWSAMVDKVMNLKK-KTKIALVGKYVELPDAYLSVVEALKHSGYVNDTAIDLNWINANEVTPETVTDLLGDADGIIVPGGFGHRGTEGKIEAIRYARENDVPMLGICLGMQLTCVEYARHVLNLEGANSAELDPDTKYPVIDIMRDQIDIEDMGGTLRLGLYPCKLKSGSKTASAYSNQEVVQRRHRHRYEFNNAFRQQFEEAGFVFSGVSPDNRLVEVVELSDKKFFVAAQYHPELQSRPNRPEELYTAFITAA 529
>gi|94991187|ref|YP_599287.1| CTP synthetase [Streptococcus pyogenes MGAS10270] >gi|119391188|sp|Q1JF16|PYRG_STRPD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|94544695|gb|ABF34743.1| CTP synthase [Streptococcus pyogenes MGAS10270] (534 aa)
Score = 1285, Expect = 2.1e-139, Identities = 250/529 (47%), Positives = 362/529 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   ++    D +I EVGGTVGDIES+PFLEA RQ++    S+ VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++ V   +K K++    + +E +    +++H+Y +P +L+ Q +   + +  K+  P +     W      +   +K   +IA+VGKY + PDAYLS++ +L+ S +   T + ++++N++ +  +N ++ L + D I+VPGGFG+R  EGKI AI+YAREN++P  GICLGMQL  +EFAR+VL M  A+S E   +T  PII I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN K+   FE  GFVFSG++ +N LVEI+EL+  KFF+A Q+HPE  S+   P  ++ +F+  + K
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKTDVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIKNKLAQFCDVNSEAVIESRDVEHLYQIPLNLQAQSMDQIVCDHLKLNAP-QADMTEWSAMVDKVMNLRK-TTKIALVGKYVELPDAYLSVVEALKHSGYANDTAIDLKWVNANDVTVDNAADLLGDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGICLGMQLTCVEFARHVLNMEGANSFELEPSTKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAMAYNNQEVVQRRHRHRYEFNNKFRPEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNRPEELYTAFVTAAIK 531
>gi|162448231|ref|YP_001621363.1| cytidine triphosphate (CTP) synthetase [Acholeplasma laidlawii PG-8A] >gi|161986338|gb|ABX81987.1| cytidine triphosphate (CTP) synthetase [Acholeplasma laidlawii PG-8A] (536 aa)
Score = 1285, Expect = 2.5e-139, Identities = 256/529 (48%), Positives = 362/529 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG++ S++G +LK  G +V   KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL KES++T G++Y   I KER G +LGAT+QV+PH+T+ I  K+   +     D +I E GGTVGDIES+P+LEA RQ +  +     ++IH   +  L   +++KTKP QHSVK+L S GI P+++++RS+  +S+ +KEKI+L   ++ E ++  +++  IY    +   QK+ + I   F+++         W+     IK P +++  I +VGKY    DAYLS+  SL+ + FY + ++ I+++N+  L  +N  + L   D ILVPGGFGKR   GK+LAIQYARE+NIPFFGIC GMQLA+IE+ARNVL   +A++TE + NT+ P+I  LE     T+LGGTLRLG Y+C+++  +   + Y    I ERHRHRYEFN +Y  +F  + F+FSGIN E NLVEIIEL+NH +F+ VQ+HPEF S+ L P+P+F  F+ +S K
  S:     3 TKFIFVTGGVVSSLGKGISASAIGQILKSRGLKVFTQKFDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDINLTKESSITTGKIYQNVINKERRGDYLGATVQVIPHVTDEIKLKLKEAAQISGADVIITETGGTVGDIESLPYLEAIRQARRDFGYKNTLYIHNTLVPFLKASNEIKTKPTQHSVKELRSLGIQPDIIILRSEVNISSDVKEKIALFCDVDKEAVFESLDVNVIYESILNFRKQKIDDYILKHFQIDNEVIPDMSSWEDLIERIKTP-QHRITIGLVGKYVTLQDAYLSVSESLKHAGFYHRCEVKIKWLNAEKLTNDNYEDTLESCDGILVPGGFGKRATSGKLLAIQYAREHNIPFFGICYGMQLATIEYARNVLGYKEAETTEIDPNTSMPLIHTLEAPG--TDLGGTLRLGLYDCKIEPNTVASKSYGHALIKERHRHRYEFNNQYKALFNDNNFIFSGINPERNLVEIIELKNHVWFVGVQYHPEFLSRPLRPHPLFRRFIEMSLK 530
>gi|125718782|ref|YP_001035915.1| CTP synthetase [Streptococcus sanguinis SK36] >gi|125498699|gb|ABN45365.1| CTP synthase, putative [Streptococcus sanguinis SK36] (537 aa)
Score = 1283, Expect = 3.7e-139, Identities = 246/527 (46%), Positives = 357/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+  KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   ++++H+Y +P  L+ QK+   + +  K++VP       W      +   +K + RIA+VGKY + PDAY+S++ +L+ + +    ++ I++I+++ +   N +E L   D I+VPGGFG+R  EGKI  I+YARE ++P  G+CLGMQL  +EFAR+VL + DA+S E N +T  PII ++  +    +LGGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKDKIKRAARTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEKPAGQNIKNKLAQFCDVAPEAVIESLDVEHLYQIPLDLQAQKMDQIVCDHLKLDVP-AADMTEWSAMVEKVMSLEK-QVRIALVGKYVELPDAYISVVEALKHAGYANDAEVKIDWIDANQVTVENAAELLGSADGIIVPGGFGQRGTEGKIQTIRYAREQDVPMLGVCLGMQLTCVEFARHVLGLADANSAELNPDTPFPIIDLMRDQIDVEDLGGTLRLGLYPSKLKSGSKAAAAYDHQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEGLYTAFVTAA 530
>gi|55820232|ref|YP_138674.1| CTP synthetase [Streptococcus thermophilus LMG 18311] >gi|116627092|ref|YP_819711.1| CTP synthetase [Streptococcus thermophilus LMD-9] >gi|81561093|sp|Q5M6C0|PYRG_STRT2 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|55736217|gb|AAV59859.1| CTP synthetase [Streptococcus thermophilus LMG 18311] >gi|116100369|gb|ABJ65515.1| CTP synthase [Streptococcus thermophilus LMD-9] (534 aa)
Score = 1283, Expect = 4.4e-139, Identities = 248/527 (47%), Positives = 356/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+  KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++HIY +P +++ Q +   + +  K+  P       W      +   KK   +IA+VGKY +  DAYLS++ +L+ S     T + I+++N++ L   N+ S L++ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E +  T  PII I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN K+ + FE  GFVFSG++ +N L+E++EL + KFF+A Q+HPE+ S+      ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKDKIKRAATTTDSDVVITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHIYQVPLNMQAQGMDQIVCDHLKLNAP-AADMTEWSAMVDKVLNLKK-TTKIALVGKYVELHDAYLSVVEALKHSGLANDTAIDIDWVNANDLTAENVASRLADADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLHLDGANSAELDPETQYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAAAYGNQEVVQRRHRHRYEFNTKFREQFEAEGFVFSGVSPDNRLMEVVELPDKKFFVAAQYHPEYHSRPNHAEELYSAFVTAA 529
>gi|167756042|ref|ZP_02428169.1| hypothetical protein CLORAM_01562 [Clostridium ramosum DSM 1402] >gi|167704034|gb|EDS18613.1| hypothetical protein CLORAM_01562 [Clostridium ramosum DSM 1402] (534 aa)
Score = 1283, Expect = 4.5e-139, Identities = 252/528 (47%), Positives = 355/528 (67%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV S LGKG+  +SLG +LK  G +V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  L + S++T GR+Y   I+KER G +LGAT+QVVPHIT  I  KI   ++    D +I E+GGT GDIES+PFLEA RQ++        ++IHT  L  +    ++KTKP QHSVK+L   GI P+ ++ RS+  +  +LK+KISL   +  +N+ S  +++ +Y LP  L +Q + + +    ++E P +     W++    +K    ++  IA+VGKY+  PDAYLS+  +L  + +Y  + ++IEF++S  + ++N++E L   D I+VPGGFG R IEG I AI+YAR NN+PFFGICLGMQLA+IE+ARNV  + DA+S EF+E T NPII ++  ++  T++GGT RLG+YNCEL  G+   E+Y    I ERHRHRYEFN +Y D   +HG   +GIN E NLVEI+E++ H +F+A QFHPEFTS+     P+F   +  + K
  S:     3 KYIFVTGGVVSGLGKGLTAASLGRILKQRGLKVFMQKLDPYINVDPGTMSPYQHGEVFVTADGAETDLDLGHYERFIDEELNRNSSITTGRIYSNVISKERRGDYLGATVQVVPHITNEIKAKIYAAASSSNADIVITEIGGTTGDIESLPFLEAIRQVRLDLGYDNTLYIHTTLLPYIGASHEVKTKPTQHSVKELRGLGIQPDFIVCRSEKYIEQELKDKISLFCNVPTKNVISNYDVEVLYELPMMLLDQHMDDLVLEHLRIEAP-QPNMSEWESLIERVK-GLDHEITIALVGKYTQLPDAYLSVNEALRHAGYYENSVVNIEFVDSEEITKDNVAEKLKTADGIIVPGGFGNRGIEGMIDAIEYARINNLPFFGICLGMQLATIEYARNVCGLKDANSLEFDELTKNPIINLMSDQSL-TDMGGTQRLGDYNCELAAGTHARELYGVDMIQERHRHRYEFNNEYKDALVEHGLTIAGINPERNLVEIVEIKEHPYFVACQFHPEFTSRPNRSQPLFQGLITAAHK 529
>gi|88196031|ref|YP_500844.1| CTP synthetase [Staphylococcus aureus subsp. aureus NCTC 8325] >gi|119391183|sp|Q2FWD1|PYRG_STAA8 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|87203589|gb|ABD31399.1| CTP synthase [Staphylococcus aureus subsp. aureus NCTC 8325] (536 aa)
Score = 1282, Expect = 4.9e-139, Identities = 254/529 (48%), Positives = 347/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  SSLG +LK  G  V I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY   + KER G +LG T+QV+PHIT  I ++++L       D +I E+GGT GDIES+PF+EA RQ+++   R  VM++H   L  +    ++KTKP QHSVK+L   GI P+L++VR++  ++  LK+KI+L   I  E++    +   +Y +P  L  Q + + +    ++          W     ++      K  I +VGKY    DAYLS++ SL+ + +    D+ I +I+SS + + N +E L++ D ILVPGGFG R  EGKI AI+YARENN+PFFGICLGMQLA++EF+RNVL +  A S E +  T  PII +L  +    +LGGTLRLG Y+C +K+G+   ++Y +  I ERHRHRYEFN  Y +  E +G V SG + +  LVE++E+  + FFIA QFHPEF S+   P+PIF SF+  S K
  S:     2 TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKFSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITNEIKERLLLAGESTNADVVITEIGGTTGDIESLPFIEAIRQIRSDLGRENVMYVHCTLLPYIKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIALFCDINKESVIECRDADSLYEIPLQLSQQNMDDIVIKRLQLNAKYETQLDEWKQLLDIVNNLDG-KITIGLVGKYVSLQDAYLSVVESLKHAGYPFAKDIDIRWIDSSEVTDENAAEYLADVDGILVPGGFGFRASEGKISAIKYARENNVPFFGICLGMQLATVEFSRNVLGLEGAHSAELDPATPYPIIDLLPEQKDIEDLGGTLRLGLYSCSIKEGTLAQDVYGKAEIEERHRHRYEFNNDYREQLEANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEASLK 531
>gi|89095586|ref|ZP_01168480.1| CTP synthetase [Bacillus sp. NRRL B-14911] >gi|89089332|gb|EAR68439.1| CTP synthetase [Bacillus sp. NRRL B-14911] (535 aa)
Score = 1282, Expect = 5.9e-139, Identities = 250/529 (47%), Positives = 352/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K +NVT G++Y   + KER G +LG T+QV+PHIT  I ++++   ++   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS  +K+KI L   ++ + +    +   +Y +P +L+ Q     + +  K++   +     W    + ++   K   +IA+VGKY +  DAY+S++ +L+ + +   +D+ I+++NS  + E N+ EL  + D ILVPGGFG R I+GKILAIQYARE   PF GICLGMQLASIEFARNVL +  A S E + +T +PII +L  +    +LGGTLRLG   C+L + +     Y+ + + ERHRHRYEFN  Y    E+ GFVFSG + +  LVEIIE+++H +F+A QFHPEF S+   P P+F  F+  S K
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLNVTIQKFDPYINVDPGTMSPYQHGEVFVTGDGAETDLDLGHYERFIDINLTKFNNVTTGKIYSTVLKKERRGDYLGGTVQVIPHITNEIKERVMRAGHETNADVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHCTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNVIVVRTEMPVSQDMKDKIGLFCDLDPKAVIECRDADTLYAVPLALQEQNFDQIVCDHLKLDC-GQADMAEWTELLNKVRNLSK-TTKIALVGKYVELQDAYISVVEALKHAGYSFDSDIEIKWVNSEEVTEGNVEELLQDADGILVPGGFGDRGIDGKILAIQYAREQKRPFLGICLGMQLASIEFARNVLSLEGAHSAEIDPSTPHPIIDLLPEQKDIEDLGGTLRLGLQACKLNEETNAYAAYQDEVVYERHRHRYEFNNHYRQAMEEKGFVFSGTSPDGRLVEIIEVKDHPWFVASQFHPEFISRPNRPQPLFRDFVGASLK 530
>gi|55822123|ref|YP_140564.1| CTP synthetase [Streptococcus thermophilus CNRZ1066] >gi|81559916|sp|Q5M1S7|PYRG_STRT1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|55738108|gb|AAV61749.1| CTP synthetase [Streptococcus thermophilus CNRZ1066] (534 aa)
Score = 1281, Expect = 7.0e-139, Identities = 248/527 (47%), Positives = 356/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+  KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++HIY +P +++ Q +   + +  K+  P       W      +   KK   +IA+VGKY +  DAYLS++ +L+ S     T + I+++N++ L   N+ S L++ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E +  T  PII I+  +    ++GGTLRLG Y C+LK GSK    Y  + +V+ RHRHRYEFN K+ + FE  GFVFSG++ +N L+E++EL + KFF+A Q+HPE+ S+      ++ +F+  +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVYVTDDGVETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKDKIKRAATTTDSDVVITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHIYQVPLNMQAQGMDQIVCDHLKLNAP-AADMTEWSAMVDKVLNLKK-TTKIALVGKYVELHDAYLSVVEALKHSGLANDTAIDIDWVNANDLTAENVASRLADADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLHLDGANSAELDPETQYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAAAYGNQEVVQRRHRHRYEFNTKFREQFEAEGFVFSGVSPDNRLMEVVELPDKKFFVAAQYHPEYHSRPNHAEELYSAFVTAA 529
>gi|70725909|ref|YP_252823.1| CTP synthetase [Staphylococcus haemolyticus JCSC1435] >gi|82581533|sp|Q4L808|PYRG_STAHJ CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|68446633|dbj|BAE04217.1| CTP synthase [Staphylococcus haemolyticus JCSC1435] (535 aa)
Score = 1280, Expect = 8.7e-139, Identities = 256/529 (48%), Positives = 353/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHW----DTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY   + KER G +LG T+QV+PHIT  I ++++L       D +I E+GGT GDIES+PF+EA RQ+++   R  VM++H   L  +    ++KTKP QHSVK+L   GI P+L++VR++  ++  LK+KI+L   I  E++    +   +Y +P  L  Q + + +     ++         W    DT  SL          I +VGKY    DAYLS++ SL+ + + LK D+ +++I+S  +N+NN+ + L + D ILVPGGFG R  EGKI AI+YARENN+P+FGICLGMQLA++EFARNVL +  A S E N +T  PII +L  +    +LGGTLRLG Y C++K+ +   +IY   +I ERHRHRYEFN ++ +  E +G VFSG + +  LVE++E+  + F+IA QFHPEF S+   P PIF SF+  + K
  S:     2 TKFIFVTGGVVSSLGKGITAASLGRLLKDRGLKVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITNEIKERLLLAGESTNADVVITEIGGTTGDIESLPFIEAIRQIRSDLGRENVMYVHCTLLPYIKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIALFCDINKESVIECRDASSLYEIPLQLSAQDMDDIVIKRLDLDAKYETQLDEWQYLLDTVNSL-----DGTITIGLVGKYVSLQDAYLSVVESLKHAGYPLKKDVVVKWIDSGEVNDNNVEDYLKDVDGILVPGGFGFRASEGKIAAIKYARENNVPYFGICLGMQLATVEFARNVLGLEGAHSAELNPSTPYPIIDLLPEQKDIEDLGGTLRLGLYPCKIKENTLAHQIYDAVNIEERHRHRYEFNNEFREQLEANGMVFSGTSPDGRLVEMVEIPENDFYIACQFHPEFLSRPNRPQPIFKSFVEAAYK 531
>gi|15925117|ref|NP_372651.1| CTP synthetase [Staphylococcus aureus subsp. aureus Mu50] >gi|15927701|ref|NP_375234.1| CTP synthetase [Staphylococcus aureus subsp. aureus N315] >gi|21283780|ref|NP_646868.1| CTP synthetase [Staphylococcus aureus subsp. aureus MW2] >gi|49484351|ref|YP_041575.1| CTP synthetase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49486920|ref|YP_044141.1| CTP synthetase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57652149|ref|YP_186934.1| CTP synthetase [Staphylococcus aureus subsp. aureus COL] >gi|82751728|ref|YP_417469.1| CTP synthetase [Staphylococcus aureus RF122] >gi|87160553|ref|YP_494727.1| CTP synthetase [Staphylococcus aureus subsp. aureus USA300] >gi|148268578|ref|YP_001247521.1| CTP synthetase [Staphylococcus aureus subsp. aureus JH9] >gi|150394642|ref|YP_001317317.1| CTP synthetase [Staphylococcus aureus subsp. aureus JH1] >gi|151222243|ref|YP_001333065.1| CTP synthetase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156980442|ref|YP_001442701.1| CTP synthetase [Staphylococcus aureus subsp. aureus Mu3] >gi|161510332|ref|YP_001575991.1| CTP synthetase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|168727864|ref|ZP_02760141.1| CTP synthase [Staphylococcus aureus subsp. aureus USA300_TCH1516] >gi|54038961|sp|P65924|PYRG_STAAW CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|54038992|sp|P99072|PYRG_STAAN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|54041768|sp|P65923|PYRG_STAAM CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|81648892|sp|Q6G7I3|PYRG_STAAS CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|81650644|sp|Q6GEU8|PYRG_STAAR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|81694047|sp|Q5HE73|PYRG_STAAC CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391182|sp|Q2FF01|PYRG_STAA3 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391184|sp|Q2YUM6|PYRG_STAAB CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|13701921|dbj|BAB43213.1| CTP synthase [Staphylococcus aureus subsp. aureus N315] >gi|14247900|dbj|BAB58289.1| CTP synthase [Staphylococcus aureus subsp. aureus Mu50] >gi|21205222|dbj|BAB95916.1| CTP synthase [Staphylococcus aureus subsp. aureus MW2] >gi|49242480|emb|CAG41196.1| putative CTP synthase [Staphylococcus aureus subsp. aureus MRSA252] >gi|49245363|emb|CAG43838.1| putative CTP synthase [Staphylococcus aureus subsp. aureus MSSA476] >gi|57286335|gb|AAW38429.1| CTP synthase [Staphylococcus aureus subsp. aureus COL] >gi|82657259|emb|CAI81700.1| CTP synthase [Staphylococcus aureus RF122] >gi|87126527|gb|ABD21041.1| CTP synthase [Staphylococcus aureus subsp. aureus USA300_FPR3757] >gi|147741647|gb|ABQ49945.1| CTP synthase [Staphylococcus aureus subsp. aureus JH9] >gi|149947094|gb|ABR53030.1| CTP synthase [Staphylococcus aureus subsp. aureus JH1] >gi|150375043|dbj|BAF68303.1| CTP synthase [Staphylococcus aureus subsp. aureus str. Newman] >gi|156722577|dbj|BAF78994.1| CTP synthase [Staphylococcus aureus subsp. aureus Mu3] >gi|160369141|gb|ABX30112.1| CTP synthase [Staphylococcus aureus subsp. aureus USA300_TCH1516] (536 aa)
Score = 1280, Expect = 9.2e-139, Identities = 254/529 (48%), Positives = 346/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  SSLG +LK  G  V I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY   + KER G +LG T+QV+PHIT  I ++++L       D +I E+GGT GDIES+PF+EA RQ+++   R  VM++H   L  +    ++KTKP QHSVK+L   GI P+L++VR++  ++  LK+KI+L   I  E++    +   +Y +P  L  Q + + +    ++          W     ++      K  I +VGKY    DAYLS++ SL+ + +    D+ I +I+SS + + N +E L++ D ILVPGGFG R  EGKI AI+YARENN+PFFGICLGMQLA++EF+RNVL +  A S E +  T  PII +L  +    +LGGTLRLG Y C +K+G+   ++Y +  I ERHRHRYEFN  Y +  E +G V SG + +  LVE++E+  + FFIA QFHPEF S+   P+PIF SF+  S K
  S:     2 TKFIFVTGGVVSSLGKGITASSLGRLLKDRGLNVTIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKFSNVTAGKVYSHVLKKERRGDYLGGTVQVIPHITNEIKERLLLAGESTNADVVITEIGGTTGDIESLPFIEAIRQIRSDLGRENVMYVHCTLLPYIKAAGEMKTKPTQHSVKELRGLGIQPDLIVVRTEYEMTQDLKDKIALFCDINKESVIECRDADSLYEIPLQLSQQNMDDIVIKRLQLNAKYETQLDEWKQLLDIVNNLDG-KITIGLVGKYVSLQDAYLSVVESLKHAGYPFAKDIDIRWIDSSEVTDENAAEYLADVDGILVPGGFGFRASEGKISAIKYARENNVPFFGICLGMQLATVEFSRNVLGLEGAHSAELDPATPYPIIDLLPEQKDIEDLGGTLRLGLYPCSIKEGTLAQDVYGKAEIEERHRHRYEFNNDYREQLEANGMVISGTSPDGRLVEMVEIPTNDFFIACQFHPEFLSRPNRPHPIFKSFIEASLK 531
>gi|78044367|ref|YP_358997.1| CTP synthetase [Carboxydothermus hydrogenoformans Z-2901] >gi|119391086|sp|Q3AFT7|PYRG_CARHZ CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|77996482|gb|ABB15381.1| CTP synthase [Carboxydothermus hydrogenoformans Z-2901] (535 aa)
Score = 1279, Expect = 1.3e-138, Identities = 252/529 (47%), Positives = 349/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G+VY+  I+KER G +LG T+QV+PHIT  I ++I+ ++ +  PD +I E+GGTVGDIES+PFLEA RQL+    +  V++IH   +  L    +LKTKP QHSVK+L S GI P++++ RS+  +S ++ EKI+L   I+   +   ++  +IY +P  L+ + + + +     +          W+      K P K++  I +VGKY   PDAYLS+  +L  +  Y +T ++I +I+S  L +  + + LS  D ILVPGGFG R +EGKI AIQYAREN +P+ G+CLGMQ A IEFARNV  + DA+S+EF  +  + +I +L  +     LGGT+RLG Y C+L  G+K    Y  + I ERHRHRYEFN +Y ++    G V SG + +  LVEIIEL +H +F+A QFHPEF S+   P+P+F  F+  S K
  S:     2 TKFIFVTGGVVSSLGKGITAASLGRLLKSRGLKVAIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLTKNSNVTTGKVYWAVISKERRGDYLGGTVQVIPHITNEIKERILRVAKESNPDVVITEIGGTVGDIESLPFLEAIRQLKNDVGKDNVLYIHVTLVPTLRVTGELKTKPTQHSVKELRSIGIQPDIIVARSEQPLSREITEKIALFCDIDKNAVIQAVDASNIYEVPLKLKEEGLDDIVIKKLGLTC-GEPDLSEWEQIVERYKNP-KFEVTIGIVGKYVSLPDAYLSVAEALRHAGIYHETRVNIRWIDSEMLEKEPVEKYLSNLDGILVPGGFGDRGVEGKIKAIQYARENKVPYLGLCLGMQTAVIEFARNVAGLKDANSSEFKPDGPHSVIDLLPEQKEVEQLGGTMRLGLYPCKLVPGTKAHAAYGEEIIYERHRHRYEFNNEYRELLTGLGLVISGTSPDGRLVEIIELSDHPWFVATQFHPEFKSRPNRPHPLFREFIGASLK 530
>gi|194246452|ref|YP_002004091.1| CTP synthase (UTP-ammonia ligase) [Candidatus Phytoplasma mali] >gi|193806809|emb|CAP18236.1| CTP synthase (UTP-ammonia ligase) [Candidatus Phytoplasma mali] (541 aa)
Score = 1278, Expect = 1.5e-138, Identities = 267/526 (50%), Positives = 365/526 (69%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKH-GFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           + TK + +TGGV SSLGKG+  +S+G +LK  G ++ I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERFL+ NL KES++T G++Y E I KER G++LG T+QV+PHIT+ I +++   +   + D LIVEVGGTVGDIES+PFLEA RQ++       V++IH   +  L +  ++KTKP QHS+K+L S GI   +L++RS   +S  +K+KIS    ++ E I+  +++  +Y +  +L NQ + N I   FK+E     +    W    S I+  KK    I +VGKY    DAYLSI+ +L+ + ++   +++I++INS ++N+ NI   L + D ILVPGGFG R   GK++AI+YARENNIPFFGICLGMQLA IE+ARNVL + +ADSTE NE T+ P+I   + K    NLGGTLRLG Y C LK  SKI  IY+ + I ERHRHRYE N KY+ +FEK+  F+ SG   + NL EIIEL+NH +FI VQFHPEF S+ L P+P+F +F+
  S:     7 NNTKFIFITGGVISSLGKGITAASIGQILKNRGLKIFIQKFDPYINIDPGTMSPYQHGEVFVTNDGSETDLDLGHYERFLDENLSKESSITTGKIYKEVINKERKGEYLGNTVQVIPHITDEIKKRLFRAAEFSKADILIVEVGGTVGDIESLPFLEAIRQMRYDCGYHNVLYIHNTLIPYLPSIKEIKTKPTQHSIKELRSLGIQAQILVLRSHSTISENIKKKISSLCDVKKEAIFENLDVNILYQMIINLSNQGIDNFILKHFKIEKKIFSLDLSCWQKLISRIQNLKK-NINIGLVGKYVQLQDAYLSIVEALKHAGYFYDVNINIQWINSENINDKNIKIILEKCDGILVPGGFGSRATNGKLIAIKYARENNIPFFGICLGMQLAVIEYARNVLNLKNADSTEINEKTSEPVI---KPKIDSLNLGGTLRLGLYQCNLKLNSKIFNIYQNEIIYERHRHRYEMNSKYIRLFEKNENFIISGFYNKENLPEIIELKNHIWFIGVQFHPEFLSRPLRPHPLFKNFI 532
>gi|167629018|ref|YP_001679517.1| CTP synthetase [Heliobacterium modesticaldum Ice1] >gi|167591758|gb|ABZ83506.1| ctp synthase [Heliobacterium modesticaldum Ice1] (537 aa)
Score = 1277, Expect = 2.0e-138, Identities = 246/528 (46%), Positives = 351/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++I+L K SNVT G++Y+  I KER G+FLG T+QV+PHIT  I ++++ ++ +  PD +I E+GGTVGDIES+PFLEA RQ+++   + +V++IH   +  + +  +LKTKP QHSVK+L S GI P++++ R++ A   +L+EKI+L   IE E +   ++   IY +P  L+ + + + I     ++       + W+     IK P++ +  I +VGKY   PDAY+S+  SL  +  +    + I++I S+ L   +  E LS+ D ILVPGGFG R IEGKI A++YARE  IP  GICLGMQLA +EF+RNVL   DA S+EF E T +P+I +L  +      GGT+RLG + C L   +K    Y+ + I ERHRHRYEFN  +    EK G + SG + +  LVEI+EL +H +F+A QFHPEF S+   P+P+F  F++ +
  S:     2 QTKFIFVTGGVVSSLGKGITAASLGRLLKSRGLKVAIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFVDISLTKASNVTTGKIYWSVITKERKGEFLGGTVQVIPHITNEIKERVLRVARESNPDVVITEIGGTVGDIESLPFLEAIRQMKSDIGKERVVYIHVTLMPFISSAGELKTKPTQHSVKELRSIGIQPDVIVCRTEKAFPKELEEKIALFCDIEPEAVIQNVDCDTIYEVPLLLKKEGLDDIIIEKLNLQC-GEPDLQDWEALVQKIKNPRR-QVTIGLVGKYVALPDAYMSVAESLRHAGLFHDAAVKIKWIYSADLEGADPDEFLSDVDGILVPGGFGDRGIEGKITALRYAREKGIPLLGICLGMQLAVVEFSRNVLGWQDAHSSEFAEATEHPVIDLLPEQKDVEEKGGTMRLGIWACRLNRNTKAWNAYQEEVIYERHRHRYEFNNNFRAALEKAGLIISGTSPDGRLVEIVELADHPWFVASQFHPEFKSRPNRPHPLFRDFVSAA 529
>gi|83591225|ref|YP_431234.1| CTP synthetase [Moorella thermoacetica ATCC 39073] >gi|119391132|sp|Q2RFU8|PYRG_MOOTA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|83574139|gb|ABC20691.1| CTP synthase [Moorella thermoacetica ATCC 39073] (537 aa)
Score = 1273, Expect = 5.0e-138, Identities = 243/526 (46%), Positives = 347/526 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++I+L K SNVTAG+VY+  I KER G FLG T+QV+PHIT  I  +++ ++ +  PD +I E+GGTVGDIES+PFLEA RQ+++   R +V++IH   +  L    + KTKP QHSVK+L S GI P++++ R++   S +++EKI+L   I+ + +    +   IY +P  ++ + + + +    K+   P ++    W    + +K   ++   IA+VGKY   PDAYLS++ SL  +  Y    + I +I S+ L    + +L +   ILVPGGFG R +EGKI+A +YARE+ IPF GICLGMQLA +EFAR+V  +  A+S+EFN  T +P+I +L  +    + GGT+RLG Y C L+ G++  + Y  + I ERHRHRYEFN  Y       G V SG + ++ LVEIIEL +H +F+A QFHPEF S+   P+P+F  F+  +
  S:     4 KFIFVTGGVTSSLGKGITAASLGRLLKSRGLKVAIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDISLTKASNVTAGKVYWSVITKERRGDFLGGTVQVIPHITNEIKARLLRVAEESDPDVVITEIGGTVGDIESLPFLEAIRQMKSDIGRDRVLYIHVTLVPYLRAAGEAKTKPTQHSVKELRSIGIQPDIIVCRTERPFSREMEEKIALFCDIDPDAVIQAWDADSIYEVPLMMQEEGLDSIVVERLKLNCGPAQM--DDWRAMVAKLKNITRH-LEIALVGKYVTLPDAYLSVVESLRHAGMYHNVQVDIRWIYSADLERGGLEQLQDVAGILVPGGFGDRGVEGKIIAARYAREHGIPFLGICLGMQLAVVEFARHVCGLEAANSSEFNPETPHPVIDLLPEQKEIEDKGGTMRLGLYPCRLQPGTRAHQAYGEEIIYERHRHRYEFNNNYRAELTARGMVISGTSPDDRLVEIIELADHPWFVACQFHPEFKSRPNRPHPLFRDFIGAA 528
>gi|116511302|ref|YP_808518.1| CTP synthetase [Lactococcus lactis subsp. cremoris SK11] >gi|116106956|gb|ABJ72096.1| CTP synthase [Lactococcus lactis subsp. cremoris SK11] (535 aa)
Score = 1273, Expect = 5.3e-138, Identities = 243/527 (46%), Positives = 362/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGG  SS+GKG+  +SLG +LK  G +V + KFDPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT+G+VY E + KER G++LGAT+Q+VPH+T  + +KI   +     D +I EVGGTVGD+ES+PF+EA RQ++A+  +  VM+IHTVP++ L    +LKTK  Q++ K L   GI  N+L++RS+  ++ ++++KI++   +  E +   ++++H+Y +P +L+ Q +   + +  K++ P +     W      +   KK K +IA+VGKY + PDAY+S+  +L+ + +    ++ I ++N++ + + N++EL  +   I+VPGGFG+R  EGKI AI+YAREN++P  GICLGMQL ++EFARNVL +  A S E +  T  P+I I+  +    ++GGTLRLG Y  +LK+GS+    Y    +V+ RHRHRYEFN KY + FEK GFVFSG++ +N LVEI+EL + KFF+A Q+HPE  S+   P  ++  F+ V+
  S:     3 TKYIFVTGGGTSSMGKGIVAASLGRLLKNRGLKVTVQKFDPYLNIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTSGKVYSEILRKERKGEYLGATVQMVPHVTNMLKEKIKRAATTTDADIIITEVGGTVGDMESLPFIEALRQMKAEVGADNVMYIHTVPILHLRAAGELKTKIAQNATKTLREYGIQANMLVLRSEVPITTEMRDKIAMFCDVAPEAVIQSLDVEHLYQIPLNLQAQNMDQIVCDHLKLDAP-KADMAEWSAMVDHVMNLKK-KVKIALVGKYVELPDAYISVTEALKHAGYASDAEVDINWVNANDVTDENVAELVGDAAGIIVPGGFGQRGTEGKIAAIKYARENDVPMLGICLGMQLTAVEFARNVLGLEGAHSFELDPETKYPVIDIMRDQVDVEDMGGTLRLGLYPAKLKNGSRAKAAYNDAEVVQRRHRHRYEFNNKYREDFEKAGFVFSGVSPDNRLVEIVELSDKKFFVACQYHPELQSRPNRPEELYTEFIRVA 530
>gi|168482739|ref|ZP_02707691.1| CTP synthase [Streptococcus pneumoniae CDC1873-00] >gi|172043577|gb|EDT51623.1| CTP synthase [Streptococcus pneumoniae CDC1873-00] (535 aa)
Score = 1273, Expect = 6.1e-138, Identities = 246/527 (46%), Positives = 359/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++H+Y +P +L+ Q +   + +  K++ P       W      +   KK + +I++VGKY +  DAY+S++ +L+ S +   T++ I ++N++ +   N++E LS+ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E    T  PII I+  +    ++GGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERRGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAP-AAAMTEWSAMVDKVMNLKK-QVKISLVGKYVELQDAYISVVEALKHSGYVNDTEVKINWVNANDVTAENVAELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGLEGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYTAFVTAA 530
>gi|125623334|ref|YP_001031817.1| CTP synthetase [Lactococcus lactis subsp. cremoris MG1363] >gi|24212098|sp|O87761|PYRG_LACLM CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|7688222|emb|CAA09021.2| CTP synthetase [Lactococcus lactis subsp. cremoris] >gi|124492142|emb|CAL97071.1| CTP synthase [Lactococcus lactis subsp. cremoris MG1363] (535 aa)
Score = 1272, Expect = 7.8e-138, Identities = 243/527 (46%), Positives = 361/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGG  SS+GKG+  +SLG +LK  G +V + KFDPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT+G+VY E + KER G++LGAT+Q+VPH+T  + +KI   +     D +I EVGGTVGD+ES+PF+EA RQ++A+  +  VM+IHTVP++ L    +LKTK  Q++ K L   GI  N+L++RS+  ++ ++++KI++   +  E +   ++++H+Y +P +L+ Q +   + +  K++ P +     W      +   KK K +IA+VGKY + PDAY+S+  +L+ + +    ++ I ++N++ + + N++EL  +   I+VPGGFG+R  EGKI AI+YAREN++P  GICLGMQL ++EFARNVL +  A S E +  T  P+I I+  +    ++GGTLRLG Y  +LK+GS+    Y    +V+ RHRHRYEFN KY + FEK GFVFSG++ +N LVEI+EL   KFF+A Q+HPE  S+   P  ++  F+ V+
  S:     3 TKYIFVTGGGTSSMGKGIVAASLGRLLKNRGLKVTVQKFDPYLNIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTSGKVYSEILRKERKGEYLGATVQMVPHVTNMLKEKIKRAATTTDADIIITEVGGTVGDMESLPFIEALRQMKAEVGADNVMYIHTVPILHLRAAGELKTKIAQNATKTLREYGIQANMLVLRSEVPITTEMRDKIAMFCDVAPEAVIQSLDVEHLYQIPLNLQAQNMDQIVCDHLKLDAP-KADMAEWSAMVDHVMNLKK-KVKIALVGKYVELPDAYISVTEALKHAGYASDAEVDINWVNANDVTDENVAELVGDAAGIIVPGGFGQRGTEGKIAAIKYARENDVPMLGICLGMQLTAVEFARNVLGLEGAHSFELDPETKYPVIDIMRDQVDVEDMGGTLRLGLYPAKLKNGSRAKAAYNDAEVVQRRHRHRYEFNNKYREDFEKAGFVFSGVSPDNRLVEIVELSGKKFFVACQYHPELQSRPNRPEELYTEFIRVA 530
>gi|81429241|ref|YP_396242.1| CTP synthetase [Lactobacillus sakei subsp. sakei 23K] >gi|119391120|sp|Q38V48|PYRG_LACSS CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|78610884|emb|CAI55936.1| Cytidine triphosphate synthase [Lactobacillus sakei subsp. sakei 23K] (530 aa)
Score = 1272, Expect = 8.3e-138, Identities = 251/527 (47%), Positives = 356/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL K SNVT G++Y E + KER G++LGAT+QV+PHIT  I +KI+  +     D +I E+GGTVGDIES+PFLEA RQ++A   ++  ++IHT  +  L    ++KTKP QHSVK+L   GI PN+L+ R++ A+ + ++ KI+    +E E +    + + IY +P  L+NQ + + + N FKM  P       W      IK  +  K +IA+VGKY +  DAY+S+  +L  + +   TD+ +  I S  + + N++E L+ FD I+VPGGFG R +EG IL+IQYAREN++P+ GICLGMQ+ASIEFARNV  + DA + E + +  + +I I+  +    N+GGT RLG Y C+LK G+K  E Y  +S++ +RHRHRYEFN +Y D+    G VF+G + +N LVE+IE+  +KFF+A Q+HPEF S+   P  +F +F+  +
  S:     2 TKYVFVTGGVVSSLGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDNNLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITNMIKEKIMRAATTTDSDIVITEIGGTVGDIESLPFLEALRQMKADVGAENCIYIHTTLVPYLKAAGEMKTKPTQHSVKELRGIGIQPNVLVCRTEKAIPDDMRNKIAQFCDVEPEAVVESRDAESIYDIPLLLKNQGLDDFVLNHFKMTAP-EADMTEWIDMLHTIKNLEGTK-KIALVGKYIELQDAYISVNEALRHAGYVYNTDVKVTPIQSEDITKENVAETLAGFDGIIVPGGFGDRGLEGMILSIQYARENDVPYLGICLGMQMASIEFARNVAGITDATTGEVHPDAEHKLIDIMSDQKDLENMGGTQRLGLYPCKLKPGTKTAEAYDNQSVIQQRHRHRYEFNNEYRDLLTDKGLVFAGTSPDNRLVEVIEIPENKFFVAAQYHPEFLSRPNKPEGLFKAFIGAT 529
>gi|116493299|ref|YP_805034.1| CTP synthetase [Pediococcus pentosaceus ATCC 25745] >gi|116103449|gb|ABJ68592.1| CTP synthase [Pediococcus pentosaceus ATCC 25745] (532 aa)
Score = 1271, Expect = 9.6e-138, Identities = 250/529 (47%), Positives = 356/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G +LGAT+QV+PHIT+AI +KI+        D +I E+GGTVGDIES+PFLEA RQ++++  S+ V +IHT  +  L    ++KTKP QHSVK+L   GI PN+L+VR+++ +++ ++ KI+    +E E +    ++  +Y +P +L+ QK+ + + + F ++ P +     W+     +     +   IA+VGKY    DAY+S+  +L+ + + +  D+ I  I+S  L + N++E L+  D I+VPGGFG R IEG I +IQYAREN++PF GICLGMQ+AS+EFARNVL   DA+S E +  T + II ++  +    ++GGT RLG Y C+LK+GS     Y  + ++ ERHRHR+EFN  Y    E  G VFSG + +N LVE+IEL   KFF+A Q+HPEF S+   P  +F +F+  + K
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERHGDYLGATVQVIPHITDAIKEKIMRAGKVTDSDIVITEIGGTVGDIESLPFLEAIRQMKSQAGSENVFYIHTTLVPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVVRTEEDITDGMRSKIAAFCDVEPEAVIESQDVASLYEIPLNLKAQKMDDIVMDHFGLQAP-QADMSKWEDLVDHVNNRLNHTINIALVGKYVALQDAYISVNEALKHAGYVVDADIKITKIDSEKLTKENVAEQLAGQDGIIVPGGFGDRGIEGMIHSIQYARENDVPFLGICLGMQMASVEFARNVLGYQDANSAEMDPATKHNIIDLMADQEGVKDMGGTQRLGLYPCKLKEGSVAAAAYNNQEMIEERHRHRFEFNNDYRAEMEAKGLVFSGTSPDNRLVEVIELPEKKFFVAAQYHPEFLSRPQRPEGLFKAFIAAANK 532
>gi|116491746|ref|YP_811290.1| CTP synthetase [Oenococcus oeni PSU-1] >gi|116092471|gb|ABJ57625.1| CTP synthase [Oenococcus oeni PSU-1] (544 aa)
Score = 1271, Expect = 1.0e-137, Identities = 248/528 (46%), Positives = 359/528 (67%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGS-DLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKS-IVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  +SLG +LK  G  V + KFDPYLN D GTM+P QHGE FVT DG ETDLD+G+YERF++IN  K SNVT+G++Y E I +ER G ++G T+QV+PH+T+AI  KI   + + + D +I E+GGT+GDIES+ F+EA RQ++ +  S   F   V L+  L  + +LKTKP QHSV +L   GI P++++VRS+ A+++ +KEK+S  T +  E I   I+   +Y +P +L  Q +   +     +    +     W      I+   K + +IA+VGKY+D PDAY+S+  +L+ + + + + ++++ INS  L +NN++E L+  D ++VPGGFG R IEG I AI+YARENNIPFFG+CLGMQ+AS+EFAR+ + M +A+STE N +T  P++ +++ + + T +GGT+RLG+Y   LK G+K  E Y   S I ERHRHRYEFN  Y + FEK G VF+G + +N+LVEIIE   + FFIAVQ+HPEF S+   P  ++ +F+  +
  S:     6 QTKYIFVTGGVVSSLGKGIVAASLGRLLKSRGLAVTVQKFDPYLNPDPGTMSPYQHGETFVTQDGVETDLDLGHYERFMDINTNKYSNVTSGKIYQEVIDRERTGDYMGRTVQVIPHVTDAIKDKIFRGAKESEADVIITEIGGTIGDIESMAFIEAIRQMKKEVGSDNTFYIHVSLVPFLRAAGELKTKPTQHSVHELRGMGIQPDMIVVRSEKAITDSMKEKLSEFTDVPTEAIIQSIDSDVLYSVPLNLAAQNMDQVVLEKLGLGSQPKANLSQWGALVDRIRHLSK-EIKIALVGKYTDLPDAYISVHEALKHAGYAVDSKITLKSINSEMLTDNNVAEKLAGIDGVIVPGGFGPRGIEGMISAIKYARENNIPFFGVCLGMQMASVEFARDAVGMSNANSTEMNPDTPYPVVGLMDSQKKITKIGGTMRLGSYPAILKAGTKTAEAYNNVSEISERHRHRYEFNNDYREQFEKAGMVFAGTSPDNSLVEIIEYPQNDFFIAVQYHPEFLSRPDRPEGLYAAFIQAA 535
>gi|195953933|ref|YP_002122223.1| CTP synthase [Hydrogenobaculum sp. Y04AAS1] >gi|195933545|gb|ACG58245.1| CTP synthase [Hydrogenobaculum sp. Y04AAS1] (534 aa)
Score = 1271, Expect = 1.0e-137, Identities = 262/524 (50%), Positives = 355/524 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           +K + VTGGV SSLGKGVA +S+GA+L+  G  + + K DPYLNVD GTM P QHGEVFVT DG ETDLD+G+YERF N NL K +N+TAG++Y   + KER G +LG+T+QV+PH+T+ I  K ++L      D  IVE+GGTVGDIES+PFLEA RQLQ +  +   +FIH   +  +    +LKTKP QHSVK+L + GI P++++ RS+  +   +K KI++   ++ EN+ S  ++ +IY +P  L+ Q +   I + F++E   PN      W+   S + E  K    IA+VGKY    DAY S+I +L       K  +++ +++S +LNE    +L   D IL+PGGFG+R IEGKI A+ Y R  NIP FGICLGMQL ++EFARNVL   DA+STEF+ NT+NP+I I+E +    NLGGT+RLG Y C +K+ +K  EIYK   I ERHRHRYEFN KY + FEKHGF+ SGI  + +LVEIIEL+NH+++I  QFHPEF SK    + +F SF+
  S:     6 SKFIFVTGGVLSSLGKGVASASIGALLEGLGLSITLQKLDPYLNVDPGTMNPYQHGEVFVTEDGAETDLDLGHYERFTNTNLSKLNNITAGKIYNSVLEKERKGAYLGSTVQVIPHVTDEI--KSMILKASKDKDIAIVEIGGTVGDIESLPFLEAIRQLQLEIGKENTLFIHLTYVPYISVAGELKTKPTQHSVKELRAIGIQPDIIICRSEVELPQDVKSKIAMFCNVKPENVISAYDVDYIYKIPLILKAQNLDKIIIDAFRLENKEPN---LTKWENIVSSL-EHLKDSVDIAIVGKYIKLKDAYKSLIEALIHGGIEHKLKVNMIWVDSENLNEK---DLEHVDGILIPGGFGERGIEGKIRALNYGRTKNIPTFGICLGMQLMAVEFARNVLGFKDANSTEFDPNTSNPVIDIMEEQKGIENLGGTMRLGAYECLIKENTKAYEIYKENLIYERHRHRYEFNNKYKEHFEKHGFIASGIYPKKSLVEIIELQNHRWYIGCQFHPEFKSKPFKAHKLFASFI 523
>gi|118587414|ref|ZP_01544839.1| CTP synthase [Oenococcus oeni ATCC BAA-1163] >gi|118432064|gb|EAV38805.1| CTP synthase [Oenococcus oeni ATCC BAA-1163] (544 aa)
Score = 1270, Expect = 1.2e-137, Identities = 248/528 (46%), Positives = 359/528 (67%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGS-DLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKS-IVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  +SLG +LK  G  V + KFDPYLN D GTM+P QHGE FVT DG ETDLD+G+YERF++IN  K SNVT+G++Y E I +ER G ++G T+QV+PH+T+AI  KI   + + + D +I E+GGT+GDIES+ F+EA RQ++ +  S   F   V L+  L  + +LKTKP QHSV +L   GI P++++VRS+ A+++ +KEK+S  T +  E I   I+   +Y +P +L  Q +   +     +    +     W      I+   K + +IA+VGKY+D PDAY+S+  +L+ + + + + ++++ INS  L +NN++E L+  D ++VPGGFG R IEG I AI+YARENNIPFFG+CLGMQ+AS+EFAR+ + M +A+STE N +T  P++ +++ + + T +GGT+RLG+Y   LK G+K  E Y   S I ERHRHRYEFN  Y + FEK G VF+G + +N+LVEIIE   + FFIAVQ+HPEF S+   P  ++ +F+  +
  S:     6 QTKYIFVTGGVVSSLGKGIVAASLGRLLKSRGLAVTVQKFDPYLNPDPGTMSPYQHGETFVTRDGVETDLDLGHYERFMDINTNKYSNVTSGKIYQEVIDRERTGDYMGRTVQVIPHVTDAIKDKIFRGAKESEADVIITEIGGTIGDIESMAFIEAIRQMKKEVGSDNTFYIHVSLVPFLRAAGELKTKPTQHSVHELRGMGIQPDMIVVRSEKAITDSMKEKLSEFTDVPTEAIIQSIDSDVLYSVPLNLAAQNMDQVVLEKLGLGSQPKANLSQWGALVDRIRHLSK-EIKIALVGKYTDLPDAYISVHEALKHAGYAVDSKITLKSINSEMLTDNNVAEKLAGIDGVIVPGGFGPRGIEGMISAIKYARENNIPFFGVCLGMQMASVEFARDAVGMSNANSTEMNPDTPYPVVGLMDSQKKITKIGGTMRLGSYPAILKAGTKTAEAYNNVSEISERHRHRYEFNNDYREQFEKAGMVFAGTSPDNSLVEIIEYPQNDFFIAVQYHPEFLSRPDRPEGLYAAFIQAA 535
>gi|167464949|ref|ZP_02330038.1| CTP synthetase [Paenibacillus larvae subsp. larvae BRL-230010] (534 aa)
Score = 1269, Expect = 1.5e-137, Identities = 248/527 (47%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G+VY   I KER G++LG T+QV+PHIT  I  ++     + Q D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    ++KTKP QHSVK+L S GI PN+++ R++ A++  LK KI+    ++   +    +   +Y +P  L  Q + + + N  K++  +      W+     +K   ++   IA+VGKY    DAYLS++ SL  +     T++ I ++N+  L ++N+ E L   D ILVPGGFG R IEGK+ AI+YAR+  IPFFGICLGMQ+A IE+ARNV  +  A+S+E N  T  P+I +L  +    NLGGT+RLG Y C+L +GS     Y+ + + ERHRHRYEFN +Y +  E  G   SG + +  LVEI+E+ +H +F+AVQFHPEFTS+   P P+F  F+  +
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSKNSNVTTGKVYSSVITKERRGEYLGGTVQVIPHITNEIKDRVFRAGKEAQSDIVITEIGGTVGDIESLPFLEAIRQIKSDIGRENVMYIHVTLIPYIKAAGEVKTKPTQHSVKELRSIGIQPNVIVCRTEHALAEDLKHKIAQFCDVDANAVIECRDADTLYEVPMMLREQGLDDIVVNHLKLDKTDAPDMTEWEAMVKRVKS-LEHTTEIAIVGKYVALHDAYLSVVESLGHAGIVNNTEVKIRWVNAEHLYDHNVEEMLDGVDGILVPGGFGDRGIEGKVTAIRYARDKKIPFFGICLGMQVAVIEYARNVAGLDGANSSEINPTTPFPVIDLLPEQKDIENLGGTMRLGLYPCKLAEGSLARNCYQDELVYERHRHRYEFNNEYRERIESTGLKISGTSPDGRLVEIVEMPDHPWFLAVQFHPEFTSRPNRPQPLFREFVKAA 529
>gi|148983874|ref|ZP_01817193.1| CTP synthetase [Streptococcus pneumoniae SP3-BS71] >gi|149012628|ref|ZP_01833625.1| CTP synthetase [Streptococcus pneumoniae SP19-BS75] >gi|168490609|ref|ZP_02714752.1| CTP synthase [Streptococcus pneumoniae CDC0288-04] >gi|168492659|ref|ZP_02716802.1| CTP synthase [Streptococcus pneumoniae CDC3059-06] >gi|194396787|ref|YP_002037163.1| CTP synthase (UTP-ammonia lyase) [Streptococcus pneumoniae G54] >gi|147763433|gb|EDK70370.1| CTP synthetase [Streptococcus pneumoniae SP19-BS75] >gi|147924021|gb|EDK75133.1| CTP synthetase [Streptococcus pneumoniae SP3-BS71] >gi|183575001|gb|EDT95529.1| CTP synthase [Streptococcus pneumoniae CDC0288-04] >gi|183576872|gb|EDT97400.1| CTP synthase [Streptococcus pneumoniae CDC3059-06] >gi|194356454|gb|ACF54902.1| CTP synthase (UTP-ammonia lyase) [Streptococcus pneumoniae G54] (535 aa)
Score = 1268, Expect = 2.0e-137, Identities = 245/527 (46%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++H+Y +P +L+ Q +   + +  K++ P       W      +   KK + +I++VGKY +  DAY+S++ +L+ S +    ++ I ++N++ +   N++E LS+ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E    T  PII I+  +    ++GGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERRGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAP-AAAMTEWSAMVDKVMNLKK-QVKISLVGKYVELQDAYISVVEALKHSGYVNDAEVKINWVNANDVTAENVAELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGLEGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYTAFVTAA 530
>gi|81177357|ref|ZP_00876190.1| CTP synthase [Streptococcus suis 89/1591] >gi|80975966|gb|EAP39642.1| CTP synthase [Streptococcus suis 89/1591] (534 aa)
Score = 1267, Expect = 2.5e-137, Identities = 246/527 (46%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+  KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   ++++H+Y +P +++ Q +   + +  K++VP       W    + +   +K K +IA+VGKY +  DAY+S++ +L+ S +     + ++++N++ L   N++E L +   I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  +EFAR+VL +  A+S E +  T  PII I+  +    +LGGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FEK GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE  S+   P  ++ +F++ +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKDKIKRAARTTDADVIITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNMQAQNMDQIVCDHLKLDVPP-ADMTEWTAMVNKVLNLQK-KVKIALVGKYVELQDAYISVVEALKHSGYANDAAIELDWVNANDLTAENVAERLGQAQGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCVEFARHVLGLEGANSFELDPETKYPIIDIMRDQIGVEDLGGTLRLGLYPSKLKRGSKAAAAYDNQEVVQRRHRHRYEFNNDFREQFEKAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELQSRPNRPEGLYTAFVSAA 529
>gi|169833776|ref|YP_001693996.1| CTP synthase [Streptococcus pneumoniae Hungary19A-6] >gi|168996278|gb|ACA36890.1| CTP synthase [Streptococcus pneumoniae Hungary19A-6] (535 aa)
Score = 1267, Expect = 3.1e-137, Identities = 245/527 (46%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++H+Y +P +L+ Q +   + +  K++ P       W      +   KK + +I++VGKY +  DAY+S++ +L+ S +    ++ I ++N++ +   N++E LS+ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E    T  PII I+  +    ++GGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERRGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAP-AADMTEWSAMVDKVMNLKK-QVKISLVGKYVELQDAYISVVEALKHSGYVNDAEVKINWVNANDVTAENVAELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGLEGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYTAFVTAA 530
>gi|146317991|ref|YP_001197703.1| CTP synthetase [Streptococcus suis 05ZYH33] >gi|146320176|ref|YP_001199887.1| CTP synthetase [Streptococcus suis 98HAH33] >gi|145688797|gb|ABP89303.1| CTP synthase (UTP-ammonia lyase) [Streptococcus suis 05ZYH33] >gi|145690982|gb|ABP91487.1| CTP synthase (UTP-ammonia lyase) [Streptococcus suis 98HAH33] (572 aa)
Score = 1267, Expect = 3.1e-137, Identities = 246/527 (46%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+  KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   S  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R++      +K K++    +  E +   ++++H+Y +P +++ Q +   + +  K++VP       W    + +   +K K +IA+VGKY +  DAY+S++ +L+ S +     + ++++N++ L   N++E L +   I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  +EFAR+VL +  A+S E +  T  PII I+  +    +LGGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FEK GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE  S+   P  ++ +F++ +
  S:    40 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERKGEYLGATVQVIPHITDALKDKIKRAARTTDADVIITEVGGTVGDIESLPFLEALRQMKADVGSDNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEQPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNMQAQNMDQIVCDHLKLDVPP-ADMTEWTAMVNKVLNLQK-KVKIALVGKYVELQDAYISVVEALKHSGYANDAAIELDWVNANDLTAENVAERLGQAQGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCVEFARHVLGLEGANSFELDPETKYPIIDIMRDQIGVEDLGGTLRLGLYPSKLKRGSKAAAAYDNQEVVQRRHRHRYEFNNDFREQFEKAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELQSRPNRPEGLYTAFVSAA 567
>gi|15672473|ref|NP_266647.1| CTP synthetase [Lactococcus lactis subsp. lactis Il1403] >gi|24212154|sp|Q9CI75|PYRG_LACLA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|12723372|gb|AAK04589.1|AE006284_7 CTP synthetase [Lactococcus lactis subsp. lactis Il1403] (535 aa)
Score = 1267, Expect = 3.2e-137, Identities = 242/527 (45%), Positives = 361/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGG  SS+GKG+  +SLG +LK  G +V + KFDPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT+G+VY E + KER G++LGAT+Q+VPH+T  + +KI   +     D +I EVGGTVGD+ES+PF+EA RQ++A+  +  VM+IHTVP++ L    +LKTK  Q++ K L   GI  N+L++RS+  ++ ++++KI++   +  E +   ++++H+Y +P +L+ Q +   + +  K++ P +     W      +   KK K +IA+VGKY + PDAY+S+  +L+ + +    ++ I ++N++ + + N++EL  +   I+VPGGFG R  EGKI AI+YAREN++P  GICLGMQL ++EFARNVL +  A S E +  T  P+I I+  +    ++GGTLRLG Y  +LK+GS+    Y    +V+ RHRHRYEFN K+ + FEK GFVFSG++ +N LVEI+EL + KFF+A Q+HPE  S+   P  ++  F+ V+
  S:     3 TKYIFVTGGGTSSMGKGIVAASLGRLLKNRGLKVTVQKFDPYLNIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTSGKVYSEILRKERKGEYLGATVQMVPHVTNMLKEKIKRAATTTDADIIITEVGGTVGDMESLPFIEALRQMKAEVGADNVMYIHTVPILHLRAAGELKTKIAQNATKTLREYGIQANMLVLRSEVPITTEMRDKIAMFCDVAPEAVIQSLDVEHLYQIPLNLQAQNMDQIVCDHLKLDAP-KADMTEWSAMVDHVMNLKK-KVKIALVGKYVELPDAYISVTEALKHAGYSSDAEVDINWVNANDVTDENVAELVGDAAGIIVPGGFGHRGTEGKIAAIKYARENDVPMLGICLGMQLTAVEFARNVLGLEGAHSFELDPETKYPVIDIMRDQVDVEDMGGTLRLGLYPAKLKNGSRAKAAYNDAEVVQRRHRHRYEFNNKFREDFEKAGFVFSGVSPDNRLVEIVELSDKKFFVACQYHPELQSRPNRPEELYTEFIRVA 530
>gi|15900408|ref|NP_345012.1| CTP synthetase [Streptococcus pneumoniae TIGR4] >gi|111656840|ref|ZP_01407686.1| hypothetical protein SpneT_02001900 [Streptococcus pneumoniae TIGR4] >gi|148988238|ref|ZP_01819701.1| CTP synthetase [Streptococcus pneumoniae SP6-BS73] >gi|148988747|ref|ZP_01820180.1| CTP synthetase [Streptococcus pneumoniae SP6-BS73] >gi|24212147|sp|Q97S93|PYRG_STRPN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|14971965|gb|AAK74652.1| CTP synthase [Streptococcus pneumoniae TIGR4] >gi|147925948|gb|EDK77023.1| CTP synthetase [Streptococcus pneumoniae SP6-BS73] >gi|147926702|gb|EDK77775.1| CTP synthetase [Streptococcus pneumoniae SP6-BS73] (535 aa)
Score = 1266, Expect = 3.5e-137, Identities = 245/527 (46%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++H+Y +P +L+ Q +   + +  K++ P       W      +   KK + +I++VGKY +  DAY+S++ +L+ S +    ++ I ++N++ +   N++E LS+ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E    T  PII I+  +    ++GGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERRGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAP-AADMTEWSAMVDKVMNLKK-QVKISLVGKYVELQDAYISVVEALKHSGYVNDAEVKINWVNANDVTAENVAELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGLEGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYTAFVTAA 530
>gi|168488183|ref|ZP_02712382.1| CTP synthase [Streptococcus pneumoniae SP195] >gi|183573157|gb|EDT93685.1| CTP synthase [Streptococcus pneumoniae SP195] (535 aa)
Score = 1266, Expect = 3.8e-137, Identities = 245/527 (46%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++H+Y +P +L+ Q +   + +  K++ P       W      +   KK + +I++VGKY +  DAY+S++ +L+ S +    ++ I ++N++ +   N++E LS+ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E    T  PII I+  +    ++GGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERRGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAP-AADMTEWSAMVDKVMNLKK-QVKISLVGKYVELQDAYISVVEALKHSGYVNDAEVKINWVNANDVTAENVAELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGLEGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYIAFVTAA 530
>gi|15902482|ref|NP_358032.1| CTP synthetase [Streptococcus pneumoniae R6] >gi|116515581|ref|YP_815950.1| CTP synthetase [Streptococcus pneumoniae D39] >gi|148996890|ref|ZP_01824608.1| CTP synthase [Streptococcus pneumoniae SP11-BS70] >gi|149005609|ref|ZP_01829348.1| CTP synthase [Streptococcus pneumoniae SP18-BS74] >gi|149025484|ref|ZP_01836420.1| CTP synthase [Streptococcus pneumoniae SP23-BS72] >gi|168485614|ref|ZP_02710122.1| CTP synthase [Streptococcus pneumoniae CDC1087-00] >gi|182683443|ref|YP_001835190.1| CTP synthetase [Streptococcus pneumoniae CGSP14] >gi|73621440|sp|Q8DQY0|PYRG_STRR6 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|15458004|gb|AAK99242.1| CTP synthetase [Streptococcus pneumoniae R6] >gi|116076157|gb|ABJ53877.1| CTP synthase [Streptococcus pneumoniae D39] >gi|147757465|gb|EDK64504.1| CTP synthase [Streptococcus pneumoniae SP11-BS70] >gi|147762549|gb|EDK69509.1| CTP synthase [Streptococcus pneumoniae SP18-BS74] >gi|147929434|gb|EDK80430.1| CTP synthase [Streptococcus pneumoniae SP23-BS72] >gi|182628777|gb|ACB89725.1| CTP synthetase [Streptococcus pneumoniae CGSP14] >gi|183571253|gb|EDT91781.1| CTP synthase [Streptococcus pneumoniae CDC1087-00] (535 aa)
Score = 1266, Expect = 4.0e-137, Identities = 245/527 (46%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G++LGAT+QV+PHIT+A+ +KI   +     D +I EVGGTVGDIES+PFLEA RQ++A   +  VM+IHT  L  L    ++KTKP QHSVK+L   GI PN+L++R+++     +K K++    +  E +   ++++H+Y +P +L+ Q +   + +  K++ P       W      +   KK + +I++VGKY +  DAY+S++ +L+ S +    ++ I ++N++ +   N++E LS+ D I+VPGGFG+R  EGKI AI+YAREN++P  G+CLGMQL  IEFAR+VL +  A+S E    T  PII I+  +    ++GGTLRLG Y  +LK GSK    Y  + +V+ RHRHRYEFN  + + FE  GFVFSG++ +N LVEI+E+  +KFF+A Q+HPE +S+   P  ++ +F+  +
  S:     3 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERRGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALRQMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPAGQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAP-AADMTEWSAMVDKVMNLKK-QVKISLVGKYVELQDAYISVVEALKHSGYVNDVEVKINWVNANDVTAENVAELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEFARHVLGLEGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAAYHNQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQYHPELSSRPNRPEELYTAFVTAA 530
>gi|172058739|ref|YP_001815199.1| CTP synthase [Exiguobacterium sibiricum 255-15] >gi|171991260|gb|ACB62182.1| CTP synthase [Exiguobacterium sibiricum 255-15] (531 aa)
Score = 1265, Expect = 5.2e-137, Identities = 244/527 (46%), Positives = 348/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SL  +LK  G  V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL + +NVT+GR+Y   + KER G + G T+QV+PHIT  I  ++     +   D +I E+GGTVGDIES+PF+EA RQ++    +  VM++H   +  L    +LKTKP QHSVK+L S GI P+++++R++  V  ++K+KI+L      E +    +   +Y +P +L+ Q +   + ++FK + P       W      +   +K K +IA+VGKY +  DAY+S+  +L+ + F   +D+ I++IN+  +  +N+ EL    + ILVPGGFG+R IEGKI A ++ARENN+PFFGICLGMQLA++EFARNVL +  A S E +  T  PII +L  +    +LGGTLRLG Y C+L+DGSK    Y  + + ERHRHRYEF  ++ + FE +G +FSG + +  LVEIIE+  HK+F+A QFHPE  S+   P  +F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLARLLKNRGLNVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSQNANVTSGRIYSTVLKKERRGDYNGGTVQVIPHITNEIKDRVFRAGKETGADVVITEIGGTVGDIESLPFIEAIRQVKNDIGKENVMYVHCTLVPYLAAAGELKTKPTQHSVKELRSYGIQPDIIVLRAEHDVPQEMKDKIALFCDTRPEAVIEAKDASTLYEVPLNLQRQGMDQLVCDYFKFDTP-AADMTAWKQLVHTVTHLEK-KTKIALVGKYVELRDAYISVAEALKHAGFAFNSDIEIDWINAEDVTRDNVQELLGSANGILVPGGFGERGIEGKIEATRFARENNVPFFGICLGMQLATVEFARNVLNLEGAHSAEIDPATPYPIIDLLPEQKDIEDLGGTLRLGLYPCKLEDGSKARAAYSSELVYERHRHRYEFGNEFREQFEANGMIFSGTSPDGRLVEIIEIPEHKWFVACQFHPELISRPERPQALFHDFIQAS 528
>gi|28377375|ref|NP_784267.1| CTP synthetase [Lactobacillus plantarum WCFS1] >gi|38258057|sp|Q88Z76|PYRG_LACPL CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|28270207|emb|CAD63106.1| CTP synthase [Lactobacillus plantarum WCFS1] (537 aa)
Score = 1264, Expect = 5.9e-137, Identities = 247/529 (46%), Positives = 356/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G +LGAT+QV+PHIT AI +KI+        D +I E+GGTVGDIES+PF+EA RQ+++   S  V +IHT  +  L    ++KTKP QHSVK+L S GI PN+L+VR++  ++ +++ KI+    +E E +   +++K IY +P +++ Q +   + + F ++ P +     W      ++   +   +IA+VGKY    DAY+S+  +L+ + +    D+ ++ I++  +   N+ E L + D ILVPGGFG R IEGKI AI+YAREN++PF GICLGMQ+AS+EFARNVL + DA+S E +  T + II ++  +    ++GGT RLG Y C+LK G+   + Y  + +V ERHRHRYEFN KY +     G VFSG + +N LVE+IEL   +FF+A Q+HPEF S+   P  +F +F++ + +
  S:     2 TKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLQKERRGDYLGATVQVIPHITNAIKEKIMRAGTTTDSDIVITEIGGTVGDIESLPFIEALRQMKSDLGSDNVFYIHTTLIPYLRAAGEMKTKPTQHSVKELRSYGIQPNMLVVRTEQPITREMRNKIASFCDVEPEAVIESLDVKTIYSIPLNVQKQNMDQIVLDHFDVQAP-KADMSEWIDLEHHVQNLSR-TIKIALVGKYVALQDAYISVTEALKHAGYTDDADIDLKKISAEDVTPENVEELLGDADGILVPGGFGDRGIEGKITAIKYARENDVPFLGICLGMQMASVEFARNVLGLKDANSAEIDPKTPDNIIDLMADQEDVEDMGGTQRLGAYPCKLKPGTVAAKAYHNEEVVMERHRHRYEFNNKYREAMAAKGMVFSGTSPDNRLVEVIELPKKRFFVASQYHPEFLSRPNRPEGLFKAFIDAANQ 531
>gi|90961322|ref|YP_535238.1| CTP synthetase [Lactobacillus salivarius UCC118] >gi|119391119|sp|Q1WV30|PYRG_LACS1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|90820516|gb|ABD99155.1| CTP synthase [Lactobacillus salivarius UCC118] (532 aa)
Score = 1259, Expect = 2.2e-136, Identities = 247/527 (46%), Positives = 350/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G++Y E + KER G +LGAT+QV+PHIT  I +KI+        D +I EVGGTVGDIES+PFLEA RQ++++  S+ V++IHT  +  L    ++KTKP QHSVK+L   GI PN+L+VR++  +S  ++ KI+    +E E +   +++  +Y +P +L+ Q +   +     ++ P       W      +K     + +IA+VGKY   PDAY+S+  +L+ + + +  ++ I++ +S  L   N++ EL  +D ++VPGGFG R +EG I AI+YAREN++P+ GICLGMQ+A IEFAR+V  + DA + E N   AN II ++  +    N+GGT RLG Y C+LK GS     Y  + ++ ERHRHRYEFN KY D     G VFSG + +N LVE++E+  +KFF+A Q+HPEF S+   P  +F +F+N S
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLKKERRGDYLGATVQVIPHITNMIKEKIMRAGTITDADVVITEVGGTVGDIESLPFLEALRQMKSEVGSENVVYIHTTLVPYLHAAGEMKTKPTQHSVKELRGLGIQPNILVVRTEKPISQSMRNKIANFCDVEPEAVIESMDVDTLYSIPLNLQAQNMDEIVCKKLHLDTP-AADMTEWAALRDKVKNLSG-EVKIALVGKYVQLPDAYISVNEALKHAGYTIDANVKIDYFDSEKLTAENVADELKGYDGVIVPGGFGDRGLEGMIQAIRYARENDVPYLGICLGMQMACIEFARDVAGIEDATTGEVNPKAANKIIDLMADQEDVENMGGTQRLGLYPCKLKAGSVASAAYGNQDVIQERHRHRYEFNNKYRDELAAKGLVFSGTSPDNRLVEVVEIPENKFFVAAQYHPEFLSRPQRPEGLFQAFINAS 529
>gi|188997013|ref|YP_001931264.1| CTP synthase [Sulfurihydrogenibium sp. YO3AOP1] >gi|188932080|gb|ACD66710.1| CTP synthase [Sulfurihydrogenibium sp. YO3AOP1] (533 aa)
Score = 1257, Expect = 3.6e-136, Identities = 257/528 (48%), Positives = 355/528 (67%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + +TGGV SSLGKGV  +++G++L+  G ++ +MK DPYLN+D GTM P QHGEVFVT DG ETDLD+G+YERF N  + K +N T+GR+Y+  + KER G FLGAT+QV+PH T  I + I  ++  +  D  +VE+GGTVGDIES PFLEA RQ+  + + + V++IH   +  +    +LKTKP QHSVK+L + GI P++L+ R++  +  ++K+K+SL T ++ ++++S  +L  IY +P   + + +  +I     +E   P+   +K   T  S ++E       I ++GKY D  DAY SI  +L  +    K  ++I +INS  +N+ N  E L   D ILVPGGFG R IEGKIL  +YARENNIP+FGICLGMQ+A IEFAR+V  +  A+STEFN  T +P+I I+  +      GGT+RLG Y C +K G+K  EIYK++ I ERHRHRYEFNPKY+ I E+ G V SGI K  NL EIIEL  HK+FIA QFHPEF SK  +P+P+F SF+  + K
  S:     3 KYIFITGGVLSSLGKGVTSAAIGSILESMGYKITLMKLDPYLNIDPGTMNPYQHGEVFVTEDGAETDLDLGHYERFTNAVMTKNNNTTSGRLYFNLLEKERRGAFLGATVQVIPHFTNEIKKSIEKVAENH--DITLVEIGGTVGDIESQPFLEAIRQMGIENKKEDVIYIHLTYVPYIKVAGELKTKPSQHSVKELRAIGIQPDILIGRAETPLPKEIKKKLSLFTNVDEDSVFSAPDLNIIYEIPLYFKKEGLDRAIAKHLNLEYKEPDLSKWKKIVTVLSKLEE----TVDIGIIGKYVDLKDAYKSIHEALIHAQIPNKVKVNIHWINSEKINQENYQEVLKGLDGILVPGGFGDRGIEGKILTAKYARENNIPYFGICLGMQIAVIEFARSVAGLEGANSTEFNPFTPHPVIDIMPDQKHVDKKGGTMRLGAYKCHIKKGTKAYEIYKQEEIYERHRHRYEFNPKYVPILEEKGLVVSGIYKAKNLPEIIELPTHKWFIACQFHPEFKSKPFAPHPLFVSFVEAAYK 528
>gi|192813560|ref|ZP_03042221.1| CTP synthase [Geobacillus sp. Y412MC10] >gi|192797671|gb|EDV74190.1| CTP synthase [Geobacillus sp. Y412MC10] (533 aa)
Score = 1257, Expect = 4.1e-136, Identities = 247/527 (46%), Positives = 349/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVT G+VY   I+KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    ++KTKP QHSVK+L S GI PN+++ R++  +S ++K KI+L   I+   +    +   +Y +P +L ++ +   + N  K+  P       W+     + + +K    IA+VGKY    DAYLS++ SL  + F    D+ I ++N+  +  +N+ E L+    ILVPGGFG R IEGKI AI+YARE+NIPFFGICLGMQ++ IE+AR+++ ++ A+S+E +  T  P+I +L  +    +LGGT+RLG Y C+L  GS     Y+ + + ERHRHRYEFN +Y +  EK G   SG + +  LVEI+EL  H +F+AVQFHPEFTS+   P P+F  F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSKNSNVTTGKVYSSVISKERRGEYLGGTVQVIPHITNEIKERVFRAGREAGSDVVITEIGGTVGDIESLPFLEAIRQIKSDVGRENVMYIHVTLIPYIKAAGEVKTKPTQHSVKELRSIGIQPNVIVCRTEHELSTEMKAKIALFCDIDPNAVVECRDASSLYEVPLNLRDEGLDEIVVNHLKLTTPAP-DMSEWEDLVERVSKLEK-TVEIAIVGKYVALHDAYLSVVESLSHAGFDANADVKIRWVNAEEITADNVEETLNGIGGILVPGGFGDRGIEGKISAIRYAREHNIPFFGICLGMQVSVIEYARSIVGLNGANSSEIDPATEYPVIDLLPEQKDIEDLGGTMRLGLYPCKLVPGSLAESCYQDELVYERHRHRYEFNNQYREDIEKAGLRISGTSPDGRLVEIVELPGHPWFLAVQFHPEFTSRPNRPQPLFREFVKAS 528
>gi|116617636|ref|YP_818007.1| CTP synthetase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] >gi|116096483|gb|ABJ61634.1| CTP synthase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] (537 aa)
Score = 1256, Expect = 4.8e-136, Identities = 252/532 (47%), Positives = 355/532 (66%)
  Q:     2 NDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVE-RHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           + + K + VTGGV SSLGKG+  +SLG +LK  G ++ I K DPY+N+D GTM+P QHGE FVT DG ETDLD+G+YERF++IN    SNVT GR+Y E +AKER G + G T+QV+PHIT AI +K+   +     D +IVEVGGTVGDIES+PF+EA RQ+++   S+ V +IHT  +I L    + KTKP QHSV  L S GI P+++++R++  +   LK+KIS  T +    +    +++ +Y +P +L+ Q + + + +  K++ P +     W     LIK PKK    + +VGKY+D PDAY+S+  +L+ + +    D+ I  + S ++   N++E L+  D ++VPGGFG+R  EGKI AI+YARENNIPF GICLGMQLASIEFAR+VL   DA+STE N NT+ PII +++ +    NLGGTLRLG Y   L  G+   + Y  +S +E RHRHRYEFN +Y + FEK G +FS  + +N L+E+IE   + FFIA Q+HPEF S+   P  +++ F+  S K
  S:     3 DKQVKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKLAIQKLDPYINIDPGTMSPYQHGETFVTGDGLETDLDMGHYERFMDINTNMYSNVTTGRIYSEVLAKERRGDYNGGTVQVIPHITNAIKEKMQKAAESTDADAVIVEVGGTVGDIESLPFVEALRQMKSDLGSENVFYIHTSLIIYLAAAGEAKTKPTQHSVAQLRSLGIQPDMIVLRTQRPLEENLKQKISTFTDVNENAVIESRDVETLYEIPLNLQAQGMDDVVLHKLKLDAP-KAEMSDWSKMVELIKHPKK-TVNVTLVGKYTDLPDAYISVNEALKHAGYAQDADVKINHVKSENVTPENVAELLAGADGVIVPGGFGERGTEGKIQAIRYARENNIPFLGICLGMQLASIEFARHVLGYKDANSTELNPNTSAPIIDLMKDQANVENLGGTLRLGLYPAMLLPGTLTAKAYGNQSEIEQRHRHRYEFNTQYREEFEKAGMLFSATSPDNRLMEVIEYPKNDFFIAAQYHPEFLSRPDRPEGLYHDFVAASIK 535
>gi|148543467|ref|YP_001270837.1| CTP synthetase [Lactobacillus reuteri F275] >gi|184152876|ref|YP_001841217.1| CTP synthase [Lactobacillus reuteri F275] >gi|148530501|gb|ABQ82500.1| CTP synthase [Lactobacillus reuteri F275] >gi|183224220|dbj|BAG24737.1| CTP synthase [Lactobacillus reuteri F275] (534 aa)
Score = 1256, Expect = 5.0e-136, Identities = 243/529 (45%), Positives = 354/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G ++ I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L K SNVT G++Y E + KER G +LG T+QV+PHIT AI  KI         + +I E+GGTVGDIES PF+EA RQ++ +  S+ V++IHT  +  L    ++KTKP QHSV++L   GI PN+L+VR++  +++ +++KI+L   ++ + +   +++  +Y +P +L+ Q +   + + F +EVP       W    + I+       +IA+VGKY+D  DAY+S+  SL  + + +   + I+  N+ ++   N+ E L ++D ILVPGGFG R +EG I AI+YAREN++P+ GICLGMQ A IEFAR+VL   DA+STEF+ NT + II ++  +    ++GGT RLG Y C+LK G+     Y  +S++ ERHRHRYEFN  Y    E HG V SG+N + NLVE++E+ + KFF+A Q+HPEF S+   P  +F +F+  + +
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKIAIQKFDPYINVDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDNDLNKYSNVTTGKIYSEVLRKERRGDYLGGTVQVIPHITNAIKDKIKRAGESTDAEVVITEIGGTVGDIESQPFMEAIRQMKEEVGSENVLYIHTTLVPYLRAAGEMKTKPTQHSVRELRGLGIQPNILVVRTEQPITDDMRKKIALFCDVDPKAVVESMDVHTLYEIPLNLQKQGMDQLVVDHFGLEVP-EADMTEWTEMVNHIEHDLTKTVKIAMVGKYTDLQDAYISVNESLRHAGYPVNAKVKIDHFNAENITPENVEETLKDYDGILVPGGFGNRGVEGMITAIKYARENDVPYLGICLGMQTACIEFARDVLGYTDANSTEFDPNTKHNIIDLMADQADIEDMGGTQRLGAYPCKLKPGTVAAAAYGNQSMISERHRHRYEFNNDYRQEMENHGLVISGVNPDRNLVEVVEIPDKKFFVAAQYHPEFKSRPNHPEGLFAAFVKAAAE 532
>gi|187604024|ref|ZP_02990235.1| CTP synthase [Exiguobacterium sp. AT1b] >gi|187484086|gb|EDU22079.1| CTP synthase [Exiguobacterium sp. AT1b] (531 aa)
Score = 1255, Expect = 6.1e-136, Identities = 242/527 (45%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SL  +LK  G  V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL + +NVT+GR+Y   + KER G + G T+QV+PHIT  I  ++     +   D +I E+GGTVGDIES+PF+EA RQ++    +  VM++H   +  L    ++KTKP QHSVK+L S GI P+++++R++  +   ++EKI+L      E +    +   +Y +P +L+ Q +   + ++F    P       W      +   +K K +IA+VGKY +  DAY+S+  +L+ + +    D+ I++IN+  +   N+S+ L + D ILVPGGFG+R IEGKI A ++ARENN+PFFGICLGMQLA++EFARNVLK+  A + E + +T  PII +L  +    +LGGTLRLG Y C+L+ G+K    Y ++ + ERHRHRYEFN +Y + FE  GF FSG + +  LVEIIE+  HK+F+A QFHPE  S+   P  +F+ F+  S
  S:     2 TKYIFVTGGVVSSLGKGITAASLARLLKNRGLNVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSQNANVTSGRIYSTVLKKERRGDYNGGTVQVIPHITNEIKDRVFRAGRETNADVVITEIGGTVGDIESLPFIEAIRQVKNDIGKENVMYVHCTLVPYLRAAGEMKTKPTQHSVKELRSYGIQPDIIVLRTEHDIPEDMREKIALFCDTRKEAVIEAQDASTLYEVPLNLQKQGMDQLVNDYFGFNTP-AADMTAWKELVHTVTHLEK-KVKIALVGKYVELRDAYISVAEALKHAGYAFNADIDIDWINAEDVTAENVSDILGDADGILVPGGFGERGIEGKIEATRFARENNVPFFGICLGMQLATVEFARNVLKLDGAHTAEIDPSTPYPIIDLLPEQKDIEDLGGTLRLGLYPCKLEKGTKAHAAYDQELVYERHRHRYEFNNEYREAFEAEGFKFSGTSPDGRLVEIIEIPEHKWFVASQFHPELISRPERPQRLFHDFIQAS 528
>gi|169190491|ref|ZP_02850421.1| CTP synthase [Paenibacillus sp. JDR-2] >gi|169002806|gb|EDS49683.1| CTP synthase [Paenibacillus sp. JDR-2] (534 aa)
Score = 1255, Expect = 7.5e-136, Identities = 248/529 (46%), Positives = 348/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K S+VT G++Y   I+KER G++LG T+QV+PHIT  I +++     +   D +I E+GGTVGDIES+PFLEA RQ+++   R  VM+IH   +  +    ++KTKP QHSVK+L S GI PN+++ R++ A+S  LK KI L   I+   +   I+   +Y +P  L  Q + + + N  K+   N+     W+   + +K   K    IA+VGKY    DAYLSI+ +L  + +   +++ + ++N+  +++ N+SE L     ILVPGGFG R IEGK+ AI+YARE  IPFFGICLGMQ+A IE+AR+V  + +A+S E N +T  P+I +L  +    ++GGT+RLG Y C+LK GS     Y  + + ERHRHRYEFN +Y +  E  G   SG + +  LVE++EL  H +F+AVQFHPEFTS+   P P+F  F+  + K
  S:     2 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLTKYSSVTTGKIYSNVISKERRGEYLGGTVQVIPHITNEIKERVYRAGKEAGSDVVITEIGGTVGDIESLPFLEAIRQIKSDIGRDNVMYIHVTLIPYIKAAGEVKTKPTQHSVKELRSIGIQPNVIVCRTEHALSEDLKRKIGLFCDIDANAVVECIDASTLYEVPLMLREQGLDDIVVNHLKLTT-NQPDMTQWEDLVNRVKSLHK-TTEIAIVGKYVALHDAYLSIVEALGHAGYDADSEVKLRWVNAEEIDDENVSEMLKGVHGILVPGGFGDRGIEGKVSAIRYAREQQIPFFGICLGMQVAVIEYARSVAGLFNANSAEINPSTPYPVIDLLPDQKDIEDMGGTMRLGLYPCKLKPGSLAATEYNDELVYERHRHRYEFNNEYRERIESAGLRISGTSPDGRLVEMVELPEHPWFLAVQFHPEFTSRPNRPQPLFRGFVRAALK 530
>gi|163726272|ref|ZP_02133787.1| Formate C-acetyltransferase [Desulfatibacillum alkenivorans AK-01] >gi|161400482|gb|EDQ24735.1| Formate C-acetyltransferase [Desulfatibacillum alkenivorans AK-01] (548 aa)
Score = 1255, Expect = 7.7e-136, Identities = 241/533 (45%), Positives = 365/533 (68%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPN-RIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL-----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +N KTK + VTGGV SSLGKG+A +S+GA+L+  G  +   K DPY+NVD GTM P QHGEVFV  DG ETDLD+G+YERF N+ L K+SN T G++YY  I KER G++LG T+QV+PHIT+ I   I+L ++    D  IVE+GGT+GDIES+PFLEA RQ ++   +  V++IH   +  + T  ++KTKP QHSVK+L S GI PN+LL R++  +++ +KEKI+L   +  + +++ I++K+IY +P +   + +   I     M  P  R+  + W      I+ PK  +  IA+VGKY D  ++Y S+  +L     + ++ + +EF++S ++ E+N++  LS+ D +LVPGGFG R +EGKI+A+QYAREN +P+FGICLGMQ+A IE+AR+V  + +A STEF+  T +P+I ++           + ++  ++ G T+RLG Y C+L + +   + Y    I ERHRHRYEFN +Y+D  ++ G + SG++ +  LVEI+E+E+H +F+  QFHPEF S+ ++P+P+F  F+  + K
  S:     1 MNKKTKYIFVTGGVLSSLGKGLASASIGALLEARGLSITFQKLDPYINVDPGTMNPFQHGEVFVLDDGTETDLDLGHYERFANVRLGKDSNFTTGKIYYSVIQKERRGEYLGGTVQVIPHITDEIKNSILLAADGV--DVAIVEIGGTIGDIESLPFLEAIRQFRSDVGKDNVLYIHLTLVPYIATAGEVKTKPTQHSVKELRSIGIQPNILLCRTQQVLNDSIKEKIALFCNLGKDEVFTAIDVKNIYEVPLNYHQEGLDEKIVELLNMWTPAPRL--EAWHDLIRRIENPKD-EVTIAIVGKYVDLRESYKSLNEALFHGGVFNESKVHLEFVDSETITESNVAAILSKADGVLVPGGFGSRGVEGKIMAVQYARENKVPYFGICLGMQIAVIEYARHVAGIKNAHSTEFDTATPDPVIYLMKEWYDEKTDTIQKRDVTSDKGATMRLGKYPCKLVEDTLACKAYCEDMISERHRHRYEFNQEYLDALKEAGLIISGMSPDQTLVEIVEIEDHPWFLGCQFHPEFKSRPMNPHPLFRDFIGAALK 542
>gi|70606594|ref|YP_255464.1| CTP synthetase [Sulfolobus acidocaldarius DSM 639] >gi|76363305|sp|Q4JAK8|PYRG_SULAC CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|68567242|gb|AAY80171.1| CTP synthase [Sulfolobus acidocaldarius DSM 639] (529 aa)
Score = 1254, Expect = 8.0e-136, Identities = 253/527 (48%), Positives = 360/527 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSL--NENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK +IVTGGV SS+GKG   +S+G +LK  G  V  +K DPYLNVDAGTM P  HGEVFVT DG ETDLD+G+YERF+ IN  + +N+TAGRVY+E I KER+GK+LG T+Q++PH+T+ I   +    +    +  I+E+GGTVGDIE +PFLEA RQ++ +    +MFIH   +  L    +LKTKPLQHSV++L   GI P++++ RS   +  + K+KI+L T ++ + I S  +++  Y +P  LE Q +   IFN   +E P       W  F   +K P K + +IA+VGKY+   D+YLSI  ++  ++  L+   ++ ++ SS L  +E+ I++L + + I+V  GFG R +EGKI AI++ARENNIPF GIC GMQLA +E+ARNVL + +A++TE N NT  PIIT+L+ + +   +GGT+RLG     LK+G+    IY    I ERHRHRYE NP+Y+D+ +K+G + SG++ EN LVEIIEL+NHKFF+  Q HPE+ S+ LSP+P+F +FL+V+
  S:     2 TKYIIVTGGVLSSVGKGTIVASIGFLLKSSGYNVTAIKVDPYLNVDAGTMNPYMHGEVFVTDDGAETDLDLGHYERFIGINTTRYNNITAGRVYFEVIRKEREGKYLGQTVQIIPHVTDEIKGLVKKAVDDTNAEIAIIEIGGTVGDIEGLPFLEAVRQMKLEEEENLMFIHVALVEYLRVTGELKTKPLQHSVQELRRIGIQPDMIIARSILPLDEETKKKIALFTNVKPDYILSNYDVELTYEVPLILEKQNITKKIFNKLGLE-PKEPKVAEWLEFVENMKNPSK-EVKIALVGKYTKLKDSYLSIKEAIYHAAAKLRVKPTLVWVESSDLEKSEDEINKLKDVNGIIVLPGFGARGVEGKIQAIKFARENNIPFLGICFGMQLAIVEYARNVLGLKEANTTEVNPNTKYPIITLLDNQKKIVQVGGTMRLGAQKIILKEGTLAYSIYNSPHIYERHRHRYEVNPEYVDLLQKYGMIISGVS-ENGLVEIIELKNHKFFLGTQAHPEYKSRPLSPSPVFLNFLSVA 527
>gi|169832317|ref|YP_001718299.1| CTP synthase [Candidatus Desulforudis audaxviator MP104C] >gi|169639161|gb|ACA60667.1| CTP synthase [Candidatus Desulforudis audaxviator MP104C] (540 aa)
Score = 1254, Expect = 8.5e-136, Identities = 247/529 (46%), Positives = 341/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G  V + K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L + SNVT G +Y   I KER G +LG T+QV+PHIT  I ++++ +      D +IVE+GGTVGDIES PFLEA RQL++   R   +++H   +  L    +LKTKP QHSVK+L   GI P++L+ R++      LK+K++L    E   +   +++  IY +P  LE + + + +    ++E   P+      W+      + P+  +  IA+VGKY   PDAY S+  +L         D++I  I++ SL    + E L   D ILVPGGFG R IEGKI AI++ARE ++PF GICLGMQLA +EFAR VL   DA+S+EF+  T +P+I +L  + +  +LGGT+RLG Y C L+  S     Y R+ I ERHRHRYEFN  Y+D F++ G VFSGIN +  LVEI+EL  H +F+A QFHPEF S+   P+P+F  F+  +++
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKSRGLRVTVQKLDPYLNVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDHSLTRLSNVTTGGIYSSVIRKERKGDYLGGTVQVIPHITNEIKERVLQVGEATGADVVIVEIGGTVGDIESQPFLEAIRQLKSDLGRQNTLYVHVTLVPYLRAADELKTKPTQHSVKELRGIGIQPDVLVCRTEKPFPPGLKQKLALFCDTEERAVVQALDVPFIYEVPVMLEREGLGDFVVERLELECGPPD---LTEWEAMIERWRNPED-RVTIALVGKYVSLPDAYKSVTEALRHGGIANGVDVNIRMIDAESLENGAVEEILDGADGILVPGGFGDRGIEGKIRAIRHARERSLPFLGICLGMQLAVVEFARGVLGWADANSSEFDPGTTHPVIHLLPEQLQVRDLGGTMRLGAYACRLRPDSVAGRAYGREEIQERHRHRYEFNNVYLDDFDRAGMVFSGINPDKQLVEIVELTGHPWFVATQFHPEFPSRPNRPHPLFRDFIAAARR 531
>gi|167456326|ref|ZP_02322545.1| CTP synthase [Anaeromyxobacter dehalogenans 2CP-1] >gi|167417473|gb|EDR84178.1| CTP synthase [Anaeromyxobacter dehalogenans 2CP-1] (555 aa)
Score = 1252, Expect = 1.4e-135, Identities = 244/528 (46%), Positives = 348/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK L VTGGV SSLGKG++ +S+GA+L+  G EV  +K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + +N T GR+Y   I +ER G++LG T+QV+PHIT+ I  K ++       D LIVEVGGTVGDIES+PFLEA RQ++        ++ H   +  +    +LKTKP QHSVK+L   GI P+LLL RS   +   +K+KI+L   ++   +++ +++  IY +P SL  + + + +   F +    P     + W+T    +K P++ + RI +VGKY +  ++Y S+  +L          + + FI+S+ L E ++S+L + DAILVPGGFG R  EGKIL ++YARE+ +PFFGICLG+Q+A IE ARNVL +  A+S EF+E T +P++T++EG+   T+ GGT+RLG Y C LK+G+K   +Y    + ERHRHR+EFN  Y   FE  G VFSG+N +  LVE+IEL   + F+  QFHPEF SK  +P+P+F  F+  +
  S:     7 KTKYLFVTGGVVSSLGKGLSAASIGALLENRGLEVQHLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTSAKMTRRNNYTTGRIYQNVIQRERRGEYLGKTVQVIPHITDEI--KAVIREAAGGADILIVEVGGTVGDIESLPFLEAIRQMKYDVGEENAVYAHLTLVPFIAAAGELKTKPTQHSVKELREIGIQPDLLLCRSDREIPRDMKDKIALFCNVDPSAVFTALDVPSIYEVPLSLHREGLDDKLAELFNIWSRAPR---LERWETIVDKVKNPRRGEVRIGIVGKYVELHESYKSLNEALVHGGIANDARVKLAFIDSTKLEEGDLSDLEKVDAILVPGGFGIRGTEGKILGVKYAREHKVPFFGICLGLQMAVIEMARNVLGLAGANSLEFDEQTPHPVVTLMEGQKGVTDKGGTMRLGAYPCALKEGTKARALYGADLVHERHRHRFEFNNDYRAQFEAAGMVFSGVNPDLGLVEMIELPG-QHFVGCQFHPEFRSKPFAPHPLFAGFVKAA 531
>gi|86160590|ref|YP_467375.1| CTP synthetase [Anaeromyxobacter dehalogenans 2CP-C] >gi|119391071|sp|Q2IH81|PYRG_ANADE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|85777101|gb|ABC83938.1| CTP synthase [Anaeromyxobacter dehalogenans 2CP-C] (555 aa)
Score = 1252, Expect = 1.6e-135, Identities = 244/528 (46%), Positives = 348/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK L VTGGV SSLGKG++ +S+GA+L+  G EV  +K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + +N T GR+Y   I +ER G++LG T+QV+PHIT+ I  K ++       D LIVEVGGTVGDIES+PFLEA RQ++        ++ H   +  +    +LKTKP QHSVK+L   GI P+LLL RS   +   +K+KI+L   ++   +++ +++  IY +P SL  + + + +   F +    P     + W+T    +K P++ + RI +VGKY +  ++Y S+  +L          + + FI+S+ L E ++S+L + DAILVPGGFG R  EGKIL ++YARE+ +PFFGICLG+Q+A IE ARNVL +  A+S EF+E T +P++T++EG+   T+ GGT+RLG Y C LK+G+K   +Y    + ERHRHR+EFN  Y   FE  G VFSG+N +  LVE+IEL   + F+  QFHPEF SK  +P+P+F  F+  +
  S:     7 KTKYLFVTGGVVSSLGKGLSAASIGALLENRGLEVQHLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTSAKMTRRNNYTTGRIYQNVIQRERRGEYLGKTVQVIPHITDEI--KAVIREAAGGADILIVEVGGTVGDIESLPFLEAIRQMKYDVGEENAVYAHLTLVPFIAAAGELKTKPTQHSVKELREIGIQPDLLLCRSDREIPRDMKDKIALFCNVDPSAVFTALDVPSIYEVPLSLHREGLDDKLAELFNIWSRAPR---LERWETIVDKVKNPRRGEVRIGIVGKYVELHESYKSLNEALVHGGIANDARVKLAFIDSTKLEEGDLSDLDKVDAILVPGGFGIRGTEGKILGVKYAREHKVPFFGICLGLQMAVIEMARNVLGLAGANSLEFDEQTPHPVVTLMEGQKGVTDKGGTMRLGAYPCALKEGTKARALYGADLVHERHRHRFEFNNDYRAQFEAAGMVFSGVNPDLGLVEMIELPG-QHFVGCQFHPEFRSKPFAPHPLFAGFVKAA 531
>gi|189466152|ref|ZP_03014937.1| hypothetical protein BACINT_02522 [Bacteroides intestinalis DSM 17393] >gi|189434416|gb|EDV03401.1| hypothetical protein BACINT_02522 [Bacteroides intestinalis DSM 17393] (543 aa)
Score = 1251, Expect = 2.2e-135, Identities = 248/528 (46%), Positives = 351/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKAR------IAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G +V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQV+PHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L SAGI P++L++R++  +S+ +++K++L   ++   +   I+   IY +P  ++ QK+  +I     + V +  G   W  F       +++KA       IA+VGKY D  DAY SI  +L  +  Y    +S++F+NS  L E N++E L     IL+  GFG+R + GK +AI+YAR ++IP FGICLGMQ  +IEFARNVL   DADS E NE T + +I I+E +   TN+GGT+RLG Y C L+ GSK  E Y  + I ERHRHRYEFN +Y   +E  G    GIN E++LVEI+E+   K+F+  QFHPE++S +L+P+P+F +F+  S
  S:     3 ETKYIFVTGGVASSLGKGIIASSIGKLLQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPYLESIRQLKWELGRDALCVHLTYVPYLTAAGELKTKPTQHSVKELQSAGIQPDILVLRTEHELSSNVRKKVALFCNVDENAVVQSIDAPTIYEVPILMQAQKLDETILKKMGLPVGDTPGLGPWRAFLE-----RRHKAENTEPLHIALVGKY-DLQDAYKSIREALSQAGTYNDCKVSVDFVNSEKLTEENVAEALKGMAGILIGPGFGERGVAGKFVAIKYARTHDIPTFGICLGMQCIAIEFARNVLGYTDADSREMNEKTPHNVIDIMEEQKSITNMGGTMRLGAYECILQKGSKAYEAYGTEHIQERHRHRYEFNNQYKTEYEAAGMKCVGINPESDLVEIVEIPKLKWFVGTQFHPEYSSTVLNPHPLFVAFIKAS 531
>gi|163766044|ref|ZP_02173073.1| CTP synthase [Anaeromyxobacter sp. K] >gi|196174535|gb|ACG75508.1| CTP synthase [Anaeromyxobacter sp. K] (555 aa)
Score = 1250, Expect = 2.5e-135, Identities = 244/528 (46%), Positives = 349/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK L VTGGV SSLGKG++ +S+GA+L+  G EV  +K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + +N T GR+Y   I +ER G++LG T+QV+PHIT+ I  K ++       D LIVEVGGTVGDIES+PFLEA RQ++        ++ H   +  +    +LKTKP QHSVK+L   GI P+LLL RS   +   +K+KI+L   ++   +++ +++  IY +P SL  + + + +   F +    P     + W+T    +K P++ + RI +VGKY +  ++Y S+  +L          + + FI+S+ L E ++S+L + DAILVPGGFG R  EGKIL ++YARE+ +PFFGICLG+Q+A IE ARNVL +  A+S EF+E T +P++T++EG+   T+ GGT+RLG Y C LK+G+K   +Y  + + ERHRHR+EFN  Y   FE  G VFSG+N +  LVE+IEL   + F+  QFHPEF SK  +P+P+F  F+  +
  S:     7 KTKYLFVTGGVVSSLGKGLSAASIGALLENRGLEVQHLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTSAKMTRRNNYTTGRIYQNVIQRERRGEYLGKTVQVIPHITDEI--KAVIREAAGGADILIVEVGGTVGDIESLPFLEAIRQMKYDVGEENAVYAHLTLVPFIAAAGELKTKPTQHSVKELREIGIQPDLLLCRSDRELPRDMKDKIALFCNVDPSAVFTALDVPSIYEVPLSLHREGLDDKLAELFNIWSRAPR---LERWETIVDKVKNPRRGEVRIGIVGKYVELHESYKSLNEALVHGGIANDARVKLAFIDSTKLEEGDLSDLDKVDAILVPGGFGIRGTEGKILGVKYAREHKVPFFGICLGLQMAVIEMARNVLGLAGANSLEFDEATPHPVVTLMEGQKGVTDKGGTMRLGAYPCTLKEGTKARALYGAELVHERHRHRFEFNNDYRAQFEAAGMVFSGVNPDLGLVEMIELPG-QHFVGCQFHPEFRSKPFAPHPLFAGFVKAA 531
>gi|150007174|ref|YP_001301917.1| CTP synthetase [Parabacteroides distasonis ATCC 8503] >gi|149935598|gb|ABR42295.1| CTP synthase [Parabacteroides distasonis ATCC 8503] (535 aa)
Score = 1249, Expect = 3.1e-135, Identities = 240/527 (45%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +L+  G +V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFLN+   + +N+T GR+Y   I KER G +LG T+QVVPHIT+ I + + LL +KY+ DF+I E+GGTVGDIES+PF+E+ RQL+ +     + +H   +  +    + KTKP QHSVK L   GI P++L++R++  ++  L  K++L   +  +++   I++  IY +P  L+ QK+   +     MEV      K W  F +L K       +I +VGKY +  DAY SI  SL  ++ Y    L +   +S  LN  N +E L + D IL+  GFG+R IEGK  AI+YARE+++P  GICLGMQ   IEFAR+VL + DA+STE   NTA+ +I ++E +   TN+GG++RLG Y+C LK+GSK+LE Y ++ I ERHRHR+EFN +Y   +E  G + +G N E NLVE++E+   K+F+ VQ+HPE+ S +++PNP+F SF+  +
  S:     4 TKYIFVTGGVVSSLGKGIISASLGKLLQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLNVQTTRANNITTGRIYQSVINKERKGDYLGKTVQVVPHITDEIKRNVKLLGSKYKFDFVITEIGGTVGDIESLPFIESVRQLKWELGKNCLCVHLTYVPYIAAAKEYKTKPTQHSVKQLQELGIQPDVLVLRTEHELNANLLRKVALFCNVAEDSVIQSIDVPTIYEVPLVLQRQKMDEVVLRKVGMEVGPTPELKPWKEFLAL-KSTATDTVKIGLVGKYVELQDAYKSIDESLLQAAIYNHHKLDLHLFHSEKLNNENAAEQLKDMDGILIAPGFGQRGIEGKFAAIKYAREHDVPCLGICLGMQCMVIEFARDVLGLADANSTEMEPNTAHKVIDLMEEQKNVTNMGGSMRLGAYDCMLKEGSKVLEAYGKEHIQERHRHRFEFNNEYKKQYEAAGMMCTGENPETNLVEVVEIPALKWFVGVQYHPEYNSTVVNPNPLFLSFVKAA 530
>gi|116333149|ref|YP_794676.1| CTP synthetase [Lactobacillus brevis ATCC 367] >gi|116098496|gb|ABJ63645.1| CTP synthase [Lactobacillus brevis ATCC 367] (535 aa)
Score = 1249, Expect = 3.3e-135, Identities = 243/531 (45%), Positives = 355/531 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPY+NVD GTM P QHGEVFVT DG ETDLD+G+YERF++ NL K SNVT G++Y E + KER G +LGAT+QV+PHIT  I +KI+        DF+I E+GGTVGDIES PFLEA RQ++A+   + V++IHT  +  L    ++KTKP QHSV++L S GI PN+L+VR++  +++ +++KI+L   ++   +   +++  IY +P  L++Q +   + + F ++ P +     W      ++   +   +IA+VGKY    DAY+S+  +L+ + + +  ++ ++ I++  + ++N+ + L   D I+VPGGFG R IEG I AI+YARE ++PF GICLGMQ+ASIEFAR+VL   DA+STE N +T++ II ++  +     +GGT RLG Y C+LK GS+    Y  + ++ ERHRHRYEFN +Y D     G VFSG + +++LVE+IEL   KFF+A Q+HPEF S+   P  +F  F+  + + +
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLNVTIQKFDPYINVDPGTMNPYQHGEVFVTDDGTETDLDLGHYERFIDNNLNKYSNVTTGKIYSEVLEKERHGDYLGATVQVIPHITGMIKEKIMRAGKTLGADFVITEIGGTVGDIESQPFLEAIRQMKAEVGDENVVYIHTTLVPYLHAAHEMKTKPTQHSVRELRSIGIQPNILVVRTEAPITDDMRKKIALFCDVDPSAVVESMDVPTIYSIPLRLQDQGLDQIVLDHFGVQAP-KADMTAWAQMVDHMQHLSR-TIKIALVGKYVALHDAYISVAEALQHAGYPVDANIDLQMIDAEKITDDNVQDVLGSADGIIVPGGFGDRGIEGMITAIKYAREQDVPFLGICLGMQVASIEFARDVLGYADANSTEMNPDTSHKIIDLMADQADVHEMGGTQRLGLYPCKLKAGSRAAAAYDNQEMIQERHRHRYEFNNQYRDEMTAKGLVFSGTSPDDHLVEVIELPEKKFFVAAQYHPEFLSRPNRPEGLFRDFVAAASREV 533
>gi|194467645|ref|ZP_03073632.1| CTP synthase [Lactobacillus reuteri 100-23] >gi|194454681|gb|EDX43578.1| CTP synthase [Lactobacillus reuteri 100-23] (534 aa)
Score = 1249, Expect = 3.6e-135, Identities = 241/529 (45%), Positives = 353/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +LK  G ++ I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L K SNVT G++Y E + KER G +LG T+QV+PHIT AI  KI         + +I E+GGTVGDIES PF+EA RQ++ +  S+ V++IHT  +  L    ++KTKP QHSV++L   GI PN+L+VR++  +++ +++KI+L   ++ + +   +++  +Y +P +L+ Q +   + + F ++ P       W    + I+       +IA+VGKY+D  DAY+S+  SL  + + +   + I+  N+ ++   N+ E L ++D ILVPGGFG R +EG I AI+YAREN++P+ GICLGMQ A IEFAR+VL   DA+STEF+ NT + II ++  +    ++GGT RLG Y C+LK G+     Y  +S++ ERHRHRYEFN  Y    E HG V SG+N + NLVE++E+ + KFF+A Q+HPEF S+   P  +F +F+  + +
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKIAIQKFDPYINVDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDNDLNKYSNVTTGKIYSEVLRKERRGDYLGGTVQVIPHITNAIKDKIKRAGESTDAEVVITEIGGTVGDIESQPFMEAIRQMKEEVGSENVLYIHTTLVPYLRAAGEMKTKPTQHSVRELRGLGIQPNILVVRTEQPITDDMRKKIALFCDVDPKAVIESMDVHTLYEIPLNLQKQGMDQLVVDHFGLDAP-EADMTEWTEMVNHIEHDLTKTVKIAMVGKYTDLQDAYISVNESLRHAGYPVNAKVKIDHFNAENITPENVKETLKDYDGILVPGGFGNRGVEGMITAIKYARENDVPYLGICLGMQTACIEFARDVLGYTDANSTEFDPNTKHNIIDLMADQADIEDMGGTQRLGAYPCKLKPGTVAAAAYGNQSMISERHRHRYEFNNDYRQEMENHGLVISGVNPDRNLVEVVEIPDKKFFVAAQYHPEFKSRPNHPEGLFAAFVKAAAE 532
>gi|42518309|ref|NP_964239.1| CTP synthetase [Lactobacillus johnsonii NCC 533] >gi|81668322|sp|Q74LG2|PYRG_LACJO CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|41582593|gb|AAS08205.1| CTP synthase [Lactobacillus johnsonii NCC 533] (540 aa)
Score = 1249, Expect = 3.6e-135, Identities = 247/527 (46%), Positives = 351/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPN-RIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG++ SSLG +LK  G +V + KFDPY+N+D GTM P QHGEV+VT DG E DLD+G+YER +++   K SNVT G++Y E + KER G + GAT+QV+PHIT+ I +KI+  +     D +I E+GGTVGDIES PF+EA RQ++ +     VM+IH   +  L    ++KTKP QHSV +L S GI PN+L++R++  ++ +LK KIS  T +  + I   I+   ++ LP + + Q +   + +F  +E P      + W       K  K  +  I +VGKY +  DAY+S+  +L+ + +   T + +  + +  + E+NI+E + + D ++VPGGFG R +EG I +I+YARE++IPF GICLGMQ+AS+EFARNVL + DA+S E N +T N II I+  K  E N+GGTLRLG Y   LK G+K  E Y  + ++ ERHRHRYEFN +Y + FEK G VFSG++ +N+LVEIIE+ N KFFIA Q+HPEF S+   P  +F +F+  +
  S:     2 TKYIFVTGGVVSSLGKGISASSLGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVYVTDDGTEADLDLGHYERIVDVRTSKYSNVTTGKIYQEVLDKERRGDYHGATVQVIPHITDMIKKKIMRAALTTDSDVIISEIGGTVGDIESTPFMEAIRQMRREVGEENVMYIHCTLVPYLHAAHEMKTKPTQHSVAELRSIGIQPNMLVLRAEKPIAQELKNKISTFTDVPVDRIIESIDAPSLFDLPLAFQAQGMDQKVCDFLHLESPKPEADMEAWKKLDERAKNLKN-ETTITLVGKYVELEDAYISVTDALQHAGYLYDTKIKVNKVQAEDITEDNIAEIMKDSDGLIVPGGFGTRGLEGMITSIKYAREHDIPFLGICLGMQMASVEFARNVLGLKDANSAEANPDTKNNIIDIMADKRDEENIGGTLRLGLYPATLKKGTKTREAYDDQDVIQERHRHRYEFNNEYREAFEKAGMVFSGVSPDNHLVEIIEIPNKKFFIAAQYHPEFLSRPQRPEGLFKAFIGAA 531
>gi|150005857|ref|YP_001300601.1| CTP synthetase [Bacteroides vulgatus ATCC 8482] >gi|149934281|gb|ABR40979.1| CTP synthase [Bacteroides vulgatus ATCC 8482] (532 aa)
Score = 1246, Expect = 6.8e-135, Identities = 247/528 (46%), Positives = 343/528 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G  V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQV+PHIT+ I + + LL +KY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L S GI P++L++R++  +S  LK+K++L   ++   +   I++  IY +P  ++ Q +  +I     + V        W  F    +     K +I +VGKY D  DAY SI+ +L  ++ Y      I FINS  L + N+ E + + D I++  GFG+R IEGK +AI+YAR +N+P FGICLGMQ  +IEFARNVL   DA+S E +E T + +I I+E +   TN+GGT+RLG Y C L   SK  E YK + I ERHRHRYEFN  Y   +EK G    GIN E++LVEIIE+   K+FI VQFHPE++S +L P+P+F SF+  +
  S:     3 ETKYIFVTGGVASSLGKGIISSSIGKLLQARGYNVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHITDEIKRNVKLLGSKYKFDFVITEIGGTVGDIESLPYLESIRQLKWEMGRNALCVHLTYVPYLAAAGELKTKPTQHSVKELQSVGIQPDVLVLRTEHELSTNLKKKVALFCNVDENAVVQSIDMPTIYEVPLRMQEQGLDVTILQKMGLPVGETPTLGPWRDFLDR-RHKATEKVKIGLVGKY-DLQDAYKSILEALSQAATYNDRKADIHFINSEKLTDANVEEQIKDMDGIIICPGFGQRGIEGKFVAIKYARTHNVPTFGICLGMQCMAIEFARNVLGYTDANSREMDEKTPHNVIDIMEEQKAITNMGGTMRLGAYECILDQHSKTFEAYKSEHIQERHRHRYEFNNDYKQEYEKAGMKCVGINPESDLVEIIEIPTLKWFIGVQFHPEYSSTVLKPHPLFLSFIKAA 529
>gi|184154678|ref|YP_001843018.1| CTP synthase [Lactobacillus fermentum IFO 3956] >gi|183226022|dbj|BAG26538.1| CTP synthase [Lactobacillus fermentum IFO 3956] (533 aa)
Score = 1246, Expect = 7.3e-135, Identities = 239/516 (46%), Positives = 349/516 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSP 520
           TK + VTGGV SSLGKG+  +SLG +LK  G ++ I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L K SNVT G++Y E + KER G +LG T+QV+PHIT  I +KI         + +I E+GGTVGDIES PF+EA RQ++ +  +  V++IHT  +  L    ++KTKP QHSV++L   GI PN+L+VR+++ +++ ++ KI+L   +E + +   ++ K++Y +P +L+ Q +   + + F ++VP       W      I+       +IA+VGKY+D  DAY+S+  SL  + + +   + I+  N+ ++ E+N++E L ++D ILVPGGFG R IEG I AI+YARE ++P+ GICLGMQ+A IE+ARNVL   DA+STEF+++T + II ++  +    ++GGT RLG Y C+LK G+     Y  + ++ ERHRHRYEFN  +    E HG V SG+N + NLVE++EL  +KFF+A Q+HPEF S+   P
  S:     2 TKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKIAIQKFDPYINVDPGTMSPYQHGEVFVTNDGTETDLDLGHYERFIDNDLNKYSNVTTGKIYSEVLRKERRGDYLGRTVQVIPHITNMIKEKIRRAGESTDAEVVITEIGGTVGDIESQPFMEAIRQMKKEAGADNVLYIHTTLVPYLKAAGEMKTKPTQHSVRELRGLGIQPNILVVRTEEPITDDMRTKIALFCDVEPKAVVESMDAKNLYEVPLNLQKQGMDQLVVDHFGLDVP-EADMGEWTKMVDHIENGLTKTVKIAMVGKYTDLQDAYISVNESLRHAGYPVDAKVKIDHFNAENITEDNVAETLKDYDGILVPGGFGSRGIEGMITAIKYAREQDVPYMGICLGMQVACIEYARNVLGYQDANSTEFDQDTKHNIIDLMADQEDVEDMGGTQRLGAYQCQLKPGTVAAAAYGNQEMISERHRHRYEFNNAFRQEMEDHGLVVSGVNPDRNLVEVVELPENKFFVAAQYHPEFLSRPNRP 519
>gi|58336574|ref|YP_193159.1| CTP synthetase [Lactobacillus acidophilus NCFM] >gi|75358099|sp|Q5FME6|PYRG_LACAC CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|58253891|gb|AAV42128.1| CTP synthetase [Lactobacillus acidophilus NCFM] (539 aa)
Score = 1246, Expect = 8.4e-135, Identities = 247/527 (46%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPN-RIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  SSLG +LK  G +V + KFDPY+N+D GTM P QHGEV+VT DG E DLD+G+YER +++   K SNVT G++Y E + KER G + GAT+QV+PHIT  I +KI+  +     D +I E+GGTVGDIES PF+EA RQ++ +     VM+IH   +  L    ++KTKP QHSV +L S GI PN+L++R++  +  + K+KIS  T +  + I   I+   ++ +P   + Q +   + +F  +E P      + W       K   ++K +I +VGKY +  DAY+S+  +L+ + +   T + ++ + +  + E+NI+E + + D ++VPGGFG R +EG I AI+YAREN+IPF GICLGMQ+AS+EFARNVL + DA+S E   N  N II I+  K  E N+GGTLRLG Y   LK+G+K  E Y  + ++ ERHRHR+EFN KY + FEK G VFSG++ +N LVEIIEL   KFFIA Q+HPEF S+   P  +F SF+  +
  S:     2 TKYIFVTGGVVSSLGKGITASSLGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVYVTDDGTEADLDLGHYERIVDVRTSKYSNVTTGKIYQEVLEKERRGDYHGATVQVIPHITNMIKKKIMRAALTTDSDVIISEIGGTVGDIESTPFMEAIRQMRREVGEDNVMYIHCTLVPLLHAAHEMKTKPTQHSVAELRSIGIQPNMLVLRAEQPIDQEHKDKISDFTDVPVDRIIESIDAPSLFDVPLEFQKQGMDQKVCDFLHLESPKPEADMEAWKKLDERAKN-LEHKTKITLVGKYVELEDAYISVTDALQHAGYLYNTKIEVDKVQAEDITEDNIAEIMKDSDGLIVPGGFGTRGLEGMITAIKYARENDIPFLGICLGMQMASVEFARNVLNLEDANSAEAEPNCKNNIIDIMADKRDEENIGGTLRLGLYPATLKEGTKTREAYDNQDVIQERHRHRFEFNNKYREAFEKAGMVFSGVSPDNRLVEIIELPKKKFFIAAQYHPEFLSRPQRPEGLFKSFIGAA 531
>gi|150388030|ref|YP_001318079.1| CTP synthetase [Alkaliphilus metalliredigens QYMF] >gi|149947892|gb|ABR46420.1| CTP synthase [Alkaliphilus metalliredigens QYMF] (534 aa)
Score = 1245, Expect = 1.0e-134, Identities = 247/527 (46%), Positives = 350/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K S+VT+G+VY+  I KER G++LG T+QV+PHIT  I ++I  +S +   D +I EVGGTVGDIES+PFLEA RQ++    +  VM+IH   +  L    +LKTKP QHSVK+L S GI P++++ R++ A+SN++K+KI L   ++  N+   I+   +Y +P  L+ + +         +E       + W       K P+     IA+VGKY +  DAYLS+  +L  +  + +  ++IE+I+S  L ++N+ E L +   ILVPGGFG R +EGKILA+QYAREN +P  GICLGMQLA +EFARN+L +  A S+E +  T  P+I ++  +    ++GGT+RLG Y C++   +K  E Y    I ERHRHRYE+N +Y D   + G V SGI+ +  L+EI+EL++H +F+A QFHPEF S+   P+P+F  F+  S
  S:     3 TKYIFVTGGVVSSLGKGITAASLGQLLKSRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLSKNSSVTSGKVYWSVITKERKGEYLGGTVQVIPHITNEIKERIYRVSKEGNFDVVITEVGGTVGDIESLPFLEAIRQVKYDVGQENVMYIHVTLVPYLGRAGELKTKPTQHSVKELRSIGIQPDVVVCRTEKALSNEMKDKIGLFCNLDPGNVVQNIDADSLYEVPLLLKEEGLDTMTLRRLGLEA-GEPQLEEWQEIVRRDKNPQN-SITIALVGKYVELRDAYLSVSEALTHAGIHNEAKVNIEWIHSGELAKDNVGEKLGQAHGILVPGGFGDRGVEGKILALQYARENEVPLLGICLGMQLAVVEFARNILGLAGAHSSELDPETPYPVIDLMPEQKDVEDMGGTMRLGLYPCKIYPKTKAKEAYGEDLIYERHRHRYEYNNEYRDQLIQAGLVISGISPDERLIEIVELKDHPWFVAAQFHPEFKSRPTRPHPLFREFVRAS 529
>gi|189461402|ref|ZP_03010187.1| hypothetical protein BACCOP_02057 [Bacteroides coprocola DSM 17136] >gi|189431931|gb|EDV00916.1| hypothetical protein BACCOP_02057 [Bacteroides coprocola DSM 17136] (532 aa)
Score = 1244, Expect = 1.3e-134, Identities = 244/528 (46%), Positives = 344/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G  V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQ++PHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L S GI P++L++R++  +S  LK+K++L   ++   +   +++  IY +P  ++ QK+  +I     + V        W  F +  +     K +I +VGKY D  DAY SI+ +L  ++ Y      I FINS  L + N+ E L E D I++  GFG+R IEGK +A++Y R +N+P FGICLGMQ  +IEFARNVL   DA+S E +E T + +I I+E +   TN+GGT+RLG Y C L   SK+ + Y+ + I ERHRHRYEFN  Y   FEK G    GIN E++LVEI+E+   K+FI  QFHPE++S +L P+P+F SF+  +
  S:     3 ETKYIFVTGGVASSLGKGIISSSIGKLLQARGYSVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQIIPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPYLESIRQLKWELGRNALCVHLTYVPYLAAAGELKTKPTQHSVKELQSVGIQPDILVLRTEHNLSTNLKKKVALFCNVDESAVVQSMDMPTIYEVPLRMQEQKLDVTILEKMGLPVGETPELGPWKDFLNR-RHNATEKVKIGLVGKY-DLQDAYKSILEALSQAATYNDRKADIHFINSEKLTDENVEESLKEMDGIIICPGFGQRGIEGKFVALKYCRTHNVPTFGICLGMQCMAIEFARNVLGYTDANSREMDEKTPHNVIDIMEEQKSITNMGGTMRLGAYECVLDPNSKVYQAYQTEHIQERHRHRYEFNNDYKAEFEKAGMKCVGINPESDLVEIVEIPTLKWFIGTQFHPEYSSTVLKPHPLFLSFIKAA 529
>gi|50085138|ref|YP_046648.1| CTP synthetase [Acinetobacter sp. ADP1] >gi|81392974|sp|Q6FAT7|PYRG_ACIAD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|49531114|emb|CAG68826.1| CTP synthase [Acinetobacter sp. ADP1] (545 aa)
Score = 1244, Expect = 1.4e-134, Identities = 250/529 (47%), Positives = 352/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLN-INLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T  + VTGGV SSLGKG++ +S+ A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G YERFL    + K +N T+GRVY + + KER G +LG T+QV+PHIT+ I ++++     Y  D  IVE+GGTVGDIES+PF+E+ RQL  +    + M +H   L  + + ++LKTKP QHSVK+L+S GI P++L+ R++  V    K KI+L T +E   +    + K IY +P +   QKV + I   F      +     WD     +  P+ Y  R+A+VGKY + PDAY S+  +L  +    +  + I+++++ +L   +IS LS  DAILVPGGFG+R  EGK+LAI+YARE  IPF GICLGMQLA IE+ARNV  + +A STEFN +T  PII +          L+ ++ E++LGGT+RLG    EL +G+K  ++Y +  IVERHRHRYE N ++++  EK G   SG +   +LVE +E+  H +FIAVQFHPEFTS     +P+F SF++ +KK
  S:     2 THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGYYERFLRRAKMTKLNNFTSGRVYQDVLNKERRGDYLGGTVQVIPHITDNIKERVLAAGEGY--DVAIVEIGGTVGDIESLPFMESVRQLMVELGHKRTMLMHLTLLPYIRSAAELKTKPTQHSVKELLSIGIQPDILICRTEHDVDADTKRKIALFTNVEARAVVVCKDAKTIYQIPRNFYEQKVDDLICERFGYNDLPQADLSDWDQVCEALFNPE-YIVRVAMVGKYVELPDAYKSVNEALLHAGIQNRVKVQIDYVDAETLETQDISILSTADAILVPGGFGERGTEGKMLAIKYAREQGIPFLGICLGMQLAVIEYARNVAGLAEATSTEFNRSTKFPIIGLITEWLDERGELQQRSVESDLGGTMRLGAQKSELVEGTKTRQVYGKAEIVERHRHRYEMNDRFIEPIEKAGMKISGYSTAQHLVETVEIPEHPWFIAVQFHPEFTSSPRDGHPLFASFIDAAKK 539
>gi|154494957|ref|ZP_02033962.1| hypothetical protein PARMER_04003 [Parabacteroides merdae ATCC 43184] >gi|154085507|gb|EDN84552.1| hypothetical protein PARMER_04003 [Parabacteroides merdae ATCC 43184] (535 aa)
Score = 1244, Expect = 1.5e-134, Identities = 242/527 (45%), Positives = 340/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +L+  G +V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFLN+   + +N+T GR+Y   I KER G +LG T+QVVPHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+PF+E+ RQL+ +     + +H   +  +    + KTKP QHSVK L   GI P++L++R++  +S  L  K++L   +  + +   I++  IY +P  L+ QK+   I     +EV      K W  F    K       RI +VGKY +  DAY SI  SL  ++ Y    L +   +S  LN+ N +E L + D IL+  GFG+R IEGK  A++YAREN++P  GICLGMQ   IEFARNV+ + +A+STE   NT   +I ++E +   TN+GG++RLG Y+C LK GSK  E Y +  I ERHRHR+EFN +Y D FE  G +  G N E+NLVE++E+   K+F+ VQFHPE+ S +++PNP+F SF+  +
  S:     4 TKYIFVTGGVVSSLGKGIIAASLGKLLQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLNVQTTRANNITTGRIYQSVINKERKGDYLGKTVQVVPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPFIESVRQLKWELGKNCICVHLTYVPYIAAAKEYKTKPTQHSVKQLQELGIQPDVLVLRTEHELSANLLSKVALFCNVAQDAVIQSIDVPTIYEVPLVLQRQKMDEVILRKVGLEVGPTPEMKPWHQFLQR-KVDATETVRIGLVGKYVELQDAYKSIDESLLQAAIYNDRKLDLHLFHSEKLNDGNAAELLKDMDGILIAPGFGQRGIEGKFAALKYARENDVPCLGICLGMQCMVIEFARNVMGLAEANSTEMEPNTPYKVIDLMEEQKNVTNMGGSMRLGAYDCILKKGSKAYEAYGQTHIQERHRHRFEFNSEYRDKFEAAGMMCVGENPESNLVEVVEIPALKWFVGVQFHPEYNSTVVNPNPLFVSFVKAA 530
>gi|110638923|ref|YP_679132.1| CTP synthetase [Cytophaga hutchinsonii ATCC 33406] >gi|119391095|sp|Q11S24|PYRG_CYTH3 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|110281604|gb|ABG59790.1| CTP synthase (CTP synthetase) [Cytophaga hutchinsonii ATCC 33406] (539 aa)
Score = 1242, Expect = 2.1e-134, Identities = 249/527 (47%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEF-DAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SL  +L+  G  V I KFDPYLN+D GT+ P +HGE +VT DG ETDLD+G+YERFL     + +N+T GR+Y   I KER G FLG T+QVVPHIT+ I + I LL    + D +I E+GG VGDIES+PFLEA RQ + +   +  + IH   +  L    +LKTKP QHSVK L   GI P++L+ R++  +  +L++K++L   +   ++   I+ + IY +P  ++ +K+   + +  K+   N    + W  F   +K P   +  IA+VGKY + PDAY SI  +   +    +  + I +I+S  L ++N+     F D ILV  GFG+R +EGKI A+++ARENNIPFFGICLGMQ A IEFARNVL + DA+STE N++TANP+I ++E +   T  GGT+RLG Y CEL  GSK   IY +  I+ERHRHRYEFN KY+  +EK G + +GIN E  LVEI+EL +H FFI  QFHPE  S + +P+PIF  F+  +
  S:     4 TKYIFVTGGVTSSLGKGIVAASLAKLLQARGFSVTIQKFDPYLNIDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLGTPTSQGNNITTGRIYNTVITKERQGAFLGKTVQVVPHITDEIKRNIQLLGESGKYDIVITEIGGCVGDIESLPFLEAVRQFRWEMGPTDTLVIHLTLVPYLNAAKELKTKPTQHSVKLLSETGIHPDILVCRTEHPLPAELRKKVALFCNVNINSVIESIDAETIYDVPLLMKKEKLDERVLSKLKLSSKNEPDLESWKVFLGKLKNPLS-EVNIALVGKYVELPDAYKSISEAFIHAGAMNECKVKIRWISSEQLQKDNLQHHLGFADGILVAPGFGERGLEGKIAAVEFARENNIPFFGICLGMQCAVIEFARNVLGLKDANSTEMNKDTANPVINMMESQKNVTMKGGTMRLGAYPCELTKGSKAHAIYGKSKIMERHRHRYEFNNKYLKQYEKEGMLATGINPETKLVEIVELRDHPFFIGSQFHPELKSTVENPHPIFVKFVKAA 531
>gi|46580034|ref|YP_010842.1| CTP synthetase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120602555|ref|YP_966955.1| CTP synthetase [Desulfovibrio vulgaris subsp. vulgaris DP4] >gi|81404682|sp|Q72BL2|PYRG_DESVH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|46449450|gb|AAS96101.1| CTP synthase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] >gi|120562784|gb|ABM28528.1| CTP synthase [Desulfovibrio vulgaris subsp. vulgaris DP4] (547 aa)
Score = 1242, Expect = 2.3e-134, Identities = 239/529 (45%), Positives = 348/529 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL-----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           KTK + +TGGV SSLGKG+A +S+GA+LK  G +V I K DPY+NVD GTM P QHGEV+VT DG ETDLD+G+YER+L   + +++N T+G +Y+  I KER G +LG T+QV+PH+T+ I   ++ L+    PD  ++E+GGTVGDIE +PFLEA RQL+    + + ++IH   +  L    + KTKP QHSVK+L S GI P+++L R ++A++  LK KI+L   ++ + ++S +++K+IY +P     +     I    ++   N    + W+T       P+  +  I +VGKY D  +AY S+  +L       K  + ++++NS  + E N++E L   D ILVPGGFG R +EGKIL I+YAREN +PFFGICLGMQ A IEFARNV+ + DA+S EFNE + N +I ++           E ++  ++ GGT+RLG+Y C +   +K  + Y  K I ERHRHR+EFN  Y D   + G VFSG++ +  LVEI+EL +H +F+  QFHPEF S  + P+P+F  F+  +K
  S:     2 KTKFIFITGGVLSSLGKGLAAASVGALLKARGLKVTIQKLDPYINVDPGTMNPFQHGEVYVTDDGAETDLDLGHYERYLAEPMSQKNNYTSGSIYHRVITKERRGDYLGGTVQVIPHVTDEIKNAVLSLAED-DPDVALIEIGGTVGDIEGLPFLEAIRQLRGDLGKDRCLYIHLTLVPYLRAAGEHKTKPTQHSVKELRSIGIQPDIILCRCEEAITADLKRKIALFCNVDQDAVFSAVDVKNIYEVPLRFYEEGFDQKIAIMLRLPAKNP-NLEPWETLVDTCAHPQG-RVTIGIVGKYVDLKEAYKSLHEALVHGGVANKVAVDLKYVNSEEITEENVAEALKGLDGILVPGGFGYRGVEGKILTIRYARENRVPFFGICLGMQCAVIEFARNVMGLEDANSEEFNELSKNKVIYLMTEWFDHRRQAVERRDSSSDKGGTMRLGSYPCVVVPDTKAHDAYGVKHIDERHRHRFEFNKAYFDAMAQSGMVFSGLSPDGELVEIVELPDHPWFLGCQFHPEFKSNPMQPHPLFREFIRAAK 540
>gi|159898267|ref|YP_001544514.1| CTP synthetase [Herpetosiphon aurantiacus ATCC 23779] >gi|159891306|gb|ABX04386.1| CTP synthase [Herpetosiphon aurantiacus ATCC 23779] (534 aa)
Score = 1242, Expect = 2.5e-134, Identities = 245/531 (46%), Positives = 343/531 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLN-ENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + +N+T G++Y   I KER G FLG TIQV+PHIT  I  ++ L++     D +IVE+GGTVGDIES+PFLEA RQ++    R  VM+IH   L  L    +LKTKP QHS+ +L   GI P ++L RS   V + ++EKI+L   + NE + +L  +  IY +P  LE   + + I     +     +    W +  + IK+PK++   +A+VGKY +  DAY+S+  S+  + +     + I++++S  L   + ++ L +   I+VPGGFG R +EGKI A++YAREN IPF G+CLGMQ A+IEFAR  L   DA+STEFN NT  P+I  +  +   ++ GGT+RLG Y C L   +K  + Y R+  +ERHRHR+EFN KY    E  GFV SG + +  LVEI+EL +H +F+A QFHPEF S+  +P+P+F  F+  + + I
  S:     2 TKYIFVTGGVASSVGKGITVASLGRLLKSRGISVSIQKLDPYINVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSRVNNITTGQIYSSVIQKERRGDFLGGTIQVIPHITNEIKSRVALVAKNTNADVVIVEIGGTVGDIESLPFLEAIRQMKKDVGRDNVMYIHVTLLPYLQASGELKTKPTQHSIAELRRVGISPAVVLCRSDLPVDDDMREKIALFADLPNEAVVALPTVDSIYEVPLVLEEAGLGDLIIERLAL-AAQPVQLDEWRSLVARIKQPKRHTT-VAIVGKYVELRDAYMSVAESVRHAGWAQDIQVDIKWVSSEELEVADPVTMLGDVQGIIVPGGFGYRGVEGKIRAVRYARENKIPFLGLCLGMQCATIEFARFALNAPDANSTEFNPNTKLPVIDFMPDQLDISDKGGTMRLGVYPCILAPDTKAAKAYGRELALERHRHRFEFNNKYRKAMEAAGFVISGHSPDGRLVEIVELRDHPWFVASQFHPEFKSRPNNPHPLFRDFVQAALEQI 532
>gi|168266782|ref|ZP_02688747.1| CTP synthetase [Listeria monocytogenes FSL J2-071] (532 aa)
Score = 1241, Expect = 2.7e-134, Identities = 245/527 (46%), Positives = 346/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ+++   ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL NH +F+A Q+HPEF S+   P  +F  F+  S
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKSDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETKHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELANHPWFVACQYHPEFISRPNRPQSLFKDFVGAS 528
>gi|83858003|ref|ZP_00951530.1| CTP synthetase [Croceibacter atlanticus HTCC2559] >gi|83848183|gb|EAP86053.1| CTP synthetase [Croceibacter atlanticus HTCC2559] (539 aa)
Score = 1241, Expect = 3.1e-134, Identities = 240/533 (45%), Positives = 354/533 (66%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +  +TK + VTGGV SSLGKG+  +SL  +L+  G +  I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+N  +E+NVT GR+Y   I KER G+FLG T+QVVPHIT  I ++I +L      D +I E+GGTVGDIES+P++E+ RQL+ +      + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S+ L++K++L   ++ E +   I+   IY +P  +  + +     +  K+    +    HW+ F    K P   +  + +VGKY +  D+Y SI+ +   +    +  ++IE I+S  +++  I + +S  D ILV  GFG+R IEGK+ A+++ARENN+PFFGICLGMQ+A IE+ARNVL + DA+S E +++T NP+I I+E +   T +GGT+RLG++ C+LKDGSKI EIY  ++I ERHRHRYE+N KY +  E  G + +GIN +  LVE IEL++H +FI VQ+HPE+ S + +P+P+F  F+   K+
  S:     1 MAQQTKYIFVTGGVSSSLGKGIIAASLAKLLQARGYKTTIQKLDPYINVDPGTLNPYEHGECYVTEDGAETDLDLGHYERFLNVNTSQENNVTTGRIYQSVIEKERRGEFLGKTVQVVPHITNEIKERIQMLGKHGDYDIVITEIGGTVGDIESLPYIESVRQLKWELGDDNALVIHLTLIPYLSAAGELKTKPTQHSVKTLMESGIKADILVCRTEHELSDDLRDKLALFCNVKREAVIQSIDASTIYDVPNLMLEEGLDVITLDKLKLSKDTQPDLTHWNAFLKRHKNPT-CEVTVGLVGKYVELQDSYKSILEAFIHAGAENEVKVNIESIHSEFIDDATIKDKISHLDGILVAPGFGERGIEGKVDAVKFARENNLPFFGICLGMQMAVIEYARNVLNLSDANSIEMDDSTKNPVIAIMEDQKNITQMGGTMRLGSWECKLKDGSKIHEIYNSQTIHERHRHRYEYNNKYKEQLEAAGLISTGINPDTGLVETIELKDHPWFIGVQYHPEYKSTVANPHPLFVGFVEACKQ 534
>gi|125974425|ref|YP_001038335.1| CTP synthetase [Clostridium thermocellum ATCC 27405] >gi|196253907|ref|ZP_03152509.1| CTP synthase [Clostridium thermocellum DSM 4150] >gi|125714650|gb|ABN53142.1| CTP synthase [Clostridium thermocellum ATCC 27405] >gi|196196674|gb|EDX91569.1| CTP synthase [Clostridium thermocellum DSM 4150] (542 aa)
Score = 1240, Expect = 3.6e-134, Identities = 246/526 (46%), Positives = 346/526 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV S LGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL K +NVT G++Y+  I+KER G FLG T+QV+PH+T  I  +I L+  + + D +I E+GGTVGDIES+PFLEA RQ+ +   R  V++IH   +  L    +LKTKP QHSVK+L S GI P++++ R++  +S +LK+KI L   I  E +   ++ + +Y +P  LE + + N +     +    +     W    +  K   K    IA+VGKY +  DAYLS++ SL     Y   ++ I+++NS  L E+N+ E L + D ILVPGGFG R IEGKILA +YAREN +P+FGICLGMQ+A +EFARNV  +  A+S+EF+ N+ +P+I ++  +      GGT+RLG Y C++   S    IY+ + I ERHRHRYEFN +Y ++    G + +G++    LVEIIEL++H +FI VQFHPEF S+   P+P+F  F+  +
  S:     4 KYIFVTGGVVSGLGKGITAASLGRLLKARGLRVTIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLSKNNNVTTGKIYWSIISKERKGDFLGGTVQVIPHVTNEIKNRIYLVGKEGKTDVVITEIGGTVGDIESLPFLEAIRQVASDVGRENVVYIHVTLVPYLSKSGELKTKPTQHSVKELRSLGIQPDIIVCRTEKRLSKELKDKIGLFCNIPGEWVIQNLDAESLYEIPLMLEEEGLANIVCERLNLGCV-KPDMTEWCELVNRQKNLSK-SLTIALVGKYVELHDAYLSVVESLNHGGIYNDAEVKIKWVNSEELTEDNLEETLCDVDGILVPGGFGDRGIEGKILAAKYARENKVPYFGICLGMQMAVVEFARNVAGLKMANSSEFDANSPHPVIDLMPEQKDIDEKGGTMRLGLYPCKIIKDSSAYRIYESELIYERHRHRYEFNNEYRELLTSKGLILAGLSPSEKLVEIIELKDHPWFIGVQFHPEFKSRPNRPHPLFKDFIRAA 529
>gi|163782511|ref|ZP_02177508.1| CTP synthetase [Hydrogenivirga sp. 128-5-R1-1] >gi|159882084|gb|EDP75591.1| CTP synthetase [Hydrogenivirga sp. 128-5-R1-1] (530 aa)
Score = 1239, Expect = 4.8e-134, Identities = 246/526 (46%), Positives = 350/526 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKGV  +S+GA+L+  G  + + K DPYLNVD GTM+P QHGEV+VT DG ETDLD+G+YERF +  + K++NVTAG+VY+  I +ER G +LGAT+QV+PHITE I + I  +S+ +  D +IVEVGGTVGDIE +PFLEA RQL  +  R+  MFIH   +  + T  +LKTKP QHSVK+L + GI P+ L+ R+   +   +K KI+L + +E   + S  +L +IY LP   + + +   +     +E  +      W    ++++  ++ +  IAV+GKY +  DAY SII +L        + +SI +++S   +E     L + D IL+PGGFG+R  +GKI A++  RE NIP FGICLGMQL ++EFARNVL +  A+STEF+ +T  P+I ++E +     LGGT+RLG Y C L++G+K+ EIY R+ I ERHRHRYEFN ++ + FE +G  FSG++ +  LVEI+EL +H ++I  QFHPEF SK   P+P+F SF+  +
  S:     3 KFIFVTGGVLSSLGKGVTSASVGAILEGMGYRITLQKLDPYLNVDPGTMSPYQHGEVYVTEDGAETDLDLGHYERFTDAVMSKDNNVTAGKVYFNVITRERRGDYLGATVQVIPHITEEIKELIKRVSDDH--DVVIVEVGGTVGDIEGLPFLEAVRQLSLELGRNDSMFIHVTYVPYIKTAGELKTKPTQHSVKELRAIGIQPDALICRADRDLPKGIKGKIALFSNVEESAVISAPDLDYIYDLPNKFKEEGLDRLVAERLGLEFRD-TNLSKWKKVVNVLRTAQR-EVNIAVIGKYVELKDAYKSIIEALTHGGIANSSKVSIAWMSSERFDEEG---LLKVDGILIPGGFGERGTKGKIDALRVGRERNIPTFGICLGMQLMAVEFARNVLGLEGANSTEFDPDTPYPVIDLMEEQKNINELGGTMRLGAYPCVLQEGTKVREIYGREVIYERHRHRYEFNNRFREPFESNGVRFSGLSPDGKLVEIMELSDHPWYIGCQFHPEFKSKPFDPHPLFVSFIEAA 522
>gi|167762903|ref|ZP_02435030.1| hypothetical protein BACSTE_01267 [Bacteroides stercoris ATCC 43183] >gi|167699243|gb|EDS15822.1| hypothetical protein BACSTE_01267 [Bacteroides stercoris ATCC 43183] (537 aa)
Score = 1239, Expect = 4.9e-134, Identities = 244/528 (46%), Positives = 351/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKAR------IAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G +V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQV+PHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L SAGI P++L++R++  +S+ L++K++L   ++ + +   I+   IY +P  ++ Q +  +I     + V +  G   W  F       +++KA       IA+VGKY D  DAY SI  +L  +  Y    +S++F+NS  L + N++E L     +L+  GFG+R I GK +AI+YAR ++IP FGICLGMQ  +IEFARNVL   DA+S E +E T + +I I+E +   TN+GGT+RLG Y C L++GSK  E Y  + I ERHRHRYEFN  Y   +E  G   +GIN E++LVEI+E+   K+F+  QFHPE++S +L P+P+F +F+  +
  S:     3 ETKYIFVTGGVASSLGKGIISSSIGKLLQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPYLESIRQLKWELGKDALCVHLTYVPYLAAAGELKTKPTQHSVKELQSAGIQPDVLVLRTEHELSSTLRKKVALFCNVDEKAVVQSIDAPTIYEVPILMQAQGLDETILKKMGLPVGDTPGLGPWRAFLE-----RRHKAETTEPVHIALVGKY-DLQDAYKSIREALSQAGTYNDRKVSVDFVNSEKLTDENVAEALKGMSGVLIGPGFGERGIAGKFVAIKYARTHDIPTFGICLGMQCIAIEFARNVLGYADANSREMDEKTPHNVIDIMEEQKSITNMGGTMRLGAYECVLQEGSKAYEAYGTEHIQERHRHRYEFNNAYKAEYEAAGMQCTGINPESDLVEIVEIPALKWFVGTQFHPEYSSTVLHPHPLFVAFVKAA 531
>gi|77919541|ref|YP_357356.1| CTP synthetase [Pelobacter carbinolicus DSM 2380] >gi|119391143|sp|Q3A371|PYRG_PELCD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|77545624|gb|ABA89186.1| CTP synthase [Pelobacter carbinolicus DSM 2380] (534 aa)
Score = 1238, Expect = 7.3e-134, Identities = 245/530 (46%), Positives = 345/530 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           KTK L +TGGV SSLGKG+A +S+GA+++  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L ++SN T G+VY   I KER G +LG T+QV+PHIT  I  KI  L+N    D  IVEVGGTVGDIES+PFLEA RQ + +  R  V+++H   +  + T  +LKTKP QHSVK+L   GI P++LL R    +   +K KI+L   +  E + +  +++ IY +P +   + +   I ++  +  + P+      W+      KEP+  +  IA+VGKY +  ++Y S+  +L          +++ +++S SL  + + +   + D ILVPGGFG R  EGKI AI+YAREN IPFFGICLGMQ+A +EFARNV  + D  S+EF E+ ANP+I I+E + + T  GGT+RLG Y C+L +G+    I+    + ERHRHRYEFN  Y +  EK G V SG+ ++  LVEI+E+E+H +F+  QFHPEF S+ + P+P+F SF+  S K
  S:     2 KTKFLFITGGVVSSLGKGLAAASIGALMEARGLRVSMQKMDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSARLSQKSNFTTGQVYDSVIRKERRGDYLGGTVQVIPHITNEIKAKI--LANSKDVDVAIVEVGGTVGDIESLPFLEAIRQFRVERGRENVLYLHLTLVPYIPTAGELKTKPTQHSVKELREIGIQPDILLCRCDREIPRDMKAKIALFCNVSEEAVVTARDVECIYEVPIAYHEEGLDERIIDYLNIWTKAPD---LTDWERIVRRFKEPES-ETTIAIVGKYVELTESYKSLSEALIHGGIANNCRVNLIYVDSESLERHGVGDTFKDVDGILVPGGFGHRGSEGKIAAIRYARENRIPFFGICLGMQMAVVEFARNVCGIDDCFSSEFKEDAANPVIHIMENQKKVTRKGGTMRLGAYPCQLVEGTLARRIFGTGDVEERHRHRYEFNNAYQERLEKGGLVISGVYRDVGLVEIVEIEDHPWFLGCQFHPEFRSRPMEPHPLFESFVGASLK 529
>gi|146297554|ref|YP_001181325.1| CTP synthetase [Caldicellulosiruptor saccharolyticus DSM 8903] >gi|145411130|gb|ABP68134.1| CTP synthase [Caldicellulosiruptor saccharolyticus DSM 8903] (543 aa)
Score = 1237, Expect = 7.6e-134, Identities = 253/531 (47%), Positives = 346/531 (65%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +  + K + VTGGV S LGKG+  +S+G +LK  G +V + KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL K SNVT G++Y+  I +ER G FLG T+QV+PHIT  I ++I  L      D +I E+GGTVGDIES+PFLEA RQ+     +  V+++H   +  L    +LKTKP QHSVK+L S GI P++++ R++  +S +LK KI+L   ++ E +   I+ + +Y +P  LE + +   I          +     W    +  K  KK    IA+VGKY +  DAYLS+  +L+ +     + + I +IN+  +   N  EL  E D ILVPGGFG R IEGKI AI+YAREN IPFFGICLGMQ A IEFARNVL +  A+STEF+ENT  P+I I+  +      GGT+RLG Y C+L++G+    IY  + + ERHRHRYEFN ++ + F + G VFSGI+ +  LVEIIEL++H +F+ VQFHPEF S+   P+PIF  F+  S
  S:     1 MEKQVKYIFVTGGVVSGLGKGITAASIGRLLKARGLKVTMQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLTKNSNVTTGKIYWSVIQRERRGDFLGGTVQVIPHITNEIKERIYRLGKSNSTDVVITEIGGTVGDIESLPFLEAIRQVATDIGKENVLYVHVTLVPYLSKSGELKTKPTQHSVKELRSIGIQPDIIVCRTEKPLSPELKAKIALFCNLKPEYVIQNIDAESLYEVPLMLEEEGLGEIICEKLGFAC-TKPDLSDWIEIVNKEKNLKK-TVNIALVGKYVELHDAYLSVAEALKHAGIANDSHVEILWINAEHVTYENAHELLKEADGILVPGGFGDRGIEGKIAAIKYARENKIPFFGICLGMQCAVIEFARNVLGLEKANSTEFDENTPYPVIDIMPEQKEIFTKGGTMRLGLYPCKLEEGTLAHRIYNDELVYERHRHRYEFNNEFKERFRQAGMVFSGISPDRRLVEIIELKDHPWFVGVQFHPEFKSRPQKPHPIFTDFIRAS 531
>gi|116873925|ref|YP_850706.1| CTP synthetase [Listeria welshimeri serovar 6b str. SLCC5334] >gi|116742803|emb|CAK21927.1| pyrG [Listeria welshimeri serovar 6b str. SLCC5334] (532 aa)
Score = 1237, Expect = 8.8e-134, Identities = 243/527 (46%), Positives = 346/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ++    ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y +  + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+A Q+HPEF S+   P  +F  F+  +
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKGDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETNHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKTEAAYGKTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELTDHPWFVACQYHPEFISRPNRPQSLFKDFVGAA 528
>gi|83319784|ref|YP_424124.1| CTP synthetase [Mycoplasma capricolum subsp. capricolum ATCC 27343] >gi|90110049|sp|Q48965|PYRG_MYCCT CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|83283670|gb|ABC01602.1| CTP synthase [Mycoplasma capricolum subsp. capricolum ATCC 27343] (532 aa)
Score = 1237, Expect = 9.0e-134, Identities = 256/523 (48%), Positives = 348/523 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV S LGKG+  SS+GA+LK  G +V + KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  L K S+ T+G++Y   I  ER G   G TIQVVPHIT+AI  K+   + + Q D +I E+GGTVGDIES PF+EA RQ++ +  +  VMF+H V L+ L    + KTKP+Q+SVK + S GI P++++ RS  +    +KEKISL   +   NI   I+   IY +P +L  Q +Q+ I    +++  N I    W  F   I    + +  I+ VGKY +  DAYLS++ SL+I+ +     + I +I + +LNE+N +E L     ILVPGGFGKR IEG +LA +YAR+N+IP+ GICLGMQ+A+I  AR++L   DADSTEFN+NT +PI   ++G +R+ N+GGTLRLG    +L+  S + ++Y     +ERHRHRYEFN KY    E  G  FSGI +E NLVE+IE+ + KFF+A QFHPEFTS+   P P+F  F+
  S:     3 KFIFVTGGVVSGLGKGITASSIGALLKASGLKVFMQKFDPYLNVDPGTMSPYQHGEVFVTKDGGETDLDLGHYERFIDEELTKLSSTTSGKIYLSVIKGERKGDTSGKTIQVVPHITDAIKNKVYQAAKQSQADVIISEIGGTVGDIESQPFIEAIRQIRLEQGKENVMFVHVVLLLWLAASKEYKTKPIQNSVKAMASLGIQPDVIVCRSDSSSPKDIKEKISLFCNVPITNIIDAIDQDSIYRVPLALAKQNLQDIIIEQLQLKA-NAIDLTSWKQFNKKIDSSSQ-EIEISFVGKYIELQDAYLSVLESLKIAGWEFNKKIKIRWIQAETLNESNYNEILKNSQGILVPGGFGKRGIEGMMLASRYARDNDIPYLGICLGMQIATISIARDLLNWTDADSTEFNKNTTHPIFDYIKGIDRD-NIGGTLRLGTMVTKLEKDSLVSKLYNSDVALERHRHRYEFNNKYKKDLESVGLRFSGIYEEKNLVEVIEMPSLKFFVASQFHPEFTSRPNKPTPLFKGFI 524
>gi|16801765|ref|NP_472033.1| CTP synthetase [Listeria innocua Clip11262] >gi|24212139|sp|Q927T4|PYRG_LISIN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|16415240|emb|CAC97930.1| pyrG [Listeria innocua] (532 aa)
Score = 1236, Expect = 1.2e-133, Identities = 243/527 (46%), Positives = 346/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ+++   ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+A Q+HPEF S+   P  +F  F+  +
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKSDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYEHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETKHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELADHPWFVACQYHPEFISRPNRPQSLFKDFVGAA 528
>gi|169335774|ref|ZP_02862967.1| hypothetical protein ANASTE_02199 [Anaerofustis stercorihominis DSM 17244] >gi|169258512|gb|EDS72478.1| hypothetical protein ANASTE_02199 [Anaerofustis stercorihominis DSM 17244] (540 aa)
Score = 1235, Expect = 1.4e-133, Identities = 244/521 (46%), Positives = 345/521 (66%)
  Q:     8 LIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNR-IGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           + VTGGV SSLGKG+  +SLG +LK  G  V I K DPYLN D GTM+P QHGEVFVT DG ETDLD+G+YERF++IN   +SN+T G++Y+  I+KER G FLG T+QV+PHIT  I   I     +   D +I E+GGTVGDIES PFLEA RQ++     +V++IH   L  L    +LKTKP QHSVK+L S GI PN+++ RS+  VS  +KEKI+L   +  E +    + + +Y +P SLE++ + + +     + +P + +    W+     +K   K K +IA+VGKY    DAYLS+  +L       + ++ I++I+S  + E N+ + L + + I+VPGGFG R +EGK+LA +YAREN +P+ G+CLGMQ+A IEFARNVL + DA S+EF+ENT NP+I ++  +    N GGT+RLG Y C+LK+G+K  E Y  + I ERHRHRYE N +Y D  E+ G + SGI+    LVE++E+++H +++A Q HPEF S+    +P+F  F+
  S:    12 IFVTGGVVSSLGKGITAASLGRLLKARGVNVFIQKLDPYLNFDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIDINCSNKSNITTGKIYWSIISKERKGDFLGGTVQVIPHITNEIKDFIKAAGEESGADVVISEIGGTVGDIESQPFLEAIRQMKGDCPGRVLYIHVTLLPYLGKAMELKTKPTQHSVKELRSIGIQPNIIVPRSELPVSESIKEKIALFCDVPKEAVIPNYDAETLYEVPMSLEDEGLADYVIKC--LNIPAKELDLTEWEQVVDKVKSINK-KVKIALVGKYVSLRDAYLSVAEALYHGGIENEAEVEIDWIDSEEITEENVKDKLKDVNGIIVPGGFGTRGVEGKLLAAKYARENKVPYLGLCLGMQVAVIEFARNVLGIKDATSSEFDENTKNPVIDLMPEQKDIDNKGGTMRLGAYPCDLKEGTKAYEAYGEEHISERHRHRYEVNNEYRDKLEEAGMIISGISPSRVLVEMVEIKDHPWYVATQAHPEFKSRPNRAHPLFREFV 531
>gi|120553851|ref|YP_958202.1| CTP synthetase [Marinobacter aquaeolei VT8] >gi|120323700|gb|ABM18015.1| CTP synthase [Marinobacter aquaeolei VT8] (542 aa)
Score = 1235, Expect = 1.4e-133, Identities = 241/527 (45%), Positives = 343/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T GRVY E I KER G +LG T+QV+PHIT+ I ++++        D  ++EVGGTVGDIES+PFLEA RQL+ +  SQ  +F+H   +  + T  ++KTKP QHSVK++ S G+ P++LL RS+  V    + KI+L T +E   +  + + + IY +P  L    +   +   F ++         WD     +  P+  +  IA+VGKY +  DAY S+I SL  +    +T ++I +I+S  +  +  S L   DAILVPGGFG+R +EGKI  +QYAREN +P+ GICLGMQ+A IE+ARNV  + DA STEF E+T  P++ ++          E +  E++LGGT+RLG  +C L +GS I+  Y +K+I ERHRHRYE N  ++   E+ G   SG + +  LVE++E  +H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIRTPMTKRNNFTTGRVYEEVIRKERRGDYLGGTVQVIPHITDEIKRRVV--EGAAGADVALIEVGGTVGDIESLPFLEACRQLKVEVGSQRALFMHLTLVPYIATAGEIKTKPTQHSVKEMRSIGLQPDILLCRSEHEVDASSRRKIALFTNVEERAVIPMQDARSIYAIPRMLHEYGLDQLVIERFGLDA-READLSEWDAVVDSLMNPQD-EVTIAMVGKYMELLDAYKSLIESLLHAGIKTRTKVNINYIDSEDIERDGTSVLESADAILVPGGFGERGVEGKIRTVQYARENKVPYLGICLGMQVAVIEYARNVAGLKDAHSTEFREHTPEPVVGLITEWLDATGEKEERTEESDLGGTMRLGAQDCVLTEGSTIVGCYGKKTIRERHRHRYEVNNHFLPRLEEAGLQISGRSADGKLVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFKGFVEAA 535
>gi|147679178|ref|YP_001213393.1| CTP synthetase [Pelotomaculum thermopropionicum SI] >gi|146275275|dbj|BAF61024.1| CTP synthase [Pelotomaculum thermopropionicum SI] (537 aa)
Score = 1235, Expect = 1.4e-133, Identities = 246/528 (46%), Positives = 346/528 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLG +LK  G +V I K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++IN+ +  NVT G +Y   I KER G++LG T+QV+PHIT  I ++++ +++    D +I E+GGTVGDIES PFLEA RQL+    R  V++IH   +  L   ++LKTKP QHSVK+L S GI P++++ RS+  +S +++EK++L   +E E +   ++   IY +P  LE + + + + +   ++  P  +    W      +K   +Y   IA+VGKY    DAYLS+  +L  + FY  + + I++INS  +N  N  + L   D ILVPGGFG R IEGKI AI++ARE  IPFFG+CLGMQLA +EF+RNV+    A+STEF+  T  P+I +L  + + ++ GGT+RLG+Y C+L  G+     YK++ + ERHRHRYE N  Y       G VFSG   +  LVEIIEL  H +F+A QFHPEF S+   P+P+F  F+  ++K
  S:     3 KFVFVTGGVVSSLGKGITAASLGRLLKSRGLKVAIQKLDPYINVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDINISRSCNVTTGGIYAAVINKERRGEYLGGTVQVIPHITNEIKERVLSVADDSLADVVITEIGGTVGDIESQPFLEAIRQLKGDLGRGNVVYIHVTLVPYLRAANELKTKPTQHSVKELRSMGIKPDIIVCRSELPLSKEMEEKLALFCDVEKEAVIQALDAPSIYEVPLMLEEEGLADIVLDKLGIKTGPPDLA--DWREMVERMKN-LRYLTTIALVGKYVSLQDAYLSVAEALRHAGFYHGSAIEIKWINSEEVNCANTEDLLGSADGILVPGGFGDRGIEGKIEAIRFARERGIPFFGLCLGMQLAVVEFSRNVIGWRGANSTEFDPYTPYPVIDLLPEQRQLSDKGGTMRLGSYPCKLVPGTLAYRAYKKEIVEERHRHRYELNNAYRADLAAKGLVFSGTLPDGYLVEIIELPGHPWFLATQFHPEFKSRPNRPHPLFRDFIGAARK 530
>gi|46908730|ref|YP_015119.1| CTP synthetase [Listeria monocytogenes str. 4b F2365] >gi|47093567|ref|ZP_00231326.1| CTP synthase [Listeria monocytogenes str. 4b H7858] >gi|153168707|ref|ZP_01928484.1| CTP synthase [Listeria monocytogenes FSL N1-017] >gi|153204155|ref|ZP_01944992.1| CTP synthase [Listeria monocytogenes HPB2262] >gi|67460835|sp|Q71WM0|PYRG_LISMF CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|46882002|gb|AAT05296.1| CTP synthase [Listeria monocytogenes str. 4b F2365] >gi|47018038|gb|EAL08812.1| CTP synthase [Listeria monocytogenes str. 4b H7858] >gi|133726097|gb|EBA27795.1| CTP synthase [Listeria monocytogenes FSL N1-017] >gi|133734282|gb|EBA35980.1| CTP synthase [Listeria monocytogenes HPB2262] (532 aa)
Score = 1235, Expect = 1.5e-133, Identities = 243/527 (46%), Positives = 346/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ+++   ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+A Q+HPEF S+   P  +F  F+  +
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKSDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETKHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELADHPWFVACQYHPEFISRPNRPQSLFKDFVGAA 528
>gi|183221032|ref|YP_001839028.1| CTP synthase (UTP--ammonia ligase; CTP synthetase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] >gi|189911126|ref|YP_001962681.1| CTP synthase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167775802|gb|ABZ94103.1| CTP synthase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] >gi|167779454|gb|ABZ97752.1| CTP synthase (UTP--ammonia ligase; CTP synthetase) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] (540 aa)
Score = 1234, Expect = 1.9e-133, Identities = 244/530 (46%), Positives = 343/530 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLK-HIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           KT+ + +TGGV SSLGKGV  ++LG +L+  G  V + K DPY+N+D GTM+P QHGEV+VT DG ETDLD+G YERF      ++++V+ G++Y+  I +ER G +LG T+QVVPHIT  I  +I  L+   + DF+IVE+GGTVGDIESIPFLEA RQ++ ++   QV+F+H   +  +    + KTKP QHSVK+L++ GI P++L+ R    +S ++K KISL   ++ +N+ S +++   IY +P      K+   + N   M++  ++ +  W+     I+  KK   ++A++GKY    DAY S+  SL         ++S+  IN   ++  NI EL +    +LVPGGFG+R IEGKI AIQYAR  NIPFFGICLGMQ A IEFARNVL   DA+STEF  N   P+I+++E +     +GGT+RLG Y C +K GS     YK   I ERHRHR+EF  +Y D FEK G   +G + + +L EI+E+ NH +FI VQFHPEF SK   P+P+F  F+  + K
  S:     3 KTRYIFITGGVSSSLGKGVTVAALGCLLEARGYTVSLQKMDPYINIDPGTMSPYQHGEVYVTEDGAETDLDLGYYERFTKSKFSRKNSVSTGQIYHAVIERERKGDYLGRTVQVVPHITNEIRSRIYNLTRDQETDFVIVEIGGTVGDIESIPFLEAIRQMRYEHGNQQVLFLHLTLVPTITAAGEAKTKPTQHSVKELLALGIQPDVLICRINKPMSKEMKNKISLFCNVKEQNVISAVDITTSIYEIPLMYREDKLDEVVLNALGMDL-RKLNFSQWENMVKKIRNTKK-TVKVALIGKYISLQDAYRSVYESLAHGGIANDVEVSVVKINPEDIDSKNIKELLKGVHGVLVPGGFGERGIEGKIAAIQYARTKNIPFFGICLGMQCAVIEFARNVLGFKDANSTEFKPNVQYPVISMIEEQKEIERMGGTMRLGAYPCLVKKGSLAHSEYKSDRISERHRHRFEFTLRYKDDFEKKGMNLTGFSPDGSLAEIVEIPNHPWFIGVQFHPEFQSKPTDPHPLFAGFIKAASK 533
>gi|86135687|ref|ZP_01054268.1| CTP synthetase [Tenacibaculum sp. MED152] >gi|85819860|gb|EAQ41017.1| CTP synthetase [Polaribacter dokdonensis MED152] (537 aa)
Score = 1234, Expect = 1.9e-133, Identities = 238/529 (44%), Positives = 353/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQ-LQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SL  +L+  G  V I K DPY+N+D GT+ P +HGE +VT DG ETDLD+G+YER+LNI   + +NVT GR+Y   I KER G+FLG T+QV+PHIT+ I ++I LL    + D +I E+GGTVGDIES+P++E+ RQ L  K     + IH   +  L    +LKTKP QHSVK LM +G+ P++L+ R++  +S+ +K K++L   ++ E++   I+ + IY +P  + N+ +   + N  ++E   +   K W++F    K PK  +  I ++GKY +  D+Y SI  +   +    +T + + +I+S SL+  ++ + L+  + ILV  GFG R IEGKI A++YARENNIPFFGICLGMQ++ IEFARNVL +  A S+E N++  +P+I +++ +   TN GGT+RLG ++CE+K GSK+ + Y+ + I ERHRHRYEFN  Y++  E  G   +GIN +  LVE++ELENH +F+ VQ+HPE+ S +L P+P+F  F+  + K
  S:     4 TKYVFVTGGVTSSLGKGIIAASLAKLLQERGFSVTIQKLDPYINIDPGTLNPYEHGECYVTDDGAETDLDLGHYERYLNIPTSQANNVTTGRIYQSVINKERKGEFLGKTVQVIPHITDEIKRRIQLLGETGEYDIVITEIGGTVGDIESLPYVESVRQMLWEKGEENAIVIHLTLVPYLAAAGELKTKPTQHSVKMLMQSGVSPDILVCRTEHEISDDIKRKLALFCNVKKEDVIQSIDAETIYDVPNLMLNEGLDEVVLNKLQLESKKKPALKTWNSFLQKHKNPKS-EVEIGLIGKYIELQDSYKSITEAFIHAGSSNETKVKVRWIHSESLSPKSVEKKLAGLNGILVAPGFGDRGIEGKIKAVKYARENNIPFFGICLGMQMSVIEFARNVLNLEGASSSEMNKSAKHPVINLMDSQKNVTNKGGTMRLGAWDCEIKKGSKVYDAYQSELISERHRHRYEFNNTYLEQMESAGLKATGINPKTGLVEVVELENHPWFVGVQYHPEYKSTVLKPHPLFVDFIKAALK 533
>gi|153198327|ref|ZP_01942415.1| CTP synthase [Listeria monocytogenes 10403S] >gi|127632076|gb|EBA21790.1| CTP synthase [Listeria monocytogenes 10403S] (532 aa)
Score = 1234, Expect = 2.1e-133, Identities = 244/529 (46%), Positives = 347/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ+++   ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+A Q+HPEF S+   P  +F  F+  + K
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKSDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETNHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELIDHPWFVACQYHPEFISRPNRPQSLFKDFVGAALK 530
>gi|153186284|ref|ZP_01936641.1| CTP synthase [Listeria monocytogenes J0161] >gi|126941292|gb|EBA19182.1| CTP synthase [Listeria monocytogenes J0161] (531 aa)
Score = 1233, Expect = 2.5e-133, Identities = 244/529 (46%), Positives = 346/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ++    ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+A Q+HPEF S+   P  +F  F+  + K
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKGDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETNHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELIDHPWFVACQYHPEFISRPNRPQSLFKDFVGAALK 530
>gi|16804597|ref|NP_466082.1| CTP synthetase [Listeria monocytogenes EGD-e] >gi|47097102|ref|ZP_00234671.1| CTP synthase [Listeria monocytogenes str. 1/2a F6854] >gi|153175829|ref|ZP_01931116.1| CTP synthase [Listeria monocytogenes FSL N3-165] >gi|153180671|ref|ZP_01933688.1| CTP synthase [Listeria monocytogenes F6900] >gi|153192239|ref|ZP_01939259.1| CTP synthase [Listeria monocytogenes J2818] >gi|24212132|sp|Q8Y495|PYRG_LISMO CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|16412047|emb|CAD00637.1| pyrG [Listeria monocytogenes] >gi|47014507|gb|EAL05471.1| CTP synthase [Listeria monocytogenes str. 1/2a F6854] >gi|127764299|gb|EBA24838.1| CTP synthase [Listeria monocytogenes J2818] >gi|133729042|gb|EBA30740.1| CTP synthase [Listeria monocytogenes FSL N3-165] >gi|133731804|gb|EBA33502.1| CTP synthase [Listeria monocytogenes F6900] (532 aa)
Score = 1232, Expect = 2.9e-133, Identities = 244/529 (46%), Positives = 346/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ++    ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+A Q+HPEF S+   P  +F  F+  + K
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKGDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETNHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELIDHPWFVACQYHPEFISRPNRPQSLFKDFVGAALK 530
>gi|126667575|ref|ZP_01738545.1| CTP synthetase [Marinobacter sp. ELB17] >gi|126628001|gb|EAZ98628.1| CTP synthetase [Marinobacter sp. ELB17] (542 aa)
Score = 1232, Expect = 2.9e-133, Identities = 239/527 (45%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N TAGRVY E I KER G +LG T+QV+PHIT+ I +++I        D  +VEVGGTVGDIES+PFLEA RQL+ +   S+ +F+H   +  + T  ++KTKP QHSVK++ S G+ P++LL RS   V    + KI+L T +E   +  + + K IY++P  L +  +   +   F ++         WD     +  P +++  IA+VGKY +  +AY S+I SL  +    +T ++I +I+S  +  +    L   DAILVPGGFG+R +EGKI  +QYAREN +P+ GICLGMQ+A IE+ARN+  + DA STEF  ++  P++ ++          E +  +++LGGT+RLG  +C L +GS I   Y RK+I ERHRHRYE N  ++   E+ G   SG + +  LVE++E+E+H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIRTPMTRRNNFTAGRVYEEVIRKERRGDYLGGTVQVIPHITDEIKRRVI--EGAAGVDVALVEVGGTVGDIESLPFLEACRQLKVEVGSSRALFMHLTLVPYIATAGEIKTKPTQHSVKEMRSIGLQPDILLCRSDHEVDASSRRKIALFTNVEERAVIPMRDAKSIYVIPRMLHDHGLDQLVIEHFNLDA-READLSEWDNVVESLMNP-QHEVTIAMVGKYMELLEAYKSLIESLLHAGIKTRTKVNINYIDSEDIERDGTGVLENVDAILVPGGFGERGVEGKIRTVQYARENKVPYLGICLGMQVAVIEYARNMAGLTDAHSTEFRPHSPEPVVGLITEWLDASGEREERTGDSDLGGTMRLGGQDCVLAEGSNIANCYGRKTIRERHRHRYEVNNHFLPRLEEAGLKVSGRSTDGKLVEVVEVEDHPWFVACQFHPEFTSTPRDGHPLFKGFVEAA 535
>gi|39996993|ref|NP_952944.1| CTP synthetase [Geobacter sulfurreducens PCA] >gi|81702145|sp|Q74BY3|PYRG_GEOSL CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|39983881|gb|AAR35271.1| CTP synthase [Geobacter sulfurreducens PCA] (536 aa)
Score = 1232, Expect = 3.1e-133, Identities = 241/525 (45%), Positives = 340/525 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQA-KYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           KTK + VTGGV SS+GKG+A +SLGA+L+  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L K SN T G+VY+  I KER G +LG T+QV+PHIT+ I  KI  L N    D  IVEVGGTVGDIES+PFLEA RQ +A +    V++IH   +  + T  +LKTKP QHSVK+L   GI P++L+ R +  +   +K KI+L   +E + + +  + +HIY +P +L  + +   +     +  + P+      W +    ++ P + + RIA+VGKY +  ++Y S+  +L          + + +++S  +    I S   + DAILVPGGFG+R  EGKI AI+YAR   IPFFGICLGMQ+A +E+ARNV  + DA S+EF  + ANP+I+++E +     LGGT+RLG Y C L  G+   + Y    I ERHRHRYE+N  + +    +G V SG+ KE +LVEI+E+ +H +F+  QFHPEF SK L+P+P+F +F+
  S:     2 KTKFIFVTGGVVSSIGKGLASASLGALLESRGLRVTMQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSARLSKRSNFTTGQVYFSVIEKERRGDYLGGTVQVIPHITDEIKHKI--LENAKGADVAIVEVGGTVGDIESLPFLEAIRQFKADRGAGNVLYIHVTLVPHIKTAGELKTKPTQHSVKELREIGIQPDILICRCEMELPRDMKAKIALFCNVEEKAVITSTDAEHIYAVPLALHKEGLDEQVVEKLNIWTKAPD---LSPWHSVVEKLRSPLRGEVRIAIVGKYVNLTESYKSLSEALTHGGIANDCRVVLTYLDSERIESEGIGSSFDDIDAILVPGGFGERGTEGKIKAIEYARTQKIPFFGICLGMQMAVVEYARNVCGLEDACSSEFRPDCANPVISLMEEQRDIDRLGGTMRLGAYPCSLTKGTFAQKAYGSLEISERHRHRYEYNNAFRETLVANGLVVSGLYKEGDLVEIVEVADHPWFLGCQFHPEFKSKPLNPHPLFRAFI 525
>gi|170017686|ref|YP_001728605.1| CTP synthase [Leuconostoc citreum KM20] >gi|169804543|gb|ACA83161.1| CTP synthase [Leuconostoc citreum KM20] (539 aa)
Score = 1231, Expect = 3.9e-133, Identities = 245/530 (46%), Positives = 350/530 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKR-KSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           + K + VTGGV SSLGKG+  +SLG +LK  G ++ I K DPY+N+D GTM+P QHGE FVT DG ETDLD+G+YERF++IN    SNVT GR+Y E +AKER G + G T+QV+PHIT+AI  K+   +     D +IVEVGGTVGDIES+PF+EA RQ+++   S  V +IHT  ++ L    + KTKP QHSV  L S GI P+++++R+   + + LK+KIS  T ++ + +    +++ +Y +P +L+ Q + + + N  K++ P +     W      IK PKK    IA+VGKY+D PDAY+S+  +L+ + +   T+++I  I S ++  +N++  L+  D ++VPGGFG+R  EGKI AI+YARE N+PF G+CLGMQLAS+EFAR+VL   DA+STE N  T  PII +++ +    NLGGTLRLG Y   L  G+   + Y     I +RHRHRYEFN K+   FE  G +FS  + +N L+E+IE   + FFIA Q+HPEF S+   P  +++ F+  + K
  S:     5 QVKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKLAIQKLDPYINIDPGTMSPYQHGETFVTGDGLETDLDMGHYERFMDINTNMYSNVTTGRIYSEVLAKERRGDYNGGTVQVIPHITDAIKDKMKKAAESTDADVVIVEVGGTVGDIESLPFIEALRQMKSDLGSDNVFYIHTSLIVYLTAAGEAKTKPTQHSVAQLRSLGIQPDMIVLRTSSPLEDNLKKKISTFTDVDPDAVIESRDVETLYDIPLNLQAQGMDDVVLNKLKVDAP-KADMVAWSEMVENIKHPKK-TVNIALVGKYTDLPDAYISVNEALKHAGYAQNTEVNINHIKSETVTSDNVATLLANADGVMVPGGFGERGTEGKIQAIRYARETNVPFLGVCLGMQLASVEFARHVLGYDDANSTELNPETHAPIIDLMKDQENVENLGGTLRLGLYPAMLTPGTLTAKAYGNVDEIEQRHRHRYEFNTKFRSEFEAAGMIFSATSPDNRLMEVIEYPKNDFFIAAQYHPEFLSRPERPEGLYHDFIGAALK 535
>gi|188159771|ref|ZP_02998876.1| CTP synthetase [Mycoplasma mycoides subsp. mycoides LC str. GM12] (532 aa)
Score = 1231, Expect = 3.9e-133, Identities = 254/523 (48%), Positives = 347/523 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV S LGKG+  SS+GA+LK  G +V + KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  L K S+ T+G++Y   I  ER G   G TIQVVPHIT+AI QK+   + + Q D +I E+GGTVGDIES PF+EA RQ++ +  +  VMF+H V L+ L    + KTKP+Q+SVK + S GI P++++ RS  +    +KEKISL   +   NI   I+   IY +P +L  Q +Q+ I    +++  N I    W  F   I    + +  I+ VGKY +  DAYLS++ SL+I+ +     + I ++ +  L+E+N  E L     ILVPGGFGKR IEG +LA +YAREN+IP+ GICLGMQ+A+I  AR++L   DADSTEFN+NT +PI   ++G +R+ N+GGTLRLG    +L+  S + ++Y     +ERHRHRYEFN +Y    E  G  FSGI +E NLVE++E+ + KFF+A QFHPEFTS+   P P+F  F+
  S:     3 KFIFVTGGVVSGLGKGITASSIGALLKASGLKVFMQKFDPYLNVDPGTMSPYQHGEVFVTKDGGETDLDLGHYERFIDEELTKLSSTTSGKIYLSVIQGERKGVNSGKTIQVVPHITDAIKQKVYQAAEQSQADVIISEIGGTVGDIESQPFIEAIRQIRLEQGKENVMFVHVVLLLWLAASKEYKTKPIQNSVKAMASLGIQPDVIVCRSDSSSPKDIKEKISLFCNVPITNIIDAIDQDSIYRVPLALAKQNIQDIIIEQLQLKAKN-IDLSLWKQFNKKIDSSTE-EIEISFVGKYIELQDAYLSVLESLKIAGWEFNKKIKIRWVQADKLDESNYKEILKNSQGILVPGGFGKRGIEGMMLASRYARENDIPYLGICLGMQIATISIARDLLNWTDADSTEFNKNTTHPIFDYIKGIDRD-NIGGTLRLGTMVTKLEKDSLVSKLYNSDVALERHRHRYEFNNEYKKDLESVGLRFSGIYEEKNLVEVVEMPSLKFFVASQFHPEFTSRPNKPTPLFRGFI 524
>gi|78485606|ref|YP_391531.1| CTP synthetase [Thiomicrospira crunogena XCL-2] >gi|119391200|sp|Q31G66|PYRG_THICR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|78363892|gb|ABB41857.1| CTP synthase [Thiomicrospira crunogena XCL-2] (543 aa)
Score = 1231, Expect = 4.5e-133, Identities = 244/529 (46%), Positives = 349/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+A +SLG++L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+  N  K ++ + G+VY + I  ER G +LG T+QV+PHIT+ I  +I L +     D  +VEVGGTVGDIES+PFLEA RQL  +  R + MF+H   L  +    ++KTKP QHSVK+L S GI P++L+ RS+  +    K KI+L T +E + + + ++ + IY +P  L  Q +   + + F+++ P       WD        P+K    IA+VGKY D  +AY S+I +L       KT ++I +I+S  L ++ I  + + DAILVPGGFG+R +EGKI AIQ+ARENN+P+ GICLGMQ+A +EFAR+V  +  A STE +  T  P++ +          L  ++ + +LGGT+RLG  +C L +GSK+ +IY    I ERHRHRYE N  Y+   E  G   SG +++ NLVE +E+E+H +F+A QFHPEFTS   + +P+F +F+  + +
  S:     2 TKFIFVTGGVVSSLGKGIAAASLGSLLEARGLKVSMLKMDPYINVDPGTMSPLQHGEVFVTDDGAETDLDLGHYERFVQRNFTKRNSFSTGQVYEKVIRNERRGDYLGGTVQVIPHITDEIKHRIKLAAAG--ADVALVEVGGTVGDIESLPFLEAIRQLGVEVGRDRAMFMHLTLLPYIAVAGEVKTKPTQHSVKELRSIGIQPDILICRSERPLEESEKRKIALFTNVEEKAVINSLDARTIYEVPRMLHEQGLDRLVTDRFRIDAP-VADLSDWDDVVQAQLNPEK-SVEIAMVGKYVDLTEAYKSLIEALIHGGIQTKTQVNIHYIDSEDLEKDGIGSIEKMDAILVPGGFGERGVEGKIAAIQFARENNVPYLGICLGMQMAVVEFARHVAGLPSAHSTELDPKTKTPVVALITEWTDENGQLVERDEKADLGGTMRLGGQSCALVEGSKMRDIYGEDVIRERHRHRYEVNDGYIAKLEAAGLKISGRSEDGNLVETVEIEDHPWFVACQFHPEFTSTPRNGHPLFKAFVEAASQ 537
>gi|42520339|ref|NP_966254.1| CTP synthetase [Wolbachia endosymbiont of Drosophila melanogaster] >gi|81652645|sp|Q73HS5|PYRG_WOLPM CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|42410077|gb|AAS14188.1| CTP synthase [Wolbachia endosymbiont of Drosophila melanogaster] (529 aa)
Score = 1231, Expect = 4.6e-133, Identities = 247/528 (46%), Positives = 341/528 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           + K + VTGGV SSLGKG+  SS+GA+L+  G ++ I K DPYLN+D GTM P QHGEVFVT DG ETDLD+G+YERF  I   K+ N+T G++Y+E + KER G +LG T+QV+PH+T+ I  K  + +     DF+I E+GGTVGDIES PFLEA RQ+     + +V+ IH   +  L    +LKTKP QHSV++L SAG+ P+++L RS+  + +  +EKI+    +   N+    ++ HIY LP       +   I   F +  P +     WD     I+ P + +  +++VGKY++ PDAY S++ +L   +   K  + I ++NS    E  I E L    AILVPGGFG   +EGKILAI YAR NNIPFFGICLGMQLA IEFARNV+K+ DA S EF  N  +PI+ +    +++ +LGGT+RLG Y C +   SK+++ Y   +I ERHRHRY  N  Y D  EK+G + SGI+++   +E +ELE+H +FI VQFHPEF SK  SP+P+F SF+  +
  S:     3 EAKFIFVTGGVVSSLGKGLVASSVGALLQAHGFKIRIRKLDPYLNIDPGTMNPTQHGEVFVTEDGAETDLDLGHYERFTGIKATKDDNITTGKIYHELLKKERRGDYLGKTVQVIPHVTDLI--KSFIFNGTEGLDFVICEIGGTVGDIESQPFLEAIRQVNYTLGKQRVILIHLTLIPYLAAAQELKTKPTQHSVRELNSAGLQPDIILCRSEKEIFDNQREKIAKLCNVSLSNVIPAPDVSHIYELPVLYSQCGLDTQILEHFHLSKP-KPSLTEWDQIVHSIRHPTQ-EVTVSIVGKYTEFPDAYKSLVEALNHGAISNKVKVKINWVNSREKEEKPIGEKLQNSHAILVPGGFGDDGVEGKILAINYARTNNIPFFGICLGMQLAIIEFARNVVKLEDAHSEEF-RNCKHPIVKL--AGDQDDDLGGTMRLGAYKCNINANSKMMDAYSNTTISERHRHRYIINSDYKDDLEKNGLLCSGISEDGTCIEAVELESHPWFIGVQFHPEFQSKPFSPHPLFVSFVKAA 525
>gi|53713894|ref|YP_099886.1| CTP synthetase [Bacteroides fragilis YCH46] >gi|60682103|ref|YP_212247.1| CTP synthetase [Bacteroides fragilis NCTC 9343] >gi|81314833|sp|Q5LC42|PYRG_BACFN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|81382248|sp|Q64T27|PYRG_BACFR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|52216759|dbj|BAD49352.1| CTP synthase [Bacteroides fragilis YCH46] >gi|60493537|emb|CAH08324.1| CTP synthase [Bacteroides fragilis NCTC 9343] (533 aa)
Score = 1231, Expect = 4.6e-133, Identities = 241/528 (45%), Positives = 343/528 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G +V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQV+PHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L S G+ P++L++R++  ++  L++K++L   +    +   I+   IY +P  ++ Q +  +I     + V  R     W  F +  +        IA+VGKY +  DAY SI+ SL  ++ Y    + IE+++S  L  +N+ E L   + +++  GFG R IEGK +A +Y RE+NIP FGICLGMQ  +IEFARNVL   DA+S E +E T + +I I+E +   TN+GGT+RLG Y C LK  SK+ E YK + I ERHRHRYEFN  Y   FE+ G    GIN E++LVEI+E+   K++I  QFHPE++S +L P+P+F SF+  +
  S:     3 ETKYIFVTGGVASSLGKGIISSSIGKLLQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPYLESIRQLKWELGQNALCVHLTYVPFLSAAQELKTKPTQHSVKELQSLGVQPDILVLRTEHDLNTNLRKKVALFCNVAENAVVQSIDASTIYEVPLLMQEQGLDETILQKMGLPVGERPPLGPWKDFLNR-RANATETVTIAMVGKYVELQDAYKSILESLSQAATYNDRKVKIEYVSSEHLTPDNVDEQLGHVNGVVICPGFGSRGIEGKFVAAKYTREHNIPTFGICLGMQCMAIEFARNVLGYADANSIEMDEKTKHNVIDIMEEQKAITNMGGTMRLGAYECVLKKDSKVYEAYKEEHIQERHRHRYEFNNDYRKQFEEAGMKCVGINPESDLVEIVEIPTLKWYIGTQFHPEYSSTVLHPHPLFVSFIKAA 530
>gi|161506826|ref|YP_001576780.1| CTP synthetase [Lactobacillus helveticus DPC 4571] >gi|160347815|gb|ABX26489.1| Cytidine triphosphate synthase [Lactobacillus helveticus DPC 4571] (539 aa)
Score = 1230, Expect = 5.1e-133, Identities = 242/527 (45%), Positives = 349/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPN-RIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  SSLG +LK  G +V + KFDPY+N+D GTM+P QHGEV+VT DG E DLD+G+YER +++   K SNVT G++Y E + KER G + GAT+QV+PHIT+ I +KI+  +     D +I E+GGTVGD+ES PF+EA RQ++ +     VM+IH   +  L    ++KTKP QHSV +L S GI PN+L++R++  +  + K KIS  T +  + I   I+   ++ +P + + Q +   + +F  ++ P      + W       K   K+  +I +VGKY +  DAY+S+  +L+ + +   T + ++ + +  + E+NI+++ E  D ++VPGGFG R +EG I AI+YAREN+IPF GICLGMQ+AS+EFAR++L + DA++TE   +  N II I+  K  E N+GGTLRLG Y   LK G+K  E Y  + ++ ERHRHR+EFN KY + FEK G VFSG++ +N+LVEIIEL   KFFIA Q+HPEF S+   P  +F SF+  +
  S:     2 TKYIFVTGGVVSSLGKGITASSLGRLLKNRGLKVTMQKFDPYINIDPGTMSPYQHGEVYVTEDGTEADLDLGHYERIVDVRTSKYSNVTTGKIYQEVLEKERRGDYNGATVQVIPHITDMIKKKIMRAALTTDSDVIISEIGGTVGDMESTPFMEAIRQMRREVGEENVMYIHCTLVPLLHAAHEMKTKPTQHSVAELRSIGIQPNMLVLRAEQPIDQEHKNKISTFTDVPVDRIIESIDAPSLFDVPLAFQKQGMDQKVCDFLHIDSPKPEADMEAWKKLDDRAKN-LKHHTKITLVGKYVELEDAYISVTDALQHAGYLYNTKIDVDKVQAEDITEDNIAKIMEGSDGLIVPGGFGTRGLEGMITAIKYARENDIPFLGICLGMQMASVEFARDILNLEDANTTEAEPHCKNNIIDIMADKRDEENIGGTLRLGLYPAALKKGTKTREAYGDQDVIQERHRHRFEFNNKYREAFEKAGMVFSGVSPDNHLVEIIELPKKKFFIAAQYHPEFLSRPQRPEGLFKSFIGAA 531
>gi|149377459|ref|ZP_01895201.1| CTP synthetase [Marinobacter algicola DG893] >gi|149358226|gb|EDM46706.1| CTP synthetase [Marinobacter algicola DG893] (542 aa)
Score = 1230, Expect = 5.8e-133, Identities = 240/527 (45%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY E I KER G +LG T+QV+PHIT+ I ++++        D  ++E+GGTVGDIES+PFLEA RQL+ +   Q  +F+H   +  + T  ++KTKP QHSVK++ S G+ P++LL RS+  V    + KI+L T +E   +  L + K IY +P  L    +   +   F +E  P  +G   WD     +  P +++  IA+VGKY +  DAY S+I SL  +    +T + + +I+S  +  +    L+  DAILVPGGFG+R +EGKI  +QYAREN +P+ GICLGMQ+A IE+ARNV  + DA STEF E+T  P++ ++          E +  E++LGGT+RLG  +C + +GS I   Y RK+I ERHRHR+E N  ++   E  G   SG + +  LVE++E+ +H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIRTPMSRRNNFTTGRVYEEVIRKERRGDYLGGTVQVIPHITDEIKRRVV--EGASGADVALIEIGGTVGDIESLPFLEACRQLKVEVGPQRALFMHLTLVPYIATAGEIKTKPTQHSVKEMRSIGLQPDILLCRSEHEVDASSRRKIALFTNVEERAVIPLQDAKSIYAIPRMLHEFGLDQLVIERFSLEASPANLG--EWDAVVESLMNP-EHEITIAMVGKYMELLDAYKSLIESLLHAGIKTRTKVRMNYIDSEDIERDGTGALASADAILVPGGFGERGVEGKIRTVQYARENKVPYLGICLGMQVAVIEYARNVAGLKDAHSTEFREHTPEPVVGLITEWLDASGEKEERTEESDLGGTMRLGAQDCVVAEGSTIANCYGRKTIRERHRHRFEVNNHFLPQLEGAGLRISGRSTDGKLVEVVEVPDHPWFVACQFHPEFTSTPRDGHPLFKGFVEAA 535
>gi|160890336|ref|ZP_02071339.1| hypothetical protein BACUNI_02777 [Bacteroides uniformis ATCC 8492] >gi|156860068|gb|EDO53499.1| hypothetical protein BACUNI_02777 [Bacteroides uniformis ATCC 8492] (539 aa)
Score = 1230, Expect = 5.8e-133, Identities = 242/528 (45%), Positives = 349/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKAR------IAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G +V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQV+PHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L SAGI P++L++R++  +S  L++K++L   ++   +   I+   IY +P  +++Q +  +I     + V +  G   W  F       +++KA       IA+VGKY D  DAY SI  +L  +  Y    +S++F+NS  L + N++E L     +L+  GFG+R + GK +AI+YAR ++IP FGICLGMQ  +IEFARNVL   DA+S E +E T + +I I+E +   TN+GGT+RLG Y C L+ GSK  E Y  + I ERHRHRYEFN  + + +E  G    GIN E++LVEI+E+   K+F+  QFHPE++S +L P+P+F +F+  +
  S:     3 ETKYIFVTGGVASSLGKGIISSSIGKLLQARGYKVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPYLESIRQLKWELGKDALCVHLTYVPYLAAAGELKTKPTQHSVKELQSAGIQPDVLVLRTEHELSTTLRKKVALFCNVDENAVVQSIDAPTIYEVPILMQSQGLDVTILKKMGLPVGDTPGLGPWRAFLE-----RRHKAEETAPLHIALVGKY-DLQDAYKSIREALSQAGTYNDRKVSVDFVNSEKLTDENVAEALKGMAGVLIGPGFGERGVAGKFVAIKYARTHDIPTFGICLGMQCIAIEFARNVLGYADANSREMDEKTPHNVIDIMEEQKSITNMGGTMRLGAYECVLQKGSKAYEAYGTEHIQERHRHRYEFNNSFKEAYEAAGMKCVGINPESDLVEIVEIPALKWFVGTQFHPEYSSTVLHPHPLFVAFVKAA 531
>gi|95928730|ref|ZP_01311476.1| CTP synthase [Desulfuromonas acetoxidans DSM 684] >gi|95135075|gb|EAT16728.1| CTP synthase [Desulfuromonas acetoxidans DSM 684] (534 aa)
Score = 1229, Expect = 8.1e-133, Identities = 241/525 (45%), Positives = 337/525 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           KTK L VTGGV SSLGKG+A +S+GA+++  G  + + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L ++SN T G+VY   I KER G +LG T+QV+PHIT  I  KII   N    D  IVEVGGTVGDIES+PFLEA RQ +       V+++H   +  L    +LKTKP QHSVK+L   GI P++LL R    +   +K KI+L   +  +++ +  ++  IY +P     Q +   + +   +  + P+      W      +K+P   +  IA+VGKY +  ++Y S+  +L          +++++++S SL  + + +  ++ D ILVPGGFG+R  EGK  AI++ARENN+PFFGICLGMQ+A +EFARNV K+ DA S EF E   NP+I I+E +      GGT+RLG Y+CEL +GS    IY +K I ERHRHRYEFN  +     + G   SG+N + +LVEI+E+ NH +F+A QFHPEF S+ + P+P+F SF+
  S:     2 KTKFLFVTGGVVSSLGKGLAAASIGALMEARGLRISMQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSARLSRKSNFTTGQVYDAVIRKERRGDYLGGTVQVIPHITNEIKSKII--ENAQDVDLAIVEVGGTVGDIESLPFLEAIRQFRTDLGHENVLYVHLTLVPYLAAAGELKTKPTQHSVKELREIGIQPDILLCRCDREIPRDMKSKIALFCNVREDSVITARDVGSIYEVPVIYHEQGLDERVVDGLGIWTKAPD---LAPWQNVVRRVKDPAS-QTTIAIVGKYVELTESYKSLSEALIHGGIANDCRVNLKYVDSESLERHGLGDTFADVDGILVPGGFGERGSEGKTAAIRFARENNVPFFGICLGMQMAVVEFARNVCKLPDAYSAEFREEAENPVIHIMEEQKEIATKGGTMRLGAYDCELTEGSLAQRIYGQKCISERHRHRYEFNNGFRQTLSECGLEISGVNPDADLVEIVEISNHPWFLACQFHPEFRSRPMDPHPLFESFV 524
>gi|90020890|ref|YP_526717.1| CTP synthetase [Saccharophagus degradans 2-40] >gi|119391170|sp|Q21LC4|PYRG_SACD2 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|89950490|gb|ABD80505.1| CTP synthase [Saccharophagus degradans 2-40] (543 aa)
Score = 1228, Expect = 8.5e-133, Identities = 243/527 (46%), Positives = 350/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T GRVY   + KER G +LG T+QV+PHIT+ I ++I  L+     D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++LL RS+  +    + KISL T +E   +  L + K IYL+P  L++  +   + + F +E         WD      + P ++   IA+VGKY D  DAY S+  +L  +  +  T + I +IN+  +    +S L + DAILVPGGFG+R +EGK++A++YAREN +P+ GICLGMQ A IEFARNVLK+  A+STEF+  +  P+I ++          E ++  ++LGGT+RLG   C L++ S+I EIY + +I+ERHRHR+E N +++D   + G    G + ++ LVE++E+ +H +F+A QFHPEFTS     +P+F S++  +
  S:     2 TRFIFVTGGVVSSLGKGIASASLAAVLEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIRTRMTKRNNFTTGRVYETVLRKERRGDYLGGTVQVIPHITDEIKRRI--LAGGDGVDIALVEIGGTVGDIESQPFLEAVRQLKVELGNQRALLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDILLCRSEKEIDVDSRRKISLFTNVEERAVVPLPDAKSIYLIPRLLQSYNLDQIVLDKFGLEAA-ETDLAEWDEVVRREQNP-EHAVTIAMVGKYMDLLDAYKSLNEALLHAGLHTLTKVKINYINAEDVETQGVSILEDADAILVPGGFGERGLEGKLMAVRYARENKVPYLGICLGMQTAVIEFARNVLKLDGANSTEFDRKSPFPVIGLITEWINEEGKVETRDESSDLGGTMRLGAQECHLEENSRIREIYGKANIIERHRHRFEVNNRFLDQLRQGGLRIGGWSSDDTLVEVVEVPDHPWFVACQFHPEFTSTPRDGHPLFTSYIQAA 535
>gi|134301012|ref|YP_001114508.1| CTP synthetase [Desulfotomaculum reducens MI-1] >gi|134053712|gb|ABO51683.1| CTP synthase [Desulfotomaculum reducens MI-1] (533 aa)
Score = 1228, Expect = 9.3e-133, Identities = 242/526 (46%), Positives = 334/526 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+  +SLG +LK  G +V I K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL K SNVT G +Y+  I KER G +LG T+QV+PHIT  I  +++ ++ +   D +I E+GGTVGDIES+PFLEA RQL+A   R  VM++H   +  L   ++ KTKP QHSVK+L S GI P++++ R++     +++EK++L   I+ + +   ++   IY +P  +E + + +       ++         W+     +K  KK    IA+VGKY   PDAYLS+  +L  +  +    + I ++NS  L +   +E L   D ILVPGGFG R IEGKI AIQYAREN IPF GICLGMQLA +EFAR+VL   DA+S EFN +   P+I +L  +     +GGT+RLG Y C+L  G+     Y  + I ERHRHRYE N  +     + G +FSG      LVEI+EL++H +++A QFHPEF S+   P+P+F  F+  S
  S:     3 KFIFVTGGVVSSLGKGITAASLGRLLKSRGLKVAIQKLDPYINVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDTNLNKTSNVTTGGIYWSVINKERRGDYLGGTVQVIPHITNEIKDRVLRMARELDADVVISEIGGTVGDIESLPFLEAIRQLRADLGRDNVMYVHVTLVPYLRVANEFKTKPTQHSVKELRSLGIQPDVIVCRTEKPFPKEMEEKLALFCDIDKDAVIQAVDAFSIYEVPLQMELEGLDDIAVERLSLQC-GETDMTEWNNMVERMKNLKK-STTIALVGKYVALPDAYLSVAEALRHAGLHHDASVEICWVNSEDLEKLPAAEILKGVDGILVPGGFGDRGIEGKIKAIQYARENKIPFLGICLGMQLAVVEFARSVLGWQDANSAEFNPHCQYPVIDLLPEQKDLDKMGGTMRLGAYPCKLAPGTAAHNAYGEEIIYERHRHRYELNNDFRKDLAQAGMIFSGTLPNGKLVEIVELQDHPWYLATQFHPEFKSRPNRPHPVFKDFVGAS 528
>gi|116628901|ref|YP_814073.1| CTP synthetase [Lactobacillus gasseri ATCC 33323] >gi|116094483|gb|ABJ59635.1| CTP synthase [Lactobacillus gasseri ATCC 33323] (554 aa)
Score = 1227, Expect = 1.2e-132, Identities = 244/527 (46%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPN-RIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG++ SSLG +LK  G +V + KFDPY+N+D GTM P QHGEV+VT DG E DLD+G+YER +++   K SNVT G++Y E + KER G + GAT+QV+PHIT+ I +KI+  +     D +I E+GGTVGDIES PF+EA RQ++ +     VM+IH   +  L    ++KTKP QHSV +L S GI PN+L++R++  V   LK KIS  T +  + I   I+   ++ LP + + Q +   + +F  +E P      + W       K   K++  I +VGKY +  DAY+S+  +L+ + +   T + +  + +  + E+NI+E+ +  D ++VPGGFG R +EG I +I+YARE++IPF GICLGMQ+AS+EFAR+VL + DA+S E +  T N II I+  K  E N+GGTLRLG Y   LK G+K    Y  + ++ ERHRHRYEFN  Y + FEK G VFSG++ +N+LVEIIE+ + KFFIA Q+HPEF S+   P  +F +F+  +
  S:    16 TKYIFVTGGVVSSLGKGISASSLGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVYVTDDGTEADLDLGHYERIVDVRTSKYSNVTTGKIYQEVLDKERRGDYHGATVQVIPHITDMIKKKIMRAALTTDSDVIISEIGGTVGDIESTPFMEAIRQMRREVGEENVMYIHCTLVPYLHAAHEMKTKPTQHSVAELRSIGIQPNMLVLRAEKPVPQDLKNKISTFTDVPVDRIIESIDAPSLFDLPLAFQAQGMDQKVCDFLHLESPKPEADMEAWKKLDERAKN-LKHETTITLVGKYVELEDAYISVTDALQHAGYLYDTKIKVNKVQAEDITEDNIAEIMKGSDGLIVPGGFGTRGLEGMITSIKYAREHDIPFLGICLGMQMASVEFARDVLGLKDANSAEADPETKNNIIDIMADKRDEENIGGTLRLGLYPATLKKGTKTRAAYDDQDVIQERHRHRYEFNNDYREAFEKAGMVFSGVSPDNHLVEIIEIPDKKFFIAAQYHPEFLSRPQRPEGLFKAFIGAA 545
>gi|94986894|ref|YP_594827.1| CTP synthetase [Lawsonia intracellularis PHE/MN1-00] >gi|119391121|sp|Q1MR71|PYRG_LAWIP CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|94731143|emb|CAJ54505.1| CTP synthase (UTP-ammonia lyase) [Lawsonia intracellularis PHE/MN1-00] (550 aa)
Score = 1227, Expect = 1.3e-132, Identities = 248/528 (46%), Positives = 348/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLS----NKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL-----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + +TGGV SSLGKG++ +S+GA+L   G  V I K DPY+N+D GTM P QHGEV+VT DG E DLD+G+YERFL  +L +++N T+G +YY+ I+KER G +LGAT+QV+PHIT+ I   I+ L+    +   PD  I+E+GGT+GDIE +PFLEA RQLQ    R   ++IH   +  L T  + KTKP QHSVK+L S GI PN++L R +  + + +K KISL   +E + ++S  ++ +IY LP     + +   I +F  +    +   K W+   + I  PK  K  I +VGKY    +AY S+  +L       +  + ++++NS  + E+N++E+ +  D ILVPGGFG R IEGKI +I+YAR+ NIPFFGICLGMQ A IEFARNV  +  A+S EFN   A+ +I ++           E ++   + GGT+RLG+Y C L   +K  + Y+  SI ERHRHRYEFN  Y D F + G +FSG + +N LVEIIEL NH +FI  QFHPEF S  + P+P+F  F++ +
  S:     2 KTKFIFITGGVLSSLGKGLSAASIGALLTSRGMTVTIQKLDPYINIDPGTMNPYQHGEVYVTDDGAEADLDLGHYERFLGTSLSQKNNSTSGAIYYKVISKERRGDYLGATVQVIPHITDEIKSTILSLAKSSIDNNTPDIAIIEIGGTIGDIEGLPFLEAIRQLQTDLGRQNCLYIHLTLVPYLGTAGEHKTKPTQHSVKELRSIGIQPNIILCRCEKPIPDDIKAKISLFCDVEKDAVFSAADINNIYELPLKFYTEGLDQKITSFLNLPT-KQANLKPWEQLVNTINNPKG-KVTITIVGKYVGLTEAYKSLHEALCHGGIANEITVDLQYVNSEIITEDNVNEIFKGVDGILVPGGFGSRGIEGKIESIRYARQKNIPFFGICLGMQCAVIEFARNVAGIEKANSEEFNPVAADKVIYLMKEWYDFRNNAIEYRDSLCDKGGTMRLGSYPCTLIKNTKAFKAYQTDSIEERHRHRYEFNNIYRDQFAEKGMIFSGTSPDNTLVEIIELLNHPWFIGCQFHPEFKSYPMKPHPLFKDFIHAA 544
>gi|58698582|ref|ZP_00373481.1| CTP synthase [Wolbachia endosymbiont of Drosophila ananassae] >gi|58534907|gb|EAL59007.1| CTP synthase [Wolbachia endosymbiont of Drosophila ananassae] (534 aa)
Score = 1226, Expect = 1.6e-132, Identities = 247/528 (46%), Positives = 342/528 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE------LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           + K + VTGGV SSLGKG+  SS+GA+L+  G ++ I K DPYLN+D GTM P QHGEVFVT DG ETDLD+G+YERF  I   K+ N+T G++Y+E + KER G +LG T+QV+PH+T+ I  K  + +     DF+I E+GGTVGDIES PFLEA RQ+     + +V+ IH   +  L    +LKTKP QHSV++L SAG+ P+++L RS+  + +  +EKI+    +   N+    ++ HIY LP       +   I   F +  P +     WD     I+ P + +  +++VGKY++ PDAY S++ +L   +   K  + I ++NS    E  I+E      L    AILVPGGFG   +EGKILAI YAR NNIPFFGICLGMQLA IEFARNV+K+ DA S EF  N  +PI+ +    +++ +LGGT+RLG Y C +   SK+++ Y   +I ERHRHRY  N  Y D  EK+G + SGI+++   +E +ELE+H +FI VQFHPEF SK  SP+P+F SF+  +
  S:     3 EAKFIFVTGGVVSSLGKGLVASSVGALLQAHGFKIRIRKLDPYLNIDPGTMNPTQHGEVFVTEDGAETDLDLGHYERFTGIKATKDDNITTGKIYHELLKKERRGDYLGKTVQVIPHVTDLI--KSFIFNGTEGLDFVICEIGGTVGDIESQPFLEAIRQVNYTLGKQRVILIHLTLIPYLTAAQELKTKPTQHSVRELNSAGLQPDIILCRSEKEIFDNQREKIAKLCNVSLSNVIPAPDVSHIYELPVLYSQCGLDTQILEHFHLSKP-KPSLTEWDQIVHSIRHPTQ-EVTVSIVGKYTEFPDAYKSLVEALNHGAISNKVKVKINWVNSREKEEKPINEKLIGEKLQNSHAILVPGGFGDDGVEGKILAINYARTNNIPFFGICLGMQLAIIEFARNVVKLEDAHSEEF-RNCKHPIVKL--AGDQDDDLGGTMRLGAYKCNINANSKMMDAYSNTTISERHRHRYIINSDYKDDLEKNGLLCSGISEDGTCIEAVELESHPWFIGVQFHPEFQSKPFSPHPLFVSFIEAA 530
>gi|169350667|ref|ZP_02867605.1| hypothetical protein CLOSPI_01440 [Clostridium spiroforme DSM 1552] >gi|169292530|gb|EDS74663.1| hypothetical protein CLOSPI_01440 [Clostridium spiroforme DSM 1552] (536 aa)
Score = 1226, Expect = 1.6e-132, Identities = 249/529 (47%), Positives = 345/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGS-DLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV S LGKG+  +SLG +LK  G +V   K DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++ NL K SN+T G+VY+  + KER GK+LG+T+QV+PHIT  I + +  +      D +I E+GGT GDIES PFLEA RQ+  +  +   +FIH V L+  + GS + K+KP QHSVK+L   GI P+++++R  + +   + +KI+L   ++ EN+   I L ++Y  P  LE       + +   ++ P     K W      IK  + +   I +VGKY    DAYLS++ +L  + +Y  + + I +I+S  +NE N  E L + D I++PGGFG R IEG ILA +YARENN+P+FGICLGMQ+  IE+ARNVL +++ADS EFNEN  + +I  + G+N + + GGTLRLG Y C LK+ S I + Y   +I ERHRHRYEFN  Y D+FEK G V SGI+ +  LVE +EL +  FFI VQFHPEF S+    +P+F  F+  + K
  S:     2 TKYIFVTGGVVSGLGKGITAASLGRLLKARGLKVASQKLDPYINVDPGTMSPYQHGEVYVTEDGTETDLDLGHYERFIDENLDKYSNLTTGKVYWNVLNKERQGKYLGSTVQVIPHITNEIKEFVYNVGKSSNADVVITEIGGTTGDIESQPFLEAIRQISLEVGKDNSIFIH-VTLVPFIKGSNEHKSKPTQHSVKELRGMGINPDIIVLRCDEPLEKSIFQKIALFCNVKLENVIENITLPNLYEAPIMLEQSNFSKVVCDELNLKTPEP-DLKEWQEMVEKIKM-RPFAINIGLVGKYVSLHDAYLSVVEALNHAGYYHNSHVEIHWIDSELINEANYQEKLKDLDGIIIPGGFGDRGIEGMILACKYARENNLPYFGICLGMQITVIEYARNVLGLNEADSREFNENAKDKVIDYMPGQNDDIDKGGTLRLGAYPCILKENSMIKKYYGINNISERHRHRYEFNNDYRDVFEKKGLVLSGISPDGRLVETVELSDKPFFIGVQFHPEFKSRPNRAHPLFVGFIEAALK 530
>gi|187933006|ref|YP_001884689.1| CTP synthase [Clostridium botulinum B str. Eklund 17B] >gi|187721159|gb|ACD22380.1| CTP synthase [Clostridium botulinum B str. Eklund 17B] (533 aa)
Score = 1226, Expect = 1.7e-132, Identities = 246/529 (46%), Positives = 350/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV S+LGKG+  +SLG +LK  G  + I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L + SNVT G++Y   I KER G++LG T+QV+PHIT AI  K+  ++ +   D +I E+GGTVGDIES PFLEA RQ++++  ++ V +IH   +  L    +LKTKP QHSVK+L + GI P++++ R++  +S+ +K KI L   I+ +++   ++  ++Y +P  L  + + N +     +   +   Y+ W      IK  K+ K  IA+VGKY +  DAY+S++ +L    +   T + I ++N+  L +  +SE L+  D ILVPGGFG R IEGKI AI+YARENNIPF GICLGMQ A IE+ARN+L    A+S+E N +T  P+I I+  +    NLGGT+RLG Y C+L  GS   E+YK + + ERHRHRYEFN K+ +   + G   +G + +  LVEI+E+ NH +++AVQFHPE  S+   P+P+F  F+  S K
  S:     3 TKYVFVTGGVVSALGKGITAASLGRLLKNRGLNISIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFVDESLTQNSNVTTGKIYSSVIEKERRGEYLGGTVQVIPHITNAIKDKVYQVAKERDIDVVITEIGGTVGDIESQPFLEAIRQIKSEVGAENVCYIHVTLVPYLGKAGELKTKPTQHSVKELRTIGIQPDIIVCRTEKNLSDDIKAKIGLFCNIDGKSVIQNLDADNLYEVPLMLHEEGLDNLVCEKLHLGCKDIDNYE-WTLMVEKIKSLKE-KVEIALVGKYVELHDAYISVVEALNHGGYANNTKVEIRWVNAEELEQKAVSEVLAGVDGILVPGGFGDRGIEGKISAIKYARENNIPFLGICLGMQCAVIEYARNMLGYDGANSSEINPSTEYPVIDIMNDQKDIENLGGTMRLGQYPCKLDVGSNSYEVYKSELVSERHRHRYEFNNKFREQISESGMKIAGTSPDGRLVEIVEVTNHPWYVAVQFHPELKSRPNKPHPLFTGFIGASIK 531
>gi|42560688|ref|NP_975139.1| CTP synthetase [Mycoplasma mycoides subsp. mycoides SC str. PG1] >gi|81400828|sp|Q6MUA3|PYRG_MYCMS CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|42492184|emb|CAE76781.1| CTP synthase [Mycoplasma mycoides subsp. mycoides SC str. PG1] (532 aa)
Score = 1225, Expect = 1.9e-132, Identities = 253/523 (48%), Positives = 347/523 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV S LGKG+  SS+GA+LK  G +V + KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  L K S+ T+G++Y   I  ER G   G TIQVVPHIT+AI QK+   + + Q D +I E+GGTVGDIES PF+EA RQ++ +  +  VMF+H V L+ L    + KTKP+Q+SVK + S GI P++++ RS  +    +KEKISL   +   NI   I+   IY +P +L  Q +Q+ I    +++  N I    W  F   I    + +  I+ VGKY +  DAYLS++ SL+I+ +     + I ++ +  L+E+N  E L     ILVPGGFGKR IEG +LA +YAREN+IP+ GICLGMQ+A+I  AR++L   DADSTEFN+NT +PI   ++G +R+ N+GGTLRLG    +L+  S + ++Y     +ERHRHRYEFN +Y    E  G  FSGI +E N+VE++E+ + KFF+A QFHPEFTS+   P P+F  F+
  S:     3 KFIFVTGGVVSGLGKGITASSIGALLKASGLKVFMQKFDPYLNVDPGTMSPYQHGEVFVTKDGGETDLDLGHYERFIDEELTKLSSTTSGKIYLSVIQGERKGVNSGKTIQVVPHITDAIKQKVYQAAKQSQADVIISEIGGTVGDIESQPFIEAIRQIRLEQGKENVMFVHVVLLLWLAASKEYKTKPIQNSVKAMASLGIQPDVIVCRSDSSSPKDIKEKISLFCNVPITNIIDAIDQDSIYRVPLALAKQNLQDIIIEQLQLKAKN-IDLSLWKQFNKKIDSSTE-EIEISFVGKYIELQDAYLSVLESLKIAGWEFNKKIKIRWVQADKLDESNYKEVLKNSQGILVPGGFGKRGIEGMMLASRYARENDIPYLGICLGMQIATISIARDLLNWSDADSTEFNKNTTHPIFDYIKGIDRD-NIGGTLRLGTMVTKLEKNSLVSKLYNSDIALERHRHRYEFNNEYKKDLESVGLRFSGIYEEKNIVEVVEMPSLKFFVASQFHPEFTSRPNKPTPLFKGFI 524
>gi|121535671|ref|ZP_01667476.1| CTP synthase [Thermosinus carboxydivorans Nor1] >gi|121305775|gb|EAX46712.1| CTP synthase [Thermosinus carboxydivorans Nor1] (538 aa)
Score = 1225, Expect = 2.1e-132, Identities = 242/526 (46%), Positives = 346/526 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELS----EFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++INL K SNVTAG+VY+  I+KER G +LG+T+QV+PHIT  I ++I  +  +   D +I E+GGTVGDIES+PFLEA RQ++ +  R+ V++IH   +  +    +LKTKP QHSVK+L S GI P++++ R++  +S +LKEK++L   I+   +    N   IY +P  LE + +   +    K+ +P        W      I  P K   RIA+VGKY    DAY+S+  +L  +       + I+++N+  + E + ++L+    + D ILVPGGFG R +EGKI  IQYAREN +PFFG+CLGMQ A IEFARNV  +  A S+EF+ NT +P+I ++  +      GGT+RLG Y C++ +G+   + Y+ + I ERHRHR+EFN  Y  +  +HG V  G      LVEI+E+++H +F+  QFHPEF S+  +P+P+F  F+  +
  S:     3 KYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYINIDPGTMSPYQHGEVFVTEDGGETDLDLGHYERFIDINLSKSSNVTAGKVYWSVISKERKGDYLGSTVQVIPHITNEIKERIYRVGKEDNADIVITEIGGTVGDIESLPFLEAIRQVKKEVGRNDVLYIHVTLVPYISAAGELKTKPTQHSVKELRSIGIHPDIIVCRTEHELSQELKEKLALFCDIDVNAVIQNRNAASIYQVPLLLEEEGLDRIVLE--KLNLPAGTADMTEWRKMVDKILYPSK-SVRIAIVGKYVQLQDAYMSVSEALRHAGIANDAAIQIKWVNAQEV-EGSDADLAALFGDVDGILVPGGFGDRGVEGKIRTIQYARENKVPFFGLCLGMQCAVIEFARNVCGLKGAHSSEFDPNTPHPVIDLMPEQVAVEEKGGTMRLGVYPCKVTEGTLTYKAYQDEIIYERHRHRFEFNNAYRQLLTEHGLVIGGTLPNGRLVEIVEIKDHPWFVGTQFHPEFKSRPTNPHPLFRDFVKAA 530
>gi|165975592|ref|YP_001651185.1| CTP synthetase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|190149407|ref|YP_001967932.1| CTP synthase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] >gi|165875693|gb|ABY68741.1| CTP synthase [Actinobacillus pleuropneumoniae serovar 3 str. JL03] >gi|189914538|gb|ACE60790.1| CTP synthase [Actinobacillus pleuropneumoniae serovar 7 str. AP76] (545 aa)
Score = 1225, Expect = 2.1e-132, Identities = 243/528 (46%), Positives = 347/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T  + VTGGV SSLGKG+A +SL ++L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y E + KER G +LGATIQV+PHIT  I +++I        D +IVEVGGTVGDIES+PFLEA RQL     R + +F+H   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS  A+ +  ++KI+L   +    + SL ++  IY +PE L++Q +   + + F+++ P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S  +    +  L   DAILVPGGFG R +EGKI   QYAREN IP+ GICLGMQ+A IE+ARNV  +  A+S+EF+++   P++ ++          E ++ E++LGGT+RLG   C L +G+K  E+Y  ++IVERHRHRYE N   +   E  G   SG++ +  LVEIIE+ NH +FIA QFHPEFTS     +P+F  F+  +K
  S:     3 TNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVLRKERRGDYLGATIQVIPHITNEIKERVI--EGGKGRDVVIVEVGGTVGDIESLPFLEALRQLAVDVGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAIPSNERKKIALFCNVPERAVISLKDVDSIYRIPELLKSQGLDTFVCDRFRLDCP-EADLSEWEQVLYRQANPTG-EVTIGMVGKYVELPDAYKSVNEALKHAGLTNRLTVNIKYIDSQDIETKGVELLHGLDAILVPGGFGYRGVEGKIRTAQYARENKIPYLGICLGMQIALIEYARNVAGLTQANSSEFDKDCPQPVVGLITEWQDESGNVETRSDESDLGGTMRLGAQQCHLIEGTKAREVYGAETIVERHRHRYEVNNTLLPQIEAAGLKVSGLSADRKLVEIIEIPNHPWFIAAQFHPEFTSTPRDGHPLFAGFVKAAK 537
>gi|77164368|ref|YP_342893.1| CTP synthetase [Nitrosococcus oceani ATCC 19707] >gi|119391139|sp|Q3JCT3|PYRG_NITOC CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|76882682|gb|ABA57363.1| CTP synthase [Nitrosococcus oceani ATCC 19707] (550 aa)
Score = 1225, Expect = 2.2e-132, Identities = 238/529 (44%), Positives = 348/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLGA+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+ + + + +N T GR+Y   IA+ER G +LG T+QV+PHIT+ I + I   ++  Q   ++VE+GGTVGDIES+PFLEA RQ+  +  R Q +F+H   +  + +  +LKTKP QHSVK+L S GI P++L+ R +  +    + KI+L T +    + S +++  IY +P  L  QK+   +     +E  P  +    W      ++ P   +  I +VGKY D  +AY S+  +L     + +T ++I +++S  +    I  L   DAIL+PGGFG+R +EG I+A+QYAREN +P+ GICLGMQ+A IEFAR+   M +A STEF+E+T +P+I +          +E ++ +  LGGT+RLGNY CEL  GS+   +Y ++ I ERHRHRYEFN  Y ++ E  G V +G + + NLVE++E+ +H +F+A QFHPEFTS     +P+F SF+  + +
  S:     2 TKFIFVTGGVVSSLGKGITSASLGALLEARGLAVTLVKLDPYINVDPGTMSPYQHGEVFVTGDGAETDLDLGHYERFVRMTMSRRNNYTTGRIYENVIAQERRGAYLGNTVQVIPHITDEIKRCICAGADNAQ--VVLVEIGGTVGDIESLPFLEAIRQMGVELGREQTLFMHLTLIPFIRSAGELKTKPTQHSVKELRSIGIQPDVLVCRLEHPLPESERRKIALFTSVPERAVISAVDVDSIYKIPLELYAQKLDEIVVEQLGLETGPANL--TEWQRVIDGLEHPHD-EVTITLVGKYVDHREAYKSLSEALIHGGIHTRTRVNITYLDSEEIEAQGIGGLESADAILIPGGFGERGVEGMIIAVQYARENGVPYLGICLGMQVAVIEFARHQAGMKEAHSTEFSEHTPDPVIALITEWRRADGSIERRDEQMGLGGTMRLGNYECELLPGSRAAALYGQERITERHRHRYEFNNDYRELLEGAGLVMAGTSFDGNLVEMVEISHHPWFVACQFHPEFTSTPRDGHPLFNSFIRAAAE 537
>gi|78222490|ref|YP_384237.1| CTP synthetase [Geobacter metallireducens GS-15] >gi|119391110|sp|Q39W62|PYRG_GEOMG CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|78193745|gb|ABB31512.1| CTP synthase [Geobacter metallireducens GS-15] (538 aa)
Score = 1225, Expect = 2.2e-132, Identities = 240/525 (45%), Positives = 340/525 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQA-KYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           KTK + VTGGV SS+GKG+A +SLGA+L+  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L K SN T G+VY+  I KER G +LG T+QV+PHIT+ I  KI  L N    D  IVEVGGTVGDIES+PFLEA RQ +A +    V+++H   +  + T  +LKTKP QHSVK+L   GI P++L+ R +  + + +K KI+L   +E + + +  + +HIY +P +L  Q + + + +   +  + P+      W++    ++ P K +  IA+VGKY +  ++Y S+  +L          + + +++S  L    +  L  + DAILVPGGFG+R  EGKI AI+YAR   +PFFGICLGMQ+A +E+ARNV  + +A S+EF  + ANP+I ++E +      GGT+RLG Y C L  G+     Y    + ERHRHRYEFN  + +I    G V SGI KE +LVEI+E+ +H +F+  QFHPEF SK L+P+P+F +F+
  S:     2 KTKFIFVTGGVVSSIGKGLASASLGALLEARGLRVSMQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSARLSKRSNFTTGQVYFSVIEKERRGDYLGGTVQVIPHITDEIKHKI--LENAKGADVAIVEVGGTVGDIESLPFLEAIRQFKADRGAGNVLYLHVTLVPYIKTAGELKTKPTQHSVKELREIGIQPDILICRCEKDLPHDMKAKIALFCNVEEKGVITSADAEHIYAVPLALHKQGLDDQVVDKLNIWTKAPD---LAPWESVVEKLRNPLKGEVHIAIVGKYVNLTESYKSLAEALTHGGIANDCRVYLRYLDSEKLESEGLGGLLDDVDAILVPGGFGERGTEGKIKAIEYARTRKVPFFGICLGMQMAVVEYARNVCGLDNAFSSEFRPDCANPVIHLMEEQKGVERKGGTMRLGAYPCSLSKGTFAHRAYGSLDVSERHRHRYEFNNAFREILVSKGLVISGIYKEGDLVEIVEVADHPWFLGCQFHPEFKSKPLNPHPLFRTFI 525
>gi|114567924|ref|YP_755078.1| CTP synthetase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] >gi|119391198|sp|Q0AU97|PYRG_SYNWW CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|114338859|gb|ABI69707.1| CTP synthase [Syntrophomonas wolfei subsp. wolfei str. Goettingen] (542 aa)
Score = 1225, Expect = 2.3e-132, Identities = 240/524 (45%), Positives = 338/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHT--VPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + +TGGV SSLGKG+  +SLG +LK  G +V + KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++ NL   +N T GR+Y   + KER G +LG T+QV+PHIT  I  ++ ++  +  PD +I E+GGTVGDIES+PFLEA RQL+    + +V++IH   +P IE     +LKTKP QHSVK+L S GI P++L+ R++  +S  LK K++L   ++ E +  L + + IY +P  L  +K+   I     +E   +   K W    S +    K +  I +VGKY + PDAYLSI+ SL+ + F    ++ I++I +  + +    E L   D IL+PGGFG+R IEGKI    YAREN +PF GICLGMQ A IEFARNV +M  A+S+EF+ ++  P++ ++ G+    N G ++RLG Y C L +G+    +Y      ERHRHRYE N +Y    E  G V SGI+ +  L+EIIEL+ H +F+A QFHPEF S+   P+P+F   +
  S:     2 TKYIFITGGVVSSLGKGITAASLGRLLKGRGLKVALQKFDPYINVDPGTMSPYQHGEVYVTEDGAETDLDVGHYERFIDENLSHYANCTTGRIYQTVLDKERRGDYLGQTVQVIPHITNEIKDRVTMIEKENSPDIVISEIGGTVGDIESLPFLEAIRQLKFDLGKDRVLYIHVTLIPYIE--AAGELKTKPTQHSVKELRSIGIQPDILVCRTQKELSEDLKAKLALFCDVDREAVVQLPDAESIYEVPLMLAREKLDLEIIRRLGLEC-KQADLKEWKELASRVHRLDK-EICIGLVGKYVELPDAYLSIVESLKHAGFQYNCEIKIKWIYAEKVEKEGAEELLQNVDGILIPGGFGERGIEGKIATAAYARENRVPFLGICLGMQCAIIEFARNVCQMKGANSSEFDPDSPYPVVHLMPGQENVANKGASMRLGGYPCRLVEGTLAYGVYGVSETSERHRHRYEINNEYRKEMESKGLVISGISPDGQLIEIIELKEHPWFVACQFHPEFKSRPNRPHPLFMGLI 525
>gi|160871655|ref|ZP_02061787.1| CTP synthase [Rickettsiella grylli] >gi|159120454|gb|EDP45792.1| CTP synthase [Rickettsiella grylli] (553 aa)
Score = 1224, Expect = 2.5e-132, Identities = 243/528 (46%), Positives = 347/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T+ L +TGGV SSLGKG+A +SLGA+L+  G ++ ++K DPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K++N TAG++Y   + KER G +LG T+QV+PH+T+ I Q I  L      D  +VE+GGTVGDIES+PFLEA RQL+ +  ++  +FIH   +  + T  ++KTKP QHS K+L S GI  ++L+ R+K+ +    +EKI+L T +E   + SL ++  IY +P  L  Q V  ++   F ++       K W    +  KE    + +I +VGKY    D+Y S+  +L  +     T +++ +I++ +L +  +  L   DAILVPGGFGKR I GKILA QYARENNIP+ GICLGMQ A IEFAR+V  +  A STEF+  T  P++ +          +E +++ ++LGGT+RLG   C LK  +K   +Y + SI+ERHRHRYE N + +   E+ G + SG +++ NLVE+IELENH +FI  QFHPEFTS     +P+F  F+  +K
  S:     3 TRYLFITGGVVSSLGKGIAAASLGAILESRGLKISLLKLDPYLNLDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFVRTKMTKDNNFTAGQIYARVLRKERRGDYLGGTVQVIPHVTDEIKQAI--LKGAQGADIALVEIGGTVGDIESLPFLEAIRQLRIELGNRYTLFIHLTLVPYISTAGEIKTKPTQHSTKELRSIGIQADMLICRAKEEIPEHAREKIALFTNVELSGVISLPDVNTIYRIPLLLHQQCVDENVLQRFGLKNYPPADLKAWAEVVA-AKENPTAEVKIGMVGKYMGLADSYKSLSEALVHAGIKTHTHVNVIYIDAEALEQQGVKLLEPLDAILVPGGFGKRGIAGKILAAQYARENNIPYLGICLGMQTAFIEFARHVAGLTHAHSTEFDPETPYPVVALVTEWTTVDGHVEKRDKNSDLGGTMRLGGQRCYLKHETKASALYHQDSIIERHRHRYEVNNQLLPCLEEKGLIVSGRSEDGNLVEMIELENHPWFIGCQFHPEFTSNPRDGHPLFVGFVEAAK 538
>gi|126207624|ref|YP_001052849.1| CTP synthetase [Actinobacillus pleuropneumoniae L20] >gi|126096416|gb|ABN73244.1| CTP synthase [Actinobacillus pleuropneumoniae L20] (545 aa)
Score = 1224, Expect = 2.5e-132, Identities = 243/528 (46%), Positives = 347/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T  + VTGGV SSLGKG+A +SL ++L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y E + KER G +LGATIQV+PHIT  I +++I        D +IVEVGGTVGDIES+PFLEA RQL     R + +F+H   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS  A+ +  ++KI+L   +    + SL ++  IY +PE L++Q +   + + F+++ P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S  +    +  L   DAILVPGGFG R +EGKI   QYAREN IP+ GICLGMQ+A IE+ARNV  +  A+S+EF+++   P++ ++          E ++ E++LGGT+RLG   C L +G+K  E+Y  ++IVERHRHRYE N   +   E  G   SG++ +  LVEIIE+ NH +FIA QFHPEFTS     +P+F  F+  +K
  S:     3 TNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVLRKERRGDYLGATIQVIPHITNEIKERVI--EGGKGRDVVIVEVGGTVGDIESLPFLEALRQLAVDVGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAIPSNERKKIALFCNVPERAVISLKDVDSIYRIPELLKSQGLDTFVCDRFRLDCP-EADLSEWEQVLYRQANPTG-EVTIGMVGKYVELPDAYKSVNEALKHAGLTNRLTVNIKYIDSQDIETKGVELLHGLDAILVPGGFGYRGVEGKIRTAQYARENKIPYLGICLGMQIALIEYARNVAGLTQANSSEFDKDCPQPVVGLITEWQDESGNVETRSDESDLGGTMRLGAQQCHLIEGTKAREVYGAETIVERHRHRYEVNNTLLPQIEAAGLKVSGLSADRKLVEIIEIPNHPWFIAAQFHPEFTSTPRDGHPLFAGFVAAAK 537
>gi|33151601|ref|NP_872954.1| CTP synthetase [Haemophilus ducreyi 35000HP] >gi|71153088|sp|Q7VNV5|PYRG_HAEDU CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|33147821|gb|AAP95343.1| CTP synthase [Haemophilus ducreyi 35000HP] (545 aa)
Score = 1224, Expect = 2.6e-132, Identities = 245/528 (46%), Positives = 344/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T  + VTGGV SSLGKG+A +SL ++L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y E + KER G +LGATIQV+PHIT  I  ++I        D +IVEVGGTVGDIES+PFLEA RQL     R + +F+H   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   +    + SL ++  IY +PE L++Q + + + + F++E P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S  +       L   DAILVPGGFG R +EGKI   QYARENNIP+ GICLGMQ+A IE+ARNV  + +A+S+EF+   + P+I ++          E +  +++LGGT+RLG   C L +G+K  EIY  ++IVERHRHRYE N   +   E  G   SG++ +  LVEIIE+ NH +FIA QFHPEFTS     +P+F  F+  +K
  S:     3 TNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVLRKERRGDYLGATIQVIPHITNEIKARVI--EGGKGRDVVIVEVGGTVGDIESLPFLEALRQLAVDVGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRTIPANERKKIALFCNVPERAVISLKDVDSIYRIPELLKSQALDSFVCDRFRLECP-EADLSEWEQVLYRQANPTG-EVTIGMVGKYVELPDAYKSVNEALKHAGLTSRLSVNIKYIDSQDIETKGTELLDGLDAILVPGGFGYRGVEGKIRTAQYARENNIPYLGICLGMQIALIEYARNVAGLTEANSSEFDPACSQPVIGLITEWQDESGNVETRTDKSDLGGTMRLGAQQCHLIEGTKAREIYGAEAIVERHRHRYEVNNVLLPTIEAAGLKVSGVSADRKLVEIIEVPNHPWFIAAQFHPEFTSTPRDGHPLFAGFVAAAK 537
>gi|71280015|ref|YP_270763.1| CTP synthetase [Colwellia psychrerythraea 34H] >gi|119391093|sp|Q47WQ9|PYRG_COLP3 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|71145755|gb|AAZ26228.1| CTP synthase [Colwellia psychrerythraea 34H] (542 aa)
Score = 1224, Expect = 2.9e-132, Identities = 250/529 (47%), Positives = 356/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+GR+Y + +A+ER G+FLGATIQV+PHIT  I +++I  +  Y  D  +VE+GGTVGD+ES PFLEA RQL  +  R + MF+H   +  L    ++KTKP QHSVKDL S GIFP++L+ RS  A+ N  + KISL T +E + + S+ ++  IY +P  L+ Q     +   F ++VP       W+        P   +  I +VGKY++ PDAY S+  +L+ +    +  ++I++I+S  +    +  L+  DAILVPGGFG+R +EGKIL  QYAREN +P+ GICLGMQ+A IEFARNV  + DA STEFN  T +P++ ++          E +N +++LGGT+RLG+  C L  G+K  ++Y  ++I ERHRHR+E N  Y +   K G +FSG++ + +LVE+IE+ +H +FIA QFHPEF S     +P+F SF+  S K
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMLKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTSGRIYQDVLARERKGEFLGATIQVIPHITNDIKRRVIEGAEGY--DIAMVEIGGTVGDMESQPFLEAIRQLALEVGRDRAMFMHLTLVPYLAAAGEIKTKPTQHSVKDLRSIGIFPDILVCRSDRAIPNAERAKISLFTNVEEKAVVSMRDVDSIYKIPALLKAQGTDEIVVKRFGLDVP-EADLTEWEEVLYHEANPIG-EVTIGMVGKYTELPDAYKSVNEALKHAGLKNQVTVNIKYIDSQDVEVKGVEILANLDAILVPGGFGERGVEGKILTAQYARENKVPYLGICLGMQVALIEFARNVAGLTDAHSTEFNSETPHPVVGLISEWLDEEGQVEYRNEQSDLGGTMRLGSQLCHLVKGTKACDVYGSETINERHRHRFEVNNNYREQLSKAGLIFSGLSSDKSLVEVIEIADHPWFIAGQFHPEFNSTPRDGHPLFESFVAASFK 538
>gi|169633622|ref|YP_001707358.1| CTP synthase [Acinetobacter baumannii SDF] >gi|169795766|ref|YP_001713559.1| CTP synthase [Acinetobacter baumannii AYE] >gi|169148693|emb|CAM86559.1| CTP synthase [Acinetobacter baumannii] >gi|169152414|emb|CAP01365.1| CTP synthase [Acinetobacter baumannii] >gi|193077500|gb|ABO12327.2| CTP synthase [Acinetobacter baumannii ATCC 17978] (545 aa)
Score = 1223, Expect = 3.2e-132, Identities = 246/528 (46%), Positives = 345/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLN-INLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T  + VTGGV SSLGKG++ +S+ A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G YERFL    + K +N T+GRVY + + KER G +LG T+QV+PHIT+ I ++++     Y  D  IVE+GGTVGDIES+PF+E+ RQL  +    + M +H   L  + + ++LKTKP QHSVK+L+S GI P++L+ R++  V    K KI+L T +E   +    + K IY +P     Q V + I   F            WD     +  P+ Y  R+A+VGKY + PDAY S+  +L  +    +  + I+++N+  L   ++S L   DAILVPGGFG+R  EGK+ AIQYAREN IPF GICLGMQLA IE+AR+V  M +A STEFN +T  P+I +          L+ ++ E++LGGT+RLG    EL +G+K  E+Y +  I ERHRHRYE N ++++  E+ G   SG +   +LVE +E+  H +FIAVQFHPEFTS     +P+F SF++ +K
  S:     2 THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGYYERFLRRAKMTKLNNFTSGRVYQDVLNKERRGDYLGGTVQVIPHITDNIKERVLRAGEGY--DVAIVEIGGTVGDIESLPFMESVRQLMVELGHKRTMLMHLTLLPYIKSAAELKTKPTQHSVKELLSIGIQPDILICRTEYDVDADTKRKIALFTNVEARAVVVCKDAKTIYQIPRGFYEQNVDDLICERFGFTDLPEADLTDWDNVVEALLNPE-YTVRVAMVGKYVELPDAYKSVNEALLHAGIKNRVKVQIDYVNAEELESQDVSILKTADAILVPGGFGERGTEGKMKAIQYARENGIPFLGICLGMQLAVIEYARHVAGMPEASSTEFNRSTKYPLIGLITEWLDERGELQQRSLESDLGGTMRLGAQKSELVEGTKTREVYGKAEITERHRHRYEMNNRFIEAIEQAGMKISGYSSAQHLVETVEIPEHPWFIAVQFHPEFTSSPRDGHPLFASFIDAAK 538
>gi|153095074|gb|EDN75625.1| CTP synthase [Mannheimia haemolytica PHL213] (545 aa)
Score = 1223, Expect = 3.4e-132, Identities = 245/528 (46%), Positives = 347/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T  + VTGGV SSLGKG+A +SL ++L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y E + KER G +LGATIQV+PHIT  I  ++  L      D  IVEVGGTVGDIES+PFLEA RQL     R + +F+H   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS  A+    K+KI+L   +    + SL ++  IY +PE L++Q + + + + F+++         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S  +       L+  D ILVPGGFG R +EGKI   QYAREN IP+ GICLGMQ+A IE+ARNV  + +A+S+EF+++ + P+I ++          E ++ E++LGGT+RLG+  C L +GSK  E+Y  ++IVERHRHRYE N K +   E  G   SG++ +  LVEIIE+ NH +FIA QFHPEFTS     +P+F  F+  +K
  S:     3 TNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVLRKERRGDYLGATIQVIPHITNEIKARV--LEGGKGRDVAIVEVGGTVGDIESLPFLEALRQLAVDIGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAIPENEKKKIALFCNVPERAVISLKDVDSIYRIPELLKSQGLDSFVCDRFRLDC-KEADLSEWEQVLYCQANPTG-EVTIGMVGKYVELPDAYKSVNEALKHAGLTHRLTVNIKYIDSQDIETKGTELLAGLDGILVPGGFGYRGVEGKIRTAQYARENKIPYLGICLGMQIALIEYARNVAGLTEANSSEFDKDCSQPVIGLITEWQDAEGNVETRSDESDLGGTMRLGSQQCHLIEGSKARELYGAETIVERHRHRYEVNNKLLPQIEAAGLKVSGLSADRKLVEIIEVPNHPWFIAAQFHPEFTSTPRDGHPLFAGFVKAAK 537
>gi|153941095|ref|YP_001389495.1| CTP synthetase [Clostridium botulinum F str. Langeland] >gi|152936991|gb|ABS42489.1| CTP synthase [Clostridium botulinum F str. Langeland] (533 aa)
Score = 1223, Expect = 3.7e-132, Identities = 243/527 (46%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT G++Y+  I+KER G +LGAT+QV+PHIT  I  ++  ++ + + D +I E+GGT+GDIES+PFLE+ RQ++ +  R  V FIH   L  L    +LKTKP QHSVK+L   GI P++++ RS+  +  +LK KI L   ++ E++   ++ +++Y +P  L  + +   +     +   ++I    W +  +  K   K    IA+VGKY +  DAY+SI+ +L    +   T ++I++INS  +NENN  + L + D ILVPGGFG R IEGKI A ++AREN IPF GICLGMQ A IEFARNVL    A S E N NT  P+I ++  +    N+GGT+RLG Y C+L  G+   + Y ++ + ERHRHRYEFN +Y     + G + SG + ++ LVEI+E+ NH +++AVQFHPE  S+   P+P+F  F+  +
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSQNSNVTTGKIYWSVISKERKGDYLGATVQVIPHITTEIKSRVYRVAKEKEVDVVITEIGGTIGDIESLPFLESIRQIKYEVGRENVCFIHVTLLPFLGKAGELKTKPTQHSVKELRGIGIQPDIIVCRSEKQIPEELKGKIGLFCNVDKEDVIQNLDAENLYEVPLMLHKENLDTLVCKKLGLNY-SKIDNTEWISMVNNAKNLSK-NTTIALVGKYVELHDAYISIVEALNHGGYANDTKVNIKWINSEEVNENNFEQYLKDVDGILVPGGFGDRGIEGKIWAAKWARENKIPFLGICLGMQCAVIEFARNVLNYKGAHSAEINPNTKYPVIDLMPEQKDIDNMGGTMRLGAYPCKLLKGTNSEKAYGQEIVYERHRHRYEFNNEYRSKLTEAGLILSGTSPDDRLVEIVEINNHPWYVAVQFHPELKSRPNKPHPLFKDFVKAT 529
>gi|184158329|ref|YP_001846668.1| CTP synthase (UTP-ammonia lyase) [Acinetobacter baumannii ACICU] >gi|183209923|gb|ACC57321.1| CTP synthase (UTP-ammonia lyase) [Acinetobacter baumannii ACICU] (545 aa)
Score = 1223, Expect = 3.8e-132, Identities = 246/528 (46%), Positives = 346/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLN-INLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T  + VTGGV SSLGKG++ +S+ A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G YERFL    + K +N T+GRVY + + KER G +LG T+QV+PHIT+ I ++++     Y  D  IVE+GGTVGDIES+PF+E+ RQL  +    + M +H   L  + + ++LKTKP QHSVK+L+S GI P++L+ R++  V    K KI+L T +E   +    + K IY +P     Q V + I   F            WD     +  P+ Y  R+A+VGKY + PDAY S+  +L  +    +  + I+++N+  L   ++S L   DAILVPGGFG+R  EGK+ AIQYAREN+IPF GICLGMQLA IE+AR+V  M +A STEFN +T  P+I +          L+ ++ E++LGGT+RLG    EL +G+K  E+Y +  I ERHRHRYE N ++++  E+ G   SG +   +LVE +E+  H +FIAVQFHPEFTS     +P+F SF++ +K
  S:     2 THFIFVTGGVVSSLGKGISAASVAALLEARGLKVTMVKMDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGYYERFLRRAKMTKLNNFTSGRVYQDVLNKERRGDYLGGTVQVIPHITDNIKERVLRAGEGY--DVAIVEIGGTVGDIESLPFMESVRQLMVELGHKRTMLMHLTLLPYIKSAAELKTKPTQHSVKELLSIGIQPDILICRTEYDVDADTKRKIALFTNVEARAVVVCKDAKTIYQIPRGFYEQNVDDLICERFGFTDLPEADLTDWDNVVEALLNPE-YTVRVAMVGKYVELPDAYKSVNEALLHAGIKNRVKVQIDYVNAEELESQDVSILKTADAILVPGGFGERGTEGKMKAIQYARENSIPFLGICLGMQLAVIEYARHVAGMPEASSTEFNRSTKYPLIGLITEWLDERGELQQRSLESDLGGTMRLGAQKSELVEGTKTREVYGKAEITERHRHRYEMNNRFIEAIEQAGMKISGYSSAQHLVETVEIPEHPWFIAVQFHPEFTSSPRDGHPLFASFIDAAK 538
>gi|170756802|ref|YP_001779759.1| CTP synthase [Clostridium botulinum B1 str. Okra] >gi|169122014|gb|ACA45850.1| CTP synthase [Clostridium botulinum B1 str. Okra] (533 aa)
Score = 1222, Expect = 4.6e-132, Identities = 243/527 (46%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT G++Y+  I+KER G +LGAT+QV+PHIT  I  ++  ++ + + D +I E+GGT+GDIES+PFLE+ RQ++ +  R  V FIH   L  L    +LKTKP QHSVK+L   GI P++++ RS+  +  +LK KI L   ++ E++   ++ +++Y +P  L  + +   +     +   ++I    W +  +  K   K    IA+VGKY +  DAY+SI+ +L    +   T ++I++INS  +NENN  + L + D ILVPGGFG R IEGKI A ++AREN IPF GICLGMQ A IEFARNVL    A S E N NT  P+I ++  +    N+GGT+RLG Y C+L  G+   + Y ++ + ERHRHRYEFN +Y     + G + SG + ++ LVEI+E+ NH +++AVQFHPE  S+   P+P+F  F+  +
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTEDGTETDLDLGHYERFIDENLSQNSNVTTGKIYWSVISKERKGDYLGATVQVIPHITTEIKSRVYRVAKEKEVDVVITEIGGTIGDIESLPFLESIRQIKYEVGRENVCFIHVTLLPFLGKAGELKTKPTQHSVKELRGIGIQPDIIVCRSEKQIPEELKGKIGLFCNVDKEDVIQNLDAENLYEVPLMLHKENLDALVCKKLGLNY-SKIDNTEWISMVNNAKNLSK-NTTIALVGKYVELHDAYISIVEALNHGGYANDTKVNIKWINSEEINENNFEQYLKDVDGILVPGGFGDRGIEGKIWAAKWARENKIPFLGICLGMQCAVIEFARNVLNYKGAHSAEINPNTKYPVIDLMPEQKDIDNMGGTMRLGAYPCKLLKGTNSEKAYGQEIVYERHRHRYEFNNEYRSKLTEAGLILSGTSPDDRLVEIVEINNHPWYVAVQFHPELKSRPNKPHPLFKDFVKAT 529
>gi|188587693|ref|YP_001919876.1| CTP synthase [Clostridium botulinum E3 str. Alaska E43] >gi|188497974|gb|ACD51110.1| CTP synthase [Clostridium botulinum E3 str. Alaska E43] (533 aa)
Score = 1222, Expect = 4.8e-132, Identities = 246/529 (46%), Positives = 350/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV S+LGKG+  +SLG +LK  G  + I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L + SNVT G++Y   I KER G++LG T+QV+PHIT AI  K+  ++ +   D +I E+GGTVGDIES PFLEA RQ++++  +  V +IH   +  L    +LKTKP QHSVK+L + GI P++++ R++  ++N +K KI L   I+ +++   ++  ++Y +P  L  + + N +     +E  +   Y+ W      IK  K+ K  IA+VGKY +  DAY+S++ SL    +   T + I ++N+  L + ++SE L+  D ILVPGGFG R IEGKI AI+YARENNIPF GICLGMQ A IE+ARNVL    A+S+E N +T  P+I I+  +    NLGGT+RLG Y C+L+  S   ++Y  + + ERHRHRYEFN K+ D   + G   +G + +  LVEI+E+ NH +++AVQFHPE  S+   P+P+F  F+  + K
  S:     3 TKYVFVTGGVVSALGKGITAASLGRLLKNRGLNISIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFVDESLTQNSNVTTGKIYSSVIEKERRGEYLGGTVQVIPHITNAIKDKVYQVAKERDVDVVITEIGGTVGDIESQPFLEAIRQIKSEVGTDNVCYIHVTLVPYLGKAGELKTKPTQHSVKELRTIGIQPDIIVCRTEKNLNNDIKAKIGLFCNIDGKSVIQNLDADNLYEVPLMLHEEGLDNLVCEKLHLECKDIDNYE-WTLMVKKIKSLKE-KVEIALVGKYVELHDAYISVVESLNHGGYANNTKVEIRWVNAEELEQRDVSEVLAGVDGILVPGGFGDRGIEGKISAIKYARENNIPFLGICLGMQCAVIEYARNVLGYDGANSSEINPSTKYPVIDIMNDQKNIENLGGTMRLGQYPCKLEVESNSYKVYNSELVSERHRHRYEFNNKFRDQIYESGMKIAGTSPDGRLVEIVEVTNHPWYVAVQFHPELKSRPNKPHPLFTGFIGAAIK 531
>gi|149277801|ref|ZP_01883941.1| CTP synthetase [Pedobacter sp. BAL39] >gi|149231489|gb|EDM36868.1| CTP synthetase [Pedobacter sp. BAL39] (538 aa)
Score = 1222, Expect = 5.3e-132, Identities = 236/524 (45%), Positives = 339/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + VTGGV SSLGKG+  +SL  +L+  G  V I KFDPY+N+D GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +N+T GR+Y   I KER G++LG T+QVVPHIT+ I + + +L +  + D +I E+GGTVGDIES+PF+EA RQ +  +  S  + IH   +  L    +LKTKP QHSVK L+  GI P++L+ R++  ++  +++KI+L   +    +    +   IY +P  +  +++  ++    K+   N    + W  F   +K P   + +I +VGKY + PDAY SII S   +    +  + +E+I+S  +  +N  E L+  D +LV  GFG R IEGKI  I+Y RE  +PFFGICLGMQ A IEF RNVL + DA++TE NE T + +I ++E + + TN GGT+RLG+Y C+LK G+K    Y +  I ERHRHRYEFN  Y+  +E  G + SG+N E+NLVEI+EL+NH FF+  QFHPE  S + +P+P+F  F+
  S:     2 TKYIFVTGGVTSSLGKGIISASLAKLLQARGYSVAIQKFDPYINIDPGTLNPYEHGECYVTEDGAETDLDLGHYERFLNVPTSQANNITTGRIYQNVINKERQGEYLGKTVQVVPHITDEIKRNMRILGDSGKFDIVITELGGTVGDIESLPFIEAVRQFKWEEGTSNAIVIHLTLIPYLAAAGELKTKPTQHSVKALLEYGIQPDILVCRTERPINQDIRKKIALFCNVNINAVIESADASTIYDVPLLMMKEQLDKTVLTKLKLAHKNEPDMESWKDFLGRLKNPTA-EVKIGLVGKYVELPDAYKSIIESFVHAGAKNECKVKVEYIHSEGIYPDNAKEKLAHLDGVLVAPGFGSRGIEGKIDTIKYVREQEVPFFGICLGMQCAVIEFGRNVLGLQDANTTEINEETGHAVINMMEDQKKVTNKGGTMRLGSYPCDLKKGTKAYAAYGKAHITERHRHRYEFNNAYLKQYEDAGMIASGLNPESNLVEIVELKNHPFFVGGQFHPELKSTVANPHPLFVKFV 526
>gi|160885688|ref|ZP_02066691.1| hypothetical protein BACOVA_03692 [Bacteroides ovatus ATCC 8483] >gi|156108501|gb|EDO10246.1| hypothetical protein BACOVA_03692 [Bacteroides ovatus ATCC 8483] (541 aa)
Score = 1221, Expect = 6.3e-132, Identities = 240/528 (45%), Positives = 347/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTF-----TSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G  V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQV+PHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L S GI P++L++R++  +S+ L++K++    ++++ +   I+ + IY +P  ++ Q + ++I     + V    G   W  F      +  KEP      IA+VGKY D  DAY SI  +L  +  Y    + + F+NS  L + N++E L     +++  GFG+R I+GK +AI+Y R ++IP FGICLGMQ  +IEFARNVL   DA+S E +E T + +I I+E +   TN+GGT+RLG Y C L+ GSK  + Y ++ I ERHRHRYEFN  Y D +E  G    GIN E++LVEI+E+   K+F+  QFHPE+ S +L+P+P+F +F+  +
  S:     3 ETKYIFVTGGVASSLGKGIISSSIGKLLQARGYNVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPYLESIRQLKWELGKNALCVHLTYVPYLAAAGELKTKPTQHSVKELQSVGIQPDVLVLRAEHPLSDGLRKKVAQFCNVDDKAVVQSIDAETIYEVPILMQAQGLDSTILEKMGLPVGETPGLGPWRKFLERRHAAETKEP----INIALVGKY-DLQDAYKSIREALSQAGTYNDRKVEVHFVNSEKLTDENVAEALKGMAGVMIGPGFGQRGIDGKFVAIKYTRTHDIPTFGICLGMQCIAIEFARNVLGYADANSREMDEKTPHNVIDIMEEQKAITNMGGTMRLGAYECVLQKGSKAYQAYGQEHIQERHRHRYEFNNDYKDRYEAAGMKCVGINPESDLVEIVEIPTLKWFVGTQFHPEYGSTVLNPHPLFVAFVKAA 531
>gi|187777277|ref|ZP_02993750.1| hypothetical protein CLOSPO_00829 [Clostridium sporogenes ATCC 15579] >gi|187774205|gb|EDU38007.1| hypothetical protein CLOSPO_00829 [Clostridium sporogenes ATCC 15579] (546 aa)
Score = 1221, Expect = 6.3e-132, Identities = 241/527 (45%), Positives = 349/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT G++Y+  I+KER G +LGAT+QV+PHIT  I  ++  ++ + + D +I E+GGT+GDIES+PFLE+ RQ++ +  R  V FIH   L  L    +LKTKP QHSVK+L   GI P++++ RS+  +  +LKEKI L   ++ E++   ++ +++Y +P  L  + +   +     +   ++I    W +  +  K   K    IA+VGKY +  DAY+SI+ +L    +   T ++I++INS  +NENN  + L + D ILVPGGFG R IEGKI + ++AREN IPF GICLGMQ A IEFARNVL    A S E + NT  P+I ++  +    ++GGT+RLG+Y C+L  G+   + Y ++ + ERHRHRYEFN +Y     + G + SG + ++ LVEI+E+ NH +++AVQFHPE  S+   P+P+F  F+  +
  S:    16 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSQNSNVTTGKIYWSVISKERKGDYLGATVQVIPHITTEIKSRVYRVAKEKEVDVVITEIGGTIGDIESLPFLESIRQIKYEVGRENVCFIHVTLLPFLGKAGELKTKPTQHSVKELRGIGIQPDIIVCRSEKQIPKELKEKIGLFCNVDKEDVIQNLDAENLYEVPLMLHKENLDTLVCKKLGLNY-SKIDNTEWISMVNNAKNLSK-NTTIALVGKYVELHDAYISIVEALNHGGYANDTKVNIKWINSEEVNENNFEQYLKDADGILVPGGFGDRGIEGKIWSAKWARENKIPFLGICLGMQCAVIEFARNVLNYKGAHSAEIDPNTKYPVIDLMPEQKDIDDMGGTMRLGSYPCKLLKGTNAEKAYGQEIVYERHRHRYEFNNEYRSKLTEAGLILSGTSPDDRLVEIVEINNHPWYVAVQFHPELKSRPNKPHPLFKDFVKAT 542
>gi|168177464|ref|ZP_02612128.1| CTP synthase [Clostridium botulinum NCTC 2916] >gi|182671157|gb|EDT83131.1| CTP synthase [Clostridium botulinum NCTC 2916] (533 aa)
Score = 1221, Expect = 6.7e-132, Identities = 242/527 (45%), Positives = 348/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT G++Y+  I+KER G +LGAT+QV+PHIT  I  ++  ++ + + D +I E+GGT+GDIES+PFLE+ RQ++ +  R  V FIH   L  L    +LKTKP QHSVK+L   GI P++++ RS+  +  +LK KI L   ++ E++   ++ +++Y +P  L  + +   +     +   ++I    W +  +  K   K    IA+VGKY +  DAY+SI+ +L    +   T ++I++INS  +NENN  + L + D ILVPGGFG R IEGKI A ++AREN IPF GICLGMQ A IEFARNVL    A S E + NT  P+I ++  +    N+GGT+RLG Y C+L  G+   + Y ++ + ERHRHRYEFN +Y     + G + SG + ++ LVEI+E+ NH +++AVQFHPE  S+   P+P+F +F+  +
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSQNSNVTTGKIYWSVISKERKGDYLGATVQVIPHITTEIKSRVYRVAKEKEVDVVITEIGGTIGDIESLPFLESIRQIKYEVGRENVCFIHVTLLPFLGKAGELKTKPTQHSVKELRGIGIQPDIIVCRSEKQIPEELKGKIGLFCNVDKEDVIQNLDAENLYEVPLMLHKENLDTLVCKKLGLNY-SKIDNTEWISMVNNAKNLSK-NTTIALVGKYVELHDAYISIVEALNHGGYANDTKVNIKWINSEEVNENNFEQCLKDVDGILVPGGFGDRGIEGKIWAAKWARENKIPFLGICLGMQCAVIEFARNVLNYKGAHSAEIDPNTKYPVIDLMPEQKDIDNMGGTMRLGAYPCKLLKGTNSEKAYGQEVVYERHRHRYEFNNEYRSKLTEAGLILSGTSPDDRLVEIVEINNHPWYVAVQFHPELKSRPNKPHPLFKNFVKAT 529
>gi|168182259|ref|ZP_02616923.1| CTP synthase [Clostridium botulinum Bf] >gi|182674707|gb|EDT86668.1| CTP synthase [Clostridium botulinum Bf] (533 aa)
Score = 1221, Expect = 6.8e-132, Identities = 242/527 (45%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT G++Y+  I+KER G +LGAT+QV+PHIT  I  ++  ++ + + D +I E+GGT+GDIES+PFLE+ RQ++ +  R  V FIH   L  L    +LKTKP QHSVK+L   GI P++++ RS+  +  +LK KI L   ++ E++   ++ +++Y +P  L  + +   +     +   ++I    W    +  K   K    IA+VGKY +  DAY+SI+ +L    +   T ++I++INS  +NENN  + L + D ILVPGGFG R IEGKI A ++AREN IPF GICLGMQ A IEFARNVL    A S E + NT  P+I ++  +    N+GGT+RLG Y C+L  G+   + Y ++ + ERHRHRYEFN +Y     + G + SG + ++ LVEI+E+ NH +++AVQFHPE  S+   P+P+F +F+  +
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSQNSNVTTGKIYWSVISKERKGDYLGATVQVIPHITTEIKSRVYRVAKEKEVDVVITEIGGTIGDIESLPFLESIRQIKYEVGRENVCFIHVTLLPFLGKAGELKTKPTQHSVKELRGIGIQPDIIVCRSEKQIPEELKGKIGLFCNVDKEDVIQNLDAENLYEVPLMLHKENLDTLVCKKLGLNY-SKIDNTEWIAMVNNAKSLSK-NTTIALVGKYVELHDAYISIVEALNHGGYANDTKVNIKWINSEEVNENNFEQCLKDVDGILVPGGFGDRGIEGKIWAAKWARENKIPFLGICLGMQCAVIEFARNVLNYKGAHSAEIDPNTKYPVIDLMPEQKDIDNMGGTMRLGAYPCKLLKGTNSEKAYGQEVVYERHRHRYEFNNEYRSKLTEAGLILSGTSPDDRLVEIVEINNHPWYVAVQFHPELKSRPNKPHPLFKNFVKAT 529
>gi|149919233|ref|ZP_01907716.1| CTP synthetase [Plesiocystis pacifica SIR-1] >gi|149819947|gb|EDM79369.1| CTP synthetase [Plesiocystis pacifica SIR-1] (545 aa)
Score = 1219, Expect = 9.6e-132, Identities = 240/525 (45%), Positives = 343/525 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQN---SIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELEN--HKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           +TK + VTGGV SSLGKG+  +S+GA+L+  G  V + K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + + SN T+G++Y   + KER G +LG T+QV+PH+T  I Q ++  +     D LI E+GGTVGDIES+PFLEA RQL+ +  S+  +FIH   L  L T  +LKTKP QHSV  L   GI P++L+ R++  +     EKI+L T ++  ++  L +   IY +P  L   +V +    + N +  E P     + W   TS+++ P+ +  +I VVGKY D  ++Y S+  +L          + I F+++  ++    + L E DA+LVPGGFG+R   GKI AI++AREN  PFFGICLGMQLA+IEFAR+V  + DA STEF+   + P+I ++E ++  T+ GGT+RLG Y+CEL   +    +Y R  I ERHRHR+EFN  YMD   + G +F G+  + +LVE++EL +  H +FIA QFHPEF S+  +P+P+F +F+
  S:     9 RTKFIFVTGGVVSSLGKGLCAASVGALLENRGLNVGMQKLDPYLNVDPGTMSPTQHGEVFVTDDGAETDLDLGHYERFVSHRMSRHSNYTSGQIYSSVLEKERKGDYLGQTVQVIPHVTNEIKQAVLKAAEGV--DLLICEIGGTVGDIESLPFLEAVRQLRLELGSENAIFIHLTLLPYLPTAGELKTKPTQHSVMKLREIGIQPDILVCRAEHPIETDTLEKIALFTNVQLSSVIPLPDADTIYAVPLMLHEARVDDVACELLNIWSRE-PQ---LEEWRRITSILRGPE-HTVKIGVVGKYVDLHESYKSLSEALTHGGLANSAGVEIVFVDAEQVSAGGPAALEELDAVLVPGGFGERGSAGKIEAIRWARENRAPFFGICLGMQLATIEFARHVAGIEDAQSTEFDPEASQPVIDLMESQSEVTHKGGTMRLGAYDCELSANTLARRVYGRPRISERHRHRWEFNNAYMDRLREAGLIFCGMAPDGSLVEMVELPSSAHPYFIACQFHPEFKSRPTAPHPLFTAFI 532
>gi|167218351|ref|ZP_02287987.1| CTP synthetase [Listeria monocytogenes FSL J1-175] (533 aa)
Score = 1219, Expect = 1.0e-131, Identities = 243/527 (46%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFIN-SSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ+++   ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+   S  + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+A Q+HPEF S+   P  +F  F+  +
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKSDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDYRKSKQKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETKHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELADHPWFVACQYHPEFISRPNRPQSLFKDFVGAA 529
>gi|26988342|ref|NP_743767.1| CTP synthetase [Pseudomonas putida KT2440] >gi|148549373|ref|YP_001269475.1| CTP synthetase [Pseudomonas putida F1] >gi|37999635|sp|Q88MG1|PYRG_PSEPK CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|24983092|gb|AAN67231.1|AE016350_4 CTP synthase [Pseudomonas putida KT2440] >gi|148513431|gb|ABQ80291.1| CTP synthase [Pseudomonas putida F1] (542 aa)
Score = 1219, Expect = 1.0e-131, Identities = 241/527 (45%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   V    + KI+L T +E   + SL ++  IY +P  L  Q + + +   F ++  N      WD        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +     S L   DAILVPGGFG R +EGKI A+QYAREN +P+ GICLGMQ+A IEFARNV+   DA+STEF+ N+ +P++ ++          E ++  ++LGGT+RLG  +C+L  GSK+ + Y +  I ERHRHRYE N   +    + G V SG +++  LVE++E ++H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRIYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGSKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPVDASSRRKIALFTNVEERAVISLEDVDTIYKIPGVLHAQGLDDFVVERFGLQC-NGADLSEWDKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTSLLEGADAILVPGGFGLRGVEGKITAVQYARENKVPYLGICLGMQVAVIEFARNVMGWKDANSTEFDRNSGHPVVGLITEWADATGAVETRDEASDLGGTMRLGAQDCQLAAGSKVHDCYGKDVITERHRHRYEVNNNLLPQLVEAGLVVSGRSEDGALVEVVESKDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|93006699|ref|YP_581136.1| CTP synthetase [Psychrobacter cryohalolentis K5] >gi|119391155|sp|Q1Q9K1|PYRG_PSYCK CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|92394377|gb|ABE75652.1| CTP synthase [Psychrobacter cryohalolentis K5] (544 aa)
Score = 1219, Expect = 1.1e-131, Identities = 248/528 (46%), Positives = 352/528 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFL-NINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           TK + VTGGV SSLGKG+  +SL A+L+  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G YERFL +  + K +N T+GR+Y   + KER G++LG T+QV+PHIT+ I  KI+     Y  D  I+E+GGTVGDIES+PF+EA RQ+Q +  R++ M +H   +  + +  + KTKP QHSVK+L S G+ P++L+ RS   +S   + KI+L T +E   +    + + IY +P +L  Q + + I   F +++P       WD        P+     +A+VGKY + PDAY SI  +L  +    K D+ I++I++  L +++  +++L   DAILVPGGFG+R   GKI AI YARENN+P+ GICLGMQLA IE+ARNVL + DA+S+EF+  TA PII +          L+ ++ +++LGGT+RLG    EL  GSK+ +IY   +I ERHRHRYE N +Y++  E+ G   SG + + +LVE +EL +H +F+AVQFHPEFTS     +P+F SF+  +K
  S:     2 TKFIFVTGGVVSSLGKGITAASLAAVLEARGVNVTMTKMDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGYYERFLRHSKMSKSNNFTSGRIYQNVLNKERRGEYLGGTVQVIPHITDEIKSKILASGEGY--DVAIIEIGGTVGDIESLPFMEAVRQMQVELGRNRAMLMHLTLVPYIASAGETKTKPTQHSVKELRSIGLQPDILICRSDHHISQDNRRKIALFTNVEERAVIMCEDAQSIYQIPRTLHEQDLDDLICERFGLDLP-EADLSDWDKVVEAQLNPES-TVTVAMVGKYVELPDAYKSINEALLHAGITHKADVKIDYIDAERLEDDDSLLAQLHNADAILVPGGFGERGTMGKIKAITYARENNVPYLGICLGMQLAVIEYARNVLHI-DANSSEFDRKTAEPIIGLITEWLDERGELQIRSDDSDLGGTMRLGAQQAELVAGSKLAQIYGANNITERHRHRYEMNNRYIEPLEQAGMTVSGYSAKQHLVESVELADHPWFVAVQFHPEFTSSPRGGHPLFNSFVKAAK 538
>gi|193211772|ref|YP_001997725.1| CTP synthase [Chlorobaculum parvum NCIB 8327] >gi|193085249|gb|ACF10525.1| CTP synthase [Chlorobaculum parvum NCIB 8327] (565 aa)
Score = 1218, Expect = 1.3e-131, Identities = 242/528 (45%), Positives = 346/528 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAI---LVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+    + SN+T GRVY   I KER G++LG T+QVVPH+ + I +K+  L+     D LI E+GGT+GDIES+PFLEA RQL+ +   + V+ IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     +  +++  L + + IY +P  L  +++   +     ++       +HW  F   +  PK  +  I V GKY++ PDAY SII +   +       +S++ + +    +++ +    F+ +   LV  GFG R IEGK+  +QYARENNIPFFGICLGMQ ASIEFARNV  + DA+STEFN+    P+I ++E + +    GGT+RLG+Y C LK+GSK+ E+Y +  I ERHRHRYEFN ++  +FE+ G +FSG +    LVEIIEL+ H++F+AVQFHPE  S++   +P+F  F+  +K+
  S:     8 KHIFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDEPTSQASNLTMGRVYKSVIDKERRGEYLGGTVQVVPHVIDEIKEKMNDLAKNGSLDVLITEIGGTIGDIESLPFLEAMRQLKLELGDRNVLNIHLTFVPYIKAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVGHFCNVHEQDVIGLNDCETIYAVPLMLLREQLDLRVMKKLGLKKFREPNLEHWKRFCEKVTNPKDGEITIGVCGKYTEYPDAYKSIIEAFIHAGASNDVKVSVKMLRAEDAEDSSFNMNKAFEGVSGLLVAPGFGDRGIEGKVQFVQYARENNIPFFGICLGMQCASIEFARNVCDLPDANSTEFNKRARFPVIDLMEQQKKVKEKGGTMRLGSYPCILKEGSKVHEVYGKFLINERHRHRYEFNNQFRKLFEEKGMIFSGTSPNGELVEIIELKEHRWFVAVQFHPELKSRVQKVHPLFDGFVQAAKE 539
>gi|89897690|ref|YP_521177.1| CTP synthetase [Desulfitobacterium hafniense Y51] >gi|109647995|ref|ZP_01371898.1| CTP synthase [Desulfitobacterium hafniense DCB-2] >gi|119391101|sp|Q24MK9|PYRG_DESHY CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|89337138|dbj|BAE86733.1| hypothetical protein [Desulfitobacterium hafniense Y51] >gi|109641085|gb|EAT50640.1| CTP synthase [Desulfitobacterium hafniense DCB-2] (532 aa)
Score = 1218, Expect = 1.4e-131, Identities = 244/527 (46%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGS-DLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  S+LG +LK  G  V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF+++ + K SNVT G++Y+  + KER G +LG T+QV+PHIT  I ++I  ++ +  PD +I E+GGTVGDIES+P+LEA RQ+++   R  V+++H V LI  L  S +LKTKP QHSVK+L   GI PN+L+ R++ A+S  +KEK++L   I+ E I  +++ K IY +P ++  + + + +     +E P       W      I  P+  +  IA+VGKY + PDAYLS+  +L  +       + I ++NS  +  ++ +EL +    ILVPGGFG R IEGKI AI+YAREN IPF GICLGMQ A IEFARNV  M +A+S+EF+ +   P+I +L  +    + GGT+RLG    +L + + +  IY+ + I ERHRHRYE N ++    EK G  FSG + +  LVEI E  +H +F+A QFHPEF S+    +P+F  F+  +
  S:     2 TKFIFVTGGVVSSLGKGITASALGCLLKNRGLSVAIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDVPVSKNSNVTTGKIYWSVLNKERRGDYLGGTVQVIPHITNEIKERIYRVARENHPDIVITEIGGTVGDIESLPYLEAIRQMRSDIGRENVLYLH-VTLIPYLNASGELKTKPTQHSVKELRGIGIQPNILVCRTEHAISEDMKEKLALFCDIDREAIIQMVDAKSIYEVPLNILEEGMDDIVLKILGLEAPP-ADMTDWRAMVDRINNPQS-ETEIAIVGKYVELPDAYLSVAEALRHAGIEHLAKVKIRWVNSEEIEGSSAAELLKGVSGILVPGGFGNRGIEGKIEAIRYARENKIPFLGICLGMQTAVIEFARNVCGMTNANSSEFDVDAPYPVIDLLPEQKEIEDKGGTMRLGISPVKLIESTLVSSIYQDEVIYERHRHRYEVNNQFRAELEKGGLKFSGTSPDGRLVEITEYPDHPWFVASQFHPEFKSRPYRSHPLFREFVKAT 528
>gi|15606537|ref|NP_213917.1| CTP synthetase [Aquifex aeolicus VF5] >gi|24212095|sp|O67353|PYRG_AQUAE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|2983754|gb|AAC07314.1| CTP synthetase [Aquifex aeolicus VF5] (531 aa)
Score = 1218, Expect = 1.4e-131, Identities = 246/523 (47%), Positives = 347/523 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + +TGGV SSLGKG+  +S+ ++L+  G  V + K DPYLNVDAGTM+P QHGEV+VT DG ETDLD+G+YERF N  + +++NVTAGR+YY  I+KER G +LGAT+QV+PHITE I + I  +      D +IVE+GGTVGDIE +PFLEA RQL  +  R   MFIH   +  +    +LKTKP QHSVK+L + GI P++++ R+   +   +K KI+L T ++ E + S  +L+  Y +P  L+ Q +   I     +E    +    W    ++++ P++ +  +A+VGKY +  D+Y S+I +L       K  +++   NS  L+   ISEL E    I+VPGGFG+R I GKI A+ + RENNIP FGICLGMQL +IEFARNVL   +A+STEF+ +T  P+I I+E + +   LGGT+RLG Y C++K+ +    IY++  I ERHRHRYEFN +Y   FE  G VFSG + ++ LVEI+EL+NH +++  QFHPEF SK  +P+P+F  F+
  S:     3 KYIFITGGVLSSLGKGITSASIASILEEMGYRVTLQKLDPYLNVDAGTMSPYQHGEVYVTEDGAETDLDLGHYERFTNAVMTRDNNVTAGRIYYNVISKERKGDYLGATVQVIPHITEEIKESIKRVEK--DNDIVIVEIGGTVGDIEGLPFLEAVRQLSLELGRKNSMFIHLTYVPYIKAAGELKTKPTQHSVKELRAIGIQPDMIICRADRELPKGIKSKIALFTNVKEEAVISAPDLEFSYEVPLKLKEQGIDRIITERLNLE-HREVNLGKWKKIVNVLRNPEE-EVNVALVGKYVELKDSYKSVIEALIHGGIANKVKVNVILKNSEQLD---ISELQEDIHGIMVPGGFGERGIRGKIEALNFGRENNIPTFGICLGMQLMAIEFARNVLGFSNANSTEFDPDTPFPVIDIMEEQKKVDKLGGTMRLGAYPCKVKENTLAHRIYQKDLIYERHRHRYEFNNRYRKDFESKGVVFSGTSPDDKLVEIMELKNHMWYLGCQFHPEFKSKPFAPHPLFRDFI 520
>gi|53728883|ref|ZP_00134711.2| COG0504: CTP synthase (UTP-ammonia lyase) [Actinobacillus pleuropneumoniae serovar 1 str. 4074] (545 aa)
Score = 1218, Expect = 1.4e-131, Identities = 242/528 (45%), Positives = 346/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T  + VTGGV SSLGKG+A +SL ++L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y E + KER G +LGATIQV+PHIT  I +++I        D +IVEVGGTVGDIES+PFLEA RQL     R + +F+H   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS  A+ +  ++KI+L   +    + SL ++  IY +PE L++Q +   + + F+++ P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S  +    +  L   DAILVPGGFG R +EGKI   QYAREN IP+ GICLGMQ+A IE+ARNV  +  A+S+EF+++   P++ ++          E ++ E++LGGT+RLG   C L +G+K  E+Y  ++IVERHRHRYE N   +   E  G   S ++ +  LVEIIE+ NH +FIA QFHPEFTS     +P+F  F+  +K
  S:     3 TNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVLRKERRGDYLGATIQVIPHITNEIKERVI--EGGKGRDVVIVEVGGTVGDIESLPFLEALRQLAVDVGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAIPSNERKKIALFCNVPERAVISLKDVDSIYRIPELLKSQGLDTFVCDRFRLDCP-EADLSEWEQVLYRQANPTG-EVTIGMVGKYVELPDAYKSVNEALKHAGLTNRLTVNIKYIDSQDIETKGVELLHGLDAILVPGGFGYRGVEGKIRTAQYARENKIPYLGICLGMQIALIEYARNVAGLTQANSSEFDKDCPQPVVGLITEWQDESGNVETRSDESDLGGTMRLGAQQCHLIEGTKAREVYGAETIVERHRHRYEVNNTLLPQIEAAGLKVSSLSADRKLVEIIEIPNHPWFIAAQFHPEFTSTPRDGHPLFAGFVAAAK 537
>gi|167032177|ref|YP_001667408.1| CTP synthetase [Pseudomonas putida GB-1] >gi|166858665|gb|ABY97072.1| CTP synthase [Pseudomonas putida GB-1] (542 aa)
Score = 1217, Expect = 1.6e-131, Identities = 241/527 (45%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   V    + KI+L T +E   + SL ++  IY +P  L  Q + + +   F ++  N      WD        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +     S L   DAILVPGGFG R +EGKI A+QYAREN +P+ GICLGMQ+A IEFARNV+   DA+STEF+ N+ +P++ ++          E ++  ++LGGT+RLG  +C+L  GSK+ + Y +  I ERHRHRYE N   +      G V SG +++  LVE++E ++H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRIYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGSKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPVDASSRRKIALFTNVEERAVISLEDVDTIYKIPGVLHAQGLDDFVVERFGLQC-NGADLSEWDKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTSLLEGADAILVPGGFGLRGVEGKITAVQYARENKVPYLGICLGMQVAVIEFARNVMGWKDANSTEFDRNSGHPVVGLITEWADATGAVETRDEASDLGGTMRLGAQDCQLAAGSKVHDCYGKDVITERHRHRYEVNNNLLPQLVDAGLVVSGRSEDGALVEVVESKDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|22298310|ref|NP_681557.1| CTP synthetase [Thermosynechococcus elongatus BP-1] >gi|34222866|sp|Q8DKT7|PYRG_SYNEL CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|22294489|dbj|BAC08319.1| CTP synthetase [Thermosynechococcus elongatus BP-1] (543 aa)
Score = 1217, Expect = 2.0e-131, Identities = 240/529 (45%), Positives = 337/529 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G ++G T+QV+PHIT  I ++I+ ++    PD +I+E+GGTVGDIES+PFLEA RQ + +  R  V+F+H   +  + +  ++KTKP QHSVK+L S GI P++L+ R    +   +KEK+S    +  E +    + K IY +P  LE + +   + N   +E   +     W      +    +    +A+VGKY    DAYLS++ +L  S+  L  +L I ++NS  L EN + + LS   AI+VPGGFG R +EGKI AIQYARE  IPF G+CLGMQ A IE+AR++  + +A+S EF+ NT +P+I +L  +    +LGGT+RLG Y C L   S   ++Y    I ERHRHRYEFN  Y ++F + G+  +G + +  LVEIIE   H FFIAVQFHPEF S+  +P+P+FY  L  + K
  S:     2 TKYVFVTGGVVSSIGKGIVAASLGRLLKSRQYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTDTPMSRLNSVTTGSIYQAVINKERRGDYMGGTVQVIPHITNEIKERILRVAKDKNPDVVIIEIGGTVGDIESLPFLEAIRQFRTEVGRHHVLFMHVTLVPWIPSAGEMKTKPTQHSVKELRSIGIQPDILICRCDRPLVPGIKEKLSQFCDVPVECVIPSPDAKSIYEVPLLLEREGLATQVLNLLNLE-QRQPDLSQWQALVERLYGSHR-PLEVAIVGKYVRLSDAYLSVVEALRHSAIALDQELRIRWVNSEELVENGVETALSNVGAIVVPGGFGIRGVEGKIAAIQYAREQGIPFLGLCLGMQCAVIEWARHIAGLENANSAEFDANTPHPVIHLLPEQQDIVDLGGTMRLGLYACRLAPHSLAEKLYGETVIYERHRHRYEFNNAYRNLFLETGYQITGTSPDGRLVEIIEYPAHPFFIAVQFHPEFRSRPNAPHPLFYGLLAAAAK 530
>gi|146300138|ref|YP_001194729.1| CTP synthetase [Flavobacterium johnsoniae UW101] >gi|146154556|gb|ABQ05410.1| CTP synthase [Flavobacterium johnsoniae UW101] (537 aa)
Score = 1215, Expect = 2.7e-131, Identities = 241/526 (45%), Positives = 349/526 (66%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIG--YKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           ++TK + VTGGV SSLGKG+  +SL  +L+  G    I KFDPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +NVT GRVY   I KER G+FLG T+QVVPHIT  I  ++ LL      D +I E+GGTVGDIES+P++E+ RQL  +   +  + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S +L++K++L   ++ E +   I+   IY +P  +  + +   +    K+++P +     K+W+TF   +K PK+    I +VGKY +  D Y SI+ +   +    +T +++  I+S  +N +N+ E L   D +LV  GFG+R IEGKI A++Y RENNIPFFGICLGMQ++ IE++RN+L   DA+STE NE T +P++ ++E +   T+ GGT+RLG + C++K  +    IY  K+I ERHRHRYE+N KY D  +K G   SG+N +  LVEI+ELENH FFI VQ+HPE+ S + +P+PIF +F+
  S:     2 NQTKYIFVTGGVTSSLGKGIIAASLAKLLQGRGYRTTIQKFDPYINVDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNVPTSQANNVTTGRVYLSVIEKERRGEFLGKTVQVVPHITNEIKDRMQLLGKSGDYDIVITEIGGTVGDIESLPYIESVRQLVWELGENNGIVIHLTLVPYLAAAGELKTKPTQHSVKTLMESGIKADILVCRTEHELSQELRQKLALFCNVKKEAVIQSIDASTIYEVPNLMLEEGL--DVVALKKLDLPKKASPDLKNWNTFLKRLKSPKQ-TVNIGLVGKYVEMQDCYKSILEAFIHAGAANETKVNVISIHSEHINADNVEEKLGTLDGVLVAPGFGERGIEGKIEAVRYVRENNIPFFGICLGMQMSVIEYSRNILGYADANSTEMNEKTPHPVVNLMEEQKNITDKGGTMRLGAWKCDIKPNTLAHRIYGEKTISERHRHRYEYNNKYADELQKAGLKASGVNPDTGLVEIVELENHPFFIGVQYHPEYKSTVANPHPIFVNFV 528
>gi|148378138|ref|YP_001252679.1| CTP synthase [Clostridium botulinum A str. ATCC 3502] >gi|153934153|ref|YP_001382539.1| CTP synthetase [Clostridium botulinum A str. ATCC 19397] >gi|153937013|ref|YP_001386091.1| CTP synthetase [Clostridium botulinum A str. Hall] >gi|148287622|emb|CAL81687.1| CTP synthase [Clostridium botulinum A str. ATCC 3502] >gi|152930197|gb|ABS35697.1| CTP synthase [Clostridium botulinum A str. ATCC 19397] >gi|152932927|gb|ABS38426.1| CTP synthase [Clostridium botulinum A str. Hall] (533 aa)
Score = 1215, Expect = 2.8e-131, Identities = 241/527 (45%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + +NVT G++Y+  I+KER G +LGAT+QV+PHIT  I  ++  ++ + + D +I E+GGT+GDIES+PFLE+ RQ++ +  R  V FIH   L  L    +LKTKP QHSVK+L   GI P++++ RS+  +  +LK KI L   ++ E++   ++ +++Y +P  L  + +   +     +   ++I    W +  +  K   K    IA+VGKY +  DAY+SI+ +L    +   T ++I++INS  +NENN  + L + D ILVPGGFG R IEGKI A ++AREN IPF GICLGMQ A IEFARNVL    A S E + NT  P+I ++  +    N+GGT+RLG Y C+L  G+   + Y ++ + ERHRHRYEFN +Y     + G + SG + ++ LVEI+E+ NH +++AVQFHPE  S+   P+P+F  F+  +
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSQNNNVTTGKIYWSVISKERKGDYLGATVQVIPHITTEIKSRVYRVAKEKEVDVVITEIGGTIGDIESLPFLESIRQIKYEVGRENVCFIHVTLLPFLGKAGELKTKPTQHSVKELRGIGIQPDIIVCRSEKQIPEELKGKIGLFCNVDKEDVIQNLDAENLYEVPLMLHKENLDTLVCKKLGLNY-SKIDNTEWISMVNNAKNLSK-NTTIALVGKYVELHDAYISIVEALNHGGYANDTKVNIKWINSEEVNENNFEQYLKDVDGILVPGGFGDRGIEGKIWAAKWARENKIPFLGICLGMQCAVIEFARNVLNYKGAHSAEIDPNTKYPVIDLMPEQKDIDNMGGTMRLGAYPCKLLKGTNSEKAYGQEIVYERHRHRYEFNNEYRSKLTEAGLILSGTSPDDRLVEIVEINNHPWYVAVQFHPELKSRPNKPHPLFKDFVKAT 529
>gi|163846697|ref|YP_001634741.1| CTP synthetase [Chloroflexus aurantiacus J-10-fl] >gi|187602627|ref|ZP_02988851.1| CTP synthase [Chloroflexus sp. Y-400-fl] >gi|163667986|gb|ABY34352.1| CTP synthase [Chloroflexus aurantiacus J-10-fl] >gi|187485447|gb|EDU23424.1| CTP synthase [Chloroflexus sp. Y-400-fl] (546 aa)
Score = 1215, Expect = 3.0e-131, Identities = 240/531 (45%), Positives = 344/531 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLN-ENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           TK + VTGGV SS+GKG+  +S+G +LK  G  V +MK DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF+++NL + SNVT G++Y   IAKER G +LG TIQV+PHIT  I  +I  L+   Q D +IVE+GGTVGDIES+PFLEA RQ++    R  +++IH   L  + TG +LKTKP QHSV  L + GI  +++L R+   + ++++EKI+    ++   +  +  +  IY +P  LE+  + + +    ++ +P      + W    + I++ K+ +  IA+VGKY +  DAY+S++ +L  +      D+ I +I +  +  E     LS    ILVPGGFG+R IEGKI A  YAR + IP+ G+CLGMQ A+I FAR+VL  HD +STEFN  TA+P+I ++  +   T  GGT+RLG Y C+L  G++    Y    + ERHRHR+EFN +Y  + E  G V SGI+ +  LVEIIEL +H +++A QFHPEF S+   P+P+F  F+  + + +
  S:     2 TKYIFVTGGVVSSVGKGIGVASIGRLLKSRGLSVSVMKLDPYLNVDPGTMSPYQHGEVFVTADGAETDLDLGHYERFIDVNLSRLSNVTTGQIYSAVIAKERRGDYLGGTIQVIPHITNEIKSRIGSLARSSQADVVIVEIGGTVGDIESLPFLEAIRQMRKDVGRDNILYIHVTLLPHISTG-ELKTKPTQHSVMALRNVGISADIILCRADRPIDDEIREKIAFFADVDVRAVIPVPTVDSIYEVPLVLEDMGLGDYLVE--RLGLPATPPDLEEWRALVARIRQEKR-RVPIALVGKYVELHDAYISVVEALHHAGLEQSIDIDIRWIAAEEVEREGPARLLSGVYGILVPGGFGERGIEGKIAAADYARIHGIPYLGLCLGMQCATIAFARHVLGTHDVNSTEFNPQTAHPVIDLMPDQRDITEKGGTMRLGLYPCDLVPGTRAHAAYGCDRVEERHRHRFEFNNRYRSVLEAAGLVISGISPDKRLVEIIELRDHPWYVASQFHPEFQSRPGKPHPLFRGFVAAAAQTL 531
>gi|29346000|ref|NP_809503.1| CTP synthetase [Bacteroides thetaiotaomicron VPI-5482] >gi|81445368|sp|Q8AA75|PYRG_BACTN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|29337894|gb|AAO75697.1| CTP synthase (UTP-ammonia ligase) [Bacteroides thetaiotaomicron VPI-5482] (537 aa)
Score = 1215, Expect = 3.1e-131, Identities = 241/528 (45%), Positives = 345/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTF-----TSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+G +L+  G  V I KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFL I   K +N+T GR+Y   I KER G +LG TIQV+PHIT+ I + + LL NKY+ DF+I E+GGTVGDIES+P+LE+ RQL+ +     + +H   +  L    +LKTKP QHSVK+L S GI P++L++R++  +S+ L++K++    ++++ +   I+ + IY +P  ++ Q + ++I     + V    G   W  F      +  KEP      IA+VGKY D  DAY SI  +L  +  Y    + + F+NS  L + N++E L     +++  GFG+R I+GK +AI+Y R ++IP FGICLGMQ  +IEFARNVL   DADS E +E T + +I I+E +   TN+GGT+RLG Y C L+ GSK    Y  + I ERHRHRYEFN  Y   +E  G    GIN E++LVEI+E+   K+FI  QFHPE++S +L+P+P+F +F+  +
  S:     3 ETKYIFVTGGVASSLGKGIISSSIGKLLQARGYNVTIQKFDPYINIDPGTLNPYEHGECYVTVDGHEADLDLGHYERFLGIQTTKANNITTGRIYKSVIDKERRGDYLGKTIQVIPHITDEIKRNVKLLGNKYKFDFVITEIGGTVGDIESLPYLESIRQLKWELGKNALCVHLTYVPYLAAAGELKTKPTQHSVKELQSVGIQPDVLVLRAEHPLSDGLRKKVAQFCNVDDKAVVQSIDAETIYEVPLLMQAQGLDSTILEKMGLPVGETPGLGPWRKFLERRHAAETKEP----INIALVGKY-DLQDAYKSIREALSQAGTYNDRKVEVHFVNSEKLTDENVAEALKGMAGVMIGPGFGQRGIDGKFVAIKYTRTHDIPTFGICLGMQCIAIEFARNVLGYADADSREMDEKTPHNVIDIMEEQKAITNMGGTMRLGAYECVLQKGSKAYLAYGEEHIQERHRHRYEFNNDYKAQYEAAGMKCVGINPESDLVEIVEIPALKWFIGTQFHPEYSSTVLNPHPLFVAFVKAA 531
>gi|190571612|ref|YP_001975970.1| CTP synthase [Wolbachia pipientis] >gi|190357884|emb|CAQ55343.1| CTP synthase [Wolbachia pipientis] (535 aa)
Score = 1214, Expect = 3.8e-131, Identities = 252/528 (47%), Positives = 347/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQ-KVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI------SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  SS+GA+L+  G  V I K DPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF  I   K+ N+T G+VY + + KER G +LG T+Q++PH+T+ I  K  + +     DF+I E+GGTVGDIES PFLEA RQ+  K  + +V+ IH   +  L    +LKTKP QHSV++L SAG+ P+++L RS+  +S+  KEKI+    +   N+    ++ HIY LP SL NQ  +   I + F +  P +     WD     +K P + +  +++VGKY++ PDAY S+I +L   +   K  + I ++NS   N  +I       +L   +++LVPGGFG   IEGKILAI YAR NNIPF GICLGMQLA IEFARNV+K+ D  S EF     +PII + +GKN   +LGGT+RLG Y C +   SK+  +Y   +I ERHRHRY  N  Y +  E++G + SGI+++   +E +EL+NH +FI VQFHPEF S+  SP+P+F SF+  +
  S:     3 ETKFIFVTGGVVSSLGKGLVASSVGALLQAHGFNVRIRKLDPYLNIDPGTMSPAQHGEVFVTEDGAETDLDLGHYERFTKIKATKDDNITTGKVYNKLLKKERCGDYLGKTVQIIPHVTDLI--KSFIFNGTEDLDFVICEIGGTVGDIESQPFLEAIRQVNYKLGKQKVILIHLTLIPYLTAAQELKTKPTQHSVRELNSAGLQPDIILCRSEKEISDNQKEKIANLCNVSLSNVIPAPDVNHIYELP-SLYNQCGLGAQILDHFHLSKP-KPSLPEWDQIVHSMKHPTQ-EVIVSIVGKYTEFPDAYKSLIEALNHGAISNKARVKINWVNSREENGKSIDAKFIREKLQSSNSVLVPGGFGDNGIEGKILAINYARVNNIPFLGICLGMQLAVIEFARNVIKLEDVHSEEF-YTCKHPIIKLADGKN--VDLGGTMRLGTYKCNVNPNSKMANVYSSVTISERHRHRYIVNLDYKNNLEENGMICSGISEDKTCIEAVELKNHSWFIGVQFHPEFQSRPFSPHPLFTSFIKAT 530
>gi|50365463|ref|YP_053888.1| CTP synthetase [Mesoplasma florum L1] >gi|81391690|sp|Q6F0G9|PYRG_MESFL CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|50364019|gb|AAT76004.1| CTP synthase (UTP-ammonia ligase) [Mesoplasma florum L1] (532 aa)
Score = 1214, Expect = 3.9e-131, Identities = 254/523 (48%), Positives = 346/523 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGN-YNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV S LGKG+  SSLG +LK  G +V + KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  L K S+ +AG++Y ETI  ER G + G TIQVVPHIT++I  K+   +     D +I E+GGTVGDIES PF+EA RQ++ +  +  V+FIH   L+ L    + KTKP+Q SVK+L+S GI P++++ R+    S ++KEKISL   I   N+   I+ + IY +P  +  Q +   + +  ++    +   + W  F   IK  K+ +  +  VGKY +  DAYLS+I SL+I+ +  K  L I +I +  LNE+N  E L     ILVPGGFG R IEG ILA ++AREN+IP+ GICLGMQ+A+I  AR+ L + +A+STEF+ + A PI   + G + + NLGGTLRLG  Y   +K+G+K  ++Y  + + ERHRHRYEFN +Y    E+ G VFSGI +E  LVEIIEL NH FF+  Q+HPEFTS+   PNP+F  F+
  S:     3 KFVFVTGGVVSGLGKGITASSLGNLLKASGLKVFMQKFDPYLNVDPGTMSPYQHGEVFVTDDGGETDLDLGHYERFIDEKLTKMSSTSAGKIYLETINAERRGDWGGQTIQVVPHITDSIKNKVYQAAKTSGADVIISEIGGTVGDIESQPFIEAIRQIRMEQGKENVVFIHVALLLYLNASKEYKTKPIQMSVKELLSLGIQPDIIVQRTDKHSSKEIKEKISLFCNIPTSNVIDAIDKESIYEVPLEMYEQNLHGLVLDQLQIRT-KKTDMESWIKFCEKIKASKE-EFEVTFVGKYIELQDAYLSVIESLKIAGYEFKRKLKINWIQADKLNESNYKEVLQNAKGILVPGGFGDRGIEGMILASKFARENSIPYLGICLGMQIATISIARDWLNLPEANSTEFDHSGAVPIFDFIRGIDVQ-NLGGTLRLGAFYKTTIKEGTKAEKLYGSREVFERHRHRYEFNNEYKKALEEKGLVFSGIYEEKKLVEIIELPNHPFFVGSQYHPEFTSRPNKPNPLFKGFV 525
>gi|186455964|ref|ZP_02966278.1| CTP synthase [bacterium Ellin514] >gi|184208042|gb|EDU05087.1| CTP synthase [bacterium Ellin514] (547 aa)
Score = 1214, Expect = 4.0e-131, Identities = 244/526 (46%), Positives = 343/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQ--LQAKYRSQVMFIHT--VPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKH-IYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           +  K + VTGGV SSLGKG+  ++LG +L+  G +V + KFDPYLNVD GTM+P QHGEV+V  DG ETDLD+G+YERF N+ L + +N+T+G+VY   + KER G +LG T+QV+PH+T+ I  +I  L+ + + D +I E+GGT GDIE +PFLEA R+  L+  Y S  +F+H   VP I+     +LKTKP Q SV  L   GI P++L+ R +  +   L++KIS+   +  E +    ++ H IY +P  L+ +++ + +     ++VP      HW      +  P+ ++ RI VVGKY +  DAY S+  ++          + I  +++  +  +   + L     ILVPGGFG+R IEGKILA +YARENNIP+ G+CLGMQ+A+IEFARNVLK+  A STEF+ N+ +P+I +L+G+ + T  GGT+RLG+  C+L  GSK  ++Y    I ERHRHRYEFN  Y D FEK GF+ SG   E  LVE+IELE H FFIA QFHPEF SK   P+P+F  F+
  S:     9 NNMKYIFVTGGVVSSLGKGLTAAALGTLLENRGLKVTLQKFDPYLNVDPGTMSPYQHGEVYVLDDGAETDLDLGHYERFTNVKLTRTNNLTSGQVYQTVLDKERRGDYLGKTVQVIPHVTDEIKMRIRTLAEQSKADVVITEIGGTTGDIEGLPFLEAIREFALEVGY-SNALFLHVTYVPFIK--AAGELKTKPTQQSVAKLREIGITPHILVCRCERPLDKDLRQKISMYCNVPFEAVIEEKDVDHSIYEVPLMLQRERLDDLVCRMLHLDVPAP-NMTHWQEIIRKLIAPQ-HRVRIGVVGKYIELNDAYKSVYEAIIHGGVANDCGVEIHKVDAEDIERDGPDKILKGLGGILVPGGFGERGIEGKILAAKYARENNIPYLGLCLGMQIATIEFARNVLKLDKAHSTEFDLNSPHPVIAMLDGQTKVTKKGGTMRLGSQACQLVMGSKSAQLYGAFVINERHRHRYEFNNAYRDRFEKAGFLISGTTPEGKLVEVIELEKHPFFIACQFHPEFQSKPHKPHPLFRGFI 535
>gi|68171294|ref|ZP_00544694.1| CTP synthase [Ehrlichia chaffeensis str. Sapulpa] >gi|88658204|ref|YP_506996.1| CTP synthetase [Ehrlichia chaffeensis str. Arkansas] >gi|119391105|sp|Q2GHT7|PYRG_EHRCR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|67999275|gb|EAM85924.1| CTP synthase [Ehrlichia chaffeensis str. Sapulpa] >gi|88599661|gb|ABD45130.1| CTP synthase [Ehrlichia chaffeensis str. Arkansas] (532 aa)
Score = 1214, Expect = 4.0e-131, Identities = 247/527 (46%), Positives = 354/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENN--LVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +S+GA+L+  G ++ + K DPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF  +   K  N+T G+VY+  + KER G +LG T+Q++PH+T+ I+  I+  ++K   DF+I E+GGTVGDIES PFLE+ RQ+  K  ++  +F+H   +  +    +LKTKP QHSVK+L S GI P+++L RSK  +S + ++KI+    + + NI   +++K+IY LP S  N  +   I N F ++ P     + W+   ++     K    +A++GKY    DAY S+I +LE +S + K  LSI++I+S SL+ N I+   + D+IL+PGGFG   I+GK+ AI YAR N IPF GIC+GMQLA IEFA NV  + DA+STEFN    NP+I  L  + ++  LGG+++LG+  C L+ GSKI  IY++  I ER RHRY FN +Y D+ E+HG +F+G +  NN  L+E+IEL++H +FI VQFHPEF S     +P+F SF+  S
  S:     6 TRFIFVTGGVVSSLGKGLAAASIGALLQARGFKICLRKLDPYLNIDPGTMSPIQHGEVFVTDDGAETDLDLGHYERFTGVKTTKNDNITTGKVYHNLLKKERRGDYLGQTVQIIPHVTDLINSFILHDTDKL--DFVICEIGGTVGDIESQPFLESIRQIGYKLSKNNTIFVHLTLVPYIDAAMELKTKPTQHSVKELSSVGIQPDIILYRSKIPLSKEQRDKIANLCNVSSTNIIPALDVKNIYELPISYHNYNLDTQILNHFNIDSPEP-DLRKWENILNISHAVTK-TVNVAIIGKYIKLLDAYKSLIEALEHASIHNKVKLSIKWIDSRSLDSNEINIFDKVDSILIPGGFGDDGIQGKMTAITYARLNKIPFLGICMGMQLAIIEFANNVAHLEDANSTEFNLYCKNPVIHQLP-ELQQNFLGGSMKLGSCPCYLESGSKIFSIYQQSIIHERRRHRYAFNLQYKDLLEQHGLIFTGKSNNNNDSLIEVIELKDHPWFIGVQFHPEFKSSPFHSHPLFISFIKAS 530
>gi|78356808|ref|YP_388257.1| CTP synthetase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] >gi|119391100|sp|Q310T4|PYRG_DESDG CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|78219213|gb|ABB38562.1| CTP synthase [Desulfovibrio desulfuricans G20] (548 aa)
Score = 1214, Expect = 4.1e-131, Identities = 239/530 (45%), Positives = 348/530 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL-----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           KTK + +TGGV SSLGKG+A +S+GA+L+  G +V I K DPY+NVD GTM P QHGEV+VT DG ETDLD+G+YER+L I + + +N T+G +Y+  I KER G +LG T+QV+PHIT+ I   I+ L++    D  +VE+GGTVGDIE  PFLEA RQL++   R + M+IH   +  L    + KTKP QHSVK+L S GI P+++L R + AV++ LK KI+L   +E + ++S +++K+IY +P S   +     I    ++   N      W         P+  K  I +VGKY D  +AY S+  +L       K  + ++++NS  + + N++E L+  D ILVPGGFG R +EGKI AI+YAREN +PFFGICLGMQ A IEFARNV  +  A+S EF+E T + +I ++           E ++  +  GGT+RLG+Y C +  G+     Y+ + + ERHRHR+EFN  Y+D  ++ G VFSG++ +  LVE++E+++H +F+  QFHPEF S  ++P+P+F  F+  + K
  S:     2 KTKFIFITGGVLSSLGKGLAAASVGALLQARGLKVTIQKLDPYINVDPGTMNPFQHGEVYVTDDGAETDLDLGHYERYLGIPMNQRNNYTSGSIYHRVITKERRGDYLGGTVQVIPHITDEIKSVIMNLASD-DLDVALVEIGGTVGDIEGQPFLEAIRQLRSDLGRDRCMYIHLTLVPYLAAAGEHKTKPTQHSVKELRSIGIQPDIILCRCEKAVTDDLKHKIALFCNVEKDAVFSAVDVKNIYEVPLSFYEEGFDQKIAIMLQLPAKNP-DLSKWQELVDTCANPQG-KVTIGIVGKYVDLKEAYKSLHEALIHGGVANKLAVELKYVNSELITDENVAESLAGLDGILVPGGFGSRGVEGKIRAIRYARENKVPFFGICLGMQCAVIEFARNVAGLPAANSEEFDEQTPDKVIYLMTEWFDFRSKQVERRDSGSEKGGTMRLGSYPCAVVKGTNAFTAYQAEKVDERHRHRFEFNNAYLDKLKEAGLVFSGLSPDGELVEMVEIKDHPWFLGCQFHPEFKSYPMTPHPLFREFIKAAGK 541
>gi|127512136|ref|YP_001093333.1| CTP synthetase [Shewanella loihica PV-4] >gi|126637431|gb|ABO23074.1| CTP synthase [Shewanella loihica PV-4] (545 aa)
Score = 1213, Expect = 4.6e-131, Identities = 250/524 (47%), Positives = 348/524 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L      D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+ +  K KISL   +E   + SL ++  IY +P  L+ Q + + +   F +E         W+        P   +  I +VGKY++ PDAY S+  +L+ +  + +  ++I++I+S ++       L   D ILVPGGFG+R +EGKI+A QYARENN+P+FGICLGMQ+A IEFAR+V  + +A STEFN++T +P++ +          +E ++ E++LGGT+RLG   C L +G+K  E YK  + VERHRHRYE N  Y +  EK G VFSG++ +  LVE+IEL NH +F+A QFHPEFTS      P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINLDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKV--LEGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLVCRGDRAIPSNEKAKISLFCNVEERAVISLKDVDSIYKIPALLKAQGLDDLVTKRFGLEC-READLSEWENVIYQEANPTG-EVTIGMVGKYTELPDAYKSVNEALKHAGLFNRVSVNIKYIDSQNIEAKGTEVLEGLDGILVPGGFGERGVEGKIMAAQYARENNLPYFGICLGMQVALIEFARHVAGLENAHSTEFNKDTPHPVVGLITEWIDEKGNIEQRHEESDLGGTMRLGAQLCHLIEGTKAAEAYKGLTCVERHRHRYEVNNTYRERLEKAGLVFSGLSTDRQLVEMIELPNHPWFVAGQFHPEFTSTPRDGQPLFQGFV 533
>gi|152995327|ref|YP_001340162.1| CTP synthetase [Marinomonas sp. MWYL1] >gi|150836251|gb|ABR70227.1| CTP synthase [Marinomonas sp. MWYL1] (544 aa)
Score = 1213, Expect = 4.7e-131, Identities = 252/529 (47%), Positives = 360/529 (68%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + K +N T+GRVY   + KER G++LG T+QV+PHIT+ I +++I  S     D  +VE+GGTVGDIES PFLEA RQL+ +    R+  M +  VP I   T  + KTKP QHSVK+L S GI P++L+ RS+ ++    ++KI+L T +E   + SL +   IY +P+ L +Q + + I  +F +  ++PN      W+  T     P+K +  IA+VGKY +  DAY S+I +++ +  + +T + + +I+S S+ E     L   DAILVPGGFG+R +EGKIL  QYAREN +P+ GICLGMQ+A IEFARNV  +  A STEFN    NP++ ++          E ++ E++LGGT+RLG  NC L +G+K L+ Y +  I ERHRHRYE N  Y+D  EK G   SG +++N+LVE+IE+ +H +F+A QFHPEFTS     + +F +F++ + K
  S:     3 TRYIFVTGGVVSSLGKGLAAASLAAILESRGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFISTKMGKRNNFTSGRVYQHVLKKERRGEYLGGTVQVIPHITDEIKRRVI--SGAEGSDVALVEIGGTVGDIESQPFLEAIRQLKVELGPRRALFMHLTLVPYIR--TAGETKTKPTQHSVKELRSIGIQPDILICRSEVSIEAPERKKIALFTSVEERAVISLPDADTIYRIPQMLNDQGLDSLIVEYFNLDCDMPN---LDIWNKVTQAKLNPEK-QINIAMVGKYMELLDAYKSLIEAMDHAGIHARTKVKLHYIDSESIEEKGTEVLKGMDAILVPGGFGERGVEGKILTAQYARENKVPYLGICLGMQVAVIEFARNVANLAGAHSTEFNLKAENPVVGLITEWTNAEGSKEIRSEESDLGGTMRLGAQNCNLTEGTKALDAYGKAVIKERHRHRYEVNNFYVDALEKAGLTISGRSEDNSLVEMIEIADHPWFVACQFHPEFTSTPRYGHGLFSAFVHAALK 538
>gi|104783177|ref|YP_609675.1| CTP synthetase [Pseudomonas entomophila L48] >gi|95112164|emb|CAK16891.1| CTP synthase [Pseudomonas entomophila L48] (542 aa)
Score = 1213, Expect = 4.7e-131, Identities = 240/527 (45%), Positives = 343/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   V    + KI+L T +E   + SL ++  IY +P  L  Q + + +   F ++  N      WD        P++ +  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +     S L   DAILVPGGFG R +EGKI A+QYAREN +P+ GICLGMQ+A IEFARNV+   DA+STEF+ N+ +P++ ++          E +   ++LGGT+RLG  +C++  GSK+ + Y +  I ERHRHRYE N   +      G V SG +++  LVE++E ++H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRIYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGSKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPVDASSRRKIALFTNVEERAVISLEDVDTIYKIPGVLHAQGLDDFVVERFGLQC-NSADLSEWDKVVDAKLNPEQ-EVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTSLLEGADAILVPGGFGLRGVEGKITAVQYARENKVPYLGICLGMQVAVIEFARNVMGWKDANSTEFDRNSGHPVVGLITEWADATGAVETRTEASDLGGTMRLGAQDCQIVAGSKVHDCYGKDVITERHRHRYEVNNNLLPQLMDAGLVVSGRSEDGALVEVVESKDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|71066196|ref|YP_264923.1| CTP synthetase [Psychrobacter arcticus 273-4] >gi|119391154|sp|Q4FR69|PYRG_PSYA2 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|71039181|gb|AAZ19489.1| CTP synthase [Psychrobacter arcticus 273-4] (544 aa)
Score = 1213, Expect = 4.9e-131, Identities = 249/528 (47%), Positives = 352/528 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFL-NINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           TK + VTGGV SSLGKG+  +SL A+L+  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G YERFL +  + K +N T+GR+Y   + KER G++LG T+QV+PHIT+ I  KI+     Y  D  I+E+GGTVGDIES+PF+EA RQ+Q    ++R+ +M +  VP I   +  + KTKP QHSVK+L S G+ P++L+ RS   +S   + KI+L T +E   +    + + IY +P +L  Q + + I   F +++P       WD        P+     +A+VGKY + PDAY SI  +L  +    K D+ I++I++  L +++  +++L   DAILVPGGFG+R   GKI AI YAREN +P+ GICLGMQLA IE+ARNVL + DA+S+EF+  TA PII +          L+ ++ +++LGGT+RLG    EL  GSK+ +IY   +I ERHRHRYE N +Y++  E+ G   SG + + +LVE +EL +H +F+AVQFHPEFTS     +P+F SF+  +K
  S:     2 TKFIFVTGGVVSSLGKGITAASLAAVLEARGVNVTMTKMDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGYYERFLRHSKMSKSNNFTSGRIYQNVLNKERRGEYLGGTVQVIPHITDEIKSKILASGEGY--DVAIIEIGGTVGDIESLPFMEAVRQMQVELGRHRAMLMHLTLVPYIA--SAGETKTKPTQHSVKELRSIGLQPDILICRSDHHISPDNRRKIALFTNVEERAVIMCEDAQSIYQIPRTLHEQDLDDLICERFGLDLP-EADLSDWDKVVEAQLNPES-TVTVAMVGKYVELPDAYKSINEALLHAGITHKVDVKIDYIDAERLEDDDSLLAQLHNADAILVPGGFGERGTMGKIKAITYARENKVPYLGICLGMQLAVIEYARNVLHI-DANSSEFDRKTAEPIIGLITEWLDERGELQIRSDDSDLGGTMRLGAQQAELVAGSKLAQIYGATNITERHRHRYEMNNRYIEPLEQAGMTISGYSAKQHLVESVELADHPWFVAVQFHPEFTSSPRGGHPLFNSFVKAAK 538
>gi|146329618|ref|YP_001209279.1| CTP synthetase [Dichelobacter nodosus VCS1703A] >gi|146233088|gb|ABQ14066.1| CTP synthase [Dichelobacter nodosus VCS1703A] (544 aa)
Score = 1213, Expect = 5.2e-131, Identities = 248/524 (47%), Positives = 345/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIH--TVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + +TGGV SSLGKG++ +SLGA+L+  G  + ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+N+   +  N TAGRVY E I +ER G +LG T+QV+PHIT+ I Q I  L      D  +VE+GGTVGDIES+PF+EA RQL  K  R   MFIH   VP I      +LKTKP QHSVK+L S GI P++L+ R+   +    K KISL T +  + + S +++K+IY +P   + Q V + +   F + V        W+     I  P +++  +A+VGKY +  DAY S+  +L  +    KT ++I +++S  L       L+  DAI+VPGGFG R + GK+ A+QYARE NIP+ GICLG+Q+A +EFARNVL + +A STE++E T  PII +          +E ++++ +LGGTLRLG    +LK GSKI  IY  + + ERHRHRYE N  Y    E  G   SG + +N+LVE+IE+ +H++FI +Q HPEFTS  L  +P+F +F+
  S:     2 TQYIFITGGVVSSLGKGISAASLGAILEARGLRITMIKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFVNMRATQFHNCTAGRVYLEVIQRERKGDYLGKTVQVIPHITDTIQQYI--LRAAQGADIAMVEIGGTVGDIESLPFMEAIRQLGTKLGRRDTMFIHLTLVPFIS--AAGELKTKPTQHSVKELRSIGIQPDMLICRADREIPEDEKAKISLFTNVPAKAVISGLSVKNIYEIPMLYQKQGVDDLVVKHFGLHV-KEANLGDWEKVVDAINHP-EHEVTVAMVGKYVNLTDAYKSLNEALYHAGIKNKTKVNIRYVDSEDLYSQGTELLAGVDAIVVPGGFGNRGVNGKLRAVQYAREENIPYLGICLGLQIAVVEFARNVLGIKNACSTEWDEKTDEPIIALVAQWVNERGEVEQRDKKMDLGGTLRLGALPAKLKAGSKIATIYGSEIMNERHRHRYEVNANYEKRLEAAGMRISGRSADNDLVEVIEIPSHRWFIGLQSHPEFTSTPLGGHPLFSAFI 532
>gi|83644692|ref|YP_433127.1| CTP synthetase [Hahella chejuensis KCTC 2396] >gi|119391113|sp|Q2SKX2|PYRG_HAHCH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|83632735|gb|ABC28702.1| CTP synthase [Hahella chejuensis KCTC 2396] (542 aa)
Score = 1213, Expect = 5.3e-131, Identities = 238/527 (45%), Positives = 350/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T GRVY   + KER G +LG T+QV+PHIT+ I ++I+        D  +VE+GGTVGDIES+PFLEATRQL+ +  S + +F+H   +  + T  ++KTKP QHSVK++ S G+ P++L+ RS+ ++    + KI+L T +E   + +L + K IY +P  L  Q +   I   F +E  P  +    W +       P +++  IA+VGKY +  DAY S+I +L+ +    KT ++I +I+S  + +  +  L   DAILVPGGFG+R +EGKI  ++YAREN IP+ GICLG+Q+A IE+AR+V  M DA STEFN  +A+P++ ++          E ++  ++LGGT+RLG   C+L DGS + E Y +  I ERHRHRYE N   +   E+ G   +G +++ +LVE++E+++H +F+A QFHPEF S     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIRTTMTKRNNFTTGRVYETVLRKERRGDYLGGTVQVIPHITDEIKRRIV--EGAGDADVALVEIGGTVGDIESLPFLEATRQLKVEVGSRRALFMHLTLVPYIATAGEVKTKPTQHSVKEMRSIGLQPDILVCRSEHSIDQSSRRKIALFTNVEERAVIALEDAKSIYSIPMMLHAQGLDEIIVERFGLECGPADL--SEWQSVVDNEANP-EHEVTIAMVGKYMELLDAYKSLIEALKHAGIRNKTKVNIRYIDSEQVYQQGVDLLKGVDAILVPGGFGERGVEGKIQTVRYARENKIPYLGICLGLQVAVIEYARHVAGMEDAHSTEFNPKSAHPVVGLITEWQDASGKTEQRDEASDLGGTMRLGAQECKLVDGSTVRECYGKAIIEERHRHRYEVNGNLVPRLEEAGLQVAGWSQDGSLVEVVEVKDHPWFVACQFHPEFKSTPRDGHPLFEGFVRAA 535
>gi|42528192|ref|NP_973290.1| CTP synthetase [Treponema denticola ATCC 35405] >gi|81570099|sp|Q73J84|PYRG_TREDE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|41819462|gb|AAS13209.1| CTP synthase [Treponema denticola ATCC 35405] (536 aa)
Score = 1213, Expect = 5.4e-131, Identities = 243/528 (46%), Positives = 351/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSL--NENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K+K + +TGGV SSLGKG+  +S+G +LK  G  V+  KFDPYLNVD GTM P QHGEVFVT DG ETDLD+G+YERF ++ L K ++ +AG+VY   + +ER G + G T+QVVPH+T+ I  +I+  + +   DF+I E+GGTVGDIE++PF+EA RQ++    +   MF+H   L  L    ++KTKP+QHSVK+L+S GI P++L+ RS+  +S   +EK+SL + I  + I   +  K IY +P  LE   +   +   F +E   PN    + W         P+K +  IA+VGKY + PDAYLS+  +L  +  Y KT + + +I+S  +   E+  + L + D I+VPGGFG R I G +L  Q+AREN IP+FGICLGMQ+++IE+A N L + +A+S+EF++N  NP+I ++  + ++  +GGTLRLG Y C + +GS   + YK   I ERHRHRYEFN  Y + F+    +FSG+N E NLVEI+EL++H +F+AVQFHPEF S+   P+P+F  F+  +
  S:     2 KSKFIFITGGVVSSLGKGLTAASIGMLLKSRGYSVVNQKFDPYLNVDPGTMNPYQHGEVFVTEDGGETDLDLGHYERFTDVPLHKFNSTSAGKVYLAILDRERAGGYNGGTVQVVPHVTDEIQSRILGTAEQTGADFVISEIGGTVGDIEALPFIEAIRQIRYTVGKENCMFVHLGLLPYLKECGEIKTKPMQHSVKELLSFGIQPDILICRSEKRLSKSTREKLSLFSNIPQDAIIENLTAKSIYEVPLMLEEAGLGKVLCKLFNIENKEPN---LEEWKKMVQTYYNPEK-EITIALVGKYVELPDAYLSVAEALTAAGIYHKTSIKLLWIDSKKIETKEDAAAFLKDADGIIVPGGFGDRGINGMLLTAQFARENKIPYFGICLGMQISAIEYALNALHIEEANSSEFDKNAKNPVIDLMPDQ-KDVKIGGTLRLGLYRCMIAEGSLAEKAYKSHEIQERHRHRYEFNNLYREKFDNSDMIFSGLNPERNLVEIVELKSHPWFVAVQFHPEFASRPNKPHPLFRDFIKAA 529
>gi|167746173|ref|ZP_02418300.1| hypothetical protein ANACAC_00869 [Anaerostipes caccae DSM 14662] >gi|167654688|gb|EDR98817.1| hypothetical protein ANACAC_00869 [Anaerostipes caccae DSM 14662] (536 aa)
Score = 1213, Expect = 5.7e-131, Identities = 242/528 (45%), Positives = 334/528 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV S LGKG+  +SLG +LK  G  V   KFDPY+N+D GTM P QHGEVFVT DG ETDLD+G+YERF++  L K+SNVT G+VY+  + KER G + G T+QV+PH+T  I  +        + +  I+E+GGTVGDIES PFLEA RQ Q +      + IH   +  L +  +LKTKP Q SVKDL   GI P++L+ RS   + + +K KI+    +E E +   ++ + +Y +P  +EN+ + +       +  P       W       K PK +K  +A+VGKY    DAY+S++ SLE +      D++I +++S  ++  N+ E L     I+VPGGFG R IEG I +IQYARE+ IP+ G+CLGMQL  +EFARNVL   DA S EFNENT +P+I I+  ++  TN+GGTLRLG+Y C L DGSK  E+Y  K I ERHRHRYE N KY D+ +++G + SG + +  +VE+IE+ +H FF+A Q HPEF S+    +P+F  F+  S K
  S:     4 KYVFVTGGVVSGLGKGITAASLGRLLKARGYHVTSQKFDPYINIDPGTMNPIQHGEVFVTDDGAETDLDLGHYERFIDEGLNKKSNVTTGKVYWNILQKERRGDYGGNTVQVIPHVTNEIKSRFYRNEEATEQEVAIIEIGGTVGDIESQPFLEALRQFQHEVGHENCILIHVTLIPYLKSSGELKTKPTQASVKDLQGMGIQPDILVCRSDYPLDDGIKRKIAQFCNVEKERVIQNLDAEVLYEVPLMMENEHLAHEACACLHLPCPEP-DLSEWRKMIDNWKHPK-HKIEVALVGKYVSLHDAYISVVESLEHAGVANSADVTIRWVDSERVSSYNVDEMLGGVQGIIVPGGFGDRGIEGMICSIQYAREHKIPYLGLCLGMQLTIVEFARNVLGYADAHSKEFNENTEHPMIHIMADQDGVTNIGGTLRLGSYPCVLADGSKAEELYGTKEISERHRHRYEVNNKYRDVLQENGMMLSGCSPDGRIVEMIEIPSHPFFLATQAHPEFKSRPNKAHPLFRGFIEASLK 531
>gi|161751103|ref|NP_376089.2| CTP synthetase [Sulfolobus tokodaii str. 7] >gi|24212144|sp|Q976E9|PYRG_SULTO CTP synthase (UTP--ammonia ligase) (CTP synthetase) (531 aa)
Score = 1212, Expect = 6.1e-131, Identities = 249/527 (47%), Positives = 358/527 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELL-TGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK +I+TGGV SS+GKG   +S+G +LK  G ++ ++K DPYLNVDAGTM P  HGEVFVT DG ETDLD+G+YERF+ IN+   +N+TAG+VY+E I  ER GK+LG T+Q++PH+T+ I   I   SN    D  IVE+GGTVGDIE +PFLEA RQL+  +    V+F+H V L+E L    ++KTKPLQHSV++L   GI P++++ RS   +  + K+KI+L T ++ E I+S  ++   Y +P  LE Q + + I +  K+ +P N+     W  F   +K   K + +IA+VGKY+   D+Y+SI  ++  ++  L     + +I S+ +  +   I +L   D I+V  GFG R +EGKILAI+YARENN+PF GIC GMQLA +EFARNVL +  A +TE + NT +P+IT+L+ + +   +GGT+RLG+    +K+G+    IY    + ERHRHRYE NP+Y+D+ +K G V SG++ EN LVE+IEL+NHKFF+ +Q HPE+ S+ L+P+P+F  FL  +
  S:     2 TKYIIITGGVLSSVGKGTVAASIGLLLKNRGYKITMVKVDPYLNVDAGTMNPYMHGEVFVTDDGAETDLDLGHYERFVGINMYSYNNITAGKVYFEVIKNERQGKYLGQTVQIIPHVTDQIKSMIRYASNMANADITIVEIGGTVGDIEGLPFLEAVRQLKLEEEEGNVVFVH-VALVEFLKVTEEIKTKPLQHSVQELRRIGIQPDIIVARSVVPLDEETKKKIALFTNVKPEYIFSNYDVNMTYEVPLILEKQGLASKILS--KLNLPDNQPNLSEWIRFIDNLKTADK-EVKIALVGKYTKLKDSYISIKEAIYHAAAKLHIKPVLVWIESTDIENSKEAIDKLKSVDGIIVLPGFGSRGVEGKILAIKYARENNVPFLGICYGMQLAVVEFARNVLGLEKAHTTEVDPNTPHPVITLLDEQKKVVQIGGTMRLGSQKVIVKEGTLAYRIYGNIEVYERHRHRYEVNPEYVDLLQKGGLVISGVS-ENGLVEMIELKNHKFFLGLQGHPEYKSRPLAPSPVFIGFLRAA 528
>gi|108760742|ref|YP_629356.1| CTP synthetase [Myxococcus xanthus DK 1622] >gi|119391134|sp|Q1DDB7|PYRG_MYXXD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|108464622|gb|ABF89807.1| CTP synthase [Myxococcus xanthus DK 1622] (546 aa)
Score = 1212, Expect = 6.9e-131, Identities = 235/528 (44%), Positives = 346/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + VTGGV SSLGKG+A +S+GA+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETD+D+G+YERF N  + + +N T+GR+Y+  I KER G++LG T+QV+PH+T+ I   I   +     D +IVEVGGTVGDIES+PFLEA RQ++    ++ V+++H   L  +    ++KTKP QHSV  L   GI P+ L+ R+   V  +LK+KI++   ++  ++++  +++  Y LP  L  Q +   +     +    P+    + W+     + EP + + RIA+VGKY +  ++Y S+  +L          +++ F++S  + E    +L +  DAILVPGGFG R  EGKI A++YARE  +PFFGICLG+Q+A +EF+R VL +  A+S EFNE+T +P++T++E + +  + GGT+RLG+Y C LK GS   ++Y + +I ERHRHRYE N  Y    ++ G V SG N E NLVE+IEL +H +FI  QFHPEF SK  +P+P+F  F+  +
  S:     5 KTKFIFVTGGVVSSLGKGLASASIGALLENRGLAVTLIKLDPYINVDPGTMSPFQHGEVFVTEDGGETDMDLGHYERFTNARMSRLNNFTSGRIYHAVIMKERRGEYLGKTVQVIPHVTDEIKSSIRQAAQ--DADVVIVEVGGTVGDIESLPFLEAIRQMRYDVGNENVVYVHLTLLPYIGAAGEVKTKPTQHSVMKLREIGIQPDFLVCRTDREVPRELKDKIAMFCNVDTRSVFTSPDVRSTYELPLELHRQGLDERLAEVLNIWSRAPH---LERWENIIRKVYEPARGQVRIAIVGKYVNLTESYKSLNEALLHGGIANDVKVNLHFVDSQEVEEQGAEKLLAGVDAILVPGGFGVRGTEGKIAAVRYAREKKVPFFGICLGLQMAVVEFSRGVLGLSSANSLEFNEHTPHPVVTLMESQVKVQDKGGTMRLGSYACALKPGSLAHQLYGQDTIQERHRHRYEVNNAYRSKLQEAGLVISGSNPELNLVEMIELADHPYFIGCQFHPEFKSKPFAPHPLFSGFIRAA 531
>gi|15806581|ref|NP_295296.1| CTP synthetase [Deinococcus radiodurans R1] >gi|24212167|sp|Q9RU23|PYRG_DEIRA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|6459338|gb|AAF11136.1|AE002001_2 CTP synthase [Deinococcus radiodurans R1] (544 aa)
Score = 1212, Expect = 6.9e-131, Identities = 237/526 (45%), Positives = 349/526 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPN-RIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL----SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIY---KRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGIN-----KENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKGVA +SLGA+L+  G +V  +K DPY+N+DAGTM P +HGE FVT  G ETDLDIGNYERFL++++P  SN+T G+VY E I KER G +L  T+QV+PH+T+ I ++I         + +++EVGGTVGDIES+PFLEA RQ +  +    V+++H   +  L T ++ KTKP QHSV  L S GI P++++VRSKD +  ++  KI+  T +    ++S  +++H+Y +P +LE Q +  ++     +E  + R+G   W      IK PK+ +  IA+ GKY+  PDAYLS++ SL  +       ++I+++N+  L E    EL    ++ D ILVPGGFG R IEGK+ A +YAR + +P+ GICLGMQ+A IE+AR+V  + DA+S EF+E   N +I ++  +     +GGT+RLG++  EL+ G+KI E+Y   +  ++ ERHRHRYE NP Y++  E  G   SG+      +   LVE +E+ +H FF+A+Q HPEF S+ + P+P F  F+  +
  S:     2 KYIFVTGGVVSSLGKGVASASLGALLRARGYKVTAVKIDPYINIDAGTMRPYEHGECFVTASGAETDLDIGNYERFLDLDIPAGSNITTGQVYQEVIRKERAGDYLSQTVQVIPHVTDEIKRRIRAAGESAGAEIVLIEVGGTVGDIESLPFLEAIRQFRFDEGDDNVLYLHLTLVPYLGTSNEFKTKPTQHSVAALRSYGISPDIVMVRSKDKLPAEITRKIAAFTSVRENRVFSSYDVEHVYQVPLALEEQGLGKAVEELLGLEGTHPRLGV--WTDAVRTIKHPKQ-QVTIAIAGKYTAMPDAYLSLMESLTHAGIANDARVNIKWVNAEQLAEAGAGELEGQFADVDGILVPGGFGIRGIEGKVKAAEYARTHGVPYLGICLGMQIAVIEYARHVAGIEDANSAEFDEYAKNKVIDLMPEQLEVAGMGGTMRLGDWPMELRAGTKIAELYGVPQGGTVKERHRHRYEVNPAYVEQLEAAGLTISGVTPGVEGRGAGLVETVEIADHPFFVALQAHPEFKSRPMRPSPPFAGFVKAA 538
>gi|89211624|ref|ZP_01189979.1| CTP synthase [Halothermothrix orenii H 168] >gi|89158771|gb|EAR78464.1| CTP synthase [Halothermothrix orenii H 168] (535 aa)
Score = 1212, Expect = 6.9e-131, Identities = 236/527 (44%), Positives = 350/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKY--KARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE--LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV S+LGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+++NL + +NVT G++Y   I KER G++LGAT+QV+PHIT+ I  +I  +  +   D +I E+GGTVGDIES+PF+EA RQL++   +  V ++H   +  L T  +LKTKP QHS+K+L   GI P+ ++ RS   ++  +K+KI+L   I+   +   ++ K+IY +P   E + +   + +  K+ + N++     + +  ++ + K    + RIA+VGKY + PDAY+SI  +   +      ++ ++++ +  L  ++  E  L + D ILVPGGFG R IEGKI AI YARE  IPFFGICLGMQ A IEF+RNV     A+S+EF+ +T +P+I ++  +    + GGT+RLG Y C+L  G+K  E Y+ + I ERHRHRYEFN +Y +   + G + +G++ +  LVEI+EL +H +F+ VQFHPEF S+   P+P+F  F+  +
  S:     2 TKYIFVTGGVVSALGKGITAASLGRLLKSRGLKVSIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDVNLSQNNNVTTGQIYGSVIRKERKGEYLGATVQVIPHITDEIKSRITRVGRETDADVVITEIGGTVGDIESLPFIEAIRQLKSDLGKENVFYLHCTLVPYLPTAGELKTKPTQHSIKELRGIGIQPDAIVCRSDRKLTQDVKDKIALFGDIDKRAVIQAVDAKNIYEVPLKFEKEGLATIVID--KLGLENKVHTPDLEDWQDMVNKMKHLDNRVRIAIVGKYVELPDAYISINEAFRHAGVANNAEVEVKWVYAEDLEGDSSPEEYLDDVDGILVPGGFGDRGIEGKIKAITYAREKGIPFFGICLGMQCAVIEFSRNVAGYKGANSSEFDLDTDHPVIDLMPEQKEIEDKGGTMRLGIYPCKLSSGTKSYEAYQDEIIYERHRHRYEFNNEYRNELIEKGLILAGLSPDERLVEIVELPDHPWFVGVQFHPEFKSRPNRPHPLFVGFIRAA 531
>gi|163749999|ref|ZP_02157243.1| CTP synthetase [Shewanella benthica KT99] >gi|161330273|gb|EDQ01254.1| CTP synthetase [Shewanella benthica KT99] (545 aa)
Score = 1212, Expect = 7.7e-131, Identities = 251/524 (47%), Positives = 346/524 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T G +Y E + KER G +LGATIQV+PHIT AI +++  L+     D  +VE+GGTVGDIES+PFLEA RQL  +  R + +++H   +  L T  ++KTKP QHSVK+L S GI P++L+ R    +  K + KISL   +E   + SL ++  IY +P  L+ Q + + +   F ++         W+        P   +  I +VGKY   PDAY S+  +L+ +  + +  ++I++I+S SL      +L   D ILVPGGFG+R IEGKILA ++ARENN+P+FGICLGMQ+A IEFARNV  M +A+STEFN+ T  P+I +          LE ++  ++LGGT+RLG   C L +GSK  E Y+  S VERHRHR+E N KY +  E+ G +FSG++ +  LVE+IEL NH +F+A QFHPEFTS      P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGSIYEEVLRKERRGDYLGATIQVIPHITNAIKERV--LAGGEGHDVALVEIGGTVGDIESLPFLEAIRQLGVELGRDRTLYVHLTLVPFLGTAGEVKTKPTQHSVKELRSIGIAPDILICRGDRPLPAKERAKISLFCNVEERAVISLKDVDSIYKIPALLKAQSLDDIVVKRFGIKC-KEADLHEWEQVIYQEANPTG-EVTIGMVGKYVQLPDAYKSVNEALKHAGLFNRVSVNIKYIDSQSLEAKGTEDLQGLDGILVPGGFGERGIEGKILAAKFARENNVPYFGICLGMQVALIEFARNVAGMDNANSTEFNKQTPYPVIGLITEWLNEEGALEERHESSDLGGTMRLGAQLCHLSEGSKAAEAYEGNSCVERHRHRFEVNNKYKERLEQAGLIFSGLSSDRQLVEMIELPNHPWFVAGQFHPEFTSTPRDGQPLFKGFI 533
>gi|30350178|gb|AAP31486.1| putative CTP synthase [Western X phytoplasma] (543 aa)
Score = 1211, Expect = 7.8e-131, Identities = 251/530 (47%), Positives = 360/530 (67%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYR-SQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHG-FVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           + K + VTGGV S LGKG+  SS+G +LK  G +V + KFDPY+NVD+GTM+P QHGEVFVT DG ETDLD+G+YERFL+ NL +ESNVT G++Y   I KER G++LG TIQV+PHIT  I  +I+ ++     D +I+E+GGTVGDIES+PFLE+ RQ++       V+++H   +  L + ++ KTKP QHSVK+L S GI P +L++RS+  ++ ++K+KIS+   ++   I+   ++  +Y +  +L  QK+ + I + F+++         W      I+  K+    I +VGKY DS DAYLSI  SL+ +S+     + I++I++  L  +NI  +L+  D IL+PGGFG R +EGKI A++YAREN+IPFFGIC GMQ+A IE+ARNVLK+  A+S+E +  T  P+IT    K   T LGG+LRLG Y+ ELK  S+   IY+++ I ERHRHRYE N +Y+ +F+K   F  SG N+E  + EI+EL+NH +F+ VQFHPEF S+ L P+P+F  F+  + K
  S:     7 QPKFIFVTGGVVSGLGKGIIASSIGQILKQRGLKVFMKKFDPYINVDSGTMSPNQHGEVFVTNDGAETDLDLGHYERFLDENLSRESNVTTGQIYQSVINKERKGEYLGKTIQVIPHITNEIKYRILTIAQNADYDIIIIEIGGTVGDIESLPFLESIRQMRYDLGFHNVLYLHNTLIPYLKSSNETKTKPTQHSVKELRSLGIQPQILILRSEKIITPEMKQKISILCDVQKNAIFDNTDVDILYKIILNLHGQKIDDFILDHFQIKNVPVSDLSQWKQLIHKIEHLKR-TITIGLVGKYIDSHDAYLSIEESLKHASYTHDVKVEIKWIDAEYLTNDNIQKQLNTCDGILLPGGFGFRAVEGKIKAVKYARENDIPFFGICFGMQIAVIEYARNVLKLEQANSSEVDSKTPYPVIT---QKIYNTQLGGSLRLGLYSSELKKDSRSYAIYQQEVINERHRHRYEMNLEYLPLFDKDPYFNVSGFNQEEKVPEIVELKNHFWFVGVQFHPEFLSRPLKPHPLFKDFIKFAIK 535
>gi|170758890|ref|YP_001785461.1| CTP synthase [Clostridium botulinum A3 str. Loch Maree] >gi|169405879|gb|ACA54290.1| CTP synthase [Clostridium botulinum A3 str. Loch Maree] (533 aa)
Score = 1211, Expect = 8.3e-131, Identities = 241/527 (45%), Positives = 346/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT G++Y+  I+KER G +LGAT+QV+PHIT  I  ++  ++ + + D +I E+GGT+GDIES+PFLE+ RQ++ +  R  V FIH   L  L    +LKTKP QHSVK+L   GI P++++ RS+  +  +LK KI L   +  E++   ++ +++Y +P  L  + +   +     +   ++I    W +  +  K   K    IA+VGKY +  DAY+SI+ +L    +   T ++I++I+S  +NENN  + L + D ILVPGGFG R IEGKI A ++AREN IPF GICLGMQ A IEFARNVL    A S E + NT  P+I ++  +    N+GGT+RLG Y C+L  G+   + Y ++ + ERHRHRYEFN +Y     + G + SG + ++ LVEI+E+ NH +++AVQFHPE  S+   P+P+F  F+  +
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSQNSNVTTGKIYWSVISKERKGDYLGATVQVIPHITTEIKSRVYRVAKEKEVDVVITEIGGTIGDIESLPFLESIRQIKYEVGRENVCFIHVTLLPFLGKAGELKTKPTQHSVKELRGIGIQPDIIVCRSEKQIPEELKGKIGLFCNVNKEDVIQNLDAENLYEVPLMLHKENLDTLVCKKLGLNY-SKIDNTEWISMVNNAKNLSK-NTTIALVGKYVELHDAYISIVEALSHGGYANDTKVNIKWIDSEEVNENNFEQYLKDADGILVPGGFGDRGIEGKIWAAKWARENKIPFLGICLGMQCAVIEFARNVLNYKGAHSAEIDPNTKYPVIDLMPEQKDIDNMGGTMRLGAYPCKLLKGTNSEKAYGQEIVYERHRHRYEFNNEYRSKLTEAGLILSGTSPDDRLVEIVEINNHPWYVAVQFHPELKSRPNKPHPLFKDFVKAT 529
>gi|126175329|ref|YP_001051478.1| CTP synthase [Shewanella baltica OS155] >gi|153001650|ref|YP_001367331.1| CTP synthetase [Shewanella baltica OS185] >gi|160876386|ref|YP_001555702.1| CTP synthetase [Shewanella baltica OS195] >gi|125998534|gb|ABN62609.1| CTP synthase [Shewanella baltica OS155] >gi|151366268|gb|ABS09268.1| CTP synthase [Shewanella baltica OS185] >gi|160861908|gb|ABX50442.1| CTP synthase [Shewanella baltica OS195] (545 aa)
Score = 1211, Expect = 8.5e-131, Identities = 252/524 (48%), Positives = 346/524 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    K KISL   +E   + SL ++  IY +P  L +Q + + +   F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKILA ++ARENN+P+FGICLGMQ+A IEFARNV  M DA STEFN+ T  P++ ++          E ++  ++LGGT+RLG   C L DGSK  + YK  S VERHRHRYE N KY +  E+ G +FSG++ +  LVE+IEL++H +F+A QFHPEFTS     +P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLVCRGDRAIPANEKAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDDLVVKRFGLEC-READLSEWENVIYQEANPNG-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRVSVTIKYIDSQTVEAKGEEVLQGLDGILVPGGFGERGVEGKILAAKFARENNLPYFGICLGMQVALIEFARNVAGMADAHSTEFNKETPFPVVGLITEWIDEEGNVEQRHEASDLGGTMRLGAQLCHLLDGSKAAQAYKGNSCVERHRHRYEVNNKYRERLEQAGMIFSGLSSDRKLVEMIELKDHPWFVAGQFHPEFTSTPRDGHPLFEGFI 533
>gi|24215109|ref|NP_712590.1| CTP synthetase [Leptospira interrogans serovar Lai str. 56601] >gi|45657413|ref|YP_001499.1| CTP synthetase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] >gi|73913713|sp|Q72S46|PYRG_LEPIC CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|73913714|sp|Q8F3J3|PYRG_LEPIN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|24196169|gb|AAN49608.1|AE011408_13 CTP synthase [Leptospira interrogans serovar Lai str. 56601] >gi|45600652|gb|AAS70136.1| ctp synthase [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] (542 aa)
Score = 1210, Expect = 1.0e-130, Identities = 245/530 (46%), Positives = 352/530 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLK-HIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFI--NSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +TK + VTGGV SSLGKGV  ++LG +L+  G  V + K DPY+N+D GTM+P QHGEV+VT DG ETDLD+G YERF +  L ++++V+ G++Y   I +ER G +LG T+QVVPHIT  I  ++ +++ +  PDF+IVE+GGTVGDIESIPFLEA RQ++ ++  S V+F+H   +  +    + KTKP QHSVK+L+  GI P++L+ R    ++ ++K K+SL   ++ EN+ S  ++   IY +P+  + +K+   +     ME+     +  WD     +   K+   +IAVVGKY    DAY SI  SL  S   +  D  +EFI  +  +LN+++  E L +   ILVPGGFG R IEGKILAIQYAR N IPF GICLGMQ A +E+ RNVL + DA+STE   +T +P+I++LE +N    +GGT+RLG+Y C++K+ +     YK   I ERHRHR+EF  +Y   +E++G + +G + ++NLVEI+E+  H +FI VQFHPEF SK   P+P+F  F+  S K
  S:     7 RTKFIFVTGGVSSSLGKGVTVAALGCLLESRGYTVSLQKMDPYINIDPGTMSPYQHGEVYVTADGAETDLDLGYYERFTHSKLTRKNSVSTGQIYNTVIQRERKGDYLGRTVQVVPHITNEIRNRMYIVAREENPDFIIVEIGGTVGDIESIPFLEAIRQMRYEHGSSNVLFVHLTLVPTITAAGEAKTKPTQHSVKELLGLGIQPDILVCRVSQPMTKEMKNKLSLFCNVKEENVISASDISTSIYEIPKMYKEEKLDEVVLKTMGMEL-RESNFSEWDKMVKGLLTTKQ-TVQIAVVGKYISLQDAYRSIYESL--SHGGIAHDTKVEFIKVDPENLNKDSYVEILKKVHGILVPGGFGDRGIEGKILAIQYARTNGIPFLGICLGMQCAVVEYGRNVLGLKDANSTEIRPDTEHPVISLLEEQNDIEQMGGTMRLGSYPCKVKENTLSYSEYKSILIHERHRHRFEFTNRYRKQYEENGMIIAGTSPDDNLVEIVEIPKHNWFIGVQFHPEFQSKPTLPHPLFAGFIRASVK 537
>gi|90407902|ref|ZP_01216077.1| CTP synthetase [Psychromonas sp. CNPT3] >gi|90310993|gb|EAS39103.1| CTP synthetase [Psychromonas sp. CNPT3] (545 aa)
Score = 1210, Expect = 1.1e-130, Identities = 246/524 (46%), Positives = 338/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + VTGGV SSLGKG+   SL A+L+  G +V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T GR+Y + +AKER G +LGATIQV+PHIT  I ++I+     +  D  IVE+GGTVGDIES PF+EA RQL  K   Q  M+IH   L  L T  ++KTKP QHSVK+L S G+ P++L+ RS+ A     + KI+L   ++++N+ SL ++  IY +P  L+ Q +       F  + P       W+   S  +    ++  I +VGKY + PDAY S+  +L+       T ++I++I+S  +       L   DAILVPGGFG R IEGKILA ++AREN IP+ GICLGMQ+A IEFARNV  +  A+STEF  +   P++ ++          E +   ++LGGT+R+G   C LK GSK+ E+Y    I ERHRHRYE N +++   EK G   +G++ +  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+
  S:     3 TKYIFVTGGVVSSLGKGITAGSLAAILEARGLDVTILKLDPYINVDPGTMSPTQHGEVFVTDDGAETDLDLGHYERFIRTRMTKRNNFTTGRIYSDVLAKERRGDYLGATIQVIPHITNEIQERIVAGGKGH--DVAIVELGGTVGDIESQPFIEAIRQLGLKVGPQNAMYIHLTLLPYLKTAGEIKTKPTQHSVKELRSLGVQPDILICRSEVAFPANERAKIALFCNVQDKNVISLRDVDSIYKIPALLKAQGLDELCVQRFGFKCP-EADLSEWEKVVSE-EANTSHEVVIGMVGKYIELPDAYKSVNEALKHGGLKNATKVNIKYIDSQDVEVKGDLALQGLDAILVPGGFGTRGIEGKILAAKFARENKIPYLGICLGMQVALIEFARNVAGLKHANSTEFKADCKQPVVGLITEWIDKSGEVELRTESSDLGGTMRVGAQKCHLKAGSKVREMYGNAEIFERHRHRYEVNNRFLPELEKAGLSIAGLSADKKLVEIIEIPNHPWFVAAQFHPEFTSTPRDGHPLFKGFI 533
>gi|58616836|ref|YP_196035.1| CTP synthetase [Ehrlichia ruminantium str. Gardel] >gi|75356593|sp|Q5FFC3|PYRG_EHRRG CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|58416448|emb|CAI27561.1| CTP synthase [Ehrlichia ruminantium str. Gardel] (543 aa)
Score = 1210, Expect = 1.2e-130, Identities = 252/527 (47%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENN---LVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +S+GA+L+  G ++ + K DPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF  +   K  N+T G+VY+  + KER G +LG T+Q++PH+T+ I+    +L N    DF+I E+GGTVGDIES PFLE+ RQ+  K  ++  +F+H   +  +    +LKTKP QHSVK+L S GI P+++L RSK  +S + ++KI+    +   NI   +++K+IY LP S     +   I   F +  P       W+   ++     K    IA++GKY    DAY S+I +LE ++ + KT LSI +I+S SLN    +      AIL+PGGFG   +EGKI+AIQYAR NNIPF GIC+GMQLA IEFARNV+ + DA+STEFN    NP+I  L     + NLGG+++LG++ C LK  SKI  IYK + I ER RHRY  N +Y D+ E HG +F+G +  NN   L E+IEL+NH +FI VQFHPEF S     +P+F SF+  S
  S:     7 TKFIFVTGGVVSSLGKGLAAASIGALLQARGFKICLRKLDPYLNIDPGTMSPIQHGEVFVTDDGAETDLDLGHYERFTGVKTTKNDNITTGKVYHNLLNKERKGDYLGQTVQIIPHVTDLINS--FILHNTDALDFVICEIGGTVGDIESQPFLESIRQIGYKLSKNNTVFVHLTLVPYISATMELKTKPTQHSVKELSSVGIQPDIILYRSKIPLSQEQRDKIANLCNVSPTNIIPALDVKNIYELPISYHQYNLDTQILKHFNITSPEP-NLDKWENILNISHVSTK-TITIAIIGKYIKLLDAYKSLIEALEHAAIHNKTKLSIHWIDSRSLNNEITNTFDNVHAILIPGGFGDDGVEGKIIAIQYARINNIPFLGICMGMQLAIIEFARNVIHLEDANSTEFNFYCKNPVIHQL--PELQQNLGGSMKLGSHPCYLKVDSKIFSIYKEQVINERRRHRYTVNLQYKDLLESHGLIFTGHSHHNNNDSLAEVIELKNHPWFIGVQFHPEFKSDPFQSHPLFMSFIQAS 531
>gi|182420294|ref|ZP_02951523.1| CTP synthase [Clostridium butyricum 5521] >gi|182375889|gb|EDT73481.1| CTP synthase [Clostridium butyricum 5521] (535 aa)
Score = 1210, Expect = 1.3e-130, Identities = 242/527 (45%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV S LGKG+  +SLG +LK  G ++ I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L K SNVT GR+Y   I KER G++LG T+QV+PHIT  I  K+  ++ +   D +I E+GGTVGDIES PFLEA RQ++++  S+ V +IH   +  L  G +LKTKP QHSVK+L + GI P++++ R++  +S+ +K KI L   IE +++   ++  H+Y +P  L N+ + N +     +   + I    W      IK  K+    IA+VGKY +  DAY+S++ +L    +   + + I ++N+  +   ++ S L   D +LVPGGFG R IEGKI +IQ+AREN +PF GICLGMQ + IE+ARNVL    A+S+E N NT  P+I I+  +    NLGGT+RLG Y C+L   S   E+Y +++I ERHRHRYEFN  Y     + G   +G + +  LVEI+E+E+H +++AVQFHPE  S+   P+P+F  F+  +
  S:     4 TKYIFVTGGVVSGLGKGITAASLGRLLKNRGLKISIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDESLSKNSNVTTGRIYSSVIEKERKGEYLGGTVQVIPHITNEIKDKVYQVAKERDLDVVITEIGGTVGDIESQPFLEAIRQIKSEVGSENVCYIHVTLVPYLRKGGELKTKPTQHSVKELRTIGIQPDIIVCRTEQELSDDIKSKIGLFCNIEGKSVIQNLDADHLYEVPLMLHNEGLDNLVCEKLHLGCKD-IENTEWINMVERIKNLKE-NVEIALVGKYVELHDAYISVVEALSHGGYANNSKVKIRWVNAEEVESGDVNSILRGVDGVLVPGGFGDRGIEGKISSIQWARENKVPFLGICLGMQCSVIEYARNVLGFEGANSSEINPNTKYPVIDIMHDQKDIENLGGTMRLGQYPCKLDMESTSYEVYGKENINERHRHRYEFNNDYRKQIAEAGMRIAGTSPDERLVEIVEVEDHPWYVAVQFHPELKSRPNKPHPLFSGFIEAA 530
>gi|116328338|ref|YP_798058.1| CTP synthetase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116331064|ref|YP_800782.1| CTP synthetase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] >gi|116121082|gb|ABJ79125.1| CTP synthase [Leptospira borgpetersenii serovar Hardjo-bovis L550] >gi|116124753|gb|ABJ76024.1| CTP synthase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] (540 aa)
Score = 1209, Expect = 1.3e-130, Identities = 237/530 (44%), Positives = 347/530 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLK-HIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +TK + VTGGV SSLGKGV  ++LG +L+  G  V + K DPY+N+D GTM+P QHGEV+VT DG ETDLD+G YERF +  L ++++V+ G++Y   I +ER G +LG T+QVVPHIT  I  ++ +++ +  PDF+IVE+GGTVGDIESIPFLEA RQ++ ++  S V+F+H   +  +    + KTKP QHSVK+L+  GI P++L+ R    ++ ++K K+SL   ++ EN+ S  ++   IY +P+  + +K+   +     ME+     +  WD     +   K+   ++A+VGKY    DAY SI  SL        T +    I+  +LN++N+ S L     +LVPGGFG R IEGKILAI+YAR N IPFFGICLGMQ A +E+ RNVLK+ DA+STE   +T  P+I++LE +N    +G T+RLG+Y C++K  +     YK   + ERHRHR+EF  +Y   +E++G V SG + +++LVEI+E+  H +F+ VQFHPEF S+   P+P+F  F+  + K
  S:     3 RTKFIFVTGGVSSSLGKGVTVAALGCLLESRGYTVSLQKMDPYINIDPGTMSPYQHGEVYVTADGAETDLDLGYYERFTHSKLSRKNSVSTGQIYNTVIQRERKGDYLGRTVQVVPHITNEIRNRMYIVAREENPDFIIVEIGGTVGDIESIPFLEAIRQIRYEHGSSNVLFVHLTLVPTITAAGEAKTKPTQHSVKELLGLGIQPDILVCRVSQPMTKEMKNKLSLFCNVKEENVISASDISTSIYEIPKMYKEEKLDEVVLKTMGMEL-RESNFSEWDKMIRRLLATKQ-TVQVAIVGKYISLQDAYRSIYESLSHGGIAYDTKVEFVKIDPENLNKDNVQSSLKNVHGVLVPGGFGDRGIEGKILAIEYARTNGIPFFGICLGMQCAVVEYGRNVLKLKDANSTEIRPDTEYPVISLLEEQNDIEQMGATMRLGSYPCKIKKDTLSYSEYKSTLVHERHRHRFEFTNRYRKQYEENGMVISGTSPDDSLVEIVEIPKHNWFVGVQFHPEFQSRPTKPHPLFAGFIRAAVK 533
>gi|15896145|ref|NP_349494.1| CTP synthetase [Clostridium acetobutylicum ATCC 824] >gi|24212146|sp|Q97F61|PYRG_CLOAB CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|15025939|gb|AAK80834.1|AE007786_7 CTP synthase (UTP-ammonia lyase) [Clostridium acetobutylicum ATCC 824] (535 aa)
Score = 1209, Expect = 1.6e-130, Identities = 239/528 (45%), Positives = 349/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYR---SQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL K SNVT G+VY+  I KER G +LG T+QV+PHIT  + +++  ++ +   D +I E+GGTVGDIES+PFLEA RQ+  KY        FIH   L  L    ++KTKP QHSVK+L   GI P++++ R++  +S  ++ KI L   I+ +++ S ++ +++Y +P  L +Q + + +    ++E    +    W++    IK     +  I +VGKY +  DAY+S++ SL    F     +++++INS  + ++N+ S LS+ D ILVPGGFG R IEGKI AI++AREN IPFFGICLGMQ A IE+ARNVL +  A S+E +  T  P+I ++  +    + GGT+RLG Y C+L   +   + Y+ + I ERHRHRYEFN ++     + G + +G + ++ LVEI+E+++H +F+ VQFHPEF S+   P+ +F  F+ V+
  S:     2 KTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLSKNSNVTTGKVYWSVINKERRGDYLGGTVQVIPHITNELKERVYRVAKEKDVDVVITEIGGTVGDIESLPFLEAIRQI--KYEVGFGNSCFIHVTLLPYLRKAGEIKTKPTQHSVKELRGIGIQPDIIVCRTEKEISKDVRSKIGLFCNIDGDSVISNLDAENLYEVPLMLHDQGLDSLVCKKLELEC-QEVDNSEWESMVKNIKSLSG-EVTIGLVGKYVELHDAYISVVESLNHGGFANNVSVNVKWINSEEVTKDNVDSVLSDVDGILVPGGFGDRGIEGKIEAIRWARENKIPFFGICLGMQCAVIEYARNVLGLEGAHSSEIDPQTKYPVIDLMPDQKDIDDKGGTMRLGLYACKLSKDTNAYDAYEEEVIYERHRHRYEFNNEFRKRLTEEGLILAGTSPDDRLVEIVEIKDHPWFVGVQFHPEFKSRPNRPHALFRDFIKVA 529
>gi|115375228|ref|ZP_01462494.1| CTP synthase [Stigmatella aurantiaca DW4/3-1] >gi|115367790|gb|EAU66759.1| CTP synthase [Stigmatella aurantiaca DW4/3-1] (546 aa)
Score = 1208, Expect = 1.8e-130, Identities = 236/528 (44%), Positives = 345/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + VTGGV SSLGKG+A +S+GA+L+  G  + ++K DPY+NVD GTM+P QHGEV+VT DG ETD+D+G+YERF +  + + +N T GR+Y+  I KER G++LG T+QV+PHIT+ I   I   S +   D +IVEVGGTVGDIES+PFLEA RQ++    SQ  +++H   L  +    ++KTKP QHSV  L   GI P+ LL R+   +S +LK+KI++   ++  N+++  ++K +Y LP  L  Q +   +     +    P+    + W+T T  I EP + + +I +VGKY D  ++Y S+  +L          +++ F++S  +      +L S  DAILVPGGFG R  EGKI A+++ARE  IPFFGICLG+Q+A +EF+R VL + +ADS EFN +T +P++T++E +    + GGT+RLG+Y C LK G+   ++Y +  I ERHRHRYE N  Y    ++ G   SG N + NLVE+IEL++H +F+  QFHPEF SK  +P+P+F  F+  +
  S:     5 KTKYIFVTGGVVSSLGKGLASASIGALLENRGLNITLLKLDPYINVDPGTMSPFQHGEVYVTEDGGETDMDLGHYERFTHARMSRTNNFTTGRIYHAVIMKERRGEYLGKTVQVIPHITDEIKANIRQASQEV--DVVIVEVGGTVGDIESLPFLEAIRQMRYDVGSQNAVYVHLTLLPYIGAAGEVKTKPTQHSVMKLREIGIQPDFLLCRTDREISRELKDKIAMFCNVDTGNVFTSPDVKSVYELPLELHRQGLDERLAEVLNIWSRAPH---LERWETITRRIYEPARGEVKIGIVGKYVDLKESYKSLNEALLHGGIANDVRVNLHFVDSQEVEAQGAEKLLSGVDAILVPGGFGVRGTEGKIAAVRHAREKKIPFFGICLGLQMAVVEFSRGVLGIKEADSLEFNAHTPHPVVTLMESQVNVQDKGGTMRLGSYACALKPGTLAHKLYGQDLIQERHRHRYEVNNAYRGRLQEAGLTISGHNPDLNLVEMIELKDHPYFVGCQFHPEFKSKPFAPHPLFSGFIKAA 531
>gi|119774172|ref|YP_926912.1| CTP synthetase [Shewanella amazonensis SB2B] >gi|119766672|gb|ABL99242.1| CTP synthase [Shewanella amazonensis SB2B] (545 aa)
Score = 1208, Expect = 1.8e-130, Identities = 252/528 (47%), Positives = 345/528 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI  K+  L      D  IVE+GGTVGDIES+PFLE+ RQL  +  R + MF+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    + KISL   +E   + SL ++  IY +P  L +Q + + +   F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S S+       L+  D ILVPGGFG+R +EGKILA +YAREN +P+FGICLGMQ+A IEFARNV  + DA STEFN+ T +P++ +          +E ++  ++LGGT+RLG   C LK G+K  E Y  +S +ERHRHRYE N  Y+   EK G VFSG++ +  LVE+IEL NH +F+A QFHPEFTS     +P+F  F+  ++
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKAKV--LEGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRSMFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDILVCRGDRAIPANERAKISLFCNVEERAVISLKDVDSIYKIPALLTSQGLDDLVCKRFHLEC-KEADLSEWENVIYQEANPNG-EITIGMVGKYIELPDAYKSVNEALKHAGLKNRVTVNIKYIDSQSVEAKGDEALAGLDGILVPGGFGERGVEGKILAAKYARENELPYFGICLGMQVALIEFARNVAGLTDAHSTEFNKQTPHPVVGLITEWIDEEGNIEQRDEASDLGGTMRLGAQLCHLKAGTKAAEAYGSESCIERHRHRYEVNNHYVKQLEKAGLVFSGLSSDRKLVEMIELPNHPWFVAGQFHPEFTSTPRDGHPLFEGFVAAAR 537
>gi|118047014|ref|ZP_01515657.1| CTP synthase [Chloroflexus aggregans DSM 9485] >gi|117996474|gb|EAV10672.1| CTP synthase [Chloroflexus aggregans DSM 9485] (547 aa)
Score = 1208, Expect = 2.0e-130, Identities = 239/531 (45%), Positives = 345/531 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVP-NRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLN-ENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           TK + VTGGV SS+GKG+  +S+G +LK  G  V +MK DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF+++NL + SNVT G++Y   IAKER G +LG TIQV+PHIT  I  +I  L+   Q D +IVE+GGTVGDIES+PFLEA RQ++    R  +++IH   L  + TG +LKTKP QHSV  L + GI  +++L R+   + + ++EKI+    ++   +  +  +  IY +P  LE+  + + +    ++ +P      + W +  + I++ K+ +  IA+VGKY +  DAY+S++ +L  ++     D+ I +I +  +  E     LS    ILVPGGFG+R IEGKI +  YAR N IP+ G+CLGMQ A+I FAR+VL  HD +STEFN  TA+P+I ++  +   T  GGT+RLG Y C+L  G++    Y    + ERHRHR+EFN +Y  + E  G V SG++ +  LVEIIEL +H +++A QFHPEF S+   P+P+F  F+  + + +
  S:     2 TKYIFVTGGVVSSVGKGIGVASIGRLLKSRGFSVSVMKLDPYLNVDPGTMSPYQHGEVFVTADGAETDLDLGHYERFIDVNLSRLSNVTTGQIYSAVIAKERRGDYLGGTIQVIPHITNEIKARIGSLARSSQADVVIVEIGGTVGDIESLPFLEAIRQMRKDVGRDNILYIHVTLLPHISTG-ELKTKPTQHSVMALRNVGISADVILCRADRPIDDDIREKIAFFADVDVRAVIPVPTVDSIYEVPLVLEDMGLGDYLVE--RLGLPATPPDLEDWRSLVARIRQEKR-RLPIALVGKYVELHDAYISVVEALHHAAIEQLIDVDIRWIAAEDVEREGPARLLSGVYGILVPGGFGERGIEGKIASADYARVNGIPYLGLCLGMQCATIAFARHVLGTHDVNSTEFNPQTAHPVIDLMPDQRDITEKGGTMRLGLYPCDLVPGTRAHAAYGCDRVEERHRHRFEFNNRYRAVLESAGLVISGLSPDRQLVEIIELRDHPWYVASQFHPEFQSRPGKPHPLFRGFIAAAAQTL 531
>gi|146281929|ref|YP_001172082.1| CTP synthetase [Pseudomonas stutzeri A1501] >gi|145570134|gb|ABP79240.1| CTP synthase [Pseudomonas stutzeri A1501] (543 aa)
Score = 1207, Expect = 2.3e-130, Identities = 241/527 (45%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY + + +ER G +LGATIQV+PHIT+ I ++II        D  +VEVGGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS  A+    + KI+L T +E   + SL +   IY +P  L  Q + + +   F +E         WD        P+K +  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +       L   DAILVPGGFG R +EGKI  ++YAREN IP+ GICLGMQ+A IEFAR+VL   DA+STEF++++ +P++ ++          E +   ++LGGT+RLG   C L+ GSK+ E Y ++ IVERHRHRYE N   +   +  G   +G + +  LVE++E  +H +F+A QFHPEFTS     +P+F  F+N +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTRMTQNNNFTTGRVYEDVLRRERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEVGGTVGDIESQPFLEAIRQLRVEVGAKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDRAIDVSSRRKIALFTNVEERAVISLPDADTIYKIPGILHAQGLDDYVVERFGLECRG-ADLSEWDRVVDAKLHPEK-EVNIAMVGKYMELLDAYKSLIEAMSHAGIQSRTKVNLRYIDSEDIENQGTGLLEGVDAILVPGGFGLRGVEGKIATVRYARENKIPYLGICLGMQVAVIEFARDVLGWSDANSTEFDKDSGHPVVGLITEWADASGNTEVRTEASDLGGTMRLGAQECGLEPGSKVFECYGKERIVERHRHRYEVNNNLLPQLQAAGLKITGRSGDGALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVNAA 535
>gi|153956306|ref|YP_001397071.1| CTP synthetase [Clostridium kluyveri DSM 555] >gi|146349164|gb|EDK35700.1| PyrG [Clostridium kluyveri DSM 555] (537 aa)
Score = 1207, Expect = 2.4e-130, Identities = 245/527 (46%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L + +N+T G++Y+  I+KER G +LG+T+QV+PHIT  I  ++  ++     D +I E+GGTVGDIES+PFLEA RQ++     + V FIH   +  L    +LKTKP QHSVK+L S GI P++++ RS+  +SN LKEKI L   +E +++   ++ +++Y +P  L  + + N +    K++  N      W      IK+  K    IA+VGKY +  DAY+S++ +L    +    +++I+++NS  + ++NI E L + D IL+PGGFG R IEGKILA  +AR+N IPFFGICLGMQ A IEFAR+VLK   A S+E N  T  P+I ++  +      GGT+RLG Y C+L   S   + Y    I ERHRHRYEFN  Y D   + G V SG + ++ LVEIIE++ H +FI VQFHPE  S+   P+P+F  F+  S
  S:     3 TKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYINIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDESLSRNNNITTGKIYWSVISKERKGDYLGSTVQVIPHITNEIKSRVYKVAEGKNIDVVITEIGGTVGDIESLPFLEAIRQIKYDVGVENVCFIHVTLVPYLKKSGELKTKPTQHSVKELRSIGIQPDIIVCRSEKLISNDLKEKIGLFCNVERDSVIQNLDAENLYEVPLMLHREGLDNLVCKKLKLQC-NETDNTEWIIMVDKIKKLSK-NVNIALVGKYVELHDAYISVVEALSHGGYANDANVNIKWLNSEDITKDNIEEYLKDIDGILIPGGFGDRGIEGKILAAGWARKNKIPFFGICLGMQCALIEFARSVLKYEGAHSSEINPETKYPVIDLMPDQKDIDEKGGTMRLGKYPCKLLKNSISFKAYGEDVIYERHRHRYEFNNIYRDELIESGLVLSGTSPDSKLVEIIEIKEHPWFIGVQFHPELKSRPNRPHPLFRDFIKAS 529
>gi|91792553|ref|YP_562204.1| CTP synthetase [Shewanella denitrificans OS217] >gi|119391172|sp|Q12PZ5|PYRG_SHEDO CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|91714555|gb|ABE54481.1| CTP synthase [Shewanella denitrificans OS217] (545 aa)
Score = 1207, Expect = 2.4e-130, Identities = 252/527 (47%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +++I     +  D  IVE+GGTVGDIES+PFLE+ RQL A+  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   AV    + KISL   +E   + SL ++  IY +P  L +Q +   +   F ++         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKILA ++AREN +P+FGICLGMQ+A IEFARNV  M DA STEFN  +  P++ +          LE ++ E++LGGT+RLG   C LK+G+K  E YK  + VERHRHRYE N  Y+D  EK G +FSG++ +  LVE+IEL  H +F+A QFHPEFTS     +P+F  F+  S
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKERVIAGGEGH--DVAIVEIGGTVGDIESLPFLESIRQLGAELGRDRTLFMHLTLVPFLGAAGEIKTKPTQHSVKELRSIGIAPDVLVCRGDRAVPANERAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDELVIKRFNIDC-KEADLSEWENVIYQEANPNG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRVTVNIKYIDSQTVEAKGDEVLQGLDGILVPGGFGERGVEGKILAAKFARENKLPYFGICLGMQVALIEFARNVAGMADAHSTEFNPASPFPVVGLITEWIDEDGQLELRHEESDLGGTMRLGAQLCHLKEGTKAAEAYKGNTCVERHRHRYEVNNNYVDRLEKAGLIFSGLSSDRKLVEMIELAEHPWFVAGQFHPEFTSTPRDGHPLFEGFIAAS 536
>gi|88705812|ref|ZP_01103521.1| CTP synthase [gamma proteobacterium KT 71] >gi|88699883|gb|EAQ96993.1| CTP synthase [Congregibacter litoralis KT71] (552 aa)
Score = 1207, Expect = 2.4e-130, Identities = 230/527 (43%), Positives = 343/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+++ VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+N+D GTM+P QHGEV+VT DG ETDLD+G+YERF    + + +N T GRVY + +AKER G +LG T+QV+PHIT+ I +++++ +     D  +VE+GGTVGDIE +PFLEA RQL+ +    R+ +M +  VP I   T  ++KTKP QHSVK+L S G+ P++LL RS   +      KI+L T +E   +  L++   IY +P +L    + + +   F ++ P       WD         ++   R+A+VGKY + PDAY S+  +L  +     TD+ ++++ +  +  + I  L   DAILVPGGFG R +EGKI A++YAREN+IPF GICLGM +A +E+ARNV  +  A S+E    T +PI+ ++          E ++  ++LGGT+RLG+  C L++G++I EIY    I ERHRHRYE N  Y+   +  G   +G + + +LVE++EL  H +F+A QFHPEFTS+    +P+F S++  +
  S:     2 TRLVFVTGGVVSSLGKGIAAASLAAVLEARGLKVTLLKLDPYINIDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFTRAVMSRRNNFTTGRVYNQVLAKERRGDYLGGTVQVIPHITDEIKRRVLVGAG--DADVAVVEIGGTVGDIEGLPFLEAARQLKVEMGSSRALLMHLTLVPYIA--TAGEIKTKPTQHSVKELRSIGLQPDILLCRSTVPIEESACSKIALFTNVEARAVIPLLDADTIYSIPRALHANGLDDFVVERFNLDCP-AADLSEWDEVLQRQVAERQATVRVAMVGKYMELPDAYKSLNEALSHAGLQTLTDVQVDYVEAEDIERDGIGILEGADAILVPGGFGDRGVEGKIEAVRYARENDIPFLGICLGMHVALVEYARNVCGLEGAHSSEMAPETPHPIVALITEWQNADGSTEQRDESSDLGGTMRLGSQPCHLEEGTRIREIYGADVINERHRHRYEVNNNYVKTLQDQGMTIAGWSADKSLVEMVELPEHAWFVACQFHPEFTSRPRGGHPLFTSYIQAA 536
>gi|118727030|ref|ZP_01575642.1| CTP synthase [Clostridium cellulolyticum H10] >gi|118663595|gb|EAV70244.1| CTP synthase [Clostridium cellulolyticum H10] (534 aa)
Score = 1207, Expect = 2.6e-130, Identities = 243/526 (46%), Positives = 337/526 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV S LGKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL K SN+T G++Y+  I+KER G +LG T+QV+PHIT  I  +I  +    + D +I E+GGTVGDIES+PFLE+ RQ+  +  R  VM+IH   +  L    +LKTKP QHSVK+L S GI P++++ R++  +S  +KEK+SL   +    +   ++ + +Y +P  LE + +   +     +E         W+      K PK     I +VGKY +  DAYLS+  SL         ++ I ++NS  +    + S L   D ILVPGGFG R IEGKI AI +AREN IPFFGICLGMQ+A +EFARNV  +HDA+S+EF E T  P+I ++  +     +GGT+RLG Y C++ + + I  I++ + I ERHRHRYEFN ++ D F K+G   SG++    LVE IEL++H +F+ VQFHPEF S+   P+P+F  F+  +
  S:     4 KYIFVTGGVVSGLGKGITAASLGRLLKARGVHVTIQKFDPYINVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSKNSNITTGKIYWSVISKERKGDYLGGTVQVIPHITNEIKDRIYRVGKSERTDVVITEIGGTVGDIESLPFLESIRQVSNEVGRENVMYIHVTLVPYLGISGELKTKPTQHSVKELRSIGIQPDVIVCRTEKYLSQDMKEKLSLFCNVPEGAVVQNLDAEVLYEVPLMLEKEGLAKIVCKRLGLEC-KEPDLDEWEEMVRRQKNPKS-SVTIGLVGKYVELHDAYLSVAESLRHGGIGNDVEVDIRWVNSEEIENGEVNSFLQGVDGILVPGGFGDRGIEGKINAITFARENKIPFFGICLGMQMAVVEFARNVAGLHDANSSEFGE-TPYPVIDLMPEQREVDEMGGTMRLGVYPCKINENTLIKGIFEDELIYERHRHRYEFNNEFRDTFIKNGMTLSGLSPSGKLVETIELKDHPWFVGVQFHPEFKSRPNKPHPLFKDFVRAA 528
>gi|194332986|ref|YP_002014846.1| CTP synthase [Prosthecochloris aestuarii DSM 271] >gi|194310804|gb|ACF45199.1| CTP synthase [Prosthecochloris aestuarii DSM 271] (564 aa)
Score = 1207, Expect = 2.6e-130, Identities = 240/528 (45%), Positives = 340/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMF-IHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI---SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+    ++SN+T GRVY   I KER G++LG T+QVVPH+ + I +++  L+     D LI E+GGT+GDIES+PFLEA RQL+  +  + M  IH   +  +    +LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     +   ++  L +   IY +P  L N+K+   +     ++        +W  F + ++ P   +  IA+ GKY++ PDAY SI+ SL  +       + +  I +    EN     + L     +LV  GFG R IEGKI  +QYARENNIPF GICLGMQ ASIEFARNV  + +A+STEF++    P+I ++E + +    GGT+RLG+Y C LK+G+K  + Y +  I ERHRHRYEFN +Y  +FE +G VFSG +    LVEI+E+ NH++F+AVQFHPE+ S++   +P+F  F+  +K+
  S:     8 KHIFVTGGVVSSLGKGILSASLGLLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDEATSQQSNLTMGRVYKSVIDKERQGEYLGGTVQVVPHVIDEIKERMGELAKNSNLDILITEIGGTIGDIESLPFLEAMRQLKLDFGPKNMLNIHLTLVPYIKAACELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVGHFCNLHELDVIGLSDCDTIYGVPLMLLNEKLDIRVLKKLGLKKYKEPDLAYWKEFCNKVQHPTDGEVTIAICGKYTEYPDAYKSILESLVHAGADNNVRVHVRLIRAEDAEENGSDVKTALEGVHGVLVAPGFGDRGIEGKIRFVQYARENNIPFLGICLGMQCASIEFARNVCGLSEANSTEFSKRCRQPVIDLMEHQKKVKEKGGTMRLGSYPCILKEGTKAHQAYDKFLINERHRHRYEFNNEYRRLFEDNGMVFSGTSPNGELVEIVEISNHRWFVAVQFHPEYKSRVHCVHPLFSGFVAAAKE 539
>gi|88803447|ref|ZP_01118973.1| CTP synthetase [Polaribacter irgensii 23-P] >gi|88781013|gb|EAR12192.1| CTP synthetase [Polaribacter irgensii 23-P] (537 aa)
Score = 1207, Expect = 2.6e-130, Identities = 238/529 (44%), Positives = 345/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SL  +L+  G  V I K DPY+N+D GT+ P +HGE +VT DG ETDLD+G+YERFLNI   + +NVT GR+Y   I KER G+FLG T+QV+PHIT+ I +++ LL    + D +I E+GGTVGDIES+P++E+ RQL  +  S+  + IH   +  L    +LKTKP QHSVK LM +G+ P++L+ R++  +S+ +K K++L   ++ E++   I+ + IY +P  +  Q +   + N  K+        K W+ F    K PK  +  IA++GKY +  DAY SI  +   +    +T + + +++S  L   N  + L+  + ILV  GFG R IEGKI A++YARE NIPFFGICLGMQ+A IEF+R +LK+ +A STE N+NT +P+I ++E +   T  GGT+RLG ++CELK  SKI   Y+ + I ERHRHRYEFN  Y+D  E  G   +G N +  LVE++E+ +H +F+ VQ+HPE+ S +L P+P+F  F+  + K
  S:     4 TKYVFVTGGVTSSLGKGIIAASLAKLLQERGFSVTIQKLDPYINIDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNIPTSQANNVTTGRIYQSVINKERKGEFLGKTVQVIPHITDEIKRRVQLLGETGEYDIVITEIGGTVGDIESLPYVESVRQLLWEKGSENAIVIHLTLVPYLAAAGELKTKPTQHSVKMLMQSGVSPDILVCRTEHEISDDIKRKLALFCNVKQEDVIQSIDAETIYDVPNLMLAQGLDTVVLNKLKLSSKGEPELKVWNEFLKKHKNPKS-EVEIALIGKYVELHDAYKSITEAFIHAGSSNETKVKVRWVHSEELTPKNAEKKLAGVNGILVAPGFGDRGIEGKIRAVRYAREQNIPFFGICLGMQMAVIEFSRTILKLENASSTEMNKNTKHPVINLMESQKGITEKGGTMRLGAWDCELKKDSKIYNAYQSEFISERHRHRYEFNNNYLDQIEAAGMKATGTNPKTGLVEVVEITSHPWFVGVQYHPEYKSTVLKPHPLFVDFIKAALK 533
>gi|149115961|ref|ZP_01842696.1| CTP synthase [Shewanella baltica OS223] >gi|146864133|gb|EDK49575.1| CTP synthase [Shewanella baltica OS223] (545 aa)
Score = 1207, Expect = 2.9e-130, Identities = 251/524 (47%), Positives = 346/524 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    K KISL   +E   + SL ++  IY +P  L +Q + + +   F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKILA ++ARENN+P+FGICLGMQ+A IEFARNV  M DA STEFN+ T  P++ ++          E ++  ++LGGT+RLG   C L +GSK  + YK  S VERHRHRYE N KY +  E+ G +FSG++ +  LVE+IEL++H +F+A QFHPEFTS     +P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLVCRGDRAIPANEKAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDDLVVKRFGLEC-READLSEWENVIYQEANPNG-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRVSVTIKYIDSQTVEAKGEEVLQGLDGILVPGGFGERGVEGKILAAKFARENNLPYFGICLGMQVALIEFARNVAGMADAHSTEFNKETPFPVVGLITEWIDEEGNVEQRHEASDLGGTMRLGAQLCHLLEGSKAAQAYKGNSCVERHRHRYEVNNKYRERLEQAGMIFSGLSSDRKLVEMIELKDHPWFVAGQFHPEFTSTPRDGHPLFEGFI 533
>gi|119477273|ref|ZP_01617509.1| CTP synthetase [marine gamma proteobacterium HTCC2143] >gi|119449636|gb|EAW30874.1| CTP synthetase [marine gamma proteobacterium HTCC2143] (543 aa)
Score = 1207, Expect = 2.9e-130, Identities = 243/527 (46%), Positives = 341/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T GRVY   + KER G +LG T+QV+PHIT+ I +++I        +  IVE+GGT+GDIE +PF EA RQL+      R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++LL RS   +     +KIS  T +E   +  L +   IY +P +L+ + + + I   F ++  P  +    WD        P+K +  IA+VGKY +  DAY S+  +L+ +    +T ++I +++S  L ++ +S L   D ILVPGGFG R +EGKI  +Q+ARENNIPF GICLGMQ+A IEFARNV  + DA+S+EFN  T  P+I ++          E ++   +LGGT+RLG   C L DGSK    Y    I+ERHRHRYE N  ++D  ++ G    G + +++LVE+IEL +H +FIA QFHPEFTS     +P+F  F+N +
  S:     3 TRFIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIRTKMGKRNNFTTGRVYETVLRKERRGDYLGGTVQVIPHITDEIKRRVI--EGAGDAEVAIVEIGGTIGDIEGLPFFEAARQLKVDLGPSRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDILLCRSDHEIDEGSLKKISSFTNVELRAVIPLQDADSIYRIPNALKQRGLDDLIVEKFGLQCGPADL--SEWDRVVDGALNPEK-EITIAMVGKYMELIDAYKSLNEALDHAGINTRTKVNIRYVDSQKLEDDGLSVLEGVDGILVPGGFGNRGVEGKIATVQFARENNIPFLGICLGMQVAVIEFARNVASLADANSSEFNAQTKFPVIALITEWVDADGITETRDENADLGGTMRLGGQECRLVDGSKAKATYDADLIIERHRHRYEVNNTFVDQLQQAGMRIGGWSADDSLVEVIELPDHPWFIACQFHPEFTSTPRDGHPLFSGFVNAA 536
>gi|18311190|ref|NP_563124.1| CTP synthetase [Clostridium perfringens str. 13] >gi|110800874|ref|YP_696886.1| CTP synthetase [Clostridium perfringens ATCC 13124] >gi|110801869|ref|YP_699482.1| CTP synthetase [Clostridium perfringens SM101] >gi|168205555|ref|ZP_02631560.1| CTP synthase [Clostridium perfringens E str. JGS1987] >gi|168210137|ref|ZP_02635762.1| CTP synthase [Clostridium perfringens B str. ATCC 3626] >gi|168213688|ref|ZP_02639313.1| CTP synthase [Clostridium perfringens CPE str. F4969] >gi|169344199|ref|ZP_02865181.1| CTP synthase [Clostridium perfringens C str. JGS1495] >gi|24212130|sp|Q8XIB3|PYRG_CLOPE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391091|sp|Q0TNA4|PYRG_CLOP1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391092|sp|Q0SQX5|PYRG_CLOPS CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|18145873|dbj|BAB81914.1| CTP synthase [Clostridium perfringens str. 13] >gi|110675521|gb|ABG84508.1| CTP synthase [Clostridium perfringens ATCC 13124] >gi|110682370|gb|ABG85740.1| CTP synthase [Clostridium perfringens SM101] >gi|169297657|gb|EDS79757.1| CTP synthase [Clostridium perfringens C str. JGS1495] >gi|170662852|gb|EDT15535.1| CTP synthase [Clostridium perfringens E str. JGS1987] >gi|170711780|gb|EDT23962.1| CTP synthase [Clostridium perfringens B str. ATCC 3626] >gi|170714836|gb|EDT27018.1| CTP synthase [Clostridium perfringens CPE str. F4969] (535 aa)
Score = 1206, Expect = 3.3e-130, Identities = 238/531 (44%), Positives = 342/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           ++  TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT+GRVY+  I+KER G++LG T+QV+PHIT AI  ++  +  +   D +I E+GGT+GDIES+PFLEA RQ++    +  V FIH   +  L    +LKTKP QHSVK+L S GI P++++ RS+  +S  +K+KI L   I+   +   ++ +H+Y +P  L  + +   +     +   + I    W      I     +  +IA+VGKY +  DAY+S++ +L        T++ IE+IN+  + + N+ E LS  D +LVPGGFG R +EGKI AI++AREN  PF GICLGMQ A IE+ARNVL +  A S+E N  T  P+I ++  +    +LGGT+RLG Y C+L+D +   ++Y    I ERHRHRYEFN +Y     + G   +G + +  LVE +E+++H +F+AVQ+HPE  S+   P+P+F  F+  +
  S:     1 MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNAIKDRVHRVGKERDVDVVITEIGGTIGDIESLPFLEAIRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPDIIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRD-IDNAEWIDMVHRITH-LTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAA 531
>gi|15598833|ref|NP_252327.1| CTP synthetase [Pseudomonas aeruginosa PAO1] >gi|116051634|ref|YP_789527.1| CTP synthetase [Pseudomonas aeruginosa UCBPP-PA14] >gi|152986406|ref|YP_001346886.1| CTP synthetase [Pseudomonas aeruginosa PA7] >gi|194547536|ref|YP_002082564.1| CTP synthase [Pseudomonas aeruginosa C3719] >gi|194553320|ref|YP_002088347.1| CTP synthase [Pseudomonas aeruginosa 2192] >gi|24212158|sp|Q9HXZ4|PYRG_PSEAE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|9949796|gb|AAG07025.1|AE004783_10 CTP synthase [Pseudomonas aeruginosa PAO1] >gi|115586855|gb|ABJ12870.1| CTP synthase [Pseudomonas aeruginosa UCBPP-PA14] >gi|126168482|gb|EAZ53993.1| CTP synthase [Pseudomonas aeruginosa C3719] >gi|126195713|gb|EAZ59776.1| CTP synthase [Pseudomonas aeruginosa 2192] >gi|150961564|gb|ABR83589.1| CTP synthase [Pseudomonas aeruginosa PA7] (542 aa)
Score = 1206, Expect = 3.6e-130, Identities = 238/529 (44%), Positives = 345/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T+ + VTGGV SSLGKG+A +SL A+L+  G ++ ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY + + KER G +LGAT+QV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   +    + KI+L T +E   + +L ++  IY +P  L  Q + + +   F +E   +     WD        P++ +  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  + +   S L   DAILVPGGFG R +EGKI  +QYAREN IP+ GICLGMQ+A IE+ARNVL   DA+STEF++++ +P++ ++          E +   ++LGGT+RLG   C+L+ G+ + + Y +  IVERHRHRYE N   +   E+ G   SG + +  LVE++E   H +F+A QFHPEFTS     +P+F  F+N + K
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKITMLKLDPYINVDPGTMSPFQHGEVFVTQDGAETDLDLGHYERFVRTTMTQNNNFTTGRVYMDVLRKERRGDYLGATVQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEIGAKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDHPIDVSSRRKIALFTNVEERAVIALEDVDTIYRIPSVLHAQGLDDIVVERFGLEC-GQADLSEWDRVVDAKLNPER-EVTIAMVGKYMELLDAYKSLIEAMTHAGIQSRTKVNLRYIDSEDIEQQGTSLLEGVDAILVPGGFGLRGVEGKISTVQYARENKIPYLGICLGMQVAVIEYARNVLGWSDANSTEFDKSSGHPVVGLITEWQDATGATEIRTEASDLGGTMRLGAQECQLQTGTLVHDCYAKDVIVERHRHRYEVNNNLLPQLEQAGLKISGRSGDGALVEVVEAPEHPWFVACQFHPEFTSTPRDGHPLFSGFVNAALK 537
>gi|89891425|ref|ZP_01202931.1| CTP synthase (UTP--ammonia ligase) [Flavobacteria bacterium BBFL7] >gi|89516456|gb|EAS19117.1| CTP synthase (UTP--ammonia ligase) [Flavobacteria bacterium BBFL7] (534 aa)
Score = 1205, Expect = 3.9e-130, Identities = 235/523 (44%), Positives = 349/523 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV SSLGKG+  +SL  +L+  G  V I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+N  + +NVT GR+Y   I KER G+FLG T+QV+PHIT+ I  +I +L    + D +I E+GGTVGDIES+P++E+ RQL     ++ S V+ +  +P   L    +LKTKP QHSVK LM +G+  ++L+ R++  +S ++K K++    +  E +   I+++ IY +P  +  + +   +     +++       +W+ F    K PK  +  I ++GKY +  D+Y SI+ S   +    +  ++IE I+S  L  +NI ++LS  D +LV  GFG+R IEGKI A++YAR N +PFFGICLGMQ+A IE++RNVL + DA+S E +E TANP+I+++E +   TN+GGT+RLG ++CEL +G  + +IY    I ERHRHRYE+N +Y +  EK G   +G+N +  LVEIIE+E+H +FI VQ+HPE+ S + +P+P+F SF+
  S:     5 KYIFVTGGVTSSLGKGIIAASLAKLLQARGFRVTIQKLDPYINVDPGTLNPYEHGECYVTEDGAETDLDLGHYERFLNVNTSQANNVTTGRIYQSVIQKERRGEFLGKTVQVIPHITDEIKHRIQILGKSGEYDIVITEIGGTVGDIESLPYIESVRQLSWELGEHNSMVIHLTLIPF--LSAAGELKTKPTQHSVKTLMESGVQADILVCRTEHELSEEIKTKLARFCNVRREAVIQSIDVETIYDVPNKMLAEGLDKVVLEELNLDIQKAPDLTNWNEFVQRHKNPKS-EVTIGLIGKYVELQDSYKSILESFIHAGAANEVKVNIESIHSEFLEVDNIDAKLSHLDGLLVAPGFGERGIEGKIEAVRYARVNKMPFFGICLGMQMAVIEYSRNVLGLQDANSVEMDEKTANPVISLMEEQKNITNMGGTMRLGAWDCEL-NGGNVADIYGSGMISERHRHRYEYNNEYKEQLEKAGLKSTGVNPKTGLVEIIEIEDHPWFIGVQYHPEYKSTVANPHPLFKSFV 527
>gi|191161196|ref|ZP_03023079.1| CTP synthase [Geobacter sp. M21] >gi|190997927|gb|EDV73372.1| CTP synthase [Geobacter sp. M21] (533 aa)
Score = 1205, Expect = 4.2e-130, Identities = 249/529 (47%), Positives = 348/529 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQA-KYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           KTK + VTGGV SS+GKG+A +SLGA+L+  G  V I K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L K+SN T G+VY+  I KER G +LG T+QV+PHIT+ I  K+ +L N    D  IVE+GGTVGDIES+PFLEA RQL++ +    V+++H   +  + T  +LKTKP QHSVK+L   GI P++LL R +  V   +K KI+L   +E + + +  + +HIY +P +L  Q + + +     +  + P+     HW    S +  P   + RIAVVGKY D  ++Y S+  +L          + + +++S  + E  I + L++ D ILVPGGFG+R  EGKI AI+YAR N +PFFGICLGMQ+A++E+ARNV ++ +A S+EF  +  +P+I ++E +    N GGT+RLG Y C L  G+   + Y    I ERHRHRYEFN  +    E+ G V SG+ KE NLVEIIEL +H +F+  QFHPEF SK L+P+P+F +F+  +K
  S:     2 KTKFIFVTGGVVSSIGKGLAAASLGALLEARGLRVTIQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSGKLSKKSNFTTGQVYFSVIEKERRGDYLGGTVQVIPHITDQI--KLNILENAKGSDIAIVEIGGTVGDIESLPFLEAIRQLKSDRGAGNVLYLHVTLVPYIKTAGELKTKPTQHSVKELREIGIQPDILLCRCEQDVPQDMKAKIALFCNVEEKAVITSQDAEHIYAVPIALNQQGLDDQVVEKLNIWTKAPD---LSHWQQVVSKLTNPGSGEVRIAVVGKYVDLKESYKSLSEALTHGGIANDCRVKLVYLDSEKIEEEGIGKSLADVDGILVPGGFGERGTEGKIKAIEYARVNKVPFFGICLGMQMAAVEYARNVCRLPEAFSSEFKPDCESPVIHLMEEQKGVENKGGTMRLGAYPCSLTKGTFAQKAYGATEISERHRHRYEFNNLFRTCLEEKGMVISGVYKEGNLVEIIELPDHPWFLGCQFHPEFKSKPLNPHPLFKAFIGATK 529
>gi|117919564|ref|YP_868756.1| CTP synthetase [Shewanella sp. ANA-3] >gi|117611896|gb|ABK47350.1| CTP synthase [Shewanella sp. ANA-3] (546 aa)
Score = 1205, Expect = 4.5e-130, Identities = 251/524 (47%), Positives = 345/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+I     +  D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    + KISL   +E   + SL ++  IY +P  L +Q + + +   F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  +SI++I+S ++       L   D ILVPGGFG+R +EGKILA +YAREN +P+FGICLGMQ+A IEFARNV  M DA STEFN+ T  P++ ++          E ++  ++LGGT+RLG   C L +GSK  + YK  + VERHRHRYE N KY +  E+ G VFSG++ +  LVE+IEL++H +F+A QFHPEFTS     +P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKVIAGGEGH--DVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLICRGDRAIPANERAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDDLVVKRFGLEC-READLSEWENVIYQEANPNG-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRVSVSIKYIDSQTVEAKGDEVLQGLDGILVPGGFGERGVEGKILAAKYARENELPYFGICLGMQVALIEFARNVAGMTDAHSTEFNKATPFPVVGLITEWVDEEGNVEQRHEASDLGGTMRLGAQLCHLLEGSKAAQAYKGNTCVERHRHRYEVNNKYRERLEQAGLVFSGLSSDRKLVEMIELKDHPWFVAGQFHPEFTSTPRDGHPLFEGFV 533
>gi|167855375|ref|ZP_02478142.1| CTP synthetase [Haemophilus parasuis 29755] >gi|167853523|gb|EDS24770.1| CTP synthetase [Haemophilus parasuis 29755] (544 aa)
Score = 1205, Expect = 4.6e-130, Identities = 241/529 (45%), Positives = 344/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T  + VTGGV SSLGKG+A +SL ++L+  G +V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y E + KER G +LGATIQV+PHIT  I  ++I     +  D  IVEVGGTVGDIES+PFLEA RQL     R + +F+H   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS   +    + KI+L   +    + SL ++  IY +P  L++Q + + I + F++          W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S  +    +  L   DAILVPGGFG R +EGKI   QYAREN IP+ GICLGMQ+A IE+ARNV  +  A+S+EF+++   P++ ++          E ++ E++LGGT+RLG   C L +G+K  E+Y+ ++IVERHRHRYE N   +   E  G   SG++ +  LVEIIE+ NH +FIA QFHPEFTS     +P+F  F+  +K+
  S:     3 TNYIFVTGGVVSSLGKGIAAASLASILEARGLDVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRTKMTKANNFTSGKIYSEVLRKERRGDYLGATIQVIPHITNEIKARVIEGGKGH--DVAIVEVGGTVGDIESLPFLEALRQLAVDVGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRMIPANERAKIALFCNVPERAVISLKDVDSIYRIPALLKSQGLDDFICDRFRLTC-KEADLSEWEQVLYQQANPTG-EVTIGMVGKYVELPDAYKSVNEALKHAGLKNRLTVNIKYIDSQDVETKGVEVLQGVDAILVPGGFGYRGVEGKIRTAQYARENKIPYLGICLGMQIALIEYARNVAGLTQANSSEFDKHCPQPVVGLITEWQDESGNVETRSDESDLGGTMRLGAQQCHLIEGTKAREVYRTETIVERHRHRYEVNNTLLPQIEAAGLKVSGLSADRKLVEIIEVPNHPWFIAAQFHPEFTSTPRDGHPLFEGFVKAAKE 538
>gi|119391076|sp|Q6MPP0|PYRG_BDEBA CTP synthase (UTP--ammonia ligase) (CTP synthetase) (534 aa)
Score = 1205, Expect = 4.9e-130, Identities = 240/530 (45%), Positives = 345/530 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEF---NENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K K + VTGGV SS+GKG+  +SLGA+L+  G +V IMKFDPYLNVD GTM+P QHGEV+VT DG ETDLD+G+YERF +  + + ++V+ G++Y   + +ER G +LG T+QV+PHITE I  +I   +     + ++VE+GGTVGDIES PFLEA RQ++    +   + +H   +  +    +LK+KP QHSVK+L   G+ P+ L+ RS+  + + LK KI L   ++ EN+ +  + + IY +P +L  +K+   I     +    ++  K W     ++  P  +  +I VVGKY D  ++Y S+  +L          + I +++S  + +  + S L + D ILVPGGFG R +EGKI AI+YARE  +PFFGIC GMQL++IEFARNV  + DA S EF   N+ T N +I  +  +    N GGT+RLG + C +  GS+  ++YK  SI+ERHRHR+EFN KY D+FEK+G + SGI KE +LVEI+EL +H +F+ VQFHPEF SK L+P+P+F  F+  S K
  S:     2 KQKFIFVTGGVVSSIGKGLTAASLGALLEGRGHKVTIMKFDPYLNVDPGTMSPLQHGEVYVTEDGAETDLDLGHYERFTSALMNRSNSVSTGQIYDTVLNRERRGDYLGGTVQVIPHITEEIKARIYEAAQG--SEIILVEIGGTVGDIESQPFLEAIRQMRIDVGQENSVLVHVTYVPYIAAAGELKSKPTQHSVKELREIGLQPDFLVCRSEKVIDDNLKAKIGLFCSVKPENVIAAQDSRFIYEVPLALHREKLDELIVARLGLSA-GKLNMKGWQNLVKILGNP-SHTVKIGVVGKYVDLKESYKSLHEALVHGGVANNARVEIIYVDSEKVTDKTVHSLLGKVDGILVPGGFGTRGVEGKITAIKYAREKRVPFFGICFGMQLSAIEFARNVCGIKDATSREFHAENKRTGNFVIDSMAEQRGVINKGGTMRLGAFPCAIASGSRAYQVYKASSIMERHRHRFEFNNKYKDLFEKNGMMASGICKERDLVEIVELPDHPWFVGVQFHPEFKSKPLAPHPLFVHFVKASLK 532
>gi|94984934|ref|YP_604298.1| CTP synthetase [Deinococcus geothermalis DSM 11300] >gi|119391099|sp|Q1J055|PYRG_DEIGD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|94555215|gb|ABF45129.1| CTP synthase [Deinococcus geothermalis DSM 11300] (553 aa)
Score = 1204, Expect = 5.8e-130, Identities = 239/523 (45%), Positives = 351/523 (67%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIY---KRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGIN-----KENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV SSLGKGVA +SLGA+L+  G +V  +K DPY+N+DAGTM P +HGEVFVT  G ETDLDIGNYERFL++++P  SN+T G+VY E I KER G +L  T+QV+PH+T+ I ++I         + +++EVGGTVGDIES+PFLEA RQ +     + V++IH   +  L T ++ KTKP QHSV +L S GI P++++VRSK+ +  ++  KI+L T +    ++S  ++ H+Y LP +LE Q +  ++ +   +E   PN +G   W      +K P  ++  IA+ GKY++ PDAYLS++ SL  +       ++I+++N+  L E ++ ++L + D ILVPGGFG R IEGKI A +YAR +N+P+ GICLGMQ+A IE+AR+V  +  A+S EF+    + +I ++  +     LGGT+RLG++  EL+ G+KI E+Y   +  ++ ERHRHRYE NP Y+   +  G V SG+      +   LVE IE+  H FF+A+Q HPEF S+ + P+P F  F+
  S:     2 KYIFVTGGVVSSLGKGVASASLGALLRARGYKVTAVKIDPYINIDAGTMRPYEHGEVFVTASGAETDLDIGNYERFLDLDIPPGSNITTGQVYLEVIRKERAGDYLSQTVQVIPHVTDEIKRRIRTAGENAGAEIVLIEVGGTVGDIESLPFLEAIRQFKFDEGDENVLYIHLTLVPYLGTSNEFKTKPTQHSVAELRSVGISPDIVMVRSKEKLPPEITRKIALFTSVRENRVFSSYDVGHVYELPLALEEQGLGKAVEDLLGLERTHPN-LGV--WQNAVRTLKHP-NHEVTIAIAGKYTEMPDAYLSLLESLTHAGIANDARVNIKWVNAEELAEGDLETQLGDADGILVPGGFGIRGIEGKIKAAEYARTHNVPYLGICLGMQIAVIEYARHVAGLTGANSAEFDPYAPHKVIDLMPEQLEVEGLGGTMRLGDWPMELRAGTKIAELYGVPQGGTVRERHRHRYEVNPAYVGQLQDAGLVISGVTPGVQGRGAGLVESIEIPGHPFFVALQAHPEFKSRPMRPSPPFAGFV 532
>gi|119493488|ref|ZP_01624155.1| CTP synthetase [Lyngbya sp. PCC 8106] >gi|119452671|gb|EAW33851.1| CTP synthetase [Lyngbya sp. PCC 8106] (574 aa)
Score = 1204, Expect = 6.2e-130, Identities = 235/520 (45%), Positives = 340/520 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYK-------HWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIF 524
           TK + +TGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VTAG +Y   I KER G + G T+QV+PHIT    ++I  ++    PD +I EVGGTVGDIES+PFLEA RQ +    R  V+++H   +  + +  ++KTKP QHSVK+L S GI P++L+ R    ++  +KEK+S    +E E++ +  +   IY +P  LE + +         +E   P+   ++       H DT       P      IA+VGKY    DAYLS++ +L   +  +  +L+I +++S  +  N+I S+L   D I+VPGGFG R I+GKI AIQYARE NIPF G+CLGMQ + IE+AR++ K+  ADS EF+  T NP+I +L  +    +LGGT+RLG Y C L+  +   ++Y+++ + ERHRHRYEFN  Y ++F + G+  SG + +  LVE++EL +H FFIA QFHPEF S+  +P+P+F
  S:     2 TKFVFITGGVVSSIGKGIVAASLGRLLKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTQDGAETDLDLGHYERFTDTSMSRLNSVTAGSIYQAVINKERRGDYQGGTVQVIPHITHECKERIRRVARDTNPDVVITEVGGTVGDIESLPFLEAIRQFRKDVGRQNVIYVHVTLVPYIASAGEMKTKPTQHSVKELRSIGIKPDMLVCRCDRPLAKGIKEKVSEFCDVEVESVITAQDADSIYEVPLILEREGLAQQTLELLHLESRQPDLRAWQTIVDRLYHRDTDNLGTTPPT---VEIAIVGKYIQLSDAYLSVVEALRHGAIEIGVELNIRWVDSEEVQNNSIESDLKNIDGIVVPGGFGIRGIDGKIAAIQYAREQNIPFLGLCLGMQCSVIEWARHIAKLERADSAEFDPETPNPVINLLPEQQDVVDLGGTMRLGLYPCRLQRDTLAYQLYQQEVVYERHRHRYEFNNAYRNLFVESGYQISGTSPDGRLVEMVELPSHPFFIAAQFHPEFQSRPNTPHPLF 529
>gi|42522384|ref|NP_967764.1| CTP synthetase [Bdellovibrio bacteriovorus HD100] >gi|39574916|emb|CAE78757.1| CTP synthase [Bdellovibrio bacteriovorus HD100] (554 aa)
Score = 1203, Expect = 7.0e-130, Identities = 240/530 (45%), Positives = 345/530 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEF---NENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K K + VTGGV SS+GKG+  +SLGA+L+  G +V IMKFDPYLNVD GTM+P QHGEV+VT DG ETDLD+G+YERF +  + + ++V+ G++Y   + +ER G +LG T+QV+PHITE I  +I   +     + ++VE+GGTVGDIES PFLEA RQ++    +   + +H   +  +    +LK+KP QHSVK+L   G+ P+ L+ RS+  + + LK KI L   ++ EN+ +  + + IY +P +L  +K+   I     +    ++  K W     ++  P  +  +I VVGKY D  ++Y S+  +L          + I +++S  + +  + S L + D ILVPGGFG R +EGKI AI+YARE  +PFFGIC GMQL++IEFARNV  + DA S EF   N+ T N +I  +  +    N GGT+RLG + C +  GS+  ++YK  SI+ERHRHR+EFN KY D+FEK+G + SGI KE +LVEI+EL +H +F+ VQFHPEF SK L+P+P+F  F+  S K
  S:    22 KQKFIFVTGGVVSSIGKGLTAASLGALLEGRGHKVTIMKFDPYLNVDPGTMSPLQHGEVYVTEDGAETDLDLGHYERFTSALMNRSNSVSTGQIYDTVLNRERRGDYLGGTVQVIPHITEEIKARIYEAAQG--SEIILVEIGGTVGDIESQPFLEAIRQMRIDVGQENSVLVHVTYVPYIAAAGELKSKPTQHSVKELREIGLQPDFLVCRSEKVIDDNLKAKIGLFCSVKPENVIAAQDSRFIYEVPLALHREKLDELIVARLGLSA-GKLNMKGWQNLVKILGNP-SHTVKIGVVGKYVDLKESYKSLHEALVHGGVANNARVEIIYVDSEKVTDKTVHSLLGKVDGILVPGGFGTRGVEGKITAIKYAREKRVPFFGICFGMQLSAIEFARNVCGIKDATSREFHAENKRTGNFVIDSMAEQRGVINKGGTMRLGAFPCAIASGSRAYQVYKASSIMERHRHRFEFNNKYKDLFEKNGMMASGICKERDLVEIVELPDHPWFVGVQFHPEFKSKPLAPHPLFVHFVKASLK 552
>gi|170723225|ref|YP_001750913.1| CTP synthase [Pseudomonas putida W619] >gi|169761228|gb|ACA74544.1| CTP synthase [Pseudomonas putida W619] (542 aa)
Score = 1203, Expect = 7.5e-130, Identities = 238/527 (45%), Positives = 341/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+      R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   + +  + KI+  T +E   + +L +   IY +P  L  Q + + +   F ++  N      WD        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +     S L   DAILVPGGFG R +EGKI A+QYAREN +P+ GICLGMQ+A IEFARNV+   DA+STEF+ N+ +P++ ++          E +   ++LGGT+RLG  +C+L  GSK+ + Y +  I ERHRHRYE N   +      G V SG +++  LVE++E ++H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRIYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRFEVGAKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDHPIDSSSRRKIAQFTNVEERAVIALEDADTIYKIPGILHAQGLDDFVVERFGLQC-NSADLSEWDKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTSLLEGADAILVPGGFGLRGVEGKITAVQYARENKVPYLGICLGMQVAVIEFARNVMGWKDANSTEFDRNSGHPVVGLITEWADATGAVETRTEASDLGGTMRLGAQDCQLAAGSKVHDCYGKDVITERHRHRYEVNNNLLPQLVDAGLVVSGRSEDGALVEVVESKDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|31544391|ref|NP_852969.1| CTP synthetase [Mycoplasma gallisepticum R] >gi|31541235|gb|AAP56537.1| PyrG [Mycoplasma gallisepticum R] (540 aa)
Score = 1203, Expect = 7.6e-130, Identities = 244/525 (46%), Positives = 351/525 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLS---NKYQPDFLIVEVGGTVGDIESIPFLEATRQ-LQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE----LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           KTK + V+GGV+SS+GKG+  +S+ ++ K    ++ I+K DPYLNVD+GTM+P +HGEVFVT DG ETDLD+G YERFL  +L + S++T+G+VY+  I KER G++LG T+Q++PH+T  I ++I L +   N    D +  E+GGT+GD+ES+PF+EA +Q ++   +    FIH VP+I L  G   KTKPLQHS+K+L + GI P+ L++RSK+++  K K KI+  T ++ ++I++ ++L + Y LP+ L  QK+   I N  ++ +  +I    WD     I        +IA++GKY+   DAYLS+I SL ++ ++    L I++I SS  ++ ++ E    L +   I+VPGGFG R +EGKI  IQ AR   IPF GICLGMQLA +E+ARNVL M DA+S+EFN  T  PI  I+     + N GG+LRLG+Y   LKD +    IY++ SI  RHRHRYEFN  Y++ F    F+ SGI  + NLVE IEL+NH FFI  Q+HPEF+SKI +   +F S +
  S:     5 KTKYIFVSGGVYSSVGKGLIVASIASIFKHQNFKINILKLDPYLNVDSGTMSPYEHGEVFVTSDGTETDLDLGYYERFLVQDLNERSSITSGKVYFSVINKERKGEYLGKTVQLIPHVTNEIKRRIALAATDENNQPYDLVFCEIGGTIGDLESLPFIEAIKQIIRENDKHDTAFIHVVPIISLFNGEQ-KTKPLQHSLKELNNLGINPDFLVIRSKESLDLKTKHKIASATYLDKDHIFNSVDLNNTYFLPDYLNQQKIHEKIANKLQITIDPKIKLSAWDDLAKKINNQNNLVRKIAIIGKYTQFKDAYLSLIESLNLAGYHNHVKLEIDWIESSLYDDASLEEVNHKLKDVHGIIVPGGFGSRGVEGKIKFIQVARTKKIPFLGICLGMQLACVEYARNVLGMTDANSSEFNSQTTYPIFKIMNPD--DLNYGGSLRLGDYLVSLKDQTLTKAIYQQDSIKRRHRHRYEFNNDYLNQFNDGEFIVSGIYLQENLVETIELKNHPFFIGCQYHPEFSSKITAAETLFDSLV 534
>gi|113969458|ref|YP_733251.1| CTP synthetase [Shewanella sp. MR-4] >gi|119391174|sp|Q0HL73|PYRG_SHESM CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|113884142|gb|ABI38194.1| CTP synthase [Shewanella sp. MR-4] (546 aa)
Score = 1203, Expect = 7.7e-130, Identities = 250/524 (47%), Positives = 345/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+I     +  D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    + KISL   +E   + SL ++  IY +P  L +Q + + +   F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKILA +YAREN +P+FGICLGMQ+A IEFARNV  M DA STEFN+ T  P++ ++          E ++  ++LGGT+RLG   C L +GSK  + YK  + VERHRHRYE N KY +  E+ G VFSG++ +  LVE+IEL++H +F+A QFHPEFTS     +P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKVIAGGEGH--DVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLICRGDRAIPANERAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDDLVVKRFGLEC-READLSEWENVIYQEANPNG-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRVSVTIKYIDSQTVEAKGDEVLQGLDGILVPGGFGERGVEGKILAAKYARENELPYFGICLGMQVALIEFARNVAGMADAHSTEFNKATPFPVVGLITEWVDEEGNVEQRHEASDLGGTMRLGAQLCHLLEGSKAAQAYKGNTCVERHRHRYEVNNKYRERLEQAGLVFSGLSSDRKLVEMIELKDHPWFVAGQFHPEFTSTPRDGHPLFEGFV 533
>gi|54310178|ref|YP_131198.1| CTP synthetase [Photobacterium profundum SS9] >gi|81615010|sp|Q6LMT0|PYRG_PHOPR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|46914619|emb|CAG21396.1| putative CTP synthase [Photobacterium profundum SS9] (545 aa)
Score = 1203, Expect = 7.9e-130, Identities = 255/527 (48%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQA-KYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL------EGKNRE----TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY E + KER G +LGATIQV+PHIT  I +++I  S  +  D  IVEVGGTVGDIES+PF+EA RQL   K R + MF+H   +  L    ++KTKP QHSVK+L S GI P++L+ RS   +    + KI+L   ++ + + S+ ++  IY +P+ ++ Q + + +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  + I++I+S  +       L   DAILVPGGFG R IEGKI   QYAREN IP+ GICLGMQ+A IEFARNV  + DA STEFN  T NP++ ++      EGK  E    +NLGGT+RLG+  C LK+GSK  E+Y   SI ERHRHRYE N   +   EK G   SG++ +  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYEEVLRKERRGDYLGATIQVIPHITNEIKERVIAGSEGH--DIAIVEVGGTVGDIESLPFMEAIRQLAVQKGRERTMFMHLTLVPYLAAAGEVKTKPTQHSVKELRSIGIQPDILICRSDRVIPANERAKIALFCNVQEKAVISMKDVDSIYKIPQLIKAQGLDDFVCKRFGITAP-EANLAEWEQVIYEEANPTD-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVKIKYIDSQDVEAKGFEMLEGLDAILVPGGFGSRGIEGKIRTAQYARENKIPYLGICLGMQVALIEFARNVAGLADAHSTEFNAETKNPVVGLITEWVDSEGKVEERTENSNLGGTMRLGSQLCHLKNGSKARELYGNASIHERHRHRYEVNNNLLPQLEKAGLKISGLSADKKLVEIIEMPNHPWFVAAQFHPEFTSTPRDGHPLFEGFVKAA 536
>gi|114777198|ref|ZP_01452209.1| CTP synthetase [Mariprofundus ferrooxydans PV-1] >gi|114552343|gb|EAU54826.1| CTP synthetase [Mariprofundus ferrooxydans PV-1] (544 aa)
Score = 1203, Expect = 8.4e-130, Identities = 241/532 (45%), Positives = 341/532 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL-----EG----KNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           +N  T+ + VTGGV SSLGKG+A +SL A+ +  G  V I K DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF +  + K SN T GR+Y   I +ER G +LGAT+QV+PHIT+AI   I+ L +    D  ++E+GGTVGDIES PFLEA RQL+    R    +IH   +  + +  ++K+KP QHSVK L   GI P++LL RS+  +    K+KI+L   ++ E +    ++  IY +P       + + +   F M+   P+      W+     I+EPK  + RIA+VGKY +  DAY S+  SL          + IE+I++ SL    ++ L     ILVPGGFG+R  EGK+ AI+YAREN IPF GICLGMQLA +EFAR+V  + +A S+EF+E   +P+I ++     EG    ++ +++LGGT+RLG Y C + +G+     Y    I ERHRHRYEFN  Y +  E  G + SG   +N+LVE++E+ +H +F+A QFHPEF S+  +P+P+F +F+  SK
  S:     1 MNTNTRFVFVTGGVVSSLGKGIAAASLAALFEARGLRVTIQKLDPYINVDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFTHAVMSKRSNFTTGRIYESVIRRERRGDYLGATVQVIPHITDAIKNAILSLRSP-DVDIALIEIGGTVGDIESQPFLEAIRQLRFDLGRKNTAYIHLTLVPYIASAGEMKSKPTQHSVKQLREIGIQPDVLLCRSEHPIPKGQKDKIALFCNVDREAVIDAPDVDTIYGVPLKSHEGGLGSVVLKHFGMDDVEPD---LSVWEDICRKIREPKD-EVRIAMVGKYVELADAYKSVNESLIHGGMASGVRVKIEYIDAESLERKGVACLESMHGILVPGGFGERGTEGKMAAIRYARENRIPFLGICLGMQLAVVEFARHVAGLENAVSSEFDERAEHPVIALMTEWEQEGARVQRSADSDLGGTMRLGGYPCRVIEGTHAYAAYGSSEIRERHRHRYEFNNTYREQLEAAGLIVSGTLPDNSLVEMVEVADHPWFVACQFHPEFLSRPYAPHPLFAAFVGASK 539
>gi|168215837|ref|ZP_02641462.1| CTP synthase [Clostridium perfringens NCTC 8239] >gi|182382308|gb|EDT79787.1| CTP synthase [Clostridium perfringens NCTC 8239] (535 aa)
Score = 1202, Expect = 9.4e-130, Identities = 238/531 (44%), Positives = 341/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           ++  TK + VTGGV SSLGKG+  +SLG +LK  G  V I KFDPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT+GRVY+  I+KER G++LG T+QV+PHIT AI  ++  +  +   D +I E+GGT+GDIES+PFLEA RQ++    +  V FIH   +  L    +LKTKP QHSVK+L S GI P++++ RS+  +S  +K+KI L   I+   +   ++ +H+Y +P  L  + +   +     +   + I    W      I     +  +IA+VGKY +  DAY+S++ +L        T++ IE+IN+  + + N+ E LS  D +LVPGGFG R +EGKI AI++AREN  PF GICLGMQ A IE+ARNVL +  A S+E N  T  P+I ++  +    +LGGT+RLG Y C+L+D +   ++Y    I ERHRHRYEFN +Y     + G   +G + +  LVE +E++ H +F+AVQ+HPE  S+   P+P+F  F+  +
  S:     1 MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNAIKDRVHRVGKERDVDVVITEIGGTIGDIESLPFLEAIRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPDIIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRD-IDNAEWIDMVHRITH-LTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVDGVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDLMPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDGRLVECVEVKEHPWFVAVQYHPELKSRPNRPHPLFVGFVGAA 531
>gi|57238847|ref|YP_179983.1| CTP synthetase [Ehrlichia ruminantium str. Welgevonden] >gi|58578777|ref|YP_196989.1| CTP synthetase [Ehrlichia ruminantium str. Welgevonden] >gi|81353063|sp|Q5HC60|PYRG_EHRRW CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|57160926|emb|CAH57831.1| CTP synthase [Ehrlichia ruminantium str. Welgevonden] >gi|58417403|emb|CAI26607.1| CTP synthase [Ehrlichia ruminantium str. Welgevonden] (540 aa)
Score = 1202, Expect = 1.0e-129, Identities = 250/527 (47%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENN---LVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +S+GA+L+  G ++ + K DPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF  +   K  N+T G+VY+  ++KER G +LG T+Q++PH+T+ I+    +L N    DF+I E+GGTVGDIES PFLE+ RQ+  K  ++  +F+H   +  +    +LKTKP QHSVK+L S GI P+++L RSK  +S + ++KI+    +   NI   +++K+IY LP S     +   I   F +  P       W+   ++     K    IA++GKY    DAY S+I +LE ++ + KT LSI +I+S SLN    +      AIL+PGGFG   +EGKI+AI+YAR NNIPF GIC+GMQLA IEF RNV+ + DA+STEFN    NP+I  L     + NLGG+++LG++ C LK  SKI  IYK + I ER RHRY  N +Y D+ E HG +F+G +  NN   L E+IEL+NH +FI VQFHPEF S     +P+F SF+  S
  S:     7 TKFIFVTGGVVSSLGKGLAAASIGALLQARGFKICLRKLDPYLNIDPGTMSPIQHGEVFVTDDGAETDLDLGHYERFTGVKTTKNDNITTGKVYHNLLSKERKGDYLGQTVQIIPHVTDLINS--FILYNTDALDFVICEIGGTVGDIESQPFLESIRQIGYKLSKNNTVFVHLTLVPYISATMELKTKPTQHSVKELSSVGIQPDIILYRSKIPLSQEQRDKIANLCNVSPTNIIPALDVKNIYELPISYHQYNLDTQILKHFNITSPEP-NLDKWENILNISHISTK-TITIAIIGKYIKLLDAYKSLIEALEHAAIHNKTKLSIHWIDSRSLNNEITNTFDNVHAILIPGGFGDDGVEGKIIAIKYARINNIPFLGICMGMQLAIIEFVRNVIHLEDANSTEFNFYCKNPVIHQL--PELQQNLGGSMKLGSHPCYLKVDSKIFSIYKEQVINERRRHRYTVNLQYKDLLESHGLIFTGHSHHNNNDSLAEVIELKNHPWFIGVQFHPEFKSDPFQSHPLFMSFVQAS 531
>gi|145618081|ref|ZP_01774142.1| CTP synthase [Geobacter bemidjiensis Bem] >gi|144945541|gb|EDJ80605.1| CTP synthase [Geobacter bemidjiensis Bem] >gi|197087347|gb|ACH38618.1| CTP synthase [Geobacter bemidjiensis Bem] (533 aa)
Score = 1202, Expect = 1.0e-129, Identities = 248/529 (46%), Positives = 349/529 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQA-KYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           KTK + VTGGV SS+GKG+A +SLGA+L+  G  V I K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L K+SN T G+VY+  I KER G +LG T+QV+PHIT+ I  K+ +L N    D  IVE+GGTVGDIES+PFLEA RQL++ +    V+++H   +  + T  +LKTKP QHSVK+L   GI P++LL R +  V   +K KI+L   +E + + +  + +HIY +P +L +Q + + +     +  + P+     HW    S +  P   + RIAVVGKY D  ++Y S+  +L          + + +++S  + E+   + L++ D ILVPGGFG+R  EGKI AI+YAR N +PFFGICLGMQ+A++E+ARNV ++ +A S+EF  +  +P+I ++E +    N GGT+RLG Y C L  G+   + Y    I ERHRHRYEFN  +    E+ G V SG+ KE NLVEIIEL +H +F+  QFHPEF SK L+P+P+F +F+  +K
  S:     2 KTKFIFVTGGVVSSIGKGLAAASLGALLEARGLRVTIQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSGKLSKKSNFTTGQVYFSVIEKERRGDYLGGTVQVIPHITDQI--KLNILENAKGSDIAIVEIGGTVGDIESLPFLEAIRQLKSDRGPGNVLYLHVTLVPYIKTAGELKTKPTQHSVKELREIGIQPDILLCRCEQDVPQDMKAKIALFCNVEEKAVITSQDAEHIYAVPMALNHQGLDDQVVEKLNIWTKAPD---LSHWQQVVSKLTNPGSGEVRIAVVGKYVDLKESYKSLSEALTHGGIANDCRVKLVYLDSEKIEEDGGEKALADVDGILVPGGFGERGTEGKIKAIEYARVNKVPFFGICLGMQMAAVEYARNVCRLPEAFSSEFKPDCESPVIHLMEEQKGVENKGGTMRLGAYPCSLTKGTFAQKAYGATEISERHRHRYEFNNLFRSCLEEKGMVISGVYKEGNLVEIIELPDHPWFLGCQFHPEFKSKPLNPHPLFKAFIGATK 529
>gi|104773508|ref|YP_618488.1| CTP synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] >gi|119391118|sp|Q1GBQ2|PYRG_LACDA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|103422589|emb|CAI97192.1| CTP synthase [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] (539 aa)
Score = 1202, Expect = 1.1e-129, Identities = 235/527 (44%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIG-YKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  SS+G +LK  G +V + KFDPY+N+D GTM P QHGEVFVT DG E DLD+G+YER +++   K SNVT G++Y E + +ER G + G T+QV+PH+T  I +K++  +     D +I E+GGTVGD+ES PF+EA RQ++ +  S+ VM++H   +  L    +LK+KP Q SV  L S GI PN+L++RS+  V  ++K+KIS  T +  + I   ++   ++ +P S + Q V   + +F  ++ P  +     W       K   KYK +I +VGKY +  DAY+S+  +L  + +   + + +E I +  + E+N++E L +   ++VPGGFG R ++G I +I+YARE++IPF GICLGMQ+AS+EFARNVL + DA+S E   N  N II ++  +  +  +GGTLRLG Y   LK G+K  E Y  + ++ ERHRHRYEFN KY + FEK G  FSGI+ +N+LVEI+E+ + KFF+A Q+HPEF S+   P  +F  F+  +
  S:     2 TKYIFVTGGVVSSLGKGITASSIGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVFVTDDGTEADLDLGHYERLVDVRTSKYSNVTTGKIYQEVLQRERRGDYHGGTVQVIPHVTNMIKEKVMRAAQMTDTDVVISEIGGTVGDMESTPFMEAIRQMRREVGSENVMYVHVTFVPYLRAAKELKSKPTQQSVSMLRSIGIQPNMLVLRSEMPVPQEMKDKISTFTDVPVDYIVESLDAPSLFDVPLSYQEQGVDQKVVDFLHIDSPKPVADMDEWRRMDERAKN-LKYKTKITLVGKYVELEDAYISVTDALHHAGYLYNSKIEVEKIQAEDITEDNVAELLKDTQGLIVPGGFGTRGLDGMITSIKYAREHDIPFLGICLGMQMASVEFARNVLHLEDANSAEAEPNCKNNIIDLMADQRDQEKIGGTLRLGLYPAMLKAGTKTRECYDGQEVIQERHRHRYEFNNKYREDFEKAGMTFSGISPDNHLVEIVEITDKKFFVAAQYHPEFLSRPNRPEGLFKGFIGAA 531
>gi|91215969|ref|ZP_01252938.1| CTP synthetase [Psychroflexus torquis ATCC 700755] >gi|91185946|gb|EAS72320.1| CTP synthetase [Psychroflexus torquis ATCC 700755] (536 aa)
Score = 1202, Expect = 1.1e-129, Identities = 239/529 (45%), Positives = 342/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME---VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SL  +L+  G +V I K DPY+N+D GT+ P +HGE FVT DG ETDLD+G+YERFLN+N  + +NVT GR+Y   I KER G FLG T+QV+PHIT  I ++I +L      D +I E+GGTVGDIES+P++EA RQL+     + S V+ +  +P +      +LKTKP QHSVK LM +GI P +L+ R++  +++ ++ K++L   ++ E +   I+ + IY +P  +  Q +         +E   VPN      W+ F   +K   + +  I +VGKY D  D+Y SI+ S   +  Y    + + +INS    ++N +   + D +LV  GFG+R IEGKI A+ YAR + IPF GICLG+Q+A IEF+RNVL +  A+STE N  T +P+I ++E +     +GGT+RLG ++CEL+ GSK+ EIY    I ERHRHR+E N KY+   E HG + SG N +  LVE IELE+H +F+ VQFHPE+ S + +P+P+F SF+  +KK
  S:     4 TKYIFVTGGVSSSLGKGIIAASLAKLLQARGYKVTIQKLDPYINIDPGTLNPYEHGECFVTEDGAETDLDLGHYERFLNVNTSQANNVTTGRIYQSVIDKERRGDFLGKTVQVIPHITNEIKERIQILGQDNSYDIVITEIGGTVGDIESLPYIEAVRQLKWELGDHNSLVIHLTLIPYLS--AAKELKTKPTQHSVKTLMESGISPEILVCRTEHQINDDIRNKLALFCNVKKEAVIQSIDAESIYYVPTLMAEQGLDTITLKKLNLEDNIVPN---LDKWNFFVDKLKNATE-ELSIGLVGKYVDLQDSYKSILESFIHAGAYNDVKVKVVWINSEK-KKHNETIFHQLDGLLVAPGFGERGIEGKINAVNYARTHKIPFLGICLGLQMAVIEFSRNVLGLEGANSTEMNPKTPHPVIGLMENQKDIQQMGGTMRLGAWDCELQPGSKLAEIYGTTQISERHRHRHEINNKYVSDLESHGLICSGKNLQTGLVETIELEDHPWFVGVQFHPEYKSTVATPHPLFLSFIKAAKK 531
>gi|114046691|ref|YP_737241.1| CTP synthetase [Shewanella sp. MR-7] >gi|119391175|sp|Q0HXH1|PYRG_SHESR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|113888133|gb|ABI42184.1| CTP synthase [Shewanella sp. MR-7] (546 aa)
Score = 1201, Expect = 1.1e-129, Identities = 250/524 (47%), Positives = 345/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+I     +  D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    + KISL   +E   + SL ++  IY +P  L +Q + + +   F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKI A ++ARENN+P+FGICLGMQ+A IEFARNV  M DA STEFN+ T  P++ ++          E ++  ++LGGT+RLG   C L +GSK  + YK  S VERHRHRYE N KY +  E+ G VFSG++ +  LVE+IEL++H +F+A QFHPEFTS     +P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKVIAGGEGH--DVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLICRGDRAIPANERAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDDLVVKRFGLEC-READLSEWENVIYQEANPNG-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRVSVTIKYIDSQTVEAKGDEVLQGLDGILVPGGFGERGVEGKIQAAKFARENNLPYFGICLGMQVALIEFARNVAGMADAHSTEFNKETPFPVVGLITEWVDEEGNVEQRHEASDLGGTMRLGAQLCHLLEGSKAAQAYKGNSCVERHRHRYEVNNKYRERLEQAGLVFSGLSSDRKLVEMIELKDHPWFVAGQFHPEFTSTPRDGHPLFEGFV 533
>gi|170078029|ref|YP_001734667.1| CTP synthase [Synechococcus sp. PCC 7002] >gi|169885698|gb|ACA99411.1| CTP synthase [Synechococcus sp. PCC 7002] (552 aa)
Score = 1201, Expect = 1.2e-129, Identities = 232/526 (44%), Positives = 334/526 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++    PDF+I E+GGTVGDIES+PFLEA RQ + +  R  V+++H   +  + +  ++KTKP QHSVK+L S GI P++L+ R    +    +EKIS    +  E + +  +   IY +P  LE + +        +ME P +   + W      +K P ++   IA+VGKY    DAYLS++ SL  ++     D+ + ++N+  + ++  S  L++   I+VPGGFG R ++GK+ AI+YAR N IPF G+CLGMQ + IE+ARNV K+ DA S EFN    NP+I +L  +    +LGGT+RLG Y C L   +   ++Y ++ I ERHRHRYEFN  Y  +F + G+  SG + +  LVEIIE  +H FFIA QFHPEF S+   P+P+F+ F+  +
  S:     3 KFIFVTGGVVSSIGKGIVAASLGRLLKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTSMSRLNSVTTGSIYQAVINKERRGDYQGGTVQVIPHITNEIKERIFRVAENTNPDFVITEIGGTVGDIESLPFLEAIRQFRKEAGRDNVLYMHVTLIPWISSAGEMKTKPTQHSVKELRSIGIQPDVLVCRCDRPLPQGQREKISEFCNVPEEQVITSQDASSIYEVPLMLEREGLAEQTLKLLRME-PRQPNLEQWQNLVERMKRPNRH-MDIAIVGKYVQLNDAYLSVVESLGHAAIANDMDIKLHWVNAEDIEKHGASMYLADMAGIVVPGGFGLRGVDGKVAAIEYARLNQIPFLGLCLGMQSSVIEWARNVAKLEDAHSAEFNPEAKNPVINLLPEQRDVVDLGGTMRLGLYPCRLTPDTLTYQLYGQEVIYERHRHRYEFNNAYRSLFLETGYQVSGTSPDGRLVEIIEYADHPFFIATQFHPEFQSRPNHPHPLFFGFIQAA 528
>gi|70728576|ref|YP_258325.1| CTP synthetase [Pseudomonas fluorescens Pf-5] >gi|119391151|sp|Q4KHF8|PYRG_PSEF5 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|68342875|gb|AAY90481.1| CTP synthase [Pseudomonas fluorescens Pf-5] (543 aa)
Score = 1201, Expect = 1.2e-129, Identities = 239/527 (45%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   V    + KI+L T +E   + SL ++  IY +P  L  Q + + +   F ++  N      W+        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +     + L   DAILVPGGFG R +EGKI A+QYAREN +P+ GICLGMQ+A IEFARNV+   DA+STEF+  + +P++ ++          E +   ++LGGT+RLG   C L+ GSK+ + Y +  I+ERHRHRYE N K +    + G   SG + +  LVE++E ++H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRVYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGSKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPVDVSSRRKIALFTNVEERAVISLEDVDTIYKIPAVLHAQGLDDFVVERFGLQC-NGADLSEWEKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTALLEGVDAILVPGGFGLRGVEGKITAVQYARENKVPYLGICLGMQVAVIEFARNVMGWKDANSTEFDRTSGHPVVGLITEWEDATGAVEVRTEASDLGGTMRLGAQECLLEAGSKVHDCYAKDVIIERHRHRYEVNNKLLPQLIEAGLKISGRSGDGALVEVVEAQDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|126647692|ref|ZP_01720197.1| CTP synthetase [Algoriphagus sp. PR1] >gi|126576368|gb|EAZ80646.1| CTP synthetase [Algoriphagus sp. PR1] (538 aa)
Score = 1201, Expect = 1.2e-129, Identities = 234/527 (44%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + +TGGV SSLGKG+  SSLG +L+  G +V I KFDPYLN+D GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +NVT GR+Y   I KER G+FLG T+QV+PHIT+ I      LS   + D +I E+GG VGDIES+PF+EA RQ +     +  + IH   +  L    +LKTKP QHSVK L+ AGI P++L+ R++  + + +K+K++L   ++  ++   ++   IY +P  ++ +K+   +    K+        + W  F   +K P + +  I ++GKY   PD+Y SII +   +   ++  ++++ ++S  +N +N  E L + D ILV  GFG+R  EGKI  +++AREN IPF GICLGMQ+A IEFARNVL    A+STE + NT +P+I ++E + +   +GGT+RLG+Y C+LK  SK  + Y +  I ERHRHRYEFN  ++   EK+G + +G N +  LVEIIEL+NH +F+ VQFHPE+ S +LSP P+F  F+  +
  S:     5 TKYIFITGGVTSSLGKGIIASSLGKLLQSRGFKVTIQKFDPYLNIDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNVTTSQNNNVTTGRIYNNVITKERKGEFLGKTVQVIPHITDEIKSNFYKLSEDNKYDVIITEIGGCVGDIESLPFIEAVRQARWDLGPNNFLVIHLTLIPYLSAAKELKTKPTQHSVKQLLEAGIQPDILVCRTEHHLPSDVKKKLALFCNVQLNSVIEAMDADSIYDVPLLMKKEKLDERVMTKLKLSSKENTDLEKWKDFLGKLKNPTQ-EVTIGLIGKYVSLPDSYKSIIEAFTHAGASIECHVNLKLLSSEEINTDNFKEKLVDLDGILVAPGFGERGFEGKIETVKFARENKIPFLGICLGMQVAVIEFARNVLGHTKANSTEMDPNTPHPVIALMEEQKKIDQMGGTMRLGSYACDLKKPSKSFQAYGKSKIQERHRHRYEFNNDFLQEMEKNGMLATGKNPDTGLVEIIELKNHPWFVGVQFHPEYKSTVLSPQPLFVRFIQAA 532
>gi|119944440|ref|YP_942120.1| CTP synthetase [Psychromonas ingrahamii 37] >gi|119863044|gb|ABM02521.1| CTP synthase [Psychromonas ingrahamii 37] (545 aa)
Score = 1201, Expect = 1.2e-129, Identities = 249/524 (47%), Positives = 338/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + VTGGV SSLGKG+A  SL A+L+  G +V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER++   +   +N T GRVY E +AKER G +LGATIQV+PHIT  I ++I+     +  D  IVE+GGTVGDIES PFLEA RQL  K  R  V+++H   L  L T  ++KTKP QHSVK+L S GI P++L+ RS+  +    + KI+L   +  +++  L ++  IY +P  L+ Q +       F ++ P       W    S  +     +  I +VGKY++ PDAY S+  +L+         + I++I+S  +    +S L   DAILVPGGFG+R IEGKILA QYAR N IP+ GICLGMQ+A IEFARNV  + +A STEF  N   P++ ++          E +   ++LGGT+R+G   C LK GSK+ ++Y  K I ERHRHRYE N   + I EK G V +G++++  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+
  S:     3 TKYIFVTGGVVSSLGKGIAAGSLAAILEARGLDVTILKLDPYINVDPGTMSPIQHGEVFVTDDGAETDLDLGHYERYIRTRMTARNNFTTGRVYSEVMAKERRGDYLGATIQVIPHITNEIQERIVAGGKGH--DIAIVELGGTVGDIESQPFLEAIRQLGLKVGRDSVIYMHLTLLPYLKTAGEVKTKPTQHSVKELRSLGIQPDILVCRSEVNIPINERVKIALFCNVTEKSVILLRDVDSIYKIPALLKAQGLDEICVKRFGLDCP-EADLSEWAQVVSE-EANTSNEVIIGMVGKYTELPDAYKSVNEALKHGGLKNAASVKIKYIDSQDVEVRGVSILEGVDAILVPGGFGERGIEGKILAAQYARVNKIPYLGICLGMQVAIIEFARNVAGLKNAHSTEFEANCDQPVVGLITEWLDKTGEVEQRTENSDLGGTMRVGAQLCHLKKGSKVFDMYGTKEIFERHRHRYEVNNNLLPILEKAGLVVTGLSEDKKLVEIIEIPNHPWFVASQFHPEFTSTPRDGHPLFKGFI 533
>gi|114320992|ref|YP_742675.1| CTP synthetase [Alkalilimnicola ehrlichei MLHE-1] >gi|119391070|sp|Q0A7K2|PYRG_ALHEH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|114227386|gb|ABI57185.1| CTP synthase [Alkalilimnicola ehrlichei MLHE-1] (540 aa)
Score = 1201, Expect = 1.2e-129, Identities = 230/527 (43%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + +TGGV SSLGKG+  +SLG +L+  G  V + K DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF+   + + +N T GR+Y   I KER G++LG T+QV+PHIT+ I + I   ++    D  ++E+GGTVGDIES+PFLEA RQ+ A+  R + +F+H   +  +    ++KTKP QHSVK+L S GI P++L+ R+   +  + + KI+L T +E   + S +++ +IY +PE L  Q + N +     +E+P     + W      ++ P+  +  IA+VGKY D  DAY+S+  SL  +    +  ++I +I+S  L       L   DA+LVPGGFG+R +EGKILA +YARE  +P+ GICLGMQ+A IE+ARNV  +  A STEF  +  +P+I ++          E ++ +++LGGT+RLG   C L +GS   ++Y +  + ERHRHRYEFN  Y++  E  G  FSG + +  LVE++E  +H +F+A QFHPEFTS     +P+F +F+  +
  S:     2 TRYIFITGGVVSSLGKGITAASLGTILQARGLSVSMTKLDPYINVDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFVRTTMTRNNNYTTGRIYESVIRKERRGEYLGGTVQVIPHITDEIKRSIQQGAD--DADIALIEIGGTVGDIESLPFLEAIRQMGAELGRGRCLFMHLTLVPFIGAAGEMKTKPTQHSVKELRSIGIQPDILVCRASQRIPEEERRKIALFTNVEPRAVVSCLDVDNIYKIPEVLHRQGLDNIVAEKLGLELPP-ASLQDWQRVVEAMQNPEG-EVTIAMVGKYVDLTDAYMSLNESLRHAGIQTRHRVNIRYIDSEELEREGTHALDGVDAVLVPGGFGERGVEGKILAARYARERKVPYLGICLGMQVAVIEYARNVAGLEGAHSTEFTRHPHHPVIGLITEWMTDEGTVEQRSEDSDLGGTMRLGAQPCRLTEGSLARQVYGKDVVEERHRHRYEFNNHYLEALEAAGLRFSGWSHDRKLVEVVEQPDHPWFLACQFHPEFTSTPRDGHPLFAAFVRAA 535
>gi|161831471|ref|YP_001597509.1| CTP synthetase [Coxiella burnetii RSA 331] >gi|161763338|gb|ABX78980.1| CTP synthase [Coxiella burnetii RSA 331] (555 aa)
Score = 1201, Expect = 1.2e-129, Identities = 244/524 (46%), Positives = 340/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIIT----------ILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + +TGGV SSLGKG+  +SLGA+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+N  + +++N T GRVY + I KER G +LG TIQV+PHIT+ I  KI         D  +VEVGGTVGDIES+PFLEA RQ++ +    Q +FIH   +  +    ++KTKP QHSVK+L S GI P++L+ RS+ ++ +  + KI+L T +   ++ SL ++K IY +P  L +Q + N +     ++         W       K P ++   +AVVGKY D  D+Y S+  +L  +  + +T + IE+I+S ++  +    L + DAILVPGGFG R IEGKILA QYAREN IP+FGICLGMQ+A IEFAR+  +M +A+STEF+  T  P++           I+E +    +LGGT+RLG   C LK  S    +Y    ++ERHRHRYE N   +   EK G V SG + ++ LVE+IEL +H +F+  QFHPEFTS     +P+F  F+
  S:     2 TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFVNATMTRKNNFTTGRVYADVIRKERRGDYLGGTIQVIPHITDEIKAKI--REGADGADVALVEVGGTVGDIESLPFLEAIRQMRIELGDQQTLFIHLTLVPYVAVAGEIKTKPTQHSVKELRSIGIQPDILVCRSEQSLPDAERAKIALFTNVPEPSVISLSDVKSIYEIPLILRDQGLGNRVCEKLNIKA-TAADLDDWKKVVQAQKNP-RHTVTVAVVGKYVDLEDSYKSLSEALIHAGIHTQTRVVIEYIDSEAIELHGTELLKKVDAILVPGGFGSRGIEGKILAAQYARENGIPYFGICLGMQIAIIEFARDKAQMENANSTEFDPKTPFPVVALVSEWMAKEGIIEKRKWGDDLGGTMRLGGQPCRLKIDSLARRLYGEDRVIERHRHRYEVNNDLIGELEKKGLVISGRSIDDRLVEMIELADHPWFVGCQFHPEFTSTPRKGHPLFIGFI 532
>gi|146303013|ref|YP_001190329.1| CTP synthetase [Metallosphaera sedula DSM 5348] >gi|145701263|gb|ABP94405.1| CTP synthase [Metallosphaera sedula DSM 5348] (531 aa)
Score = 1201, Expect = 1.3e-129, Identities = 250/524 (47%), Positives = 353/524 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGS-DLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRI-GYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLN-ENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK ++VTGGV SS+GKG   +SLG +LK  G  V I+K DPY+NVDAGTM P  HGEVFVT DG ETDLD+G+YERFLNIN  K +N+TAG+VY+E I KER+GK++G T+Q++PH+T+ I   +  +    + D +IVEVGGTVGDIE +PFLEA R+L+ +     V+F+H V L+E L+ + +LKTKPLQHSV++L   GI P++++ RS   +    K KI+L T +  E I+S  +++  Y +P  L+ Q +   + +  K+ +P +   +  W+ F   +K  +  + +IA+VGKY+   D+YLSI  ++  +S +L     + +I SS L  EN  + L + + I+V  GFG R  EGKI AI YAR NN+PF GIC G+QLA +EFARNV+ +  A STE + N  +P++T+L+ + + T  GGT+RLG     L  G+    IY +  I ERHRHRYE NP Y+D+ +KHG   SGI+ +N LVE+IEL++H+FFIA Q HPEF S+ L+P P+F  FL
  S:     2 TKYIVVTGGVLSSVGKGTVSASLGLILKNMGYNVSIIKVDPYINVDAGTMNPYMHGEVFVTEDGAETDLDLGHYERFLNINTSKHNNITAGKVYFEVIRKEREGKYMGQTVQIIPHVTDEIKAMVRKVGEVEKADIVIVEVGGTVGDIEGLPFLEAMRELRLEEEEHNVIFVH-VALVEYLSVTGELKTKPLQHSVQELRRIGIQPDIVIARSIIELDEDTKRKIALFTNVRPEYIFSSYDVETAYEVPLILQRQGLGARVTS--KLGLPQKTPDFGEWEKFVYSVKRKEGKRVKIALVGKYTKLKDSYLSIKEAIYHASAHLGVIPELLWIESSDLERENPEAILKQAEGIIVLPGFGSRGTEGKIKAINYARVNNVPFLGICFGLQLAVVEFARNVVGLQGAHSTEIDPNAPHPVVTLLDEQKKVTQFGGTMRLGAQRISLVRGTLAHSIYGKDVIYERHRHRYEVNPSYVDLLQKHGLTISGIS-DNGLVEMIELKDHRFFIATQAHPEFKSRPLNPAPLFLGFL 525
>gi|21672983|ref|NP_661048.1| CTP synthetase [Chlorobium tepidum TLS] >gi|24212100|sp|P59040|PYRG_CHLTE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|21646044|gb|AAM71390.1| CTP synthase [Chlorobium tepidum TLS] (565 aa)
Score = 1200, Expect = 1.6e-129, Identities = 240/528 (45%), Positives = 343/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAI---LVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+    +  N+T GRVY   I KER G++LG T+QVVPH+ + I +K+  L+     D LI E+GGT+GDIES+PFLEA RQL+ +     ++ IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     + + ++  L +   IY +P  L  +++   +     ++       ++W  F   +K PK  +  I + GKY++ PDAY SII S   +       + ++ + +    +      S F  I   LV  GFG R IEGK+  +QYARENNIPFFGICLGMQ A+IEFARN+  + DA+STEFN+ T  P+I ++E + +    GGT+RLG+Y C LK+GSK  E+Y +  I ERHRHRYEFN ++  +FE+ G +FSG +   +LVEI+EL+NH++F+AVQFHPE  S++   +P+F  F++ +K+
  S:     8 KHIFVTGGVISSLGKGILSASLGLLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDEPTSQACNLTMGRVYKSVIDKERRGEYLGGTVQVVPHVIDEIKEKMGDLAKNGSIDVLITEIGGTIGDIESLPFLEAMRQLKLELGEHNLLNIHLTFVPYIKAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVGHFCNVHDLDVIGLNDCDTIYEVPLMLLKEQLDLRVMKKLGLKKFREPNLEYWKNFCEKVKHPKDGEITIGICGKYTEYPDAYKSIIESFIHAGASNDVRVLVKMLRAEDAEDPKFDISSAFKGISGLLVAPGFGDRGIEGKVRFVQYARENNIPFFGICLGMQCATIEFARNICDLPDANSTEFNKRTRFPVIDLMEHQKKVKEKGGTMRLGSYPCILKEGSKAHELYGKFLINERHRHRYEFNNQFRKLFEEKGMIFSGTSPNGDLVEIVELKNHRWFVAVQFHPELKSRVQKVHPLFDGFVHAAKE 539
>gi|29654972|ref|NP_820664.1| CTP synthase [Coxiella burnetii RSA 493] >gi|81628554|sp|Q83B36|PYRG_COXBU CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|29542241|gb|AAO91178.1| CTP synthase [Coxiella burnetii RSA 493] (555 aa)
Score = 1200, Expect = 1.7e-129, Identities = 244/524 (46%), Positives = 339/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIIT----------ILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + +TGGV SSLGKG+  +SLGA+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+N  + +++N T GRVY + I KER G +LG TIQV+PHIT+ I  KI         D  +VEVGGTVGDIES+PFLEA RQ++ +    Q +FIH   +  +    ++KTKP QHSVK+L S GI P++L+ RS+  + +  + KI+L T +   ++ SL ++K IY +P  L +Q + N +     ++         W       K P ++   +AVVGKY D  D+Y S+  +L  +  + +T + IE+I+S ++  +    L + DAILVPGGFG R IEGKILA QYAREN IP+FGICLGMQ+A IEFAR+  +M +A+STEF+  T  P++           I+E +    +LGGT+RLG   C LK  S    +Y    ++ERHRHRYE N   +   EK G V SG + ++ LVE+IEL +H +F+  QFHPEFTS     +P+F  F+
  S:     2 TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFVNATMTRKNNFTTGRVYADVIRKERRGDYLGGTIQVIPHITDEIKAKI--REGADGADVALVEVGGTVGDIESLPFLEAIRQMRIELGDQQTLFIHLTLVPYVAVAGEIKTKPTQHSVKELRSIGIQPDILVCRSEQPLPDAERAKIALFTNVPEPSVISLSDVKSIYEIPLILRDQGLGNRVCEKLNIKA-TAADLDDWKKVVQAQKNP-RHTVTVAVVGKYVDLEDSYKSLSEALIHAGIHTQTRVVIEYIDSEAIELHGTELLKKVDAILVPGGFGSRGIEGKILAAQYARENGIPYFGICLGMQIAIIEFARDKAQMENANSTEFDPKTPFPVVALVSEWMAKEGIIEKRKWGDDLGGTMRLGGQPCRLKIDSLARRLYGEDRVIERHRHRYEVNNDLIGELEKKGLVISGRSIDDRLVEMIELADHPWFVGCQFHPEFTSTPRKGHPLFIGFI 532
>gi|192359367|ref|YP_001982690.1| CTP synthase [Cellvibrio japonicus Ueda107] >gi|190685532|gb|ACE83210.1| CTP synthase [Cellvibrio japonicus Ueda107] (567 aa)
Score = 1200, Expect = 1.9e-129, Identities = 241/527 (45%), Positives = 340/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY   + KER G +LG T+QV+PHIT+ I ++I  L      D  +VE+GGTVGDIES PFLEA RQL+ +    RS +M +  VP I   T  + KTKP QHSVK+L S G+ P++LL RS+  V    + KI+L T +    +  L +   IY +P  L++  +   +     ++ P       WD        P   +  I++VGKY +  DAY S+I +L  +  +  T + I +I++  +    +  LS+ DAILVPGGFG+R +EGK++A+QYAREN +P+ GICLGMQ   IEFARNVL +  A+STEF+++T +P+I ++          E ++  ++LGGT+RLG   C L  GS +  IY    IVERHRHRYE N  Y+D  +K G    G + ++ LVE++E+ +H +F+A QFHPEFTS     +P+F +F+  +
  S:    29 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTIMKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRVYETVLRKERRGDYLGGTVQVIPHITDEIKRRI--LEGGKDVDVALVEIGGTVGDIESQPFLEAVRQLKVELGLSRSLLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDILLCRSEKMVDEDSRRKIALFTNVAERAVVPLPDADTIYSIPSLLKSFGLDQIVVEQLGLDCP-EADLSEWDKVVQGKLHPTN-QITISMVGKYMELLDAYKSLIEALTHAGIHTSTKVKINYIDAERVETEGVGILSDADAILVPGGFGERGVEGKLMAVQYARENKVPYLGICLGMQSVVIEFARNVLGLKGANSTEFDKSTPHPVIGLITEWINAEGAVEKRDETSDLGGTMRLGAQECRLVTGSNVRTIYGADVIVERHRHRYEVNNNYVDQLQKAGLKIGGWSADDTLVEMVEIPDHPWFVACQFHPEFTSTPRDGHPLFTAFVTAA 562
>gi|146308056|ref|YP_001188521.1| CTP synthetase [Pseudomonas mendocina ymp] >gi|145576257|gb|ABP85789.1| CTP synthase [Pseudomonas mendocina ymp] (543 aa)
Score = 1199, Expect = 1.9e-129, Identities = 240/527 (45%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T GRVY + + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   +    + KI+L T +E   + SL ++  IY +P  L  Q + + +   F +E         WD        P+K +  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +       L   DAILVPGGFG R +EGKI  +QYAREN IP+ GICLGMQ+A IE+ARNV+   DA+STEF+  + +P++ ++          E ++  ++LGGT+RLG  +C+L+ GSK+ + Y +  IVERHRHRYE N   +    + G   +G + +  LVE++E  +H +F+A QFHPEFTS     +P+F  F+N +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMSKSNNFTTGRVYEDVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGAKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDHPIDVSSRRKIALFTNVEERAVISLEDVDTIYKIPGVLHAQGLDDFVVERFGLECGG-ADLSEWDRVVDAKLNPEK-EVTIAMVGKYMELLDAYKSLIEAMSHAGIQNRTKVNLRYIDSEDIENQGTGLLEGVDAILVPGGFGLRGVEGKIKTVQYARENKIPYLGICLGMQVAVIEYARNVVGWTDANSTEFDMASQHPVVGLITEWQDAAGSVEQRSENSDLGGTMRLGAQDCQLQAGSKVHDCYGKDVIVERHRHRYEVNNNLLPQLTEAGLKVTGRSGDGALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVNAA 535
>gi|150025941|ref|YP_001296767.1| CTP synthetase [Flavobacterium psychrophilum JIP02/86] >gi|149772482|emb|CAL43965.1| CTP synthase [Flavobacterium psychrophilum JIP02/86] (537 aa)
Score = 1199, Expect = 2.0e-129, Identities = 242/531 (45%), Positives = 349/531 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRI--GYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           ++TK + VTGGV SSLGKG+  +SL  +L+  G    I KFDPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +NVT GR+Y   I KER G+FLG T+QVVPHIT  I +++ LL      D +I E+GGTVGDIES+P++E+ RQL  +   +  + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S  L+ K++L   ++ E +   I+   IY +P  +  + +        K+++P +     K W+ F    K PK ++  I +VGKY +  D+Y SI+ +   +    +T +++  I+S  L+ N+  E L   D ILV  GFG R IEGKI  ++YARE NIPF GICLGMQ+A IE++RNVL   DA+STE N+NT++P+I ++E +   T+ GGT+RLG + C L + +   +IY +  I+ERHRHRYEFN +Y+++ +K G   SG+N E  LVE+IELENH FFI VQ+HPE+ S +L+P+P+F SF+  + K
  S:     2 NQTKYIFVTGGVTSSLGKGIIAASLAKLLQARGYRTTIQKFDPYINVDPGTLNPYEHGECYVTNDGAETDLDLGHYERFLNVPTSQANNVTTGRIYLSVIEKERRGEFLGKTVQVVPHITNEIKERMQLLGKSGDYDIVITEIGGTVGDIESLPYIESVRQLVWELGENNGIVIHLTLVPFLAAAGELKTKPTQHSVKTLMESGIKADILVCRTEYELSEDLRHKLALFCNVKREAVIQSIDASTIYDVPNLMLEEGLDKVALK--KLDLPEKSTPDLKQWNEFLQKHKNPK-HEVSIGLVGKYVELQDSYKSILEAFIHAGATNETKVNVISIHSEFLDVNSADEQLKGLDGILVAPGFGGRGIEGKIETVRYAREKNIPFLGICLGMQMAVIEYSRNVLGYTDANSTEMNQNTSHPVINLMEEQKTITDKGGTMRLGAWKCHLSENTLAHKIYGQSDILERHRHRYEFNSEYLEVLQKAGLKASGVNPETGLVEVIELENHPFFIGVQYHPEYKSTVLAPHPLFVSFIAAAVK 533
>gi|119510205|ref|ZP_01629343.1| CTP synthetase [Nodularia spumigena CCY9414] >gi|119465155|gb|EAW46054.1| CTP synthetase [Nodularia spumigena CCY9414] (545 aa)
Score = 1199, Expect = 2.0e-129, Identities = 235/527 (44%), Positives = 338/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSL-NENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I+ ++    P  LI E+GGTVGDIES+PFLEA RQL+ +  R  V+++H   +  + +  ++KTKP QHSVK+L S GI P++L+ R   A+   LK K+S    +  E + +  +   IY +P  +E + +     +  +ME   PN +    W T    +  P KY   IA+VGKY    DAYLS++ +L  ++     DL + ++NS  L NE+  + L+  D ILVPGGFG R ++GKI AI+YAR+  IPF G+CLGMQ + IE+ARNV  ++ A+S EF+  T  P+I +L  +    +LGGT+RLG Y C L   +    +Y+++ + ERHRHRYEFN  Y ++  + G+V SG + +  LVEI+E   H FF+A QFHPEF S+  +P+P+F  F+  S
  S:     2 TKFIFVTGGVVSSIGKGIVAASLGRLLKSRDYSVSILKLDPYINIDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTSMSRLNSVTTGSIYQAVINKERRGDYNGGTVQVIPHITNEIKERILRVAQDTNPSVLITEIGGTVGDIESLPFLEAIRQLRKEVGRQNVLYMHVTLIPWIASAGEMKTKPTQHSVKELRSIGIQPDILVCRCDRAIPLGLKRKLSEFCDVPQECVITAQDASSIYEVPLIVEREGLAEQALDLLQMEQRQPNLV---QWQTMVERLYSP-KYTVEIAIVGKYVRLSDAYLSVVEALRHAAISTYGDLRLRWVNSEDLENESAETYLAGVDGILVPGGFGIRGVDGKIAAIKYARDRQIPFLGLCLGMQCSVIEWARNVEGLNGANSAEFDPETKYPVINLLPEQQDVVDLGGTMRLGLYPCHLLPNTLAANLYQQEVVDERHRHRYEFNNNYRNLLLESGYVISGTSPDGRLVEIVEFPQHPFFLACQFHPEFHSRPSTPHPLFKGFMEAS 528
>gi|163755914|ref|ZP_02163031.1| CTP synthase (CTP synthetase) [Kordia algicida OT-1] >gi|161324085|gb|EDP95417.1| CTP synthase (CTP synthetase) [Kordia algicida OT-1] (544 aa)
Score = 1199, Expect = 2.2e-129, Identities = 239/527 (45%), Positives = 343/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIF---NFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SL  +L+  G    I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +NVT GR+Y   I KER G+FLG T+QVVPHIT  I ++I +L N    D +I E+GGTVGDIES+P++E+ RQL  +      M IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S +L+ K++L   ++ E +   I+ K IY +P  +  + + + +    +  + E PN      W+ F   +K PK +   I +VGKY +  D+Y SI+ +   +    +  +++E I+S  + E  I+ +    D ILV  GFG R IEGKI A+QYARE+N+PF GICLGMQ+A IEF+RNVL +  A+STE N  TA+P+I ++E +    N GGT+RLG + CELK GSK+ +IY    I+ERHRHRYEFN  Y +  E  G + +G+N +  LVEI+EL +H +F+ VQ+HPE+ S + +P+P+F +F+  +
  S:     4 TKYIFVTGGVTSSLGKGIIAASLAKLLQARGYRTTIQKLDPYINVDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNVPTSQANNVTTGRIYQSVIEKERRGEFLGKTVQVVPHITNEIKERIQILGNSGNYDIVITEIGGTVGDIESLPYIESVRQLLWELGEHNGMVIHLTLVPYLSAAGELKTKPTQHSVKTLMESGIKADVLVCRTEHELSEELRHKLALFCNVKREAVIQSIDAKTIYDVPNLMLQEGLDSVVLKKLDLIEEEAPN---LTSWNQFLKKLKNPK-HTVTIGLVGKYVELQDSYKSILEAFIHAGAENEIKVNVESIHSEHITEKTIAGKFKNLDGILVAPGFGDRGIEGKIKAVQYAREHNVPFLGICLGMQMAVIEFSRNVLGLDSANSTEMNPKTASPVINLMEAQKNIENKGGTMRLGAWECELKAGSKVHDIYGHDMILERHRHRYEFNNDYKEKIEAEGLIATGLNPKTGLVEIVELPSHPWFVGVQYHPEYKSTVANPHPLFVAFVKAA 531
>gi|90580337|ref|ZP_01236144.1| CTP synthetase [Vibrio angustum S14] >gi|90438639|gb|EAS63823.1| CTP synthetase [Vibrio angustum S14] (546 aa)
Score = 1198, Expect = 2.6e-129, Identities = 248/527 (47%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + + KER G +LGATIQV+PHIT  I  ++  L+     D  IVEVGGTVGDIES+PF+EA RQL  +  R   MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    + KI+L   ++ + + S+ ++  IY +P+ +++Q + + +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  + I++I+S  +       L++ DAILVPGGFG R +EGKI A QYARENNIP+ GICLGMQ+A IEFARNV KM DA STEFN  T +P++ ++          E +  +++LGGT+RLG+  C L+DGSK   +Y + +I ERHRHRYE N   +   EK G   SG++ +  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRKERRGDYLGATIQVIPHITNEIKSRV--LAGAEGHDVAIVEVGGTVGDIESLPFMEAIRQLAVEQGRENTMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERAKIALFCNVQEKAVISMKDVDSIYKIPQLIKSQGLDDLVCKRFGITAP-EADLSEWEQVIYEEANPTS-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVKIKYIDSQDVESKGTEVLADLDAILVPGGFGDRGVEGKIRAAQYARENNIPYLGICLGMQVALIEFARNVAKMADAHSTEFNAETKHPVVGLITEWIDSEGNVEERTEKSDLGGTMRLGSQLCHLQDGSKARTLYGQPTIHERHRHRYEVNNTLLPKLEKAGLKVSGLSADKKLVEIIEVPNHPWFVAAQFHPEFTSTPRDGHPLFEGFVKAA 536
>gi|120598077|ref|YP_962651.1| CTP synthetase [Shewanella sp. W3-18-1] >gi|124546602|ref|ZP_01705669.1| CTP synthase [Shewanella putrefaciens 200] >gi|146293852|ref|YP_001184276.1| CTP synthetase [Shewanella putrefaciens CN-32] >gi|120558170|gb|ABM24097.1| CTP synthase [Shewanella sp. W3-18-1] >gi|124509870|gb|EAY53944.1| CTP synthase [Shewanella putrefaciens 200] >gi|145565542|gb|ABP76477.1| CTP synthase [Shewanella putrefaciens CN-32] (545 aa)
Score = 1198, Expect = 2.6e-129, Identities = 249/524 (47%), Positives = 345/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    + KISL   +E   + SL ++  IY +P  L +Q + + +   F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKILA ++AREN +P+FGICLGMQ+A IEFARNV  M DA STEFN+ T  P++ ++          E ++  ++LGGT+RLG   C L +GSK  + YK  S +ERHRHRYE N KY +  E+ G VFSG++ +  LVE+IEL++H +F+A QFHPEFTS     +P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLICRGDRAIPANERAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDDLVVKRFGLEC-READLSEWENVIYQEANPNG-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRVSVTIKYIDSQTVEAKGDEVLQGLDGILVPGGFGERGVEGKILAAKFARENKLPYFGICLGMQVALIEFARNVAGMTDAHSTEFNKETPFPVVGLITEWVDEEGNVEQRHEASDLGGTMRLGAQLCHLLEGSKAAQAYKGNSCIERHRHRYEVNNKYRERLEQAGMVFSGLSSDRKLVEMIELKDHPWFVAGQFHPEFTSTPRDGHPLFEGFI 533
>gi|87118608|ref|ZP_01074507.1| CTP synthetase [Marinomonas sp. MED121] >gi|86166242|gb|EAQ67508.1| CTP synthetase [Marinomonas sp. MED121] (544 aa)
Score = 1198, Expect = 2.7e-129, Identities = 248/529 (46%), Positives = 357/529 (67%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + K +N T GR+Y   + KER G +LG T+QV+PHIT+ I +++I  +     D  +VE+GGTVGDIES PFLEA RQL+ +  S + +F+H   +  + T  + KTKP QHSVK+L S GI P++LL RS+ ++    ++KISL T ++   + SL +   IY +P+ L NQ + + I + F ++  +P+      W+        P+K +  IA+VGKY +  DAY S+I +++ +  + +T + + +I+S ++       L   DAILVPGGFG+R +EGKIL  QYAREN IP+ GICLGMQ+A IEFARNV K++ A STEFN  T NP++ ++          E ++ E++LGGT+RLG  NC L DGSK    Y +  I ERHRHRYE N  Y+   E+ G   SG +++N+LVE+IE+ +H +F+A QFHPEFTS     + +F +F++ + K
  S:     3 TRYIFVTGGVVSSLGKGLAAASLAAILESRGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFISTKMGKRNNFTTGRIYQTVLKKERRGDYLGGTVQVIPHITDEIKRRVI--AGAEGSDIALVEIGGTVGDIESQPFLEAVRQLKVELGSHRALFMHLTLVPYIRTAGETKTKPTQHSVKELRSIGIQPDILLCRSEVSIEAPERKKISLFTNVDERAVISLPDADTIYSIPQHLNNQGLDSLIVDRFSLDCGIPD---LAIWNKVAQAKLNPEK-QVNIAMVGKYMELLDAYKSLIEAMDHAGIHAQTKVKLHYIDSETIENEGTEVLKSMDAILVPGGFGERGVEGKILTAQYARENKIPYLGICLGMQVAVIEFARNVAKLNGAHSTEFNLKTENPVVGLITEWTDSEGSKEIRSEESDLGGTMRLGAQNCNLLDGSKAHVAYGQPVISERHRHRYEVNNYYLTALEEAGLTISGRSEDNSLVEMIEIADHPWFVACQFHPEFTSTPRYGHGLFSAFVHAALK 538
>gi|88806375|ref|ZP_01121893.1| CTP synthetase [Robiginitalea biformata HTCC2501] >gi|88783984|gb|EAR15155.1| CTP synthetase [Robiginitalea biformata HTCC2501] (545 aa)
Score = 1198, Expect = 2.7e-129, Identities = 236/529 (44%), Positives = 339/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKS-IVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SL  +L+  G    I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +NVT GR+Y   I KER G+FLG T+QVVPHIT  I ++I +L N    D +I E+GGTVGDIES+P++EA RQL  +   +  + +H   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S ++K+K++L   ++ E +   I+   IY +P  +  + +         + V        W  F   +K P+    R+ ++GKY +  D+Y SI  +L  +      ++ +  I+S  ++ NN+  ++ E D ILV  GFG+R IEGK+ A+QYARE +IPF GICLGMQ+A IEFARNVL + DA+STE N  T +P+I ++E +    N GGT+RLG ++CEL + + + ++Y   S I ERHRHRYEFN  Y +  E  G VFSGIN E  LVEI+EL +H +FI VQ+HPE+ S + +P+P+F  F+   ++
  S:     4 TKYIFVTGGVSSSLGKGIIAASLAKLLQARGLRTTIQKLDPYINVDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNVRTSQANNVTTGRIYQSVIEKERRGEFLGKTVQVVPHITNEIKERIQILGNSGDYDVVITEIGGTVGDIESLPYIEAVRQLLWELGENNAIVVHLTLVPYLSAAGELKTKPTQHSVKTLMESGIKADILVCRTEHELSEEIKQKLALFCNVKKEAVIQSIDANTIYDVPVLMHEEGLDKVALQKLALPVSPEPNLTQWMEFLKQLKNPRGV-VRVGLIGKYVELQDSYKSIQEALIHAGAINGVEVDVVSIHSEHISTNNLEKKMQELDGILVAPGFGERGIEGKVKAVQYAREQDIPFLGICLGMQMAVIEFARNVLGLDDANSTEMNARTPHPVIDLMEAQKTIVNKGGTMRLGAWDCELTEDTLVHKMYSGASTISERHRHRYEFNNDYKEQMEAAGLVFSGINAETGLVEIVELPSHPWFIGVQYHPEYKSTVANPHPLFVGFVQAVRQ 534
>gi|24374951|ref|NP_718994.1| CTP synthetase [Shewanella oneidensis MR-1] >gi|81460024|sp|Q8EBQ9|PYRG_SHEON CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|24349669|gb|AAN56438.1|AE015780_9 CTP synthase [Shewanella oneidensis MR-1] (546 aa)
Score = 1198, Expect = 2.8e-129, Identities = 250/524 (47%), Positives = 344/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    + KISL   +E   + SL ++  IY +P  L +Q +   +   F +          W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKILA ++ARENN+P+FGICLGMQ+A IEFARNV  M DA STEFN+ T  P++ ++          E ++  ++LGGT+RLG   C L +GSK  + YK  S VERHRHRYE N KY +  E+ G VFSG++ +  LVE+IEL++H +F+A QFHPEFTS     +P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLICRGDRAIPANERAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDELVVKRFSLTC-READLSEWENVIYQEANPNG-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRVSVTIKYIDSQTVEAKGDEVLQGLDGILVPGGFGERGVEGKILAAKFARENNLPYFGICLGMQVALIEFARNVAGMADAHSTEFNKATPFPVVGLITEWVDEEGNVEQRHEASDLGGTMRLGAQLCHLLEGSKAAQAYKGNSCVERHRHRYEVNNKYKERLEQAGLVFSGLSSDRKLVEMIELKDHPWFVAGQFHPEFTSTPRDGHPLFEGFV 533
>gi|78185990|ref|YP_374033.1| CTP synthetase [Pelodictyon luteolum DSM 273] >gi|119391144|sp|Q3B6P1|PYRG_PELLD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|78165892|gb|ABB22990.1| CTP synthase [Pelodictyon luteolum DSM 273] (597 aa)
Score = 1197, Expect = 3.2e-129, Identities = 235/527 (44%), Positives = 343/527 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFI---NSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+ +  + SN+T GRVY   I KER G++LG T+QVVPH+ + I  ++  L+ K   D +I E+GGT+GDIES+PFLEA RQ++       ++ IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     + + ++  L +   IY +P +L  +K+   +     ++  +      W  F   +K P+  +  +A+ GKY++ PDAY SI+ +L  +       ++I  I   +  S + +   EL+  + ILV  GFG R IEGKI  I+YARE NIPF GICLGMQ AS+EFARNV  + DA+STEFN+ +  P+I ++E + +    GGT+RLG+Y C +++G+K   +Y +  I ERHRHR+EFN  +   FE+HG +FSG +    LVEIIE+ +H++F+AVQFHPE  S++   +P+F+ F+  +K
  S:     8 KYVFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDESTSQASNLTMGRVYKSVIDKERKGEYLGGTVQVVPHVIDEIKDRLAELAKKGNYDVIITEIGGTIGDIESLPFLEAMRQMKLDMGERNLLNIHLTFVPYIKAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVGHFCNVNDLDVIGLNDCDTIYEVPLTLLQEKLDMRVLKKLGLKQYHEPDLAKWTDFCRKVKHPEGGEVNVAICGKYTEYPDAYKSILEALVHAGASNNVKVNIRLIRAEDGESKSYDFSKELAGINGILVAPGFGDRGIEGKIEFIRYAREQNIPFLGICLGMQCASVEFARNVCGLPDANSTEFNKRSRFPVIDLMEQQKKVKEKGGTMRLGSYPCIIREGTKAHAVYGKFLINERHRHRFEFNNTFRPAFEEHGMIFSGTSPNGELVEIIEIRDHRWFVAVQFHPELKSRVEKVHPLFHGFVGAAK 538
>gi|118445019|ref|YP_879021.1| CTP synthetase [Clostridium novyi NT] >gi|118135475|gb|ABK62519.1| CTP synthase [Clostridium novyi NT] (533 aa)
Score = 1197, Expect = 3.4e-129, Identities = 242/527 (45%), Positives = 339/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYR---SQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SLG +LK  G +V I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL + SNVT GRVY+  ++KER G +LG T+QV+PHIT  +  ++  ++ +   D +I E+GGTVGDIES+PFLEA RQ+  KY      V FIH   +  L    +LKTKP QHSVK+L S GI P++L+ R+   + +++KEKI L   ++   +   ++ +H+Y +P  L N+ +   +     +   + I    W      IK  K+    I +VGKY +  DAY+S++ +L        + + I++IN+  +   N+ + LS+ D ILVPGGFG R +EGKI AI+YARE  +PF GICLGMQ + IEFARNVL   DA S+E +ENT +P+I I+  +      GGT+RLG Y C+LK+ S     Y    + ERHRHRYEFN +Y       G   +G++ ++ LVEI+E++NH +F+A QFHPE  S+   P+P+F  F+  +
  S:     3 TKYVFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLSQNSNVTTGRVYWSVLSKERRGDYLGGTVQVIPHITNELKDRVYRVAKEKDVDVVITEIGGTVGDIESLPFLEAIRQI--KYEVGFENVCFIHLTLIPYLGKAGELKTKPTQHSVKELRSIGIQPDVLVCRTVKPLPHEVKEKIGLFCNVDANAVIQNLDAEHLYEVPLMLHNEGLDTLVCKKLGLAC-DTIDNSEWTDMVQKIKNLKE-DVTIGLVGKYVELHDAYISVVEALNHGGIPNNSSVHIKWINAEHVTSENVETYLSDVDGILVPGGFGDRGVEGKIEAIKYAREKKVPFLGICLGMQCSVIEFARNVLSYTDAHSSEIDENTKHPVIDIMPDQRDIDEKGGTMRLGLYPCKLKEDSNAFAAYGEPVVYERHRHRYEFNNEYRKELLNAGLEITGLSPDDRLVEIVEVKNHPWFVATQFHPELKSRPNRPHPLFRDFVKAA 529
>gi|167623155|ref|YP_001673449.1| CTP synthetase [Shewanella halifaxensis HAW-EB4] >gi|167353177|gb|ABZ75790.1| CTP synthase [Shewanella halifaxensis HAW-EB4] (546 aa)
Score = 1196, Expect = 4.6e-129, Identities = 247/524 (47%), Positives = 346/524 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    K KISL   +E   + SL ++  IY +P  L+ Q +   +   F ++         W+        P   +  I +VGKY + PDAY S+  +L+ +  + +  ++I++I+S ++       L   D ILVPGGFG+R +EGKI+A Q+ARENN+P+FGICLGMQ+A IEFAR+V  +  A STEF++NT +P++ ++          E ++ E++LGGT+RLG   C L++G+K    YK  + VERHRHRYE N  Y +  EK G +FSG++ + +LVE+IEL NH +F+A QFHPEFTS      P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLVCRGDRAIPANEKAKISLFCNVEERAVISLKDVDSIYKIPALLKAQGLDQLVTKRFGIDC-KEADLAEWEKVVYQEANPVG-EVTIGMVGKYIELPDAYKSVNEALKHAGLFNRVSVNIKYIDSQNVEAKGDEVLQGLDGILVPGGFGERGVEGKIMAAQFARENNLPYFGICLGMQVALIEFARHVAGLEGAHSTEFDKNTPHPVVGLITEWINEDGQVEERHEESDLGGTMRLGAQLCHLEEGTKAAAAYKSTTCVERHRHRYEVNNNYKERLEKAGLIFSGLSSDRSLVEMIELPNHPWFVAGQFHPEFTSTPRDGQPLFEGFV 533
>gi|194335276|ref|YP_002017070.1| CTP synthase [Pelodictyon phaeoclathratiforme BU-1] >gi|194307753|gb|ACF42453.1| CTP synthase [Pelodictyon phaeoclathratiforme BU-1] (565 aa)
Score = 1196, Expect = 5.0e-129, Identities = 244/528 (46%), Positives = 344/528 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSL--EISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLG +LK  G +V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+ +  + SN+T GRVY   I KER G++LGAT+QVVPH+ + I  ++   +     D LI E+GGT+GDIES+PFLEA RQ++ +   S ++ IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     +   ++  L +   IY +P  L  +K+   +     ++        +W  F + +K P+  +  I + GKY++ PDAY SII S     +S  +K ++ +     + LN  + + EL   + ILV  GFG R IEGKI  IQYARE+N+PF GICLGMQ ASIEFARNV  + DA+STEFN+ T  P+I ++  + +    GGT+RLG+Y C + +GSK   +Y +  I ERHRHRYEFN  Y   FE+ G VFSG +    LVEIIEL+NH++F+AVQFHPE  S++   +P+F+ F+  +K+
  S:     8 KHIFVTGGVISSLGKGILSASLGMLLKSRGLKVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDESTTQSSNLTMGRVYKSVIDKERRGEYLGATVQVVPHVIDEIKDRMAEQAKNGDLDVLITEIGGTIGDIESLPFLEAMRQMKLEMGDSNLLNIHLTFVPYIKAASELKTKPTQHSVKMLLGVGIQPDILVCRSEKPLSREIKNKVGHFCNVNELDVIGLNDCDTIYEVPLMLLKEKLDLRVLKKLGLKKYKEPTLDYWRDFCNKVKFPQDGEVTIGICGKYTEYPDAYKSIIESFIHAGASNNVKVNVKLLRAEDAELNAFDFAKELEGINGILVAPGFGDRGIEGKIKYIQYAREHNVPFLGICLGMQCASIEFARNVCGLQDANSTEFNKRTRFPVIDLMAHQKKVKEKGGTMRLGSYPCIISEGSKAYAVYHKFLINERHRHRYEFNNAYRKNFEESGMVFSGTSPNGELVEIIELKNHRWFVAVQFHPELKSRVQKVHPVFHGFVAAAKE 539
>gi|168333756|ref|ZP_02692006.1| CTP synthetase [Epulopiscium sp. 'N.t. morphotype B'] (529 aa)
Score = 1196, Expect = 5.2e-129, Identities = 244/527 (46%), Positives = 336/527 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +K + VTGGV S LGKG+  +SLG +LK  G +V   K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL K SN+T+G++YYE + KER G +LG T+QV+PHIT  I  K  + ++    D LI E+GGT GDIE  PFLE  RQ+  +  R   +FIH   +  + +  + K+KP QHSVK+L + GI P++++ R+ + +S  +  KISL   ++ + +   I L  +Y  P  L    +   +    K+E   P+      W      I    K    IA+VGKY    DAYLS+  SL  + + L   +SI +I+S  +   NIS  LS  D I+VPGGFG R IEGKIL  +YAREN+IP  GICLGMQ+A +EFARNVL + DA+S EF+E T NP+I I++ +   T+ GGT+RLG+Y C +KDG+ + E+Y +  I ERHRHRYEFN  Y +    +G V SG++ +  LVE+IE+    ++IAVQFHPEF S+   P+P+F   +  S
  S:     2 SKFIFVTGGVVSGLGKGITAASLGRLLKARGLKVSAQKLDPYMNVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLNKFSNLTSGKIYYEVLTKERSGGYLGQTVQVIPHITNVI--KDFIYNSAKNTDVLITEIGGTTGDIEIQPFLETIRQISLEVGRDNCVFIHLTLVPYIKSSGEHKSKPTQHSVKELQAMGISPDIIVARADEELSADIMAKISLFCNVKKDCVIENITLPSLYEAPLMLHKNGLDKVVCRTLKLETVAPD---LTEWKEMVDHIYNSSK-DVNIAIVGKYVKLHDAYLSVAESLRHAGYMLGAKVSISWIDSEEVTAKNISAMLSGVDGIVVPGGFGDRGIEGKILTCKYARENDIPLLGICLGMQVAVVEFARNVLGLADANSAEFSETTQNPVIHIMQEQKTITDKGGTMRLGSYLCSIKDGTLLKELYGKDEIAERHRHRYEFNNDYREQMISNGLVISGVSPDKTLVEVIEIPTLSYYIAVQFHPEFKSRPNKPHPLFSGLIQAS 526
>gi|117924855|ref|YP_865472.1| CTP synthetase [Magnetococcus sp. MC-1] >gi|117608611|gb|ABK44066.1| CTP synthase [Magnetococcus sp. MC-1] (547 aa)
Score = 1195, Expect = 6.4e-129, Identities = 242/526 (46%), Positives = 344/526 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSL-NENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI---------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + +TGGV SSLGKG+A +SL A+L+  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERFL + + K +N TAGR+Y   I +ER G +LGAT+QV+PHIT+AI   +  + N    D  ++EVGGTVGDIES+PF+EA RQL+    + + MF+H   L  + T  +LKTKP QHSVK+L++ GI P++L+ RS  AV    K KI+L   ++ +N+ S ++   IY +P +L  +     + +   M V        W+     +  P  YK  IA+VGKY +  DAY+S+  +L          +SI ++++ ++ +E   S L   D ILVPGGFG+R   GK+ AI YAR N +P+FGICLGMQ+A +EFARNV  +  A STE +++T +P+I +         L+ ++++ + GGT+RLG Y C LK  S    IY +  I+ERHRHRYEFN  Y +  E+ G VFSG + +N LVE++E+ +H FFIA Q+HPEF S+   P+P+F +F+  +
  S:     3 KFVFITGGVVSSLGKGLAAASLAALLQARGYRVTMQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFLGLPMGKANNWTAGRIYQHVIKRERRGDYLGATVQVIPHITDAIKNAVRSVGNDV--DIALIEVGGTVGDIESLPFMEAIRQLRNDLGKQETMFVHLTLLPYIPTSGELKTKPTQHSVKELLAIGIQPDILVCRSDRAVPETEKRKIALFCNVDQQNVISCVDQDTIYKVPFALYQEGFARKVLDHLGMGV-REPDLSAWEAVLEAVVNP-AYKTTIAIVGKYVELKDAYMSLAEALSHGGIANNAKVSIRWVDAENVHDEEAESLLGGVDGILVPGGFGERGTHGKLAAIHYARTNKVPYFGICLGMQMAVVEFARNVAGLAGAHSTELSDDTPHPVIGLLTEWVDGGTLQKRDKDGDKGGTMRLGAYPCVLKPDSLAAWIYPQGEIMERHRHRYEFNNAYREQLEQAGMVFSGTSPDNELVEVVEIPDHPFFIACQYHPEFMSRPREPHPLFTAFVRAA 535
>gi|118580037|ref|YP_901287.1| CTP synthetase [Pelobacter propionicus DSM 2379] >gi|118502747|gb|ABK99229.1| CTP synthase [Pelobacter propionicus DSM 2379] (535 aa)
Score = 1195, Expect = 6.7e-129, Identities = 237/528 (44%), Positives = 347/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + +TGGV SS+GKG+A +SLGA+L+  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF N  L K+SN T G+VY+  I KER G +LG T+QV+PHIT+ +  KII   N    D  IVEVGGTVGDIES+PFLEA RQ +  +     +++H   +  + T  +LKTKP QHSV +L   GI P++LL RS+  +  ++K KI+L   ++ +++  +++ +HIY +P +L  +++   +     +  + P+      W      +  P   + RIA+VGKY +  ++Y S+  +L          +S+++I+S  +  + I   L + DA+LVPGGFG+R  EGK++AI+YAR + IPFFGICLGMQ+A +E+ARNV  + DA S+EF +   NP+I ++E +   +  GGT+RLG Y C L+ G+     Y  + I ERHRHRYEFN  Y ++  K+G + SGI ++ +LVE++E+ +H +F+  QFHPEF SK L+P+P+F SF+  +
  S:     2 KTKFIFITGGVVSSIGKGLAAASLGALLEARGLRVTLQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTNARLSKKSNFTTGQVYFSVIDKERRGDYLGGTVQVIPHITDEMKCKII--ENAKGADVAIVEVGGTVGDIESLPFLEAIRQFRFDRGAGNTLYVHVTLVPYIRTAGELKTKPTQHSVMELRKIGIQPDILLCRSEREIPQEMKNKIALFCNVDVKDVIPVVDSEHIYYVPLALSKERLDERVVEKLNIWTKAPD---LTPWQDVVETVCHPGHGEVRIAIVGKYVNLTESYKSLSEALTHGGIANDCRVSLKYIDSEKIERDGIDGHLVDMDAVLVPGGFGERGTEGKVMAIEYARLHKIPFFGICLGMQMAVVEYARNVCHIDDACSSEFKKGCGNPVIHLMEEQKSVSKKGGTMRLGGYPCSLEKGTLAHVAYNAQEISERHRHRYEFNNAYREVLTKNGLILSGIYRDKDLVEVVEIADHPWFLGCQFHPEFKSKPLAPHPLFKSFVRAA 528
>gi|196257659|ref|ZP_03156195.1| CTP synthase [Cyanothece sp. PCC 7822] >gi|196201259|gb|EDX96078.1| CTP synthase [Cyanothece sp. PCC 7822] (602 aa)
Score = 1195, Expect = 6.9e-129, Identities = 230/531 (43%), Positives = 339/531 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL---------NVSKKPI 535
           TK + VTGGV SS+GKG+  +SLG + K     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G ++G T+QV+PHIT  I ++I+ ++    PD +I E+GGTVGDIES+PFLEA RQ +    R+ V+++H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +   LKEK+S    +   ++    +   IY +P +LE + +         +E P +     W T    ++ P ++   IA+VGKY    DAYLS++ +L  ++    +++ + ++N+ ++      + L   D I+VPGGFG R ++GK+L I+YAR+NNIPF G+C+GMQ + IE+ARN+  +  A+S EF+    NP+I +L  +    +LGGT+RLG Y C L   +    +Y ++ + ERHRHRYEFN  Y  +F + G+V SG + +  LVEIIEL  H FFIA QFHPEF S+  SP+P+F+ F+         +VS+ PI
  S:    46 TKFVFVTGGVVSSIGKGIVAASLGRLFKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTDTPMSRLNSVTTGSIYQAVINKERRGDYMGGTVQVIPHITNEIKERILRVAKNTNPDIVITEIGGTVGDIESLPFLEAIRQFRKDVGRNNVVYMHVTLIPWIPAAGEMKTKPTQHSVKELRSIGIQPDVLVCRCDRPLQPGLKEKLSAFCDVPVASVIMSQDASSIYQVPLNLEEEGLAQQTLELLNLE-PRQPNLTQWRTLVQQMQSPTQH-LEIALVGKYVQLSDAYLSVVEALGHAAITTHSEVKVRWVNAENIEAEGAEKYLQGVDGIVVPGGFGVRGVDGKVLTIEYARKNNIPFLGLCMGMQCSVIEWARNIAHLDKANSAEFDPECPNPVINLLPEQQDVVDLGGTMRLGLYPCRLTPDTVTFSLYAQEVVYERHRHRYEFNNAYRSLFLETGYVISGTSPDGRLVEIIELPGHPFFIATQFHPEFRSRPSSPHPLFFGFVKAALGYKCNHVSESPI 585
>gi|148657223|ref|YP_001277428.1| CTP synthetase [Roseiflexus sp. RS-1] >gi|148569333|gb|ABQ91478.1| CTP synthase [Roseiflexus sp. RS-1] (557 aa)
Score = 1194, Expect = 8.2e-129, Identities = 233/528 (44%), Positives = 339/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHD-ADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SS+GKG+  +S+G +LK  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+++NL + SNVT G++Y   I KER G +LG TIQV+PHIT  I  +I  ++ +   D +IVE+GGTVGDIE +PFLEA RQ++    R  V++IH   L  +    ++KTKP QHSV +L   GI  ++++ RS   +++++++KI+L   ++ E +  L  +  IY +P  LE   +   +     +   +R     W    + IK PK+ K  IA+VGKY +  DAY+S++ +L  +  +   D+ I +I+S  + E      L +   I+VPGGFG R IEGKI A +YAR NN+P+ G+CLGMQ+A+I FAR+++     A+STEF+ +T +P+I  +  +   T+ GGT+RLG Y C+L  G++    Y    +VERHRHR+EFN KY  +FE  G + SG + +  LVEIIEL NH +++  QFHPEF S+   P+P+F  F+  + K
  S:     3 KYIFVTGGVASSVGKGITVASIGRLLKARGVRVSVQKLDPYINVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDVNLTRLSNVTTGQIYSAVIQKERRGDYLGGTIQVIPHITNEIKSRIAAVARQTGADVVIVEIGGTVGDIEGLPFLEAIRQMRKDVGRDNVLYIHVTLLPHIGATGEVKTKPTQHSVMELRRVGITADVIVCRSDYPITDEIRDKIALFADVDVEAVVPLHTVDSIYEVPLVLEEAGLGAYLTQRLGLSA-SRPDLDDWRDLVARIKAPKR-KLAIALVGKYVELHDAYISVVEALRHAGLHQGVDVDIRWISSEQIEEEGCEPLLHDVYGIVVPGGFGDRGIEGKIAAAEYARVNNVPYLGLCLGMQVATISFARHIMGPESRANSTEFDLHTPHPVIDFMPDQLDITDKGGTMRLGGYPCKLTPGTRAYAAYGVDVVVERHRHRFEFNNKYRRLFESAGMIVSGQSPDGRLVEIIELRNHPWYVGTQFHPEFQSRPDRPHPLFRDFVAAAAK 531
>gi|57241672|ref|ZP_00369617.1| CTP synthase [Campylobacter lari RM2100] >gi|57017565|gb|EAL54342.1| CTP synthase [Campylobacter lari RM2100] (545 aa)
Score = 1194, Expect = 8.8e-129, Identities = 251/528 (47%), Positives = 353/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+A +S+  +LK  G +V I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFLN +L +++N T GRVY   I KER G +LG TIQV+PHI + I  +I         D LIVE+GGTVGDIE +PFLEA R L+    KY +  + +  VP I+     +LKTKP QHSV +L   GI P++++ RS+ ++  +LK+KI+++ G+E   +   ++   IY +P +   Q + NSI +   ++   PN      WD+    +  P   +  IA VGKY D  ++Y S+  ++  +   L   +++++I+S  L   N+ E   +   ILV GGFG R +EGKI AIQYAREN IPF GICLGMQL+ +EFARNVLK+ DA+S EF+    NPII +++           +  +T LGGT+RLG Y C +K  + + ++Y  + I+ ERHRHRYE NPKY ++FEK+G + SG N+   LVE +EL++H FF+AVQFHPEFTS+++  NP  +SF+  S
  S:     5 QTKYIFVTGGVLSSLGKGIAAASIATILKNSGLKVSILKADPYINVDPGTMSPLEHGEVFVTDDGAETDLDLGHYERFLNESLSQDNNFTTGRVYQSVIEKERRGDYLGKTIQVIPHIVDEIKDRI--KRAGVDKDILIVEIGGTVGDIEGLPFLEAIRALKLEVGKYNAINIHLTLVPFIK--AAGELKTKPTQHSVGELRRIGISPDMIICRSEKSLDRELKDKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILNSIASLLDLQNLKPN---MNEWDSLVKRVIAPSN-ELSIAFVGKYVDLKESYKSLTEAIIHAGAALDARVNLKWIDSEKLENANVEESFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLSLVEFARNVLKLEDANSHEFDPKCKNPIIFLIDEFIDASGEKQIRTSKTPLGGTMRLGAYECHIKPNTLLSKVYDNQKIIKERHRHRYEANPKYKEMFEKNGLIISGENE--GLVEAVELKDHPFFLAVQFHPEFTSRLVRVNPAIFSFIKAS 539
>gi|126661859|ref|ZP_01732858.1| CTP synthase (CTP synthetase) [Flavobacteria bacterium BAL38] >gi|126625238|gb|EAZ95927.1| CTP synthase (CTP synthetase) [Flavobacteria bacterium BAL38] (537 aa)
Score = 1193, Expect = 9.7e-129, Identities = 238/526 (45%), Positives = 344/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           ++TK + VTGGV SSLGKG+  +SL  +L+  G    I KFDPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +NVT GRVY   I KER G+FLG T+QVVPHIT  I +++ LL      D +I E+GGTVGDIES+P++E+ RQL  +   +  + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S  L++K++L   ++ E +   I+   IY +P  +  + +         +   N     +W+ F   +K PK ++  I +VGKY +  D+Y SI+ +   +    +T +++  I+S  L+  +  S+L + D ILV  GFG R IEGKI  ++YARENNIPFFGICLGMQ+A IE++RNVL   DA+STE NE+TA+P+I ++E +    N GGT+RLG + C +K+ +   +IY +  I+ERHRHRYEFN  Y++  EK G V SG+N +  LVEI+E+  H FFI VQ+HPE+ S + +P+P+F +F+
  S:     2 NQTKYIFVTGGVTSSLGKGIIAASLAKLLQARGYRTTIQKFDPYINVDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNVPTSQANNVTTGRVYLSVIEKERRGEFLGKTVQVVPHITNEIKERMQLLGKSGDFDIVITEIGGTVGDIESLPYIESVRQLIWELGENNGIVIHLTLVPYLAAAGELKTKPTQHSVKTLMESGIKADILVCRTEHEISQDLRQKLALFCNVKKEAVIQSIDASTIYEVPNLMLEEGLDRVALKKLDLPEKNTPDLNNWNEFLYSLKNPK-HEVNIGLVGKYVELQDSYKSILEAFIHAGAANETKVNVISIHSEFLDAKSAESQLKDLDGILVAPGFGGRGIEGKIDTVRYARENNIPFFGICLGMQMAVIEYSRNVLGYADANSTEMNESTAHPVINLMEEQKNIENKGGTMRLGAWKCSIKENTLAHKIYGKTEIMERHRHRYEFNGSYLNELEKAGLVASGVNPDTKLVEIVEIPTHPFFIGVQYHPEYKSTVANPHPLFVNFV 528
>gi|121998221|ref|YP_001003008.1| CTP synthetase [Halorhodospira halophila SL1] >gi|121589626|gb|ABM62206.1| CTP synthase [Halorhodospira halophila SL1] (551 aa)
Score = 1193, Expect = 9.9e-129, Identities = 233/527 (44%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ L +TGGV SSLGKG++ +SLG +L+  G  V ++K DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF+   + + +N T GR+Y   I KER G +LG T+QV+PH+T+ I + I   ++    D  +VE+GGTVGDIES+PFLEA RQ+  +  R + MF+H   +  + T  ++KTKP QHSVK+L S GI P++L+ R+   +  + + KI+L T +E   + + +++ +IY +PE L  Q + + +   + +E+P       W     ++  P+  +  +A+VGKY D  DAY+S+  +L  +    +  ++I +++S SL     S L   DAILVPGGFG+R IEGKI A+++ARE+ IP+ GICLGMQLA IE+AR+   + +A STEF  +  +P+I ++          E ++   +LGGT+RLG   C L  G+ I ++Y +  IVERHRHRYEFN  Y +   + G  FSG +++  LVE++EL  H +FI  QFHPEFTS     +P+F SFL  +
  S:     2 TRYLFITGGVVSSLGKGISAASLGTILQARGLSVTLIKLDPYINVDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFVRAPVSRRNNFTTGRIYESVIRKERRGDYLGGTVQVIPHVTDEIKRCIQEGADDV--DVALVEIGGTVGDIESLPFLEAIRQMGTELGRERCMFMHLTLVPFIGTAGEMKTKPTQHSVKELRSIGIQPDILVCRAAHPIPEEERRKIALFTNVEPRAVIAALDVPNIYQIPEELHQQGLDHIVAEKWGLELPP-ANLADWHRVVEIMSNPEG-EVTVAMVGKYVDLTDAYMSLNEALRHAGIQTRQRVNIRYVDSESLEREGCSALEGADAILVPGGFGQRGIEGKIEAVRFARESRIPYLGICLGMQLAVIEYARHQAGLENAHSTEFVRHPHHPVIGLITEWMTDEGEVEQRDEADDLGGTMRLGGQPCRLAAGTLINQVYGKDRIVERHRHRYEFNNHYRERLAEAGLSFSGWSQDGRLVEVVELPEHPWFIGCQFHPEFTSTPRDGHPLFASFLRAA 535
>gi|120436564|ref|YP_862250.1| CTP synthetase [Gramella forsetii KT0803] >gi|117578714|emb|CAL67183.1| CTP synthase [Gramella forsetii KT0803] (546 aa)
Score = 1193, Expect = 1.1e-128, Identities = 232/529 (43%), Positives = 345/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SL  +L+  G +  I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+N  + +NVT GR+Y   I KER G+FLG T+QVVPHIT  I ++I +L      D +I E+GGTVGDIES+P++EA RQL+ +      + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S+ ++ K+++   +  E +   I+ + IY +P  +  + +         +   +      W+ F    K PK  +  I ++GKY +  D+Y SI+ S   +    +  +++E+I+S  +N++ I +++S  D +LV  GFG+R IEGKI A++YAREN++PF GICLGMQ+A IEF+RNVL++  A+STE + +T +P+I ++E +   T+ GGT+RLG ++CEL   S I  +Y    I ERHRHRYE+N KY +  E  G + +GIN E  LVEIIEL++H +F+ VQ+HPE+ S + SP+P+F SF+  + +
  S:     4 TKYIFVTGGVSSSLGKGIIAASLAKLLQARGFKATIQKLDPYINVDPGTLNPYEHGECYVTEDGAETDLDLGHYERFLNVNTSQANNVTTGRIYQSVIEKERRGEFLGKTVQVVPHITNEIKERIQILGKNGDYDIVITEIGGTVGDIESLPYIEAVRQLKWELGDDNALVIHLTLVPYLSAAGELKTKPTQHSVKTLMESGIKADILVCRTEHELSDDIRRKLAIFCNVRQEAVIQSIDARTIYDVPNMMLKEGLDKVTLKKLALPDDSTPNLDRWNQFLQRHKNPKA-EVHIGLIGKYVELQDSYKSILESFIHAGAENEVSVNVEYIHSEFINDSTIHNKISHLDGVLVAPGFGERGIEGKIDAVRYARENDLPFLGICLGMQMAVIEFSRNVLQLKGANSTEMDADTKHPVIDLMEAQKEVTHKGGTMRLGAWDCELSKDSIIHAVYGVDKIKERHRHRYEYNNKYKEQLENAGMLSTGINPETGLVEIIELKDHPWFVGVQYHPEYKSTVASPHPLFVSFVKAAHE 533
>gi|153207538|ref|ZP_01946221.1| CTP synthase [Coxiella burnetii 'MSU Goat Q177'] >gi|165918297|ref|ZP_02218383.1| CTP synthase [Coxiella burnetii RSA 334] >gi|120576506|gb|EAX33130.1| CTP synthase [Coxiella burnetii 'MSU Goat Q177'] >gi|165917947|gb|EDR36551.1| CTP synthase [Coxiella burnetii RSA 334] (555 aa)
Score = 1193, Expect = 1.2e-128, Identities = 243/524 (46%), Positives = 338/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIIT----------ILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + +TGGV SSLGKG+  +SLGA+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+N  + +++N T GRVY + I KER G +LG TIQV+PHIT+ I  KI         D  +VEVGGTVGDIES+PFLEA RQ++ +    Q +FIH   +  +    ++KTKP QHSVK+L S GI P++L+ RS+  + +  + KI+L T +   ++ SL ++K IY +P  L +Q + N +     ++         W       K P ++   +AVVGKY D  D+Y S+  +L  +  + +T + IE+I+S ++  +    L + DAILVPGGFG R IEGKILA QYAREN IP+ GICLGMQ+A IEFAR+  +M +A+STEF+  T  P++           I+E +    +LGGT+RLG   C LK  S    +Y    ++ERHRHRYE N   +   EK G V SG + ++ LVE+IEL +H +F+  QFHPEFTS     +P+F  F+
  S:     2 TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFVNATMTRKNNFTTGRVYADVIRKERRGDYLGGTIQVIPHITDEIKAKI--REGADGADVALVEVGGTVGDIESLPFLEAIRQMRIELGDQQTLFIHLTLVPYVAVAGEIKTKPTQHSVKELRSIGIQPDILVCRSEQPLPDAERAKIALFTNVPEPSVISLSDVKSIYEIPLILRDQGLGNRVCEKLNIKA-TAADLDDWKKVVQAQKNP-RHTVTVAVVGKYVDLEDSYKSLSEALIHAGIHTQTRVVIEYIDSEAIELHGTELLKKVDAILVPGGFGSRGIEGKILAAQYARENGIPYLGICLGMQIAIIEFARHKAQMENANSTEFDPKTPFPVVALVSEWMAKEGIIEKRKWGDDLGGTMRLGGQPCRLKIDSLARRLYGEDRVIERHRHRYEVNNDLIGELEKKGLVISGRSIDDRLVEMIELADHPWFVGCQFHPEFTSTPRKGHPLFIGFI 532
>gi|159027352|emb|CAO90538.1| pyrG [Microcystis aeruginosa PCC 7806] (540 aa)
Score = 1193, Expect = 1.2e-128, Identities = 232/529 (43%), Positives = 342/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +K + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  L + ++VT G +Y   + KER G ++G T+QV+PHIT  I ++I+ ++    PD +I E+GGTVGDIES+PFLEA RQ +    R+ V+++H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +   LKEK+S    +  E++ +  +   IY +P +LE + +         +  P     + W+     ++ P + K  IA+VGKY    DAYLS++ +L+ ++  L +++ + ++++  +++++  S LS  D I+VPGGFG R ++GKI AI+YAR NNIPF G+CLGMQ + IE+ RNV ++  A+S+EF E+T NP+I +L  +    +LGGT+RLG Y C L   S    +Y ++ I ERHRHRYEFN  Y  +F + G++ SG + +  LVEIIEL  H FFIA QFHPEF S+    +P+F  F+  + K
  S:     2 SKFVFVTGGVVSSIGKGIVAASLGRLLKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTDTELSRLNSVTTGSIYQAVLNKERRGAYMGGTVQVIPHITNEIKERILRVAKDTNPDIVITEIGGTVGDIESLPFLEAIRQFRKDVGRNNVVYMHVTLIPWIPAAKEMKTKPTQHSVKELRSIGIQPDVLVCRCHLPLQPGLKEKLSAFCDVPVESVITAQDASSIYEVPLNLEKEGLAQQTLELLNLG-PRYPHLEEWENLIRQMQSPSQ-KLEIAIVGKYVQLGDAYLSVVEALKHAAIALNSEIELRWVSAEDVDKDSAESHLSGVDGIVVPGGFGIRGVDGKIKAIEYARVNNIPFLGLCLGMQCSIIEWGRNVARLERANSSEFEEDTPNPVINLLPEQADVVDLGGTMRLGLYPCRLNPDSLAFSLYGQEVIYERHRHRYEFNNAYRSLFFETGYLVSGTSPDGRLVEIIELPKHPFFIATQFHPEFRSRPNKAHPLFSGFMKAALK 530
>gi|116513503|ref|YP_812409.1| CTP synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] >gi|116092818|gb|ABJ57971.1| CTP synthase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] (539 aa)
Score = 1193, Expect = 1.2e-128, Identities = 233/527 (44%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIG-YKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  SS+G +LK  G +V + KFDPY+N+D GTM P QHGEVFVT DG E DLD+G+YER +++   K SNVT G++Y E + +ER G + G T+QV+PH+T  I +K++  +     D +I E+GGTVGD+ES PF+EA RQ++ +  S+ VM++H   +  L    +LK+KP Q SV  L S GI PN+L++RS+  V  ++K+KIS  T +  + I   ++   ++ +P S + Q V   + +F  ++ P  +     W       K   KYK +I +VGKY +  DAY+S+  +L+ + +   + + +E I +  + E+N++E L +   ++VPGGFG R ++G I +I+YARE++IPF GICLGMQ+AS+EFARNVL + DA+S E   N  N II ++  +  +  +GGTLRLG Y   LK G+K  E Y  + ++ ERHRHRYEF  KY + FEK G  FSG++ +N+LVEI+E+ + KFF+A Q+HPEF S+   P  +F  F+  +
  S:     2 TKYIFVTGGVVSSLGKGITASSIGRLLKNRGLKVTMQKFDPYINIDPGTMNPYQHGEVFVTDDGTEADLDLGHYERLVDVRTSKYSNVTTGKIYQEVLQRERRGDYHGGTVQVIPHVTNMIKEKVMRAAQMTDTDVVISEIGGTVGDMESTPFMEAIRQMRREVGSENVMYVHVTFVPYLRAAKELKSKPTQQSVSMLRSIGIQPNMLVLRSEMPVPQEMKDKISTFTDVPVDYIVESLDAPSLFDVPLSYQEQGVDQKVVDFLHIDSPKPVADMDEWRRMDERAKN-LKYKTKITLVGKYVELEDAYISVTDALQHAGYLYNSKIEVEKIQAEDITEDNVAELLKDTQGLIVPGGFGIRGLDGMITSIKYAREHDIPFLGICLGMQMASVEFARNVLHLEDANSAEAEPNCKNNIIDLMADQRDQEKIGGTLRLGLYPAMLKAGTKTRECYDGQEVIQERHRHRYEFYNKYREDFEKAGMTFSGVSPDNHLVEIVEITDKKFFVAAQYHPEFLSRPNRPEGLFKGFIGAA 531
>gi|51891178|ref|YP_073869.1| CTP synthetase [Symbiobacterium thermophilum IAM 14863] >gi|81389872|sp|Q67TG8|PYRG_SYMTH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|51854867|dbj|BAD39025.1| CTP synthase [Symbiobacterium thermophilum IAM 14863] (541 aa)
Score = 1192, Expect = 1.2e-128, Identities = 238/526 (45%), Positives = 337/526 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ--VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE------LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + +TGGV S LGKG+  +SLG ++K  G  V  +KFDPYLNVD GTM+P QHGEVFVT DG E DLD+G+YERF+++N+ K +NVT G++Y   IAKER G +LG T+QV+PHIT  I   I  ++     D ++VE+GGTVGDIE  PFLEA RQ + +  S+  V+FIH   +  +    +LKTKP QHSV++L S GI P++++ RS   +   L+EKI+L   +  E +    +L  +Y +P ++E + +   +     ++   P+      W+      K P++ +  IA+VGKY    DAYLS++ SL  +  +    + I +++S  L EN I+       L   D ILVPGGFG R IEGKI AI+YARE  IPFFGIC+GMQ A IE ARN+L +  A+STEF  +  +P+I ++  + + T+LGGT+RLG + C LK GSK    Y  + + ERHRHR+E N  Y++  E  G    G+  E NLVE++E+E H +F+ VQFHPEF S+   P+P+F  F+  +
  S:     3 KFIFITGGVVSGLGKGITAASLGRLIKSRGYRVTALKFDPYLNVDPGTMSPIQHGEVFVTEDGGECDLDVGHYERFMDVNMGKGNNVTTGKIYSSVIAKERRGDYLGGTVQVIPHITNEIKSHIRRVAEDSDADVILVEIGGTVGDIEGQPFLEAIRQFKNEVPSKDDVLFIHVTLVPYIAASGELKTKPTQHSVRELRSIGIQPDVIVCRSDREIPKDLREKIALFCDVPPEAVIPNEDLGSLYEVPLAMEKEGLAEIVCRRLGLDSRTPD---LAEWEALVQRAKHPER-EVEIALVGKYVALEDAYLSVVESLNHAGIHNNARVRIHWVDSEKL-ENGITPEALEACLGRADGILVPGGFGYRGIEGKINAIRYAREKGIPFFGICMGMQSAVIEAARNLLGLSKANSTEFVTDCKDPVIDMMAQQKQVTDLGGTMRLGAFPCRLKPGSKAHAAYGTEVVHERHRHRFEVNNAYLERLEAVGLKAVGVWPEGNLVEVVEMEGHPWFVGVQFHPEFKSRPNRPHPLFRDFIKAA 533
>gi|15897152|ref|NP_341757.1| CTP synthetase [Sulfolobus solfataricus P2] >gi|24212148|sp|Q980S6|PYRG_SULSO CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|13813337|gb|AAK40547.1| CTP synthetase (UTP-ammonia lyase) (pyrG) [Sulfolobus solfataricus P2] (535 aa)
Score = 1192, Expect = 1.4e-128, Identities = 250/523 (47%), Positives = 362/523 (69%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGS-DLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKA-RIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNEN--NISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K ++VTGGV SS+GKG   +S+G +LK  G  V  +K DPY+NVDAGTM P  HGEVFVT DG ETDLD+G+YERF+++N+ K +N+TAG+VY+E I KER+GK+LG T+Q++PH+T+ I   I   S     +  +VE+GGTVGDIES+PFLEA RQL+ +     V+F+H + L+E L+ + +LKTKPLQHSV++L   GI P+ ++ R+   + ++ + KI+L T ++ ++I S  +++  Y +P  LE+QK+ + I +  K+E   ++    W +F + IK     K   IA+VGKY+   D+Y+SI  ++  +S Y+     + +I S+ L  +  N++E L   + I+V  GFG R  EGKI AI+YARE+NIPF GIC G QL+ +EFAR+VL + +A+STE N NT +P+IT+L+ +   T LGGT+RLG     LK+G+   ++Y +K + ERHRHRYE NPKY+DI E  G V SGI+ EN LVEIIEL ++KFF+A Q HPEF S+  +P+PI+  F+
  S:     4 KYIVVTGGVLSSVGKGTLVASIGMLLKRRGYNVTAVKIDPYINVDAGTMNPYMHGEVFVTEDGAETDLDLGHYERFMDVNMTKYNNITAGKVYFEVIKKEREGKYLGQTVQIIPHVTDQIKDMIRYASKINNAEITLVEIGGTVGDIESLPFLEAVRQLKLEEGEDNVIFVH-IALVEYLSVTGELKTKPLQHSVQELRRIGIQPDFIVGRATLPLDDETRRKIALFTNVKVDHIVSSYDVETSYEVPIILESQKLVSKILSRLKLE-DRQVDLTDWISFVNNIKGINSKKTINIALVGKYTKLKDSYISIKEAIYHASAYIGVRPKLIWIESTDLESDTKNLNEILGNVNGIIVLPGFGSRGAEGKIKAIKYAREHNIPFLGICFGFQLSIVEFARDVLGLSEANSTEINPNTKDPVITLLDEQKNVTQLGGTMRLGAQKIILKEGTIAYQLYGKKVVYERHRHRYEVNPKYVDILEDAGLVVSGIS-ENGLVEIIELPSNKFFVATQAHPEFKSRPTNPSPIYLGFI 529
>gi|77457346|ref|YP_346851.1| CTP synthetase [Pseudomonas fluorescens PfO-1] >gi|119391153|sp|Q3KH94|PYRG_PSEPF CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|77381349|gb|ABA72862.1| CTP synthase [Pseudomonas fluorescens PfO-1] (543 aa)
Score = 1192, Expect = 1.4e-128, Identities = 240/527 (45%), Positives = 340/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +    R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   V    + KI+L T +E   + SL ++  IY +P  L  Q + + +   F ++  N      W+        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +     + L   DAILVPGGFG R +EGKI A+QYAREN +P+ GICLGMQ+A IEFARNVL   DA+STEF+  + +P++ ++          E +   ++LGGT+RLG   C L+ GSK+ + Y +  IVERHRHRYE N   +    + G   SG + +  LVE++E  +H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRVYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGSKRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPVDVSSRRKIALFTNVEERAVISLEDVDTIYKIPAVLHAQGLDDFVVERFGLQC-NGADLSEWEKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTALLEGVDAILVPGGFGLRGVEGKITAVQYARENKVPYLGICLGMQVAVIEFARNVLGWKDANSTEFDRASGHPVVGLITEWEDATGAVEVRTEASDLGGTMRLGAQECLLEAGSKVHDCYGKDVIVERHRHRYEVNNNLLPQIIEAGLKISGRSSDAALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|118475168|ref|YP_892872.1| CTP synthetase [Campylobacter fetus subsp. fetus 82-40] >gi|118414394|gb|ABK82814.1| CTP synthase [Campylobacter fetus subsp. fetus 82-40] (546 aa)
Score = 1192, Expect = 1.5e-128, Identities = 249/526 (47%), Positives = 345/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYK-RKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           ++TK + VTGGV SSLGKG+A +S+  +LK  G +V I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFL+ NL + +N T GRVY   I KER G +LG TIQV+PHI   I ++I         D LIVE+GGTVGDIE +PFLEA R L+++  R   MFIH   +  +    +LKTKP QHSV +L   GI P++++ RS+  ++ +LK+KI+ + G+E  ++    +L+ IY +P S   Q +   I +   +    R   ++WD     +  P      IA VGKY D  ++Y S+  S+  +   L   + +++ +S  ++EN+ SE L + D ILV GGFG R IEGK+ AI+YAREN IP+ GICLGMQL+ IEFARN+L + DA+S EF EN  NPII +++           +  ++ LGGT+RLG+Y C +   S +  IY   K I ERHRHRYE NPKY + FEK+G + SG  +   L+E +EL++H FF+ VQFHPEFTS++  PNP    F+
  S:     5 NQTKYIFVTGGVLSSLGKGIAAASIATLLKNVGLKVSILKADPYINVDPGTMSPLEHGEVFVTDDGAETDLDLGHYERFLDENLTQNNNFTTGRVYSSVIEKERRGDYLGKTIQVIPHIVGEIVERI--KKAGVGKDILIVEIGGTVGDIEGLPFLEAIRALRSEVGRKNGMFIHLTLVPYIKVAGELKTKPTQHSVGELRRIGISPDMIICRSEIPINRELKDKIASSCGVERNSVIESPDLQSIYQVPLSFLKQDILEPIADVLDLG-ELRPNMQNWDNLVKRVIAPSD-SVTIAFVGKYIDLKESYKSLTESIIHAGANLDARVHLKWCDSEKIDENSASETLKDVDGILVAGGFGSRGIEGKMQAIKYARENKIPYLGICLGMQLSLIEFARNILNLEDANSVEFQENCKNPIIYLIDSFIDANGKKQLRTHKSPLGGTMRLGSYKCNILPNSLLSRIYNGAKQIKERHRHRYEANPKYREAFEKNGLIVSG--ESEGLIEAVELQDHPFFLGVQFHPEFTSRLTKPNPAILGFI 537
>gi|154706562|ref|YP_001423743.1| CTP synthetase [Coxiella burnetii Dugway 5J108-111] >gi|154355848|gb|ABS77310.1| CTP synthase [Coxiella burnetii Dugway 5J108-111] (555 aa)
Score = 1192, Expect = 1.6e-128, Identities = 243/524 (46%), Positives = 338/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIIT----------ILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + +TGGV SSLGKG+  +SLGA+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+N  + +++N T GRVY + I KER G +LG TIQV+PHIT+ I  KI         D  +VEVGGTVGDIES+PFLEA RQ++ +    Q +FIH   +  +    ++KTKP QHSVK+L S GI P++L+ RS+  + +  + KI+L T +   ++ SL ++K IY +P  L +Q + N +     ++         W       K P ++   +AVVGKY D  D+Y S+  +L  +  + +T + IE+I+S ++  +    L + DAILVPGGFG R IEGKILA QYAREN IP+ GICLGMQ+A IEFAR+  +M +A+STEF+  T  P++           I+E +    +LGGT+RLG   C LK  S    +Y    ++ERHRHRYE N   +   EK G V SG + ++ LVE+IEL +H +F+  QFHPEFTS     +P+F  F+
  S:     2 TRYIFITGGVVSSLGKGITSASLGAILEAQGLTVTLLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFVNATMTRKNNFTTGRVYADVIRKERRGDYLGGTIQVIPHITDEIKVKI--REGADGADVALVEVGGTVGDIESLPFLEAIRQMRIELGDQQTLFIHLTLVPYVAVAGEIKTKPTQHSVKELRSIGIQPDILVCRSEQPLPDAERAKIALFTNVPEPSVISLSDVKSIYEIPLILRDQGLGNRVCEKLNIKA-TAADLDDWKKVVQAQKNP-RHTVTVAVVGKYVDLEDSYKSLSEALIHAGIHTQTRVVIEYIDSEAIELHGTELLKKVDAILVPGGFGSRGIEGKILAAQYARENGIPYLGICLGMQIAIIEFARHKAQMENANSTEFDPKTPFPVVALVSEWMAKEGIIEKRKWGDDLGGTMRLGGQPCRLKIDSLARRLYGEDRVIERHRHRYEVNNDLIGELEKKGLVISGRSIDDRLVEMIELADHPWFVGCQFHPEFTSTPRKGHPLFIGFI 532
>gi|34540341|ref|NP_904820.1| CTP synthetase [Porphyromonas gingivalis W83] >gi|81417681|sp|Q7MWR7|PYRG_PORGI CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|34396653|gb|AAQ65719.1| CTP synthase [Porphyromonas gingivalis W83] (539 aa)
Score = 1192, Expect = 1.6e-128, Identities = 223/529 (42%), Positives = 343/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +L+  G  V + KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFLN    + +N+T GR+Y   I KER G++LG T+QVVPHIT+ I + + LL  K Q DF+I E+GGTVGDIES+PFLE+ RQL+ +     + +H   +  +    ++KTKP QHSVK L   GI P++L++R++  +   + +K++L   +  +++   +++  IY +P  L+ Q +  ++     ++V      + W  F  + K   +    IA+VGKY +  DAY SI  SL  ++ Y +  L++  ++S  + E N++E L + D I++  GFG R +EGK++A++YAREN++P  GICLGMQ   IE+ARNVL   DA++TE   N  + +I +++ +   T++GG++RLG Y+C L+ GSK+   Y ++ + ERHRHR+EFN +Y + FEK G    G N E  LVE +E+   ++F+ VQFHPE+ S +++PNP+F +F+  + K
  S:     4 TKYIFVTGGVVSSLGKGIVAASLGKLLQARGFNVALQKFDPYINIDPGTLNPYEHGECYVTEDGHEADLDLGHYERFLNTPTTRANNITTGRIYQNVIRKERKGEYLGKTVQVVPHITDEIKRNVKLLGQKSQYDFVITEIGGTVGDIESLPFLESVRQLKWELGQNCLCVHLTYVPYIAAAGEVKTKPTQHSVKQLQEVGIQPDILVLRTEHELQPDILKKVALFCNVAPDSVVQSVDVPTIYEVPLVLQQQHMDETVLRKVGLQVGPVPEMRQWHEFLEM-KHTARETVTIALVGKYVELQDAYKSIDESLMQAAIYNRKKLNLISVHSEKVTEANVAETLKDMDGIVIAPGFGSRGVEGKLIALKYARENDLPTLGICLGMQCMVIEYARNVLGFKDANTTEIESNIEHKVIDLMDEQKTVTDMGGSMRLGAYDCALRKGSKLAAAYGKEFVRERHRHRFEFNSQYREAFEKAGMQCVGENPETGLVEAVEVPACRWFVGVQFHPEYNSTVVNPNPLFMAFIREAIK 532
>gi|89075077|ref|ZP_01161518.1| CTP synthetase [Photobacterium sp. SKA34] >gi|89049164|gb|EAR54729.1| CTP synthetase [Photobacterium sp. SKA34] (546 aa)
Score = 1191, Expect = 1.8e-128, Identities = 251/527 (47%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL------EGKNRE----TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + + KER G +LGATIQV+PHIT  I  ++  L+     D  IVEVGGTVGDIES+PF+EA RQL  +  R   MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    + KI+L   ++ + + S+ ++  IY +P+ ++ Q + + +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  + I++I+S  +       L+  DAILVPGGFG R +EGKIL  QYARENNIP+ GICLGMQ+A IEFARNV KM DA STEFN  T  P++ ++      EGK  E    ++LGGT+RLG+  C L+DGSK   +Y + +I ERHRHRYE N   +   EK G   SG++ +  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTMMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRKERRGDYLGATIQVIPHITNEIKSRV--LAGAEGHDVAIVEVGGTVGDIESLPFMEAIRQLAVEQGRENTMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERAKIALFCNVQEKAVISMKDVDSIYKIPQLIKAQGLDDLVCKRFGITAP-EADLSEWEQVIYEEANPTS-EVVIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVKIKYIDSQDVESKGTEVLAGLDAILVPGGFGSRGVEGKILTAQYARENNIPYLGICLGMQVALIEFARNVAKMADAHSTEFNAETKYPVVGLITEWIDSEGKVEERTEKSDLGGTMRLGSQLCHLQDGSKARTLYGQPTIHERHRHRYEVNNTLLPKLEKAGLKVSGLSADKKLVEIIEVPNHPWFVAAQFHPEFTSTPRDGHPLFEGFVKAA 536
>gi|161350000|ref|NP_143630.2| CTP synthetase [Pyrococcus horikoshii OT3] >gi|24212094|sp|O59456|PYRG_PYRHO CTP synthase (UTP--ammonia ligase) (CTP synthetase) (537 aa)
Score = 1191, Expect = 1.9e-128, Identities = 238/529 (44%), Positives = 339/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGI-NKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV S LGKG+  +S+G ++K  G +   +K DPY+N DAGTM P QHGEVFV  DG E DLD+GNYERFL+ NL  E N+T G+VY   I KER G++LGAT+QV+PHIT+ I ++I  ++  Y  D ++VE+GGTVGDIES+PFLEA RQ+Q +  R  V F+H   + +L    + KTKP QHSVK+L S GI P+ ++ RS+D +  + ++KISL T +  E + S  +++  Y +P  LE + +   +    K+E       + W+   +  K  K+    IA+VGKY    D+YLSI  +L+ +S      + I +I +  + E+    L   D I+VPGGFG R  EGKI+ I+YAREN+IPF GIC G QL  +EFARNVL M  A STE +  T  P++ ++  +     LGGT+RLG Y  ++K G+    +YK++ + ERHRHR+E NP Y++ FEK G VFSG+   +   +EI+EL + ++FIA QFHPEF S+ + P P+F+  +  +K+
  S:     2 TKFIFVTGGVVSGLGKGITSASIGLLMKARGYKTTNIKIDPYINYDAGTMNPYQHGEVFVLDDGGEVDLDLGNYERFLDTNLTFEHNITTGKVYSTVIEKERRGEYLGATVQVIPHITDEIKRRIREIAKDY--DIVVVEIGGTVGDIESMPFLEAARQMQLEEGRENVAFVHVTYVPKLKVVGEQKTKPTQHSVKELRSLGIQPDAIVARSEDPLEEEARKKISLFTNVPREAVVSAYDVEDTYEVPLLLEREGLGKYLIKRLKLE-DREPDLREWEKMVAKYKALKE-TVEIAIVGKYVKLTDSYLSIKEALKHASVSNDVKVKIRWIEAEDIEEHGTKLLEGVDGIIVPGGFGARGAEGKIMTIKYARENDIPFLGICFGFQLTVVEFARNVLGMKGAHSTEIDPQTPYPVVDLMPEQRNLEKLGGTMRLGAYPVKIKKGTLAYRLYKKELVYERHRHRWEVNPDYIEAFEKAGLVFSGVAGDDERRMEILELPDKRYFIATQFHPEFKSRPMRPAPVFHGLVRAAKE 528
>gi|56459882|ref|YP_155163.1| CTP synthetase [Idiomarina loihiensis L2TR] >gi|81363621|sp|Q5R142|PYRG_IDILO CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|56178892|gb|AAV81614.1| CTP synthase; UTP-ammonia lyase [Idiomarina loihiensis L2TR] (545 aa)
Score = 1191, Expect = 2.0e-128, Identities = 246/527 (46%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   +   +N T GRVY + I +ER G+FLGATIQV+PHIT  I +++I  S  +  D  I+E+GGTVGDIES PFLEA RQL  +  R   +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ RS  ++    + KI+L T +E   +  L ++  IY +P  L+ Q + + +   F ++ P       W+        P   +  +  VGKY + PDAY S+  +L  +    +  ++I +I+S  L     S+L + DAILVPGGFG R IEGK++A +YARENNIP+ GICLGMQ+A IEFARNV  +  A+STEF+EN ++P++ ++          E +++ ++LGGT+RLG+  C L+ GSK L++Y +++I ERHRHRYE N  Y++  EK G   +G + +  LVEI+E   H++F+AVQFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTVDGAETDLDLGHYERFIRTRMTSSNNFTTGRVYEDIIRRERKGEFLGATIQVIPHITNEIKRRVIEGSKGF--DIAIIEIGGTVGDIESQPFLEAIRQLGTEIGRDHTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIQPDVLVCRSDRSLPATERSKIALFTNVEERAVIGLRDVDSIYKIPSMLKAQSLDDIVTKRFNLDCP-EADLHEWEEVLYQESNPNG-EVTVGFVGKYVELPDAYKSVNEALAHAGLKNRLTVNIRYIDSQDLETKGTSKLEDVDAILVPGGFGDRGIEGKLIAAKYARENNIPYLGICLGMQVAMIEFARNVAGLTGANSTEFDENCSDPVVGLITEWMDASGQKELRDKHSDLGGTMRLGSQECHLEKGSKALKMYGKETIEERHRHRYEVNNHYIEPLEKAGLKITGYSHDKQLVEILENPKHRWFVAVQFHPEFTSTPRDGHPLFKGFIEAA 536
>gi|94500737|ref|ZP_01307266.1| CTP synthetase [Oceanobacter sp. RED65] >gi|94427059|gb|EAT12040.1| CTP synthetase [Oceanobacter sp. RED65] (543 aa)
Score = 1190, Expect = 2.1e-128, Identities = 239/529 (45%), Positives = 344/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY---RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T+ + VTGGV SSLGKG+A +SLGA+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   +   +N T GRVY + + KER G +LG T+QV+PHIT+ I +++   S     D  +VE+GGTVGDIES+PFLEA RQL+ +    R+  M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   + +    KI+L T +E   +  L +   IY +PE L+   + + + + F +E  +      WD        P +++  IA+VGKY +  DAY S+I +++ +    +T ++IE+I+S  +  +    L+  DAILVPGGFG R +EGKI  +QYAREN IP+ GICLGMQ A IEFARNV  + DA STEF+ +T NP++ ++          E +  +++LGGT+RLG   C L   S   + Y ++ IVERHRHRYE N  +++  EK+G   +G + +  LVE++E+ +H +F+A QFHPEFTS     + +F +F+    K
  S:     3 TRFIFVTGGVVSSLGKGIASASLGAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFIRTTMSSRNNFTTGRVYQDVLRKERRGDYLGGTVQVIPHITDEIKRRV--YSGAEGADVALVEIGGTVGDIESLPFLEAVRQLKVELGSKRALSMHLTLVPFIA--TAGETKTKPTQHSVKELRSIGLQPDILVCRSDHRIDSGSLRKIALFTNVEERAVIPLEDADTIYRIPELLKQTGLDDYVIDKFGLEC-DEADLSEWDEVIDAKLNP-EHEINIAMVGKYMELLDAYKSLIEAIDHAGLKNRTKVNIEYIDSEIIERDGADVLAGKDAILVPGGFGNRGVEGKIRTVQYARENKIPYLGICLGMQSAVIEFARNVCGLEDAHSTEFSSSTKNPVVGLITEWTTAEGETEQRTEDSDLGGTMRLGGQECRLTPESLSAQAYGQEVIVERHRHRYEVNNNFLETLEKNGLRIAGRSMDGKLVEVVEVADHPWFVACQFHPEFTSTPRDGHGLFTAFVAAGLK 538
>gi|40062765|gb|AAR37659.1| CTP synthase [uncultured marine bacterium 439] (544 aa)
Score = 1190, Expect = 2.3e-128, Identities = 235/529 (44%), Positives = 350/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + +TGGV SSLGKG+A +SL ++L+  G  + ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   L K++N TAGRVY   I +ER G +LGAT+Q++PHIT+ I  K +        D  +VE+GGT GDIES+PF+EA RQ+  +  R   +FIH   +  +    +LKTKP QHSVK+L   GI P++L+ RS++ +++  ++KI+L T +   +++  ++   IY +PE L  Q + + +     ++         W    S ++ P K+   +A+VGKY D  ++Y S+  +L  +  + +T ++I + +S  + +N+   LS   A+LVPGGFG R IEGK+ A++YARENN+P+ GICLGMQ+A IEFAR+   M DA+STEF++NT  P+I ++          + +N +++LGGT+RLG   CEL  GS+  +IY  + + ERHRHRYE N   +   EK G   SG + + +LVE+IE+ +H +F+A QFHPEFTS     +P+F SF+N +K+
  S:     2 TKYIFITGGVVSSLGKGIASASLASILENRGLNITLLKLDPYINVDPGTMSPFQHGEVFVTNDGAETDLDLGHYERFVRTQLGKKNNFTAGRVYENVIKRERKGDYLGATVQIIPHITDEI--KRLTKEGAEGSDVALVEIGGTAGDIESLPFMEAIRQMSLELGRENTLFIHLTLVPYIKVAGELKTKPTQHSVKELRGIGIQPDILICRSEEPLADAERKKIALFTNVAENSVFVSLDQDSIYKIPEVLHEQGLDDIVVAKLGLDC-KAADLTEWSNVISRLEMP-KHSVDVAMVGKYMDLTESYKSLSEALIHAGIHTQTKVNIHYFDSEEIEKNSADCLSNMSAVLVPGGFGIRGIEGKVEAVRYARENNLPYLGICLGMQVAVIEFARHKANMKDANSTEFDQNTPFPVIGLITEWQDENGDTQKRNSDSHLGGTMRLGGQECELVKGSRSQKIYGTERVTERHRHRYEVNNNLIGKIEKAGLTISGRSHDGSLVEMIEISDHSWFVACQFHPEFTSTPRDGHPLFESFINAAKE 537
>gi|145218989|ref|YP_001129698.1| CTP synthetase [Prosthecochloris vibrioformis DSM 265] >gi|145205153|gb|ABP36196.1| CTP synthase [Prosthecochloris vibrioformis DSM 265] (594 aa)
Score = 1190, Expect = 2.5e-128, Identities = 237/527 (44%), Positives = 341/527 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSL-NE--NNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFLN +  + SN+T GRVY   I KER G +LG T+QVVPH+ + I  ++  L+     D +I E+GGT+GDIES+PFLEA RQ++     + ++ IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S+++K K+     + N ++  L +   IY +P +L  +++   +     ++        +W  F + +K P   +  I V GKY++ PDAY SI+ +   +       + +  I + +  NE  +   EL     ILV  GFG R IEGK+  I+YARE  IPFFGICLGMQ AS+EFARNV  + +A+STEFN+    P+I ++E + +    GGT+RLG+Y C +K+G+K  E+Y +  I ERHRHR+EFN  Y + FE+HG VFSG +    LVEIIE+++H +F+AVQFHPE  S++ + +P+F+ F+  +K
  S:     8 KYVFVTGGVVSSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLNESTSQASNLTMGRVYKSVIDKERRGAYLGGTVQVVPHVIDEIKDRLAELAKNGNYDVIITEIGGTIGDIESLPFLEAMRQMKLDMGDRNLLNIHLTFVPYIRAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSSEIKRKVGHFCNVNNLDVIGLNDCDTIYEVPLTLLQEQLDLRVLKKLGLKKFKEPDLVYWREFCNKVKHPTSGEVTIVVCGKYTEYPDAYKSILEAFIHAGASNDVKVHVRLIGAEAAENEAYDFARELEGVHGILVAPGFGDRGIEGKVAFIRYAREQGIPFFGICLGMQCASVEFARNVCNLAEANSTEFNKRARYPVIDLMEQQKKVKEKGGTMRLGSYPCIIKEGTKANEVYGKFLINERHRHRFEFNNAYRETFEEHGMVFSGTSPNGELVEIIEIKDHPWFVAVQFHPELKSRVQAVHPLFHGFVGAAK 538
>gi|27904859|ref|NP_777985.1| CTP synthetase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] >gi|29839500|sp|P59577|PYRG_BUCBP CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|27904257|gb|AAO27090.1| CTP synthase [Buchnera aphidicola str. Bp (Baizongia pistaciae)] (544 aa)
Score = 1190, Expect = 2.5e-128, Identities = 249/528 (47%), Positives = 351/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYK-ARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNR---------ETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + + +TGGV SSLGKG+  ++L A+L+     V I+K DPY+N+D GT++P QHGEVFVT DG ETDLD+G+YERF+   + +++N T G +Y E + KER G++LGATIQ++PHIT  I ++II  S  +  D + VEVGGTVGDIES+PFLEA RQ+     R   ++IH   +  +    ++KTKP QHSVK+L+S GI P++L+ RS+  +  + + KI+L   +  E++ SLIN+  IY +P+ L  QKV   I + FK++VP       WD    +  E        I ++GKY  SPDAY S+I +L+      KT + I+ INS  + +N  + L+    IL+PGGFG R I GK++ ++YAR NN+PFFGICLGMQ+A IEF RNV+ + DA+STEF++N  +PII+++   NR         +  LGGT+RLGN  C LK  S   ++Y +  I ERHRHRYE N K+++  EK+G   +G +K+N LVEIIEL NH +FIA QFHPEFTS     +P+F  F+  +
  S:     2 KKRFIFITGGVVSSLGKGITTAALAAVLEARNLNVTIIKLDPYINIDPGTISPEQHGEVFVTEDGAETDLDLGHYERFIRTKMTRKNNFTTGSIYSEVLNKERKGEYLGATIQIIPHITNTIKKRII--SCAHNVDIVFVEVGGTVGDIESLPFLEAIRQIAIDIGRENTIYIHLTLVPYISITKEIKTKPTQHSVKELLSIGIQPDILICRSQYTIPIQARSKIALFCNVLKESVISLINVDSIYKIPKLLNLQKVDQIICHHFKLKVPP-ADLSEWDEV--IYNELNTNNVVTIGIIGKYIKSPDAYKSVIEALKHGGIKNKTVVKIKLINSEKIEKNGTNRLNCLHGILIPGGFGHRGITGKLITVEYARINNVPFFGICLGMQIALIEFFRNVIGLKDANSTEFSQNCQHPIISLIPKGNRNLPNINNNVKKKLGGTMRLGNQTCYLKQDSISHKLYGKNIISERHRHRYEVNNKFINKIEKYGLKITGKSKKNKLVEIIELSNHLWFIACQFHPEFTSTPRDGHPLFIDFIKAA 535
>gi|188995311|ref|YP_001929563.1| CTP synthase [Porphyromonas gingivalis ATCC 33277] >gi|188594991|dbj|BAG33966.1| CTP synthase [Porphyromonas gingivalis ATCC 33277] (539 aa)
Score = 1190, Expect = 2.5e-128, Identities = 223/529 (42%), Positives = 343/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SLG +L+  G  V + KFDPY+N+D GT+ P +HGE +VT DG E DLD+G+YERFLN    + +N+T GR+Y   I KER G++LG T+QVVPHIT+ I + + LL  K Q DF+I E+GGTVGDIES+PFLE+ RQL+ +     + +H   +  +    ++KTKP QHSVK L   GI P++L++R++  +   + +K++L   +  +++   +++  IY +P  L+ Q +  ++     ++V      + W  F  + K   +    IA+VGKY +  DAY SI  SL  ++ Y +  L++  ++S  + E N++E L + D I++  GFG R +EGK++A++YAREN++P  GICLGMQ   IE+ARNVL   DA++TE   N  + +I +++ +   T++GG++RLG Y+C L+ GSK+   Y ++ + ERHRHR+EFN +Y + FEK G    G N E  LVE +E+   ++F+ VQFHPE+ S +++PNP+F +F+  + K
  S:     4 TKYIFVTGGVVSSLGKGIVAASLGKLLQARGFNVALQKFDPYINIDPGTLNPYEHGECYVTEDGHEADLDLGHYERFLNTPTTRANNITTGRIYQNVIRKERKGEYLGKTVQVVPHITDEIKRNVKLLGQKSQYDFVITEIGGTVGDIESLPFLESVRQLKWELGQNCLCVHLTYVPYIAAAGEVKTKPTQHSVKQLQEVGIQPDILVLRTEHELQPDILKKVALFCNVAPDSVVQSVDVPTIYEVPLVLQQQHMDETVLRKVGLQVGPVPEMRQWHEFLEM-KHTAQETVTIALVGKYVELQDAYKSIDESLMQAAIYNRKKLNLISVHSEKVTEANVAETLKDMDGIVIAPGFGSRGVEGKLVALKYARENDLPTLGICLGMQCMVIEYARNVLGFKDANTTEIESNIEHKVIDLMDEQKTVTDMGGSMRLGAYDCALRKGSKLAAAYGKEFVRERHRHRFEFNSQYREAFEKAGMQCVGENPETGLVEAVEVPACRWFVGVQFHPEYNSTVVNPNPLFMAFIREAIK 532
>gi|188534841|ref|YP_001908638.1| CTP synthase (UTP-ammonia ligase) [Erwinia tasmaniensis] >gi|188029883|emb|CAO97767.1| CTP synthase (UTP-ammonia ligase) [Erwinia tasmaniensis] (545 aa)
Score = 1190, Expect = 2.5e-128, Identities = 240/529 (45%), Positives = 345/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T  + VTGGV SSLGKG+A +SL A+L+  G +V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI ++II     +  D ++VE+GGTVGDIES+PFLEA RQ+     R   M++H   +  +    ++KTKP QHSVK+L+S GI P++L+ RS  AV    + KI+L   +  + + SL ++  IY +P  L++Q + + I   F +  P     + W+        P   +  I +VGKY + PDAY S+I +L+      +  ++I+ I+S  +    +  L + DAIL+PGGFG R +EGK++  QYARENNIP+ GICLGMQ+A +EFARNV  M  A+STEF  +   P++ ++          E ++ +++LGGT+RLG+  C+L DGS + ++Y   +IVERHRHRYE N   +   E  G   +G + ++ LVEI+E+ NH +F+A QFHPEFTS     +P+F  F+  + +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTIMKLDPYINVDPGTMSPTQHGEVFVTDDGAETDLDLGHYERFIRTRMSRRNNFTTGRIYSEVLRKERRGDYLGATIQVIPHITNAIKERIIEGGEGH--DVVLVEIGGTVGDIESLPFLEAIRQMAVDVGREHTMYMHLTLVPYMAAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGMLKSQGLDDYICKRFSLNAP-EANLQEWEQVIYQEANPGG-EVNIGMVGKYVELPDAYKSVIEALKHGGLKNRVTVNIKLIDSQDVETRGVELLKDLDAILIPGGFGYRGVEGKLMTAQYARENNIPYLGICLGMQVALMEFARNVAHMEGANSTEFVPDCKYPVVALITEWRDEEGNVEQRSEQSDLGGTMRLGSQQCQLTDGSLVRQLYGSDTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSGDDQLVEIVEIPNHPWFVACQFHPEFTSTPRDGHPLFSGFVKAASE 538
>gi|154495769|ref|ZP_02034465.1| hypothetical protein BACCAP_00048 [Bacteroides capillosus ATCC 29799] >gi|150274967|gb|EDN02015.1| hypothetical protein BACCAP_00048 [Bacteroides capillosus ATCC 29799] (536 aa)
Score = 1190, Expect = 2.7e-128, Identities = 238/528 (45%), Positives = 333/528 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQL-QAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDG-SKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV S LGKG+A +SLG +LK  G  V + KFDPYLNVD GTM P QHGEVFVT DG ETDLD+G+YERF + NL   S+VT+G+VY+  +++ER G +LG TIQV+PHIT+ I  +I  +    + D +I E+GGTVGDIES PFLEA RQ+ Q   R  VM++H   ++ +    +LK+KP QHSVK+L+  GI P+++L RS   V   L+EKI+L   I  EN+   +    +Y +P  LE + +  ++     +    P+      W       K P     RIA+VGKY    DAYLS+  +L          + I+++++  + + N +E L + D +LVPGGFG R +EGKI AI+YARENN+PF GICLGMQ+A +EFAR+   +  A S E +  T  P+I +++ +   T  GGT+RLG Y C L +G +KI   Y ++ I ERHRHRYEFN +Y +     G V SG++ + +LVE +EL  H +F+ VQ+HPEF S+    +P+F  F+  + K
  S:     4 KYIFVTGGVVSGLGKGIAAASLGRLLKQRGLRVALQKFDPYLNVDPGTMNPYQHGEVFVTDDGAETDLDLGHYERFTDENLTVNSSVTSGKVYWTVLSRERSGDYLGGTIQVIPHITDEIKSRIYRVGRSGEVDVVITEIGGTVGDIESQPFLEAIRQVGQEVGRQDVMYLHVSLIVSIPGTGELKSKPTQHSVKELLGLGIQPDVILARSDSPVPRDLREKIALFCNIAPENVIPNLTAPILYEVPLMLEQEGLARAVCRRLGLGDTAPD---LTEWQAMVERAKCPAG-TVRIALVGKYVALHDAYLSVAEALTHGGIENGVKVDIKWVDAEQVTDENAAELLRDCDGVLVPGGFGSRGVEGKISAIRYARENNVPFLGICLGMQMAVVEFARHAAGLTGAHSAELDPATPYPVIALMDEQRNVTEKGGTMRLGAYPCRLTEGDTKIRRAYGQEVISERHRHRYEFNNQYREALTSKGLVLSGLSPDGSLVETVELPGHPWFVGVQYHPEFKSRPNKAHPLFRDFVAAAVK 532
>gi|3258228|dbj|BAA30911.1| 557aa long hypothetical CTP synthase [Pyrococcus horikoshii OT3] (557 aa)
Score = 1190, Expect = 2.7e-128, Identities = 239/533 (44%), Positives = 341/533 (63%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGI-NKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           L+  TK + VTGGV S LGKG+  +S+G ++K  G +   +K DPY+N DAGTM P QHGEVFV  DG E DLD+GNYERFL+ NL  E N+T G+VY   I KER G++LGAT+QV+PHIT+ I ++I  ++  Y  D ++VE+GGTVGDIES+PFLEA RQ+Q +  R  V F+H   + +L    + KTKP QHSVK+L S GI P+ ++ RS+D +  + ++KISL T +  E + S  +++  Y +P  LE + +   +    K+E       + W+   +  K  K+    IA+VGKY    D+YLSI  +L+ +S      + I +I +  + E+    L   D I+VPGGFG R  EGKI+ I+YAREN+IPF GIC G QL  +EFARNVL M  A STE +  T  P++ ++  +     LGGT+RLG Y  ++K G+    +YK++ + ERHRHR+E NP Y++ FEK G VFSG+   +   +EI+EL + ++FIA QFHPEF S+ + P P+F+  +  +K+
  S:    18 LSTMTKFIFVTGGVVSGLGKGITSASIGLLMKARGYKTTNIKIDPYINYDAGTMNPYQHGEVFVLDDGGEVDLDLGNYERFLDTNLTFEHNITTGKVYSTVIEKERRGEYLGATVQVIPHITDEIKRRIREIAKDY--DIVVVEIGGTVGDIESMPFLEAARQMQLEEGRENVAFVHVTYVPKLKVVGEQKTKPTQHSVKELRSLGIQPDAIVARSEDPLEEEARKKISLFTNVPREAVVSAYDVEDTYEVPLLLEREGLGKYLIKRLKLE-DREPDLREWEKMVAKYKALKE-TVEIAIVGKYVKLTDSYLSIKEALKHASVSNDVKVKIRWIEAEDIEEHGTKLLEGVDGIIVPGGFGARGAEGKIMTIKYARENDIPFLGICFGFQLTVVEFARNVLGMKGAHSTEIDPQTPYPVVDLMPEQRNLEKLGGTMRLGAYPVKIKKGTLAYRLYKKELVYERHRHRWEVNPDYIEAFEKAGLVFSGVAGDDERRMEILELPDKRYFIATQFHPEFKSRPMRPAPVFHGLVRAAKE 548
>gi|119358425|ref|YP_913069.1| CTP synthetase [Chlorobium phaeobacteroides DSM 266] >gi|119355774|gb|ABL66645.1| CTP synthase [Chlorobium phaeobacteroides DSM 266] (565 aa)
Score = 1189, Expect = 2.9e-128, Identities = 236/528 (44%), Positives = 339/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI---SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLG +LK  G +V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+    + SN+T GRVY   I KER G++LG T+QVVPH+ + I  ++  L+     D LI E+GGT+GDIES+PFLEA RQ++ +     ++ IH   +  +    +LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     +   ++  L +   IY +P  L  +K+   +     ++       ++W  F + +  P + +  I V GKY++ PDAY SI+ +   +       ++I+ + +      +     E+     +LV  GFG R IEGKI  I+YARE NIPFFGICLGMQ A+IEFARNV  +HDA+STEFN+ T  P+I ++E + +    GGT+RLG+Y C +K+GSK  +IYK+  I ERHRHR+EFN  Y    E+ G VFSG +    LVEIIEL++H++F+ VQFHPE  S++   +P+F+ F+  +K+
  S:     8 KHIFVTGGVISSLGKGILSASLGMLLKSRGLKVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDEATSQASNLTMGRVYKSVIDKERSGEYLGGTVQVVPHVIDEIKDRMAELAKNGNLDVLITEIGGTIGDIESLPFLEAMRQMKLEMGERNLLNIHLTFVPYIKAACELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVGHFCNVNELDVIGLNDCDTIYEVPLMLLKEKLDLRVMKKLGLKKFREPNLEYWRDFCNKVLHPTEGEVTIGVCGKYTEYPDAYKSILEAFIHAGASNNVRVTIKLLRAEDAEAGSFDFKKEMQGVSGVLVAPGFGDRGIEGKISFIRYAREQNIPFFGICLGMQCATIEFARNVCGLHDANSTEFNKRTRFPVIDLMEQQKKVKEKGGTMRLGSYPCIIKEGSKAYDIYKKFLINERHRHRFEFNNTYRSALEEQGMVFSGTSPNGELVEIIELKDHRWFVGVQFHPELKSRVQQVHPLFHGFVAAAKE 539
>gi|167626769|ref|YP_001677269.1| CTP synthetase [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596770|gb|ABZ86768.1| CTP synthase [Francisella philomiragia subsp. philomiragia ATCC 25017] (546 aa)
Score = 1189, Expect = 3.0e-128, Identities = 242/531 (45%), Positives = 343/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +N  TKI+ VTGGV SSLGKGV  +SL  +L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + SN T G+VY   + +ER G +LGATIQV+PHIT+ I +++         D  IVE+GGTVGDIES PFLEA RQL+ +  R++ +F+H   L  +    +LKTKP QHSVK+L   GI  ++L+ R +    +  K KI+L T ++ + I++  ++  IY +P     Q     +     +          W    + I+  K  +  IA+VGKY    +AY S+  +L  + +     + I+F++S  +N+ N+ S  ++ DAILVPGGFG R +EGKI +I+YAREN IPF GICLGMQLA +E+ARNVL + DA S+E N +T NP+I +          +  +  +++LGGT+RLG Y C LK GS+  EIY+   ++ERHRHRYE N  Y+D  E  G +FSG +++N L+E+IE+  HK+FIA Q HPEFTS     + +F S+++ +
  S:     1 MNPNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQASNFTTGKVYQSVLRRERKGDYLGATIQVIPHITDEIKRRVC-EGIAEDVDVAIVEIGGTVGDIESQPFLEAIRQLRIELGRNRTLFVHLTLLPYIRVAGELKTKPTQHSVKELRGIGIQADVLVCRCEKRFDDSEKRKIALFTNVDQDCIFTAEDVDTIYEVPLRYNQQGFDAKLVELLNLNT-KEADLSEWQNVVNTIRSTKG-EVTIAMVGKYVSLTEAYKSLNEALYNAGYKNGVKVKIKFVDSEEVNDTNVESFFNDADAILVPGGFGSRGVEGKIASIKYARENQIPFLGICLGMQLAVVEYARNVLGIQDAHSSELNPSTTNPVIGLITEWQAEDGTIHQRTHDSDLGGTMRLGGYRCVLKAGSRAREIYQADEVIERHRHRYEVNNNYVDRLEDAGLIFSGRSEDNKLMELIEIPEHKWFIACQAHPEFTSTPRYGHKLFESYIHAA 540
>gi|88714051|ref|ZP_01108129.1| CTP synthetase [Flavobacteriales bacterium HTCC2170] >gi|88707566|gb|EAQ99808.1| CTP synthetase [Flavobacteriales bacterium HTCC2170] (545 aa)
Score = 1189, Expect = 3.1e-128, Identities = 238/528 (45%), Positives = 348/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRI--GYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYK-RKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+  +SL  +L+  G +  I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+   + +NVT GR+Y   I KER G+FLG T+QVVPHIT  I +++ +L    + D +I E+GGTVGDIES+P++EA RQL  +   +  + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S+++K K++L   ++ E +   I+   IY +P  ++ + +        K+E+P+      K WD F    K P K++  I +VGKY +  D+Y SI+ S   +    +  +++ FI+S  +++ NI + L   D +LV  GFG+R IEGKI A+++AREN IPF GICLGMQ+A IE+ARN+L +  A+STE + +T +P+I+++E +   TN GGT+RLG ++C L D + + E+Y   K I ERHRHRYEFN  Y +  EK G   SGINKE  LVEI+EL +H +FI VQ+HPE+ S + +P+P+F   +  +
  S:     3 QTKYIFVTGGVTSSLGKGIIAASLAKLLQARGYKTTIQKLDPYINVDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNVKTSQANNVTTGRIYQSVIEKERRGEFLGKTVQVVPHITNEIKERVQILGKSGEYDIVITEIGGTVGDIESLPYIEAVRQLLWELGDNNGIVIHLTLVPYLSAAGELKTKPTQHSVKTLMESGIKADILVCRTEHEISDEIKNKLALFCNVKREAVIQSIDASTIYDVPILMQEEGLDTVTLQ--KLELPDNTIPDLKQWDEFLRKHKNP-KHEVTIGLVGKYVELQDSYKSILESFIHAGATNEVRVNVRFIHSEHISKKNIEKNLHGLDGVLVAPGFGERGIEGKIEAVRHARENKIPFLGICLGMQMAVIEYARNILGLTKANSTEMDGSTTDPVISLMEEQKTITNKGGTMRLGAWDCHLNDATLVQEVYNGTKDISERHRHRYEFNNDYKEQLEKAGLKASGINKETGLVEIVELPDHPWFIGVQYHPEYKSTVANPHPLFVGLVKAA 532
>gi|86606146|ref|YP_474909.1| CTP synthetase [Synechococcus sp. JA-3-3Ab] >gi|119391192|sp|Q2JUH1|PYRG_SYNJA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|86554688|gb|ABC99646.1| CTP synthase [Synechococcus sp. JA-3-3Ab] (544 aa)
Score = 1189, Expect = 3.3e-128, Identities = 231/526 (43%), Positives = 336/526 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHT--VPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + +TGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + N+ K +NVT G +Y   I KER G + G+T+QV+PH+T+ I ++I  ++ +  PD ++VEVGGTVGDIES+PFLEA RQ +    R+ V ++H   VPLI+     ++KTKP QHSVK+L S GI P++L+ R +  +   +KEKIS    +  E +    +   IY +P  LE + +   +     +E P +   + W+     +  P++ +  IA+VGKY    DAYLS+  +L  +   L   +++ +I+S  + E      L++ D ++VPGGFG R IEGK+  I+Y RE  IPF G+CLGMQ A I++  N+  +  A+S EF+ +T +P+I++L  +    +LGGTLRLG Y C +   +   ++Y    + ERHRHRYEFN  Y  +F + G+V SG++ +N LVEIIEL +H FFIA QFHPEF S+   P+P+F   +  +
  S:     3 KFVFITGGVVSSIGKGIVAASLGRLLKSRNYTVSILKLDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFTDTNMSKLNNVTTGAIYQAVIYKERRGDYQGSTVQVIPHVTQEIKERIRRVARETNPDVVLVEVGGTVGDIESLPFLEAIRQFRKDVGRANVAYVHVTLVPLIK--AAGEMKTKPTQHSVKELRSIGIQPDVLVCRCEQPLPRSIKEKISEFCDVPVECVIQAQDAPSIYDVPLVLEQEGLAQRVLQILNLE-PQQPDLREWELLVQRLHHPQE-QVEIAIVGKYVRLTDAYLSVAEALRHAGLALNAGVTLRWISSEEVEERGPEALLADVDGVVVPGGFGSRGIEGKVATIRYVRERGIPFLGLCLGMQCAVIDWGCNIAGLERANSYEFDPDTPHPVISLLPEQKDVEHLGGTLRLGLYPCRILPDTLAAKLYGESIVYERHRHRYEFNNAYRSLFLESGYVISGVSPDNRLVEIIELPSHPFFIATQFHPEFRSRPNRPHPLFLGLIEAA 528
>gi|113476457|ref|YP_722518.1| CTP synthetase [Trichodesmium erythraeum IMS101] >gi|119391203|sp|Q110M9|PYRG_TRIEI CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|110167505|gb|ABG52045.1| CTP synthase [Trichodesmium erythraeum IMS101] (571 aa)
Score = 1189, Expect = 3.3e-128, Identities = 237/527 (44%), Positives = 340/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYR-SQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYKHWDTFTSLIKEPKKYKAR-------------IAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + +TGGV SS+GKG+  +SLG +LK  G  V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++    PD +I E+GGTVGDIES PFLEA RQ +   R +  ++IH   +  + +  ++KTKP QHSVK+L S GI P++L+ R    +S  LKEK+S    +  E++ +  + + IY +P  LE + +        KME   PN     HW T  + +    K   R             IA+VGKY    DAYLS++ +L  ++  +  DL++  +N+  +      + L + + I+VPGGFG R I+GKI  ++YAR N IPF G+CLGMQ A IE+ARN+ K+  A S EF+  T NP+I +L  +    +LGGT+RLG Y C L+  +   + Y+++ I ERHRHRYEFN  Y ++F++ G++ SG + +  LVEIIEL  H FFIA QFHPEF S+  +P+P+F++F   +
  S:     2 TKFVFITGGVVSSIGKGIVAASLGRLLKSRGYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTSMSRLNSVTQGSIYQAVINKERRGDYQGGTVQVIPHITNEIKERIHRVAKNANPDVVITEIGGTVGDIESQPFLEAIRQFRKDVRRNNALYIHVTLVPWIASAGEMKTKPTQHSVKELRSIGIQPDILVCRCDRKLSEGLKEKMSEFCDVPVESVITSQDAQSIYEVPLMLETEGLAVQALELLKMEQRQPN---LSHWKTLVNRLYHRDKQDIRTSQGKLSITATVEIAIVGKYIQLSDAYLSVVEALRHAAIAVGVDLNLHLVNAEDVETKGARTYLEKANGIIVPGGFGVRGIDGKIATVEYARINKIPFLGLCLGMQCAVIEWARNIAKLDAAHSFEFDPQTPNPVINLLPEQQDVVDLGGTMRLGLYPCRLQGDTLAFKTYQQEVIYERHRHRYEFNNAYRNLFKETGYIISGTSPDGRLVEIIELPAHPFFIATQFHPEFQSRPSTPHPLFHNFFQAA 542
>gi|57236939|ref|YP_178054.1| CTP synthetase [Campylobacter jejuni RM1221] >gi|86152384|ref|ZP_01070594.1| CTP synthase [Campylobacter jejuni subsp. jejuni 260.94] >gi|88597702|ref|ZP_01100935.1| CTP synthase [Campylobacter jejuni subsp. jejuni 84-25] >gi|121612860|ref|YP_999747.1| CTP synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|148926843|ref|ZP_01810522.1| CTP synthase [Campylobacter jejuni subsp. jejuni CG8486] >gi|167004723|ref|ZP_02270481.1| CTP synthetase [Campylobacter jejuni subsp. jejuni 81-176] >gi|81354267|sp|Q5HXD1|PYRG_CAMJR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|57165743|gb|AAW34522.1| CTP synthase [Campylobacter jejuni RM1221] >gi|85840681|gb|EAQ57933.1| CTP synthase [Campylobacter jejuni subsp. jejuni 260.94] >gi|87249042|gb|EAQ72004.1| CTP synthase [Campylobacter jejuni subsp. jejuni 81-176] >gi|88190006|gb|EAQ93982.1| CTP synthase [Campylobacter jejuni subsp. jejuni 84-25] >gi|145844568|gb|EDK21675.1| CTP synthase [Campylobacter jejuni subsp. jejuni CG8486] (543 aa)
Score = 1189, Expect = 3.5e-128, Identities = 252/528 (47%), Positives = 353/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIH--TVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKR-KSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+A +S+  +LK  G +V I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFL+ +L +++N T GRVY   I KER G++LG TIQV+PHI   I  +I         D LIVE+GGTVGDIE +PFLEA R L+ +  ++  M IH   VP I+     +LKTKP QHSV +L   GI P++++ RS+ A+   LK+KI+++ G+E   +   ++   IY +P +   Q + + I     ++   PN    ++WD+    +  P   + +IA VGKY D  ++Y S+  ++  +   L T + +++++S  L     SE+  +   ILV GGFG R +EGKI AIQYAREN IPF GICLGMQLA +EFARNVLK+ DA+S+EFNE   NP++ +++           +  +T LGGT+RLG Y C++K+ S + ++Y   KS+ ERHRHRYE NPKY   FEKHG + SG +K   L+E +EL  H FF+AVQFHPEFTS++   NP+  SF+  +
  S:     3 QTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKERRGEYLGKTIQVIPHIVGEIKDRIKKAGEG--KDILIVEIGGTVGDIEGLPFLEAIRALRLEVGKNNAMNIHLTLVPFIK--AAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLKDKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILSPIAEILDLKNLKPN---MENWDSLVKRVIAPSN-EVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESSEVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLKDANSSEFNEKCQNPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAKVYNEVKSVKERHRHRYEANPKYRADFEKHGLIVSGESK--GLIEAVELNCHPFFLAVQFHPEFTSRLEHVNPVICSFIKAA 537
>gi|78188073|ref|YP_378411.1| CTP synthetase [Chlorobium chlorochromatii CaD3] >gi|119391087|sp|Q3ANY4|PYRG_CHLCH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|78170272|gb|ABB27368.1| CTP synthase [Chlorobium chlorochromatii CaD3] (569 aa)
Score = 1188, Expect = 3.6e-128, Identities = 235/527 (44%), Positives = 341/527 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI---SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+ +  + SN+T GRVY   I KER+G +LGAT+QVVPH+ + I +++   +     D LI E+GGT+GDIES+PFLEA R+L+       ++ IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S  +K K+     + + ++  L +   IY +P  L  +++ + +     ++        +W  F + +K P++ +  I + GKY++ PDAY SI+ +   +       ++++ + + S  E       EL+   AILV  GFG R IEGKI  IQYARE NIPFFGICLGMQ A+IEFARNV  + DA+STEFN+     II ++E + +    GGT+RLG+Y C + DGSK    Y++  + ERHRHRYEFN  +  +FE+ G +FSG +    L+EI+E++NH++F+ VQFHPE  S++   +P+F+SF+  +K
  S:     8 KHIFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDESTSQTSNLTMGRVYKSVIDKERNGDYLGATVQVVPHVIDEIKERMAEQAKNSNLDILITEIGGTIGDIESLPFLEAMRELKLDMGDGNLINIHLTYVPYIKAASELKTKPTQHSVKMLLGVGIQPDILVCRSEKQLSRDIKNKVGHFCNLNDLDVIGLSDCATIYEVPLMLLQEELDSRVLKKLGIKGYQEPALTYWRDFCNKVKFPQEGEITIGICGKYTEYPDAYKSILEAFVHAGASNNVRVNVKLLRAESAEEPTFDFAKELAGIHAILVAPGFGDRGIEGKIRYIQYAREQNIPFFGICLGMQCATIEFARNVCDLQDANSTEFNKRARFAIIDLMEHQKKVKEKGGTMRLGSYPCIITDGSKAHMAYQKFLVNERHRHRYEFNNSFRTLFEERGMLFSGTSPNGELIEIVEIKNHRWFVGVQFHPELKSRVQKVHPLFHSFVAAAK 538
>gi|126697218|ref|YP_001092104.1| CTP synthetase [Prochlorococcus marinus str. MIT 9301] >gi|126544261|gb|ABO18503.1| Glutamine amidotransferase class-I:CTP synthase [Prochlorococcus marinus str. MIT 9301] (536 aa)
Score = 1188, Expect = 3.9e-128, Identities = 236/528 (44%), Positives = 340/528 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           +K + VTGGV SS+GKG+  +SLG +LK  G  V I+K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++     D +I E+GGTVGDIES+PFLEA R+ +    R+ V +IH   L  + T  ++KTKP QHSVK+L S GI P+LL+ RS  +++  LK+K+S   G+   ++   ++   IY +P SL+ + +     N+ ++E   +   K+W+     ++ P     ++A+VGKY +  DAYLS++ +L  +    K  L + ++++  + +N+  + L+E DAI+VPGGFG R + GKI AI++AREN IPF G+CLGMQ A IE+ARNV  + DA S+E + NT NP+I +L  +    +LGGT+RLG Y C L   +    +Y    I ERHRHRYEFN  Y   F   G+  SG + +  LVE+IELENH +F+A Q+HPEF S+   P+P+F   +  S+
  S:     2 SKFVFVTGGVVSSIGKGIVAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTAMTRLNSVTTGSIYQAVINKERRGSYNGGTVQVIPHITGEIRERIHRVAANSNADIIITEIGGTVGDIESLPFLEAIREFKNDVNRNDVAYIHVTLLPYIKTSGEIKTKPTQHSVKELRSIGIQPDLLVCRSDKSINEALKKKLSGFCGVSINSVIEALDADSIYSVPLSLKKEGLCKETLNYLELE-DKKCDLKNWEQLIHNLRNPGG-PIKVALVGKYIELGDAYLSVVEALRHACIEQKALLDLHWVSAEMIEKNSAETYLNEVDAIVVPGGFGNRGVNGKIAAIKFARENKIPFLGLCLGMQCAVIEWARNVAHLPDASSSELDPNTPNPVIHLLPEQQDVVDLGGTMRLGVYPCRLTKNTTGKNLYDEDVIYERHRHRYEFNNYYKQSFLDSGYKISGTSPDGRLVELIELENHPYFLACQYHPEFLSRPGKPHPLFKGLIKASQ 529
>gi|166364189|ref|YP_001656462.1| CTP synthetase [Microcystis aeruginosa NIES-843] >gi|166086562|dbj|BAG01270.1| CTP synthetase [Microcystis aeruginosa NIES-843] (546 aa)
Score = 1188, Expect = 3.9e-128, Identities = 231/529 (43%), Positives = 341/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSL-NENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +K + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  L + ++VT G +Y   + KER G ++G T+QV+PH+T  I ++I+ ++    PD +I E+GGTVGDIES+PFLEA RQ +    R+ V+++H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +   LKEK+S    +  E++ +  +   IY +P +LE + +         +  P     + W+     ++ P + K  IA+VGKY    DAYLS++ +L+ ++  L +++ + ++++  + N++  + LS  D I+VPGGFG R ++GKI AI+YAR NNIPF G+CLGMQ + IE+ RNV ++  A+S+EF E+T NP+I +L  +    +LGGT+RLG Y C L   S    +Y ++ I ERHRHRYEFN  Y  +F + G++ SG + +  LVEIIEL  H FFIA QFHPEF S+    +P+F  F+  + K
  S:     2 SKFVFVTGGVVSSIGKGIVAASLGRLLKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTDTELSRLNSVTTGSIYQAVLNKERRGAYMGGTVQVIPHVTNEIKERILRVAKDTNPDIVITEIGGTVGDIESLPFLEAIRQFRKDVGRNNVVYMHVTLIPWIPAAKEMKTKPTQHSVKELRSIGIQPDVLVCRCHLPLQPGLKEKLSAFCDVPVESVITAQDASSIYEVPLNLEKEGLAQQTLELLNLG-PRYPHLEEWENLIRQMQSPGQ-KLEIAIVGKYVQLGDAYLSVVEALKHAAIALNSEIELRWVSAEDVDNDSAEAHLSGVDGIVVPGGFGIRGVDGKIKAIEYARVNNIPFLGLCLGMQCSIIEWGRNVARLERANSSEFEEDTPNPVINLLPEQADVVDLGGTMRLGLYPCRLNPDSLAFSLYGQEVIYERHRHRYEFNNAYRSLFFETGYLVSGTSPDGRLVEIIELPKHPFFIATQFHPEFRSRPNKAHPLFSGFMKAALK 530
>gi|94676521|ref|YP_588677.1| CTP synthetase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] >gi|119391075|sp|Q1LTN7|PYRG_BAUCH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|94219671|gb|ABF13830.1| CTP synthase [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] (543 aa)
Score = 1188, Expect = 3.9e-128, Identities = 237/530 (44%), Positives = 344/530 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL-----EGKNRE-TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           KT  + VTGGV SSLGKG+A +SL A+L+  G +V IMK DPY+NVD GT++P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y++ + KER G +LGATIQV+PHIT  I Q+II     +  D ++VE+GGTVGDIES+PFLEA RQ+  +  R   +++H   +  +    ++KTKP QHSVK+L+S GI P++L+ RS  AV +  + KI+L   +  + + SL ++  IY +P  L++Q + + I   F ++ P +     W+        P   +  + +VGKY D PDAY S+I +L  +    +  ++I  I+S  +   ++  L + DAIL+PGGFG R +EGKI+  QYARE  IP+ GICLGMQ+A +EFAR+V  M +A+STEF  +   P++ ++     E  NR+ +NLGGT+RLG+  C+L  GS   +IY +  I+ERHRHRYE N   +   E  G   +G++++  LVE+IE   H +FIA QFHPEF S     +P+F  F+  + +
  S:     2 KTNYIFVTGGVVSSLGKGIAVASLAAILEARGLKVTIMKLDPYINVDPGTISPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYFDVLHKERRGDYLGATIQVIPHITNTIKQRIIECGEGH--DVVLVEIGGTVGDIESLPFLEAIRQMAGEVGRDHTLYMHLTLVPYIKAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAVPSNERAKIALFCNVSEKAVISLKDVDSIYKIPALLKSQYLDDYICERFSLKCP-KANLSEWEQVIYQQANPVG-EVTVGIVGKYIDLPDAYKSVIEALHHAGLKNRIAVNICLIHSQDVETRSVKILQDLDAILIPGGFGYRGVEGKIMTAQYAREKQIPYLGICLGMQVAIVEFARHVAGMPEANSTEFVSDCKYPVVALITEWYEENNNRKLSNLGGTMRLGSQPCKLTYGSLAYQIYGKTIIMERHRHRYEVNNMLLKQIEAAGLRVAGLSEDYKLVEMIEYPAHPWFIASQFHPEFNSTPRDGHPLFTGFIKAASE 534
>gi|148244764|ref|YP_001219458.1| CTP synthetase [Candidatus Vesicomyosocius okutanii HA] >gi|146326591|dbj|BAF61734.1| CTP synthase [Candidatus Vesicomyosocius okutanii HA] (545 aa)
Score = 1188, Expect = 4.1e-128, Identities = 244/529 (46%), Positives = 350/529 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + +TGGV SSLGKG+  +SL ++L+  G  + ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF  I L KE+N TAGRVY   I +ER GK+LG T+QV+PHIT  I +++  +  K   D  +VE+GGT GDIES+PF+EA RQ+  +  R  V+FIH   L  +    +LKTKP QHSVK+L S GI P++L+ RS+  +S+  + KI+L T +  +++++ +++  IY +P +L  Q + N +     ++  P  +    WD     ++ PK     IA+VGKY D  ++Y S+  +L  +S + +T ++I + +S  + EN    LSE  AILVPGGFG R +EGKI  +++ARENN+P+ GICLGMQ+A IE+ARN+  M +A+STEFN+ TA P+I ++             N+++ LGGT+RLG   C L +G+   EIY +  I ERHRHRYE N   +   E  G + SG +    LVE+IE+++H +F+A QFHPEFTS     +P+F SF+  S K
  S:     3 TKYIFITGGVVSSLGKGIVSASLASILESRGLNITMLKLDPYINVDPGTMSPFQHGEVFVTNDGAETDLDLGHYERFTRIQLGKENNFTAGRVYENVIERERLGKYLGDTVQVIPHITNEI-KRLTQIGAK-GADVTLVEIGGTAGDIESLPFMEAIRQMSLELGRDNVLFIHLTLLPYIKVVGELKTKPTQHSVKELRSIGIQPDILICRSEYPMSDIERAKIALFTNVSQDSVFTSLDVDTIYKVPRALHEQGLDNVVVKKLALDCKPTDLC--EWDNVIKRLQHPKS-SVDIAMVGKYIDLTESYKSLSEALIHASIHTQTKVNIHYFDSEEIEENGTDCLSEMSAILVPGGFGNRGVEGKIATVKFARENNVPYLGICLGMQVAVIEYARNMANMINANSTEFNKKTAYPVIHLITNWKDVDGYKHSLNKDSYLGGTMRLGGQKCVLVEGTNSQEIYSKLVITERHRHRYEVNNLLIKQLEVSGLIVSGRSINGTLVEMIEIKDHPWFVACQFHPEFTSNPRDGHPLFESFIKASNK 538
>gi|196192268|gb|EDX87232.1| CTP synthase [Synechococcus sp. PCC 7335] (547 aa)
Score = 1188, Expect = 4.3e-128, Identities = 227/529 (42%), Positives = 342/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I KER G + G T+QV+PH+T  I  +I  ++    PD +IVE+GGTVGDIES+PF+EA RQ +       V+++H   +  +    +LKTKP QHSVK+L S GI P++L+ RS+  +  +L++KIS    +    +   ++ + IY +P  +E + +     +F ++          W T    +  P K    +A+VGKY    DAYLS+I +L  +  + +T++ I +++S  + ++   + L E  AI+VPGGFG R ++GKI  IQYAREN IPF G+CLGMQ   +E+A+N+ K+  A+S+EF+E TANP+I+++  +    +LGGT+RLG + C ++  +   ++Y ++ I ERHRHRYEFN  Y ++F + GF+ SG + +  LVEI+EL +H +FIA QFHPEF S+  +P+P+F   +  + K
  S:     2 TKFVFVTGGVVSSIGKGIVAASLGRLLKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTSMSRLNSVTTGAIYQSVINKERRGDYEGGTVQVIPHVTNEIKSRIHRVARNRNPDVVIVEIGGTVGDIESLPFMEAIRQFKQDVGPHDVLYMHVTLIPWIPAAHELKTKPTQHSVKELRSIGIQPDILVCRSERPLREELRQKISSFCNVPLPCVIQALDARSIYEVPLYMEKEGLAEQTLDFLQLS-QRSPDLTKWTTLVQRMHRPSK-SIEVAIVGKYIQLNDAYLSVIEALTHAGTHFETEVKIRWVDSEDIEQHGPQKHLKEVAAIIVPGGFGSRGVDGKIQTIQYARENRIPFLGLCLGMQCLVMEWAQNIAKLEQANSSEFDEQTANPVISLMPEQEDVVDLGGTMRLGLWPCRIEPNTLASKLYNKEVIYERHRHRYEFNNAYRNLFLETGFMVSGTSPDGRLVEIVELPSHPYFIACQFHPEFQSRPSTPHPMFLGLVEAALK 530
>gi|196235610|ref|ZP_03134412.1| CTP synthase [Thermus aquaticus Y51MC23] >gi|196220354|gb|EDY14971.1| CTP synthase [Thermus aquaticus Y51MC23] (536 aa)
Score = 1187, Expect = 4.8e-128, Identities = 232/524 (44%), Positives = 343/524 (65%)
  Q:     8 LIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGIN-----KENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           + VTGGV SSLGKG+  SSLGA+L+  G  V  +K DPY+NVDAGTM P +HGEVFVT DG ETDLDIG+YERFL+++L + +N+T G+VY   I KER G++L  T+QV+PHIT+ I  +I  ++   + +  +VEVGGTVGDIES+PFLEA RQ +  +      ++H   +  L T  + KTKP QHSV  L   GI P+ +++RS   V  ++++K++L T +   +++S  N++H+Y +P  LE Q +   +     +E P       W     ++K P++   RIA+ GKY   PDAYLS++ +L+ +    +  + ++++++ SL   ++ E  ++   ILVPGGFG R IEGK+ A QYARE  IP+ GICLG+Q+A IEFARNV  +  A+STEF+  T +P+I ++  +     LGGT+RLG++   ++ G+ +  +Y R+ ++ERHRHRYE NP Y+D  E+ G V S I      +   LVE IEL++H FF+A+Q HPEF S+ + P+P F  F+  +
  S:     1 MFVTGGVVSSLGKGILTSSLGALLRARGYRVTAIKIDPYVNVDAGTMRPYEHGEVFVTADGAETDLDIGHYERFLDMDLSRGNNLTTGQVYLSVIQKERRGEYLSQTVQVIPHITDEIKDRIRKVAEDQRAEIAVVEVGGTVGDIESLPFLEAIRQFRFDEGEDNTFYLHLTLVPYLETSEEFKTKPTQHSVATLRGVGIQPDAIVLRSAKPVPEEVRKKVALFTNVRPGHVFSSPNVEHLYEVPLLLEEQGLGRVVERALGLE-PVFPNLAFWQEAARVLKNPER-TVRIAIAGKYVKMPDAYLSLLEALKHAGIKNRARVEVKWVDAESLEAADLDEAFADVAGILVPGGFGVRGIEGKVRAAQYARERKIPYLGICLGLQIAVIEFARNVAGLKGANSTEFDPYTPHPVIDLMPEQLEVEGLGGTMRLGDWPMRIRPGTLLHRLYGREEVLERHRHRYEVNPLYVDELERAGLVISAITPGMKGRGAGLVEAIELQDHPFFLALQSHPEFKSRPMRPSPPFAGFVEAA 529
>gi|114562229|ref|YP_749742.1| CTP synthetase [Shewanella frigidimarina NCIMB 400] >gi|119391173|sp|Q086B1|PYRG_SHEFN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|114333522|gb|ABI70904.1| CTP synthase [Shewanella frigidimarina NCIMB 400] (545 aa)
Score = 1187, Expect = 5.1e-128, Identities = 248/527 (47%), Positives = 343/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E I+KER G +LGATIQV+PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL ++  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    K KISL   +E   + SL ++  IY +P  L +Q + + +   F +   N      W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++I+S ++       L   D ILVPGGFG+R +EGKI A ++ARENN+P+FGICLGMQ+A IEFAR+V  +  A STEFN  T  P++ ++          E ++  ++LGGT+RLG   C LK+G+K    Y   + VERHRHRYE N  Y+D  EK G VFSG++ +  L+E+IEL NH +F+A QFHPEFTS     + +F  F+  S
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVISKERRGDYLGATIQVIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGSELGRERTLFMHLTLVPFLGAAGEIKTKPTQHSVKELRSIGIAPDVLVCRGDRAIPANEKAKISLFCNVEERAVISLKDVDSIYKIPALLRSQGLDDLVIKRFNLTC-NEADLSEWENVIYQEANPNG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRVTVNIKYIDSQTVEAKGEEVLQGLDGILVPGGFGERGVEGKIFAAKFARENNLPYFGICLGMQVALIEFARHVAGLEGAHSTEFNPQTPYPVVGLITEWINEEGDVETRHESSDLGGTMRLGAQLCHLKEGTKAAVAYDSATCVERHRHRYEVNNNYIDRLEKAGLVFSGLSSDRKLIEMIELPNHPWFVASQFHPEFTSTPRDGHALFEGFIAAS 536
>gi|149372150|ref|ZP_01891420.1| CTP synthetase [unidentified eubacterium SCB49] >gi|149354917|gb|EDM43479.1| CTP synthetase [unidentified eubacterium SCB49] (536 aa)
Score = 1186, Expect = 7.1e-128, Identities = 234/527 (44%), Positives = 346/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRI--GYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SL  +L+  G  V I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN    + +NVT GR+Y   I KER G+FLG T+QVVPHIT  I ++I +L      D +I E+GGTVGDIES+P++E+ RQL+ +      + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S  LK K++L   ++ E +   I+   IY +P  +  + +   +    K+++ N +    K W+ F    K PK  +  I +VGKY +  D+Y SI+ +   +    +  +++  I+S  +N  NISE L   +A+LV  GFG+R IEGKI A++YARENN+PF GICLGMQ+A IE++RNVL + DA+S E + +T+NP+I ++E +   T +GGT+RLG++ C+L   SK+ ++Y   +I ERHRHRYE+N KY +  E+ G   +G+N +  LVEI+E+  H FF+ VQ+HPE+ S +++P+P+F +F+  +
  S:     4 TKYIFVTGGVSSSLGKGIIAASLAKLLQARGYRVTIQKLDPYINVDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNTPTSQANNVTTGRIYQSVIEKERRGEFLGKTVQVVPHITNEIKERIQILGKSGDYDIVITEIGGTVGDIESLPYIESVRQLKWELGDDNALVIHLTLIPYLSAAGELKTKPTQHSVKTLMESGIKADILVCRTEHELSQDLKNKLALFCNVQKEAVIQSIDASTIYDVPNLMLEEGL--DVVTLHKLKLLNTVEPNLKEWNEFLDRHKNPKA-EVTIGLVGKYVELQDSYKSILEAFTHAGAENEMKVNVRSIHSEHINAANISEELKGLNALLVAPGFGERGIEGKIEAVRYARENNLPFLGICLGMQMAVIEYSRNVLGLKDANSIEMDPDTSNPVINLMEDQKNITEMGGTMRLGSWKCDLIKDSKVYDVYGSGTIDERHRHRYEYNNKYKEALEEAGLATTGVNPKTGLVEIVEIPTHPFFVGVQYHPEYKSTVVNPHPLFVAFVKAA 531
>gi|15618160|ref|NP_224445.1| CTP synthetase [Chlamydophila pneumoniae CWL029] >gi|33241577|ref|NP_876518.1| CTP synthetase [Chlamydophila pneumoniae TW-183] >gi|4376510|gb|AAD18389.1| CTP Synthetase [Chlamydophila pneumoniae CWL029] >gi|33236085|gb|AAP98175.1| CTP synthetase [Chlamydophila pneumoniae TW-183] (537 aa)
Score = 1186, Expect = 7.3e-128, Identities = 236/526 (44%), Positives = 337/526 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKH-IYLLPESLENQKVQNSIFNFFKM-EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + +TGGV SSLGKG+  +SL  +L+     V ++K DPYLNVD GTM P +HGE++VT DG ETDLD+G+Y RF +  L + S+ T+G++Y   I +ER+G +LG+T+QV+PHIT  I Q I+  + ++ PD LIVE+GGT+GDIES+PFLEA RQ +  +    + IH   +  L    ++K+KP QHSV+ L   GI P+ +L RS+  ++ ++K KISL   + N  ++++I++KH IY +P  L  +K+ N I    K+  VP  +    W    + + +    K +I VVGKY    DAY SI  +L  ++  L+   + E I   + +EN   ELS+ DA LVPGGFG R  EGKI A ++ RE  IP+FGICLGMQ+  +E+ARNVL +  A+S E + NT +PI+ ++EG++     GGT+RLG Y C LK GSK  + Y   S++ ERHRHRYE NP Y+   E HG    G      L EIIE+ +H + I VQFHPEF SK++SP+P+F +F+  +
  S:     4 KCIFLTGGVVSSLGKGLTAASLALILERQRLNVAMLKLDPYLNVDPGTMNPFEHGEIYVTDDGVETDLDLGHYHRFSSAALSRHSSATSGQIYARVIKREREGDYLGSTVQVIPHITNEIIQVILDAAKEHSPDVLIVEIGGTIGDIESLPFLEAIRQFRYDHSEDCLNIHMTYVPYLQAADEVKSKPTQHSVQTLRGIGIIPDAILCRSEKPLTQEVKSKISLFCNVPNRAVFNVIDVKHTIYEMPLMLAQEKIANFIGEKLKLATVPENL--DDWKVLVNQLSQDLP-KVKIGVVGKYVQHRDAYKSIFEALTHAA--LRLGHAAEIIPIDAEDENLTMELSQCDACLVPGGFGVRGWEGKIAAAKFCREQGIPYFGICLGMQVLVVEYARNVLNLDQANSLEMDPNTPHPIVYVMEGQDPLVATGGTMRLGAYPCLLKPGSKAHKAYNESSLIQERHRHRYEVNPDYIQSLEDHGLRIVGTCPPQGLCEIIEVSDHPWMIGVQFHPEFVSKLISPHPLFIAFIEAA 527
>gi|177664776|ref|ZP_02940577.1| CTP synthase [Cyanothece sp. PCC 8801] >gi|172075887|gb|EDT61300.1| CTP synthase [Cyanothece sp. PCC 8801] (547 aa)
Score = 1186, Expect = 7.4e-128, Identities = 228/527 (43%), Positives = 334/527 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I KER G ++G T+QV+PHIT  I ++I  ++    PD +I E+GGTVGDIES+PFLEA RQ +    R+ V+++H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +   +KEK+S    +  E++ +  +   IY +P  +E + +         +E P +     W T    ++ P++ +  IA+VGKY    DAYLS++ SL      + +++ + ++N+  + +    + L +   ILVPGGFG R ++GK+ AIQYAR+  IPF G+CLGMQ A IE+ARN+ ++  ++S EF+  T NP+I +L  +    +LGGT+RLG Y C L   +    +Y ++ I ERHRHRYEFN  Y  +  + G+V SG + +  LVEIIEL  H FFIA QFHPEF S+  SP+P+F  F+  +
  S:     2 TKFVFVTGGVVSSIGKGIVAASLGRLLKSRNYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTSMSRLNSVTTGSIYQAVINKERRGAYMGGTVQVIPHITNEIKERIHRVAKNTNPDVVITEIGGTVGDIESLPFLEAIRQFRKDVGRNNVVYMHVTLIPWIPAAREMKTKPTQHSVKELRSIGIQPDVLVCRCDRPLKEGMKEKLSEFCDVPVESVITAQDASSIYEVPLIVEREGLAQQTLALLNLE-PRQPNLTDWQTLVQRMQTPQR-QIEIALVGKYVQLSDAYLSVVESLVHGGIAVNSEVKLNWVNAEDIEQYGAEKFLKDVSGILVPGGFGIRGVDGKVQAIQYARQQKIPFLGLCLGMQCAVIEWARNIARLERSNSAEFDPETPNPVINLLPEQEDVVDLGGTMRLGLYACRLSPDTLASSLYPQEVIYERHRHRYEFNNAYRSLLIETGYVVSGTSPDGRLVEIIELPGHPFFIATQFHPEFQSRPNSPHPLFLGFVKAA 528
>gi|189345661|ref|YP_001942190.1| CTP synthase [Chlorobium limicola DSM 245] >gi|189339808|gb|ACD89211.1| CTP synthase [Chlorobium limicola DSM 245] (569 aa)
Score = 1186, Expect = 7.5e-128, Identities = 239/528 (45%), Positives = 339/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSI---FNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI---SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+ +  + SN+T GRVY   I KER G++LG T+QVVPH+ + I  ++  L+     D LI E+GGT+GDIES+PFLEA RQ++ +     ++ IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     + + ++  L +   IY +P  L  +K+   +       K + PN I   +W  F   +  P+  +  I + GKY++ PDAY SII S   +       ++I  + +            EL     ILV  GFG R IEGKI  I+YARE NIPFFGICLGMQ A+IEFARNV  + +A+STEFN+ T  P+I ++E + +    GGT+RLG+Y C L++GS+   +Y++  I ERHRHRYEFN  +   FE++G +FSG +    LVEI+EL NH++F+ VQFHPE  S++   +P+F+ F+  +K+
  S:     8 KHIFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDESTSQSSNLTMGRVYKSVIDKERRGEYLGGTVQVVPHVIDEIKDRMAELAKNGNLDVLITEIGGTIGDIESLPFLEAMRQMKLEMGERNLLNIHLTFVPYIKAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVGHFCNVNDLDVIGLNDCDTIYEVPLMLLKEKLDLRVMKKLGLKKFKEPNLI---YWREFCDKVNHPRDGEITIGICGKYTEYPDAYKSIIESFVHAGASNNVRVNIRLLKAEDAEGKTFDFAKELEGVSGILVAPGFGDRGIEGKIQYIRYAREQNIPFFGICLGMQCATIEFARNVCNLQEANSTEFNKRTRYPVIDLMEHQKKVKEKGGTMRLGSYPCILREGSRAYAVYQKFLINERHRHRYEFNNTFRKPFEENGMIFSGTSPNGELVEIVELANHRWFVGVQFHPELKSRVQKVHPLFHGFVEAAKE 539
>gi|154505840|ref|ZP_02042578.1| hypothetical protein RUMGNA_03381 [Ruminococcus gnavus ATCC 29149] >gi|153793858|gb|EDN76278.1| hypothetical protein RUMGNA_03381 [Ruminococcus gnavus ATCC 29149] (535 aa)
Score = 1186, Expect = 7.7e-128, Identities = 229/526 (43%), Positives = 336/526 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV S LGKG+  +SLG +LK  G  V + KFDPY+N+D GTM P QHGEVFVT DG ETDLD+G+YERF++ +L K SNVT G++Y+  + KER G F G T+QV+PHIT  I  +     +    +  I+EVGGTVGDIES PFLE+ RQ Q  K R  V+ IH   +  L    ++KTKP Q SVK+L   GI P++++ RS+  + N +K+KISL   +  +++   +++ ++Y  P ++E + +   +     ++ P +     W+T    ++ P   K RIA+VGKY    DAY+S++ +L+    Y  T + I+++++ ++      E+  +   ILVPGGFG R +EGKI AI+YAR + IPF GICLGMQLA +EFARNV+  HDA S E N +T +P+I I++ +    ++GGTLRLG Y C L   SK  E+Y+++ I ERHRHRYE N  Y ++  ++G    G++ +  +VE+ E+++H +FIA Q HPE  S+   P+P+F  F+  +
  S:     4 KYVFVTGGVVSGLGKGITAASLGRLLKARGYTVTMQKFDPYINIDPGTMNPVQHGEVFVTDDGAETDLDLGHYERFIDESLTKNSNVTTGKIYWSVLQKERRGDFGGGTVQVIPHITNEIKSRFYRNPSAENTEIAIIEVGGTVGDIESQPFLESIRQFQHEKGRDNVILIHVTLIPYLRASQEMKTKPTQASVKELQGMGIQPDIIVCRSEHPLDNGIKDKISLFCNLPADHVLQNLDVDYLYEAPLAMEKENLAQVVCECLHLDCP-KPDLSDWETMVDNLRHPVS-KVRIALVGKYVQLHDAYISVVEALKHGGIYSHTTVEIKWVDAETVTPETADEIFKDVTGILVPGGFGHRGVEGKIEAIRYARTHKIPFLGICLGMQLAIVEFARNVIGFHDAHSLELNPSTTHPVIHIMQDQIGIEDIGGTLRLGAYPCILDKTSKAYEVYQKEEIQERHRHRYEVNNDYREVLTENGMNLCGLSPDGKIVEMAEIKDHPWFIATQAHPELKSRPNKPHPLFKGFVEAA 529
>gi|88858175|ref|ZP_01132817.1| CTP synthetase [Pseudoalteromonas tunicata D2] >gi|88819792|gb|EAR29605.1| CTP synthetase [Pseudoalteromonas tunicata D2] (544 aa)
Score = 1186, Expect = 7.9e-128, Identities = 242/528 (45%), Positives = 351/528 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           TK + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K++N T GRV+ + + +ER G+FLGATIQV+PHIT  I +++  L      D  IVE+GGTVGDIES PFLEA RQL  +  R   +++H   +  L    +LKTKP QHSVK+L S GI P++L+ RS  A+    + KI+L T +E + + SL ++  IY +P  L+ Q + + +   F ++ P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++++S  +    +  LS  DAILVPGGFG R +EGKILA +YAREN +P+ GICLGMQ+A IE+ARNV  +  A+STEF+  + +P++ ++          E ++  ++LGGT+RLG+  C L +GSK+ ++Y    IVERHRHRYE N  Y++  E+ G  F+G++++  LVEIIE ++H +FIA QFHPEFTS     +P+F  F+  ++
  S:     3 TKFIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMLKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMTKKNNFTQGRVFEDVLRRERRGEFLGATIQVIPHITNDIKRRV--LEGAEGCDIAIVEIGGTVGDIESQPFLEAIRQLGTELGREAALYMHLTLVPHLGAAGELKTKPTQHSVKELRSIGIQPDILICRSDRAIPANERAKIALFTNVEEKAVISLKDVSSIYQIPSILKTQGLDDLVCRRFYLDCP-EADLAEWEQVLYQESNPTG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRVTVNIQYVDSQDVESKGVEILSGLDAILVPGGFGHRGVEGKILAAKYARENKVPYLGICLGMQVALIEYARNVAGLAGANSTEFDPASPHPVVGLITEWLDAEGNVELRDEASDLGGTMRLGSQLCHLTEGSKVHQVYGSAEIVERHRHRYEVNNNYVERLEQAGLAFTGLSEDKKLVEIIENKDHPWFIAAQFHPEFTSTPRDGHPLFEGFVAAAR 537
>gi|167766836|ref|ZP_02438889.1| hypothetical protein CLOSS21_01344 [Clostridium sp. SS2/1] >gi|167711590|gb|EDS22169.1| hypothetical protein CLOSS21_01344 [Clostridium sp. SS2/1] (535 aa)
Score = 1185, Expect = 8.0e-128, Identities = 233/526 (44%), Positives = 330/526 (62%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV S LGKG+  +SLG +LK  G  V   KFDPY+N+D GTM P QHGEVFVT DG ETDLD+G+YERF++  L K+SNVT G+VY+  ++KER G + G T+QV+PH+T  I  +     +    +  I+E+GGTVGDIES PFLEA RQ Q +      + IH   +  L +  +LKTKP Q SVKDL   GI P++L+ RS   + + +K KI+    +E   +   ++ + +Y +P  +E + + + +     M  P+      W       K P+ +K  IA+VGKY    DAY+S++ SLE +      D+ I +++S  ++  N+ E L     ILVPGGFG R IEG I AI+YAREN IP+ G+CLGMQL  +EF R+VL   DA S EFN +T +P++ I+  ++  T+LGGTLRLG+Y C L +GSK  E+Y  K I ERHRHRYE N +Y DI +++G + SG + +  +VE++E+  H +F+A Q HPEF S+    +P+F  F+  +
  S:     4 KYVFVTGGVVSGLGKGITAASLGRLLKARGYHVTSQKFDPYINIDPGTMNPIQHGEVFVTDDGAETDLDLGHYERFIDEGLNKKSNVTTGKVYWSILSKERRGDYGGNTVQVIPHVTNEIKSRFYRSEDPSDQEVAIIEIGGTVGDIESQPFLEALRQFQHEVGHENCILIHVTLIPYLKSSGELKTKPTQASVKDLQGMGIQPDILVCRSDYPLDDGIKRKIAQFCNVERSRVIQNLDAEVLYEVPLMMEKEHLAHEVCECLNMPCPDP-DLDDWKKMIDAWKHPE-HKVEIALVGKYVSLHDAYISVVESLEHAGVANSADVKIRWVDSERISSYNVDEMLGGVHGILVPGGFGDRGIEGMICAIKYARENKIPYLGLCLGMQLTLVEFGRHVLGFSDAHSQEFNPDTTHPMVHIMPDQDGVTDLGGTLRLGSYPCVLTEGSKAYELYGEKEIHERHRHRYEVNNEYRDILQENGMMLSGCSPDGRIVEMVEIPEHPWFVATQAHPEFKSRPNKAHPLFKGFVEAA 529
>gi|151571442|gb|EDN37096.1| CTP synthase [Francisella tularensis subsp. novicida GA99-3548] (546 aa)
Score = 1185, Expect = 8.5e-128, Identities = 242/531 (45%), Positives = 343/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +N  TKI+ VTGGV SSLGKGV  +SL  +L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T G+VY   + +ER G +LGATIQV+PHIT+ I ++I         D  IVE+GGTVGDIES PFLEA RQL+ +  R++ +F+H   L  +    ++KTKP QHSVK+L   GI  ++L+ R +    +  K KI+L T ++ ++I++  ++  IY +P     Q     +     +          W    + I++ K  +  IA+VGKY    +AY S+  +L  + +     + I+F++S  +NENN+ S   +  AILVPGGFG R +EGKI++I+YAREN IPF GICLGMQLA IE+ARN+L + DA S+E    TANP+I ++            +   ++LGGT+RLG Y C LK GS+  EIY+   +VERHRHRYE N  Y++  E+ G +FSG +++N L+E+IE+  HK+FIA Q HPEFTS     + +F S++  +
  S:     1 MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQANNFTTGKVYQSVLRRERKGDYLGATIQVIPHITDEIKRRIC-SGIADDVDVAIVEIGGTVGDIESQPFLEAIRQLRIELGRNRTLFVHLTLLPYIKVAGEIKTKPTQHSVKELRGIGIQADVLVCRCEKKFDDSEKRKIALFTNVDQDSIFTAEDVDTIYEVPLKYNQQGFDAKLVELLNLNA-KEADLSEWQNVVNTIRDVKG-EVTIAMVGKYVSLTEAYKSLNEALYNAGYKKGVKVKIKFVDSEDVNENNVESYFKDVAAILVPGGFGSRGVEGKIISIKYARENQIPFLGICLGMQLAVIEYARNILGIKDAHSSELEPTTANPVIGLITEWQAEDGTVHQRTHSSDLGGTMRLGGYKCVLKQGSRAREIYQADEVVERHRHRYEVNSNYVERLEEAGLIFSGRSEDNKLMELIEIPQHKWFIACQAHPEFTSTPRYGHKLFESYIQAA 540
>gi|186901293|ref|ZP_02974246.1| CTP synthase [Cyanothece sp. PCC 7424] >gi|186691778|gb|EDU16401.1| CTP synthase [Cyanothece sp. PCC 7424] (558 aa)
Score = 1185, Expect = 8.5e-128, Identities = 229/527 (43%), Positives = 337/527 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE--LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG + K     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G ++G T+QV+PHIT  I ++I  ++    PD +I+E+GGTVGDIES+PFLEA RQ + +  R+ V+++H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +   LKEK+S    +   ++    +   IY +P +LE + +         +E P +     W T    ++ P K +  +A+VGKY    DAYLS++ +L  ++    + + I ++++  L EN+ +E  L     I+VPGGFG R ++GK+ AI+YAR +NIPF G+C+GMQ + IE+ARN+  +  A+S EF+  + NP+I +L  +    +LGGT+RLG Y C L   ++   +YK++ + ERHRHRYEFN  Y  +F + G+V SG + +  LVEIIEL  H FFIA QFHPEF S+  +P+P+F  F+  S
  S:     2 TKFVFVTGGVVSSIGKGIVAASLGRLFKSRDYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTDTPMSRLNSVTTGSIYQAVINKERRGDYMGGTVQVIPHITNEIKERIHRVAKNTNPDIVIIEIGGTVGDIESLPFLEAIRQFRKEVGRNNVVYMHVTLIPWIPAAGEMKTKPTQHSVKELRSIGIQPDVLVCRCDRPLQPGLKEKLSAFCDVPVASVIMSQDASTIYQVPLNLEEEGLAQQTLELLNLE-PRQPDLSQWRTLVQQMQSPSK-QIEVALVGKYVQLSDAYLSVVEALGHAAIATNSVVKIRWVSAEDL-ENDSAEQHLEGVSGIVVPGGFGVRGVDGKVRAIEYARHHNIPFLGLCMGMQCSVIEWARNIAHLEKANSAEFDRESPNPVINLLPEQQDVVDLGGTMRLGLYPCRLTPDTQTFALYKQEVVYERHRHRYEFNNAYRSLFLETGYVISGTSPDGRLVEIIELPGHPFFIATQFHPEFRSRPSTPHPLFLGFVKAS 528
>gi|162455521|ref|YP_001617888.1| CTP synthetase [Sorangium cellulosum 'So ce 56'] >gi|161166103|emb|CAN97408.1| CTP synthase [Sorangium cellulosum 'So ce 56'] (561 aa)
Score = 1185, Expect = 9.0e-128, Identities = 237/528 (44%), Positives = 333/528 (63%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           ++ +TK + VTGGV SS+GKG+A +S+GA+++  G +V  +K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF    + +++N T GRVY   I+KER G++LGAT+QV+PH+T+ I  K+ + S     D  IVEVGGTVGDIES+PF+EA RQL+ +  +Q  + +H   +  + T  +LKTKP QHSVK++   GI P++LL R    +   +KEKISL + +  + + + +++  IY LP  L  + +   I     +    +     W       K+P +   +I VVGKY    D+Y S+  +L     +    + +E+I+S  +     +EL S  DAILVPGGFG R  EGKI AI+YARE  IPFFGICLGMQLA +E+AR+V  M  A+S EF+ N A+P+I ++  +      GGT+RLG Y C L  GS   E Y + SI ERHRHRYE + KY +   + G V SG + +  LVE+IEL  H +F+  QFHPEF S+    +P+F  F+
  S:     1 MSKRTKFVFVTGGVVSSIGKGLAAASIGALMESRGLKVTHLKLDPYINVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFTLARMSRQNNFTTGRVYEAVISKERRGEYLGATVQVIPHVTDEI--KLRIRSAADGADVAIVEVGGTVGDIESLPFIEAIRQLKVESGAQNAISVHVTLVPFIATAGELKTKPTQHSVKEMREIGIQPDILLCRCDRPLPRSMKEKISLFSNVAVDCVIAAVDVDCIYELPLVLHAEGIDEKITELLNIWA-RQPDLSPWQRIVERFKKPSRGIVKIGVVGKYVHLRDSYKSLHEALVHGGLHNDVRVELEYIDSEQIEARGAAELLSNLDAILVPGGFGDRGTEGKIEAIRYAREEKIPFFGICLGMQLAVVEYARHVCGMTGANSVEFDRNAADPVIDLMPDQKGVVEKGGTMRLGAYPCVLDKGSIAAEAYGQTSISERHRHRYEVSNKYREAMVQKGLVLSGTSPDQRLVEMIELREHPYFVGCQFHPEFKSRPHGAHPLFARFV 527
>gi|148265018|ref|YP_001231724.1| CTP synthetase [Geobacter uraniireducens Rf4] >gi|146398518|gb|ABQ27151.1| CTP synthase [Geobacter uraniireducens Rf4] (534 aa)
Score = 1185, Expect = 9.1e-128, Identities = 246/525 (46%), Positives = 342/525 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQA-KYRSQVMFIHT--VPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           KTK + VTGGV SS+GKG+A +SLGA+L+  G  V   K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L K+SN T G+VY+  I KER G +LG T+QV+PHIT+ I  KI  L N    D  I+E+GGTVGDIES+PFLEA RQ +A +    V+++H   VP I+  T  +LKTKP QHSVK+L   GI P++LL R +  +  ++K KI+L   +E + + + ++ +HIY +P +L  + +   +     +  + P+      W      +  P   K RIA+VGKY +  ++Y S+  +L          + + +++S  + +  I  L +  D ILVPGGFG+R  EGKI AI+YAR   IPFFGICLGMQ+A +E+ARNV  + DA S+EF ++ ANPII ++E +   +  GGT+RLG Y C L  GS   + Y    I ERHRHRYEFN  Y D+   +G + SGI KE +LVEI+E+ +H +F+  QFHPEF SK L+P+P+F +F+
  S:     2 KTKFIFVTGGVVSSIGKGLAAASLGALLEARGLRVTHQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSARLSKKSNFTTGQVYFSVIEKERRGDYLGGTVQVIPHITDEIKSKI--LDNAKGSDIAIIEIGGTVGDIESLPFLEAIRQFKADRGAGNVLYLHVTLVPFIK--TADELKTKPTQHSVKELREIGIQPDILLCRCEQDLPREMKAKIALFCNVEEKAVITSMDAEHIYAVPLALHKEGLDEQVVEKLNIWAKAPD---LTPWQQVVDKLMHPGHGKVRIAIVGKYVNLTESYKSLAEALTHGGIANDCRVHLSYLDSEKIEQEGIDGLLDGVDGILVPGGFGERGTEGKIKAIEYARTRKIPFFGICLGMQMAVVEYARNVCHLDDAFSSEFKQDCANPIIHLMEEQKGVSRKGGTMRLGAYPCTLAKGSFAQKAYGTLDISERHRHRYEFNNDYRDLLVSNGLILSGIYKEGDLVEIVEIPDHPWFVGCQFHPEFKSKPLNPHPLFRAFI 525
>gi|62261332|gb|AAX77981.1| unknown protein [synthetic construct] (581 aa)
Score = 1185, Expect = 9.2e-128, Identities = 242/531 (45%), Positives = 342/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +N  TKI+ VTGGV SSLGKGV  +SL  +L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T G+VY   + +ER G +LGATIQV+PHIT+ I ++I         D  IVE+GGTVGDIES PFLEA RQL+ +  R++ +F+H   L  +    ++KTKP QHSVK+L   GI  ++L+ R +    +  K KI+L T ++ + I++  ++  IY +P     Q     +     +          W    + I++ K  +  IA+VGKY    +AY S+  +L  + +     + I+F++S  +NENN+ S   +  AILVPGGFG R +EGKI++I+YAREN IPF GICLGMQLA IE+ARN+L + DA S+E    TANP+I ++            +   ++LGGT+RLG Y C LK GS+  EIY+   +VERHRHRYE N  Y++  E+ G +FSG +++N L+E+IE+  HK+FIA Q HPEFTS     + +F S++  +
  S:    27 MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQANNFTTGKVYQSVLRRERKGDYLGATIQVIPHITDEIKRRIC-SGIADDVDVAIVEIGGTVGDIESQPFLEAIRQLRIELGRNRTLFVHLTLLPYIKVAGEIKTKPTQHSVKELRGIGIQADVLVCRCEKKFDDSEKRKIALFTNVDQDCIFTAEDVDTIYEVPLKYNQQGFDAKLVELLNLNA-KEADLSEWQNVVNTIRDVKG-EVTIAMVGKYVSLTEAYKSLNEALYNAGYKKGVKVKIKFVDSEDVNENNVESYFKDVAAILVPGGFGSRGVEGKIISIKYARENQIPFLGICLGMQLAVIEYARNILGIKDAHSSELEPTTANPVIGLITEWQAEDGTVHQRTHSSDLGGTMRLGGYKCVLKQGSRAREIYQADEVVERHRHRYEVNSNYVERLEEAGLIFSGRSEDNKLMELIEIPQHKWFIACQAHPEFTSTPRYGHKLFESYIQAA 566
>gi|193214481|ref|YP_001995680.1| CTP synthase [Chloroherpeton thalassium ATCC 35110] >gi|193087958|gb|ACF13233.1| CTP synthase [Chloroherpeton thalassium ATCC 35110] (557 aa)
Score = 1185, Expect = 9.5e-128, Identities = 237/528 (44%), Positives = 339/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  +SLGA+LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+    + SN+T GR+Y   +  ER G +LG T+QVVPH+ + I  +++ L+ K   D +I E+GGTVGDIES+PFLEA RQL+ +  S+ ++ IH   +  + + ++LKTKP QHSVK L+  GI P++L+ RS+  +S  +K KI L   + + ++  L + + IY +P  L  +K+ + +     ++ P     K W  F+  +K PK     I V GKY+  PDAY SI+ S   +       + + +++S  L + +  ++E L     ILV  GFG+R IEGKI  ++ ARE NIPFFGICLGMQ A+IE+ARNV  M  A STEF + T  P+I ++E +      GGT+RLG+Y C L++ +     Y +  I ERHRHRYEFN ++ +     G V +G + +  LVEIIEL+ H++F+ VQFHPE  S++  P+P+F SF+  +KK
  S:     8 KHIFVTGGVVSSLGKGILSASLGALLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDEATSRASNMTMGRIYKTVLDNERRGDYLGGTVQVVPHVIDEIKARMLDLAKKGSFDVVITEIGGTVGDIESLPFLEAMRQLKLQLGSKNLVNIHLTLVPYIKSAAELKTKPTQHSVKMLLEIGIQPDILVCRSEHPLSKDIKHKIGLFCNLSDSDVVGLCDAETIYEVPLVLHEEKIDSLVLKKLMLKSPKPADIKDWKDFSGKVKFPKDGVVEIGVCGKYTKYPDAYKSIVESFIHAGAANNVKVKVRWMHSEDLEQKDCKVNEMLQGISGILVAPGFGERGIEGKIEIVKIARERNIPFFGICLGMQCATIEYARNVCGMEGAHSTEFVKKTKYPVIDLMEHQRSVKQKGGTMRLGSYPCILEENTNAFAAYGKNLINERHRHRYEFNNQFKEELSAKGLVIAGASPDGELVEIIELKGHRWFVGVQFHPELKSRVHKPHPLFISFVAEAKK 539
>gi|15835771|ref|NP_300295.1| CTP synthetase [Chlamydophila pneumoniae J138] >gi|16752802|ref|NP_445070.1| CTP synthetase [Chlamydophila pneumoniae AR39] >gi|13633650|sp|Q9Z8U8|PYRG_CHLPN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|7189440|gb|AAF38350.1| CTP synthase [Chlamydophila pneumoniae AR39] >gi|8978609|dbj|BAA98446.1| CTP synthetase [Chlamydophila pneumoniae J138] (537 aa)
Score = 1185, Expect = 9.8e-128, Identities = 236/526 (44%), Positives = 337/526 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKH-IYLLPESLENQKVQNSIFNFFKM-EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + +TGGV SSLGKG+  +SL  +L+     V ++K DPYLNVD GTM P +HGE++VT DG ETDLD+G+Y RF +  L + S+ T+G++Y   I +ER+G +LG+T+QV+PHIT  I Q I+  + ++ PD LIVE+GGT+GDIES+PFLEA RQ +  +    + IH   +  L    ++K+KP QHSV+ L   GI P+ +L RS+  ++ ++K KISL   + N  ++++I++KH IY +P  L  +K+ N I    K+  VP  +    W    + + +    K +I VVGKY    DAY SI  +L  ++  L+   + E I   + +EN   ELS+ DA LVPGGFG R  EGKI A ++ RE  IP+FGICLGMQ+  +E+ARNVL +  A+S E + NT +PI+ ++EG++     GGT+RLG Y C LK GSK  + Y   S++ ERHRHRYE NP Y+   E HG    G      L EIIE+ +H + I VQFHPEF SK++SP+P+F +F+  +
  S:     4 KCIFLTGGVVSSLGKGLTAASLALILERQRLNVAMLKLDPYLNVDPGTMNPFEHGEIYVTDDGVETDLDLGHYHRFSSAALSRHSSATSGQIYARVIKREREGDYLGSTVQVIPHITNEIIQVILDAAKEHSPDVLIVEIGGTIGDIESLPFLEAIRQFRYDHSEDCLNIHMTYVPYLQAADEVKSKPTQHSVQTLRGIGIIPDAILCRSEKPLTQEVKSKISLFCNVPNRAVFNVIDVKHTIYEMPLMLAQEKIANFIGEKLKLATVPENL--DDWRVLVNQLSQDLP-KVKIGVVGKYVQHRDAYKSIFEALTHAA--LRLGHAAEIIPIDAEDENLTMELSQCDACLVPGGFGVRGWEGKIAAAKFCREQGIPYFGICLGMQVLVVEYARNVLNLDQANSLEMDPNTPHPIVYVMEGQDPLVATGGTMRLGAYPCLLKPGSKAHKAYNESSLIQERHRHRYEVNPDYIQSLEDHGLRIVGTCPPQGLCEIIEVSDHPWMIGVQFHPEFVSKLISPHPLFIAFIEAA 527
>gi|86153976|ref|ZP_01072178.1| CTP synthase [Campylobacter jejuni subsp. jejuni HB93-13] >gi|85842514|gb|EAQ59727.1| CTP synthase [Campylobacter jejuni subsp. jejuni HB93-13] (543 aa)
Score = 1184, Expect = 1.1e-127, Identities = 250/528 (47%), Positives = 353/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIH--TVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKR-KSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+A +S+  +LK  G +V I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFL+ +L +++N T GRVY   I KER G++LG TIQV+PHI   I  +I         D LIVE+GGTVGDIE +PFLEA R L+ +  ++  M IH   VP I+     +LKTKP QHSV +L   GI P++++ RS+ A+   LK+KI+++ G+E   +   ++   IY +P +   Q + + I     ++   PN    ++WD+    +  P   + +IA VGKY D  ++Y S+  ++  +   L T + +++++S  L     SE+  +   ILV GGFG R +EGKI AIQYAREN IPF GICLGMQLA +EFARNVLK+ DA+S+EF+E   NP++ +++           +  +T LGGT+RLG Y C++K+ S + ++Y   KS+ ERHRHRYE NPKY   FEKHG + SG +K   L+E++EL  H FF+AVQFHPEFTS++   NP+   F+  +
  S:     3 QTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKERRGEYLGKTIQVIPHIVGEIKDRIKKAGEG--KDILIVEIGGTVGDIEGLPFLEAIRALRLEVGKNNAMNIHLTLVPFIK--AAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLKDKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILSPIAEILDLKNLKPN---MENWDSLVKRVIAPSN-EVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESSEVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLKDANSSEFDEKCQNPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAKVYNEAKSVKERHRHRYEANPKYRADFEKHGLIVSGESK--GLIEVVELNCHPFFLAVQFHPEFTSRLEHVNPVIRGFIKAA 537
>gi|189424786|ref|YP_001951963.1| CTP synthase [Geobacter lovleyi SZ] >gi|189421045|gb|ACD95443.1| CTP synthase [Geobacter lovleyi SZ] (535 aa)
Score = 1184, Expect = 1.2e-127, Identities = 239/528 (45%), Positives = 337/528 (63%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV-PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           KTK + +TGGV SS+GKG+A +SLGA+L+  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YER+ +  L K+SN T G+VY+  I KER G +LG T+QV+PHIT+ I  KII   N    D  IVEVGGTVGDIES+PFLEA RQ +  +     +++H   +  + T  ++KTKP QHSV +L   GI P++LL R    +   +K+KISL   +E   +   ++ +HIY +P +L  +++   +    K+ +   +     W      ++ P   + RIA+VGKY +  ++Y S+  +L          + ++++++  + EN +   L + D +LVPGGFG+R  EGK+LAI+YAR   IPFFGICLGMQ+A+IEFARNV  +  A STEF  +   P+I ++E +      GGT+RLG   C +  G+K  + Y    I ERHRHRYEFN  Y ++    G V SGIN++ +LVEIIEL +H +F+A QFHPEF SK L P+P+F +F+  S
  S:     2 KTKFIFITGGVVSSIGKGLAAASLGALLESRGLRVTMQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERYTSARLSKKSNFTTGQVYFSVIDKERRGDYLGGTVQVIPHITDEIKSKII--ENAKGADVAIVEVGGTVGDIESLPFLEAIRQFRFDRGAGNTLYVHVTLVPYIRTAGEMKTKPTQHSVMELRKIGIQPDILLCRCDRELPQDMKKKISLFCNVEESCVIPSVDSEHIYAVPLALNKERLDEQVVE--KLNIWTKQPDLTPWQDVVETLRHPSHGEVRIAIVGKYVNLTESYKSLAEALTHGGIANDCRVYLKYVDAEKIEENGVEGWLDDVDGVLVPGGFGERGTEGKVLAIEYARTRQIPFFGICLGMQMAAIEFARNVCGLAKACSTEFKNDCKEPVIHLMEEQKSVNKKGGTMRLGACPCTVTKGTKAFDAYNEADISERHRHRYEFNNTYRELMTTKGLVLSGINQQKDLVEIIELPDHPWFLACQFHPEFKSKPLVPHPLFRAFIGAS 528
>gi|56707525|ref|YP_169421.1| CTP synthetase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110669996|ref|YP_666553.1| CTP synthetase [Francisella tularensis subsp. tularensis FSC198] >gi|118496882|ref|YP_897932.1| CTP synthetase [Francisella tularensis subsp. novicida U112] >gi|134302545|ref|YP_001122515.1| CTP synthetase [Francisella tularensis subsp. tularensis WY96-3418] >gi|194324105|ref|ZP_03057879.1| CTP synthase [Francisella tularensis subsp. novicida FTE] >gi|81597911|sp|Q5NHS1|PYRG_FRATT CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391107|sp|Q14J73|PYRG_FRAT1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|56604017|emb|CAG45007.1| CTP synthase [Francisella tularensis subsp. tularensis SCHU S4] >gi|110320329|emb|CAL08390.1| CTP synthase [Francisella tularensis subsp. tularensis FSC 198] >gi|118422788|gb|ABK89178.1| CTP synthase (UTP-ammonia lyase) [Francisella tularensis subsp. novicida U112] >gi|134050322|gb|ABO47393.1| CTP synthase [Francisella tularensis subsp. tularensis WY96-3418] >gi|151568280|gb|EDN33934.1| CTP synthase [Francisella tularensis subsp. tularensis FSC033] >gi|151569971|gb|EDN35625.1| CTP synthase [Francisella tularensis subsp. novicida GA99-3549] >gi|194321552|gb|EDX19036.1| CTP synthase [Francisella tularensis subsp. novicida FTE] (546 aa)
Score = 1184, Expect = 1.2e-127, Identities = 242/531 (45%), Positives = 342/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +N  TKI+ VTGGV SSLGKGV  +SL  +L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T G+VY   + +ER G +LGATIQV+PHIT+ I ++I         D  IVE+GGTVGDIES PFLEA RQL+ +  R++ +F+H   L  +    ++KTKP QHSVK+L   GI  ++L+ R +    +  K KI+L T ++ + I++  ++  IY +P     Q     +     +          W    + I++ K  +  IA+VGKY    +AY S+  +L  + +     + I+F++S  +NENN+ S   +  AILVPGGFG R +EGKI++I+YAREN IPF GICLGMQLA IE+ARN+L + DA S+E    TANP+I ++            +   ++LGGT+RLG Y C LK GS+  EIY+   +VERHRHRYE N  Y++  E+ G +FSG +++N L+E+IE+  HK+FIA Q HPEFTS     + +F S++  +
  S:     1 MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQANNFTTGKVYQSVLRRERKGDYLGATIQVIPHITDEIKRRIC-SGIADDVDVAIVEIGGTVGDIESQPFLEAIRQLRIELGRNRTLFVHLTLLPYIKVAGEIKTKPTQHSVKELRGIGIQADVLVCRCEKKFDDSEKRKIALFTNVDQDCIFTAEDVDTIYEVPLKYNQQGFDAKLVELLNLNA-KEADLSEWQNVVNTIRDVKG-EVTIAMVGKYVSLTEAYKSLNEALYNAGYKKGVKVKIKFVDSEDVNENNVESYFKDVAAILVPGGFGSRGVEGKIISIKYARENQIPFLGICLGMQLAVIEYARNILGIKDAHSSELEPTTANPVIGLITEWQAEDGTVHQRTHSSDLGGTMRLGGYKCVLKQGSRAREIYQADEVVERHRHRYEVNSNYVERLEEAGLIFSGRSEDNKLMELIEIPQHKWFIACQAHPEFTSTPRYGHKLFESYIQAA 540
>gi|150398788|ref|YP_001322555.1| CTP synthetase [Methanococcus vannielii SB] >gi|150011491|gb|ABR53943.1| CTP synthase [Methanococcus vannielii SB] (534 aa)
Score = 1184, Expect = 1.3e-127, Identities = 248/528 (46%), Positives = 342/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-------SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SSLGKG+  SSLG +LK  G  V ++K DPYL +DAGTM+P +HGEVFVT DG ETDLD+GNYERF++I+L  ++N+T G++Y+  ++KER G +LG T+QV+PHIT  I + I  L +  + D  IVE+GGTVGDIES+PFLEA RQ +    +  V++IH   L  + +  +LKTKP QHSVK+L   GI P++L+ R++  ++ KL+EK++L   +E E +    + K IY +P +LE + +   +     +    PN      W      I  P      I VVGKY +  DAY SI+ +L  +     T +++ +IN+  L   N  E+        + D ILVPGGFG R I+GKI A+ YARENNIPF GICLGMQ A IEF+RNV  ++ ADSTEFNE T +P+I  +  +   T  GGT+RLG Y   L++GS +  +Y    + ERHRHRYE NP+Y +I  K+G   SGI+ +  L E +ELE+HK+FIA Q HPEF S+  +P+P+F   +  S K
  S:     2 KYIFVTGGVVSSLGKGITASSLGRLLKARGFNVNMVKIDPYLQIDAGTMSPYEHGEVFVTDDGGETDLDLGNYERFIDISLKAKNNITTGKIYWNVLSKERKGDYLGKTVQVIPHITNEIKEWIKELGS--ESDITIVEIGGTVGDIESLPFLEAIRQFKKDVGKENVLYIHVSLLPYIRSAGELKTKPTQHSVKELKGIGIQPDILVCRTEIPINEKLREKLALFCDVEKEAVIEGKDAKTIYEVPLNLEKEGLGALVIKKLNLRDSAPN---LSEWRANVDRIINPLN-SVSIGVVGKYVELKDAYASILEALGHAGAKNDTKVNVTWINAEELENKNYREILDKMREDEKIDGILVPGGFGDRGIDGKINAVCYARENNIPFLGICLGMQCAVIEFSRNVCGLNGADSTEFNEKTEHPVIDYIPEQRDVTEKGGTMRLGAYTAFLENGSLVNTLYNSIEVSERHRHRYEVNPEYHEILRKNGLKISGISPDGKLAEFVELESHKYFIATQGHPEFKSRPNNPHPLFNGLIKASLK 533
>gi|110598904|ref|ZP_01387152.1| CTP synthase [Chlorobium ferrooxidans DSM 13031] >gi|110339481|gb|EAT58008.1| CTP synthase [Chlorobium ferrooxidans DSM 13031] (565 aa)
Score = 1184, Expect = 1.3e-127, Identities = 241/527 (45%), Positives = 347/527 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQVMF-IHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSL--EISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           K + VTGGV SSLGKG+  +SLG +LK  G  V I K+DPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERFL+ +  + SN+T GRVY   I KER G++LGAT+QVVPH+ + I  ++  L+     D LI E+GGT+GDIES+PFLEA RQ++ +   + M  IH   +  +   S+LKTKP QHSVK L+  GI P++L+ RS+  +S ++K K+     + + ++  L +   IY +P  L  +K+   +     ++       ++W  F + +K P++ +  I + GKY++ PDAY SI+ +     +S  +K ++ +     + +N  N+S EL     ILV  GFG R IEGKI  I+YARE N+PFFGICLGMQ A+IEFARNV  + DA+STEFN+ T  P+I ++E + +    GGT+RLG+Y C +K+GS    +Y++  I ERHRHR+EFN  Y + FE+ G VFSG +    LVEIIEL++H++F+ VQFHPE  S++   +P+F+ F+  +K
  S:     8 KHIFVTGGVISSLGKGILSASLGMLLKSRGLRVAIQKYDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDESTSQSSNLTMGRVYKSVIDKERRGEYLGATVQVVPHVIDEIKDRMAELAKNGNLDVLITEIGGTIGDIESLPFLEAMRQMKLEMGDRNMLNIHLTFVPYIKAASELKTKPTQHSVKMLLETGIQPDILVCRSEKPLSREIKNKVGHFCNVNDLDVIGLNDCDTIYDVPLLLLKEKLDLRVLKKLGLKKYKEPNLEYWREFCNKVKFPEEGEVTIGICGKYTEYPDAYKSILEAFIHAGASNNVKVNIKLLRAEDAEINTFNLSKELEGVSGILVAPGFGDRGIEGKINFIRYAREKNVPFFGICLGMQCATIEFARNVCGLQDANSTEFNKRTRFPVIDLMEHQKKVKEKGGTMRLGSYPCIIKEGSMAHAVYQKFLINERHRHRFEFNNTYRNSFEESGLVFSGTSPNGELVEIIELKDHRWFVGVQFHPELKSRVQKVHPLFHGFVAAAK 538
>gi|37521093|ref|NP_924470.1| CTP synthetase [Gloeobacter violaceus PCC 7421] >gi|81710328|sp|Q7NKF4|PYRG_GLOVI CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|35212089|dbj|BAC89465.1| CTP synthetase [Gloeobacter violaceus PCC 7421] (549 aa)
Score = 1183, Expect = 1.7e-127, Identities = 228/527 (43%), Positives = 339/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ K +NVT G +Y   I KER G ++G T+QV+PHIT  I ++I  +++   PD +IVEVGGTVGDIES+PFLEA RQ +    R  V++IH   ++ + T  ++KTKP QHSVK+L S GI P++L+ RS   +S  +K+KIS    +    + +  + + IY +P +LE + + +       +E   +   + W+     I  P +    IA+VGKY    DAY+S++ +L  ++  L  ++ +E++++ ++ E      L+  D  +VPGGFG R I+GK+ AI+++R + +PF G+CLGMQ + IE+AR+   +  A+STEF+  T NP+I++L  +    +LGGT+RLG + C L++G+    +Y    + ERHRHRYEFN  Y     + GF  SG + +  LVEIIEL +H +FIA QFHPEF S+   P+P+F+  +  +
  S:     2 TKYVFVTGGVVSSIGKGIVAASLGRLLKSRGYSVTILKLDPYINVDPGTMSPFQHGEVFVTNDGAETDLDLGHYERFTDTDVSKLNNVTTGSIYQSVINKERRGDYMGGTVQVIPHITNEIKERIRRVAHDTNPDVVIVEVGGTVGDIESLPFLEAIRQFRKDVGRENVLYIHVTYILHIPTAGEMKTKPTQHSVKELRSIGIQPDILVCRSDRPLSVGIKDKISEFCDVPVRAVITCQDAQTIYAVPLNLEREGLAHQAITLLGLE-QRQPDLRDWEILVDRICNPSR-AVTIAIVGKYVRLSDAYISVVEALRHAAVALDAEVKVEWVSAEAVEERGAGYFLNNVDGAVVPGGFGSRGIDGKVSAIEFSRGHRLPFLGLCLGMQCSVIEWARHTAGLA-ANSTEFDPQTPNPVISLLPEQADVVDLGGTMRLGLWPCRLQEGTLAHRLYGETLVYERHRHRYEFNNAYRKAIIEAGFQISGASPDERLVEIIELADHPYFIATQFHPEFKSRPNKPHPLFFGLVRAA 527
>gi|196243809|ref|ZP_03142538.1| CTP synthase [Cyanothece sp. PCC 8802] >gi|196208726|gb|EDY03516.1| CTP synthase [Cyanothece sp. PCC 8802] (547 aa)
Score = 1182, Expect = 1.8e-127, Identities = 227/527 (43%), Positives = 334/527 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I KER G ++G T+QV+PHIT  I ++I  ++    PD +I E+GGTVGDIES+PFLEA RQ +    R+ V+++H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +   +KEK+S    +  E++ +  +   IY +P  +E + +         +E P +     W T    ++ P++ +  IA+VGKY    DAYLS++ SL      + +++ + ++N+  + +    + L +   I+VPGGFG R ++GK+ AIQYAR+  IPF G+CLGMQ A IE+ARN+ ++  ++S EF+  T NP+I +L  +    +LGGT+RLG Y C L   +    +Y ++ I ERHRHRYEFN  Y  +  + G+V SG + +  LVEIIEL  H FFIA QFHPEF S+  SP+P+F  F+  +
  S:     2 TKFVFVTGGVVSSIGKGIVAASLGRLLKSRNYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTSMSRLNSVTTGSIYQAVINKERRGAYMGGTVQVIPHITNEIKERIHRVAKNTNPDVVITEIGGTVGDIESLPFLEAIRQFRKDVGRNNVVYMHVTLIPWIPAAREMKTKPTQHSVKELRSIGIQPDVLVCRCDRPLKEGMKEKLSEFCDVPVESVITAQDASSIYEVPLIVEREGLAQQTLALLNLE-PRQPNLTDWQTLVQRMQTPQR-QIEIALVGKYVQLSDAYLSVVESLVHGGIAVNSEVKLNWVNAEDIEQYGAEKFLKDVSGIVVPGGFGIRGVDGKVQAIQYARQQKIPFLGLCLGMQCAVIEWARNIARLERSNSAEFDPETPNPVINLLPEQEDVVDLGGTMRLGLYACRLSPDTLASSLYPQEVIYERHRHRYEFNNAYRSLLIETGYVVSGTSPDGRLVEIIELPGHPFFIATQFHPEFQSRPNSPHPLFLGFVKAA 528
>gi|157961012|ref|YP_001501046.1| CTP synthetase [Shewanella pealeana ATCC 700345] >gi|157846012|gb|ABV86511.1| CTP synthase [Shewanella pealeana ATCC 700345] (546 aa)
Score = 1182, Expect = 2.0e-127, Identities = 245/524 (46%), Positives = 343/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    K KISL   +E   + SL ++  IY +P  L+ Q +   +   F ++         W+        P   +  I +VGKY + PDAY S+  +L+ +  + +  ++I++I+S ++       L   D ILVPGGFG+R +EGKI+A ++ARENN+P+FGICLGMQ+A IEFAR+V  +  A STEF   T +P++ ++          E ++ E++LGGT+RLG   C L++G+K    YK  + VERHRHRYE N  Y +  EK G +FSG++ + +LVE+IEL NH +F+A QFHPEFTS      P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQVIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRDRTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLVCRGDRAIPANEKAKISLFCNVEERAVISLKDVDSIYKIPALLKAQGLDQLVTKRFGIDC-KEADLAEWEKVVYQEANPVG-EVTIGMVGKYIELPDAYKSVNEALKHAGLFNRVSVNIKYIDSQNVEAKGDEVLQGLDGILVPGGFGERGVEGKIMAAKFARENNLPYFGICLGMQVALIEFARHVAGLEGAHSTEFKPETPHPVVGLITEWINEDGQVEERHEESDLGGTMRLGAQLCHLEEGTKAAAAYKSTTCVERHRHRYEVNNNYKERLEKAGLIFSGLSSDRSLVEMIELPNHPWFVAGQFHPEFTSTPRDGQPLFEGFV 533
>gi|14520571|ref|NP_126046.1| CTP synthetase [Pyrococcus abyssi GE5] >gi|24212169|sp|Q9V1S2|PYRG_PYRAB CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|5457787|emb|CAB49277.1| pyrG CTP synthase [Pyrococcus abyssi GE5] (537 aa)
Score = 1182, Expect = 2.1e-127, Identities = 239/529 (45%), Positives = 339/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKA-----RIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGI-NKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV S LGKG+  +S+G ++K  G +   +K DPY+N DAGTM P QHGEVFV  DG E DLD+GNYERFL+ +L  + N+T G+VY   I KER G++LGAT+QV+PHIT+ I ++I  ++  Y  D ++VE+GGTVGDIES+PFLEA RQ+Q +  R  V F+H   + +L    + KTKP QHSVK+L S GI P+ ++ RS+D +    ++KISL T +  E + S  +++  Y +P  LE + +   +     +E       + W+   +      KYKA      IA+VGKY    D+YLSI  +L+ +S   +  + I +I +  + E+    L   D I+VPGGFG R  EGKI+ I+YAREN+IPF GIC G QL  +EFARNVL M  A STE +  T  P++ ++  +     LGGT+RLG Y  ++K G+   E+YK+  + ERHRHR+E NP Y++ FEK G VFSGI   +   +EI+EL + ++FIA QFHPEF S+ + P P+F+  +  +K+
  S:     2 TKFIFVTGGVVSGLGKGITSASIGLLMKARGYKTTNIKIDPYINYDAGTMNPYQHGEVFVLDDGGEVDLDLGNYERFLDTSLTFDHNITTGKVYSTVIEKERRGEYLGATVQVIPHITDEIKRRIREIARNY--DIVVVEIGGTVGDIESMPFLEAARQMQLEEGRENVAFVHVTYVPKLRVVGEQKTKPTQHSVKELRSLGIQPDAIVARSEDPLEEGARKKISLFTNVPEEAVISAYDVEDTYEVPLLLEREGLGKYLVKRLGLE-DREPDLREWEKMVA------KYKALQDSVEIAIVGKYVKLTDSYLSIKEALKHASVSNEVKVKIRWIEAEDIEEHGTKLLEGVDGIIVPGGFGARGAEGKIMTIRYARENDIPFLGICFGFQLTVVEFARNVLGMKGAHSTEIDPQTPYPVVDLMPEQRNLDKLGGTMRLGAYPVKIKKGTLAYELYKKDLVYERHRHRWEVNPDYIEAFEKAGLVFSGIAGDDERRMEILELPDKRYFIATQFHPEFKSRPMKPAPVFHGLVKAAKE 528
>gi|124515314|gb|EAY56824.1| CTP synthase [Leptospirillum sp. Group II UBA] (545 aa)
Score = 1181, Expect = 2.4e-127, Identities = 228/526 (43%), Positives = 335/526 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLN--ENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + +TGGV SSLGKG+A +SLG +L+  G  +  +KFDPY+NVD GTM P QHGEV+VT DG ETDLD+G+YERF  + + +E+N T GR+YY+ I +ER G++LG T+Q+VPHIT  I  K ++ +  +  D ++ E+GGTVGDIES+PFLE  RQ      +  V ++H   +  +    +LKTKP QHSV  L   GI PN+++ R+++ +   +++KI+L   ++ E + S  ++  IY +P    +Q++   +   F++  P R+G K W    +  ++  K    I +VGKY D  D+Y S+I +L+ +       + I +++S  +   E      S    ILVPGGFG R IEGK++A+++ARE  IPF GICLGMQLA IEFARNV+ +  A S EF+ N    +I +L G+  + ++GG++RLG ++ +LK G++I  +YK   I ERHRHRYE N +Y    E+ G + SG   E  LVE +EL +H FF+A QFHPEF S+ L P+P+F  F+  S
  S:    10 KYVFITGGVVSSLGKGIASASLGLLLERRGYRINFLKFDPYINVDPGTMNPYQHGEVYVTEDGSETDLDLGHYERFTRLTMGRENNYTTGRIYYDVITRERSGEYLGGTVQIVPHITNEI--KSVIQNRGHNADIVLCEIGGTVGDIESLPFLETIRQFSRDVGKDNVAYVHLTLVPYVRASCELKTKPTQHSVHKLREIGISPNVIICRTEEDLPEDVRQKIALFCDVDPEAVISAPDVPSIYQVPLEFHHQRLDALLLKHFRLPTP-RVGMKDWVDLVNRFRKIHK-TVPIGIVGKYVDLQDSYKSLIEALQHAGVKQGVKVKIHWLDSEEIEAAEEPSGLFSGLAGILVPGGFGARGIEGKMIAVRHARERKIPFLGICLGMQLAVIEFARNVVGLRGATSREFDPNPPYAVIDLLPGQADQKDMGGSMRLGAFDVDLKPGTRIHGLYKSDRIRERHRHRYEVNGEYQKAMEEKGLLVSGTYSERRLVETVELPDHPFFVASQFHPEFRSRPLEPHPLFLGFVQAS 534
>gi|157374428|ref|YP_001473028.1| CTP synthetase [Shewanella sediminis HAW-EB3] >gi|157316802|gb|ABV35900.1| CTP synthase [Shewanella sediminis HAW-EB3] (545 aa)
Score = 1181, Expect = 2.4e-127, Identities = 247/524 (47%), Positives = 340/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQ++PHIT AI +K+  L+     D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R    V    K KISL   +E   + SL ++  IY +P  L+ Q +   +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +  + +  ++I++I+S ++       L   D ILVPGGFG+R +EGKILA +YARENN+P+FGICLG+Q+A IEFAR+V  +  A STEFN+ T +P++ ++          E ++  ++LGGT+RLG   C L +GSK    Y   + VERHRHRYE N  Y D  EK G VFSG++ +  LVE+IEL NH +F+A QFHPEFTS      P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYEEVLRKERRGDYLGATIQIIPHITNAIKEKV--LAGGEGHDVAIVEIGGTVGDIESLPFLESIRQLSVELGRERSLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLVCRGDRPVPANEKAKISLFCNVEERAVISLKDVDSIYKIPALLKAQGLDELVVKRFGITCP-EADLHEWEQVIYQEANPTG-EVTIGMVGKYIELPDAYKSVNEALKHAGLFNRVSVNIKYIDSQTVEAKGEEVLQGLDGILVPGGFGERGVEGKILAAKYARENNLPYFGICLGLQVALIEFARHVAGLEGAHSTEFNKETPHPVVGLITEWINEEGNVEQRHETSDLGGTMRLGAQLCHLSEGSKAAISYDGNTCVERHRHRYEVNNNYKDRLEKAGLVFSGLSSDRQLVEMIELPNHPWFVAGQFHPEFTSTPRDGQPLFVGFV 533
>gi|170727689|ref|YP_001761715.1| CTP synthase [Shewanella woodyi ATCC 51908] >gi|169813036|gb|ACA87620.1| CTP synthase [Shewanella woodyi ATCC 51908] (545 aa)
Score = 1181, Expect = 2.4e-127, Identities = 246/524 (46%), Positives = 339/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           T+ + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI +K+  L      D  IVE+GGTVGDIES+PFLE+ RQL  +  R + +F+H   +  L    ++KTKP QHSVK+L S GI P++L+ R   A+    K KISL   +E   + SL ++  IY +P  L+ Q +   +   F +E         W+        P      I +VGKY + PDAY S+  +L+ +  + +  ++I++I+S ++       L   D ILVPGGFG+R +EGKI A +YARENN+P+FGICLGMQ+A IEFAR+V  +  A STEF + T +P++ ++          E ++  ++LGGT+RLG   C L++G+K    Y+  + VERHRHRYE N  Y D  EK G VFSG++ +  LVE+IEL NH +F+A QFHPEFTS      P+F  F+
  S:     3 TRYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINLDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMNRRNNFTTGRIYSEVLRKERRGDYLGATIQVIPHITNAIKEKV--LDGGEGHDVAIVEIGGTVGDIESLPFLESIRQLGVELGRERTLFMHLTLVPFLGAAGEVKTKPTQHSVKELRSIGIAPDVLVCRGDRAIPANEKAKISLFCNVEERAVISLKDVDSIYKIPALLKAQGLDELVTKRFGIEC-KEADLHEWEQVIYQEANPTG-DVTIGMVGKYIELPDAYKSVNEALKHAGLFNRVSVNIKYIDSQTVEAKGEEVLEGLDGILVPGGFGERGVEGKIFAAKYARENNLPYFGICLGMQVALIEFARHVAGLEGAHSTEFQKETPHPVVGLITEWLNEDGNVEQRHETSDLGGTMRLGAQLCHLEEGTKAAAAYQANTCVERHRHRYEVNNNYKDRLEKAGLVFSGLSSDRQLVEMIELPNHPWFVAGQFHPEFTSTPRDGQPLFVGFV 533
>gi|171912367|ref|ZP_02927837.1| CTP synthetase [Verrucomicrobium spinosum DSM 4136] (536 aa)
Score = 1181, Expect = 2.5e-127, Identities = 234/526 (44%), Positives = 338/526 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQL-QAKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKH-IYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+A +SLG +L+  G +V++ KFDPYLNVD GTM P +HGEV+V  DG ETDLD+G+YERF + NL + +N+T+G+VY   +AKER G +LG+T+QV+PH+T  I ++I  ++ +   D +I E+GGTVGDIE +PFLEA RQ  Q      V++IHT  +I +    +LKTKP Q S+  L   GI P ++L R++  +   +K+KISL   +E E +    ++K+ IY +P  L  +K+ + +     +E   +     W  F + +  P  +  RIAVVGKY +  DAY SI  ++  +       + +  +++  + +      L+    ILVPGGFG R  EGKI A +YARE+ IP+FGICLGMQ+A IEFARNV    DA+STEFN+ TA+P++ +LE +   T  GG++RLG +  +L   ++  ++Y   +I ERHRHRYE+N  Y +  E  GF+ SG++ +  L EIIEL++H FF+A QFHPE  SK   P+PIFY F+  +
  S:     2 KYIFVTGGVVSSLGKGLAAASLGTLLEHRGLKVILQKFDPYLNVDPGTMNPYEHGEVYVLDDGAETDLDLGHYERFTSTNLSRLNNLTSGQVYTNVLAKERSGAYLGSTVQVIPHVTNEIKERIRKVAREMTADVIITEIGGTVGDIEGLPFLEAIRQFGQEVGPENVLYIHTTLIIYIRAAGELKTKPTQQSIAKLREIGISPGIVLCRTEMRLDQDVKDKISLFCNVEPEAVIEAADVKNSIYEVPLKLHEEKLDDLVCKLLHIET-KQPDLARWRKFVNRVINPTHH-VRIAVVGKYIELQDAYKSIYEAIVHAGAANDAKVEVVRVDAEDIEKGGPDMHLAGMQGILVPGGFGDRGTEGKITACKYARESGIPYFGICLGMQIAVIEFARNVCGWTDANSTEFNKTTAHPVVNLLEEQQHVTQKGGSMRLGAWVTDLAPNTRAYDLYHSATITERHRHRYEYNSIYKEEMESKGFIISGMSPDGTLAEIIELKDHPFFMACQFHPELLSKPNHPHPIFYGFVRAA 528
>gi|187931148|ref|YP_001891132.1| CTP synthase (UTP-ammonia lyase) [Francisella tularensis subsp. mediasiatica FSC147] >gi|187712057|gb|ACD30354.1| CTP synthase (UTP-ammonia lyase) [Francisella tularensis subsp. mediasiatica FSC147] (546 aa)
Score = 1181, Expect = 2.5e-127, Identities = 243/531 (45%), Positives = 342/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +N  TKI+ VTGGV SSLGKGV  +SL  +L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T G+VY   + +ER G +LGATIQV+PHIT+ I ++I         D +IVE+GGTVGDIES PFLEA RQL+ +  R++ +F+H   L  +    ++KTKP QHSVK+L   GI  ++L+ R +    +  K KI+L T ++ + I++  ++  IY +P     Q     +     +          W    + I + K  +  IA+VGKY    +AY S+  +L  + +     + I+F++S  +NENN+ S   +  AILVPGGFG R IEGKI++I+YAREN IPF GICLGMQLA IE+ARN+L + DA S+E    TANP+I ++            +   ++LGGT+RLG Y C LK GS+  EIY+   +VERHRHRYE N  Y++  E+ G +FSG +++N L+E+IE+  HK+FIA Q HPEFTS     + +F S++  +
  S:     1 MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQANNFTTGKVYQSVLRRERKGDYLGATIQVIPHITDEIKRRIC-SGIADDVDVVIVEIGGTVGDIESQPFLEAIRQLRIELGRNRTLFVHLTLLPYIKVAGEIKTKPTQHSVKELRGIGIQADVLVCRCEKKFDDSEKRKIALFTNVDQDCIFTAEDVDTIYEVPLKYNQQGFDAKLVELLNLNA-KEADLSEWQNVVNTIIDVKG-EVTIAMVGKYVSLTEAYKSLNEALYNAGYKKGVKVKIKFVDSEDVNENNVESYFKDVAAILVPGGFGSRGIEGKIISIKYARENQIPFLGICLGMQLAVIEYARNILGIKDAHSSELEPTTANPVIGLITEWQAEDGTVHQRTHSSDLGGTMRLGGYKCVLKQGSRAREIYQADEVVERHRHRYEVNSNYVERLEEAGLIFSGRSEDNKLMELIEIPQHKWFIACQAHPEFTSTPRYGHKLFESYIQAA 540
>gi|89256620|ref|YP_513982.1| CTP synthetase [Francisella tularensis subsp. holarctica] >gi|115315045|ref|YP_763768.1| CTP synthetase [Francisella tularensis subsp. holarctica OSU18] >gi|156502752|ref|YP_001428817.1| CTP synthetase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|167009580|ref|ZP_02274511.1| CTP synthase [Francisella tularensis subsp. holarctica FSC200] >gi|119391108|sp|Q2A2S0|PYRG_FRATH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391109|sp|Q0BLA3|PYRG_FRATO CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|89144451|emb|CAJ79750.1| CTP synthase [Francisella tularensis subsp. holarctica LVS] >gi|115129944|gb|ABI83131.1| CTP synthase [Francisella tularensis subsp. holarctica OSU18] >gi|134253743|gb|EBA52837.1| CTP synthase [Francisella tularensis subsp. holarctica 257] >gi|156253355|gb|ABU61861.1| CTP synthase [Francisella tularensis subsp. holarctica FTNF002-00] >gi|157122594|gb|EDO66723.1| CTP synthetase [Francisella tularensis subsp. holarctica FSC022] (546 aa)
Score = 1181, Expect = 2.6e-127, Identities = 242/531 (45%), Positives = 342/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +N  TKI+ VTGGV SSLGKGV  +SL  +L+  G  V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T G+VY   + +ER G +LGATIQV+PHIT+ I ++I         D  IVE+GGTVGDIES PFLEA RQL+ +  R++ +F+H   L  +    ++KTKP QHSVK+L   GI  ++L+ R +    +  K KI+L T ++ + I++  ++  IY +P     Q     +     +          W    + I++ K  +  IA+VGKY    +AY S+  +L  + +     + I+F++S  +NENN+ S   +  AILVPGGFG R +EGKI++I+YAREN IPF GICLGMQLA IE+ARN+L + DA S+E    TANP+I ++            +   ++LGGT+RLG Y C LK GS+  EIY+   +VERHRHRYE N  Y++  E+ G +FSG +++N L+E+IE+  HK+FIA Q HPEFTS     + +F S++  +
  S:     1 MNSNTKIIFVTGGVVSSLGKGVTAASLATLLESRGLNVTMMKLDPYINVDPGTMSPLQHGEVFVTEDGAETDLDLGHYERFIRNKMTQANNFTTGKVYQSVLRRERKGDYLGATIQVIPHITDEIKRRIC-SGIADDVDVAIVEIGGTVGDIESQPFLEAIRQLRIELGRNRTLFVHLTLLPYIKVAGEIKTKPTQHSVKELRGIGIQADVLVCRCEKKFDDSEKRKIALFTNVDQDCIFTAEDVDTIYEVPLKYNQQGFDAKLVELLNLNA-KEADLSEWQNVVNTIRDVKG-EVIIAMVGKYVSLTEAYKSLNEALYNAGYKKGVKVKIKFVDSEDVNENNVESYFKDVAAILVPGGFGSRGVEGKIISIKYARENQIPFLGICLGMQLAVIEYARNILGIKDAHSSELEPTTANPVIGLITEWQAEDGTVHQRTHSSDLGGTMRLGGYKCVLKQGSRAREIYQADEVVERHRHRYEVNSNYVERLEEAGLIFSGRSEDNKLMELIEIPQHKWFIACQAHPEFTSTPRYGHKLFESYIQAA 540
>gi|58584429|ref|YP_198002.1| CTP synthetase [Wolbachia endosymbiont strain TRS of Brugia malayi] >gi|75498044|sp|Q5GTB4|PYRG_WOLTR CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|58418745|gb|AAW70760.1| CTP synthase [Wolbachia endosymbiont strain TRS of Brugia malayi] (539 aa)
Score = 1181, Expect = 2.7e-127, Identities = 244/525 (46%), Positives = 336/525 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE------LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           + K + VTGGV SSLGKG+  SS+GA+L+  G +V I K DPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF  I   K+ N+T G++Y+E + KER G +LG T+QV+PH+T+ I  K  + +     DF+I E+GGTVGDIES PFLEA RQ+  K  + +V+ IH   +  L    +LKTKP QHSV++L   G+ P+++L RS+  +S+  + KI+    +   N+ S  ++ HIY LP       +   +   F +  P +     W+     ++ P + +  +++VGKY++ PD Y S++ +L  S+   + ++ I ++NS   +   I+E      L    AILVPGGFG   IEGK+LAI YAR NNIPFFGICLGMQLA IEFARNV+K  D  S EF     +PII +   KN   +LGGT+RLG Y C +   SK+   Y    I ERHRHRY  N  Y D  EK+G + SG++++   +E +ELENH +FI VQFHPEF SK  SP+P+F SF+
  S:     3 EAKFIFVTGGVVSSLGKGLVASSVGALLQAHGFKVRIRKLDPYLNIDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFTGIKATKDDNITTGKMYHELLKKERRGDYLGKTVQVIPHVTDLI--KSFIFNGTEGLDFVICEIGGTVGDIESQPFLEAIRQISYKLGKQRVILIHLTLVPYLAVAQELKTKPTQHSVRELNFVGLQPDIILCRSEKEISDNQRGKIANLCNVSLSNVISAPDVSHIYELPVLYNQCGLGTQVLEHFHLSKP-KPSLVGWNQIVHSMRHPMQ-EVTVSIVGKYTEFPDTYKSLVEALSHSAISNRIEVKINWVNSREKSGKPINEKFMGDKLKNSHAILVPGGFGDDGIEGKMLAISYARTNNIPFFGICLGMQLAVIEFARNVIKFKDVHSEEF-YTCKHPIIKLAGDKN--VDLGGTMRLGAYKCNISPNSKMAGAYSDTIISERHRHRYIINLDYKDDLEKNGLICSGMSEDGTYIEAVELENHPWFIGVQFHPEFQSKPFSPHPLFVSFI 527
>gi|15617015|ref|NP_240228.1| CTP synthetase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] >gi|11134001|sp|P57491|PYRG_BUCAI CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|25293717|pir||B84978 CTP synthase (EC 6.3.4.2) [imported] - Buchnera sp. (strain APS) >gi|10039080|dbj|BAB13114.1| CTP synthase [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] (545 aa)
Score = 1181, Expect = 2.7e-127, Identities = 246/526 (46%), Positives = 352/526 (66%)
  Q:     8 LIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKAR--IAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRET-----------NLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           + +TGGV SSLGKG+A +SLGA+LK     + I+K DPY+NVD GT++P QHGEVFVT DG ETDLD+G+YERF++  +   +N T G VY + + KER G +LGATIQV+PHIT AI ++IIL S     + ++VE+GGTVGDIES+PFLEA RQ+     R  V++IH   +  + T  ++KTKP QHSVK L+S GI P++L+ RS+  V    ++KI+L   +  + + SL ++  IY +P+ L+NQK+ + I N+FK+ VP     + W+    +I   K +     I ++GKY   PDAY S++ +L+ + F  K  + I+ I+S  +   N   L   + IL+PGGFG R I GK+L+IQYAREN+IP+FGICLGMQ+A IEFA+NV+ + +A+STEF+     PII +++ +   +           NLGGT+RLG+  C+L   S   ++Y ++ I+ERHRHRYE N       E  G   +G +++NN+VEIIEL NH +F+A QFHPEFTS     +P+F  F+  + K
  S:     6 IFITGGVVSSLGKGIAAASLGAILKARNLNITIIKLDPYINVDPGTISPIQHGEVFVTEDGAETDLDLGHYERFIHTKMTFLNNFTTGGVYSQVLKKERRGDYLGATIQVIPHITNAIKERIILCSE--NSNIILVEIGGTVGDIESLPFLEAIRQMAVDIGRKNVIYIHLTLVPYIATAGEIKTKPTQHSVKQLLSIGIQPDILICRSEKTVPLHERKKIALFCNVPVDAVISLKDVNSIYKIPKLLKNQKLDDYICNYFKLNVP-EADLQEWE---EVIYAEKNFNNTIVIGIIGKYIKLPDAYKSVMEALKHAGFKNKIKVDIQLIDSQEVENKNFQILKNLNGILIPGGFGDRGIVGKLLSIQYARENHIPYFGICLGMQIAIIEFAQNVVGIKEANSTEFDPQCKYPIIDLIKNRPNNSSKNYNKIENRINLGGTMRLGSQPCKLSANSLSRKLYNQEIIIERHRHRYEVNNLLFKKIEAAGLQVTGRSQKNNVVEIIELSNHPWFLACQFHPEFTSTPRDGHPLFIDFIKSAGK 539
>gi|158336054|ref|YP_001517228.1| CTP synthetase [Acaryochloris marina MBIC11017] >gi|158306295|gb|ABW27912.1| CTP synthase [Acaryochloris marina MBIC11017] (555 aa)
Score = 1181, Expect = 2.7e-127, Identities = 231/520 (44%), Positives = 329/520 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIF 524
           TK + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   + KER G + G T+QV+PHIT  I  +I  ++ +  PD LI+E+GGTVGDIES+PFLEA RQ +    R  +++ H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +S  +KEK+S    +  E + +  +   IY +P  LE + +   +  F  +E   R     W      +  P +    IA+VGKY    DAYLS++ SL+ ++      + I ++NS  +  +     L++   I+VPGGFG R ++GKI AIQYAR+N +PF G+CLGMQ A IE+AR++  + DA+S EFN  T NP+I +L  +    +LGGT+RLG Y C L   +    +Y +++IV ERHRHRYEFN  +  +F + G+V SG + +  LVE+IEL +H FFIA QFHPEF S+   P+P+F
  S:     2 TKFVFVTGGVVSSIGKGIVAASLGRLLKSRNYSVSILKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTDTAMSRLNSVTTGSIYQSVLNKERRGDYEGGTVQVIPHITNEIKDRIKRVAKQATPDVLIIEIGGTVGDIESLPFLEAIRQFRKDVGRDNILYTHVTLMPWIPAAGEMKTKPTQHSVKELRSIGIQPDILVCRCDRPLSEGIKEKVSEFCDVPVEAVITSQDASSIYAVPLILEQEGLAQQVLKFMHLE-QRRPDLTQWQALVHQLDHPSQ-TIEIALVGKYVQLSDAYLSVVESLQHAAVAQGIAVQIRWVNSEEIEAHGPDRYLADAAGIIVPGGFGIRGVDGKIAAIQYARDNQVPFLGLCLGMQCAVIEWARHIAGLEDANSAEFNPETRNPVINLLPEQQDVVDLGGTMRLGLYPCRLLPDTLASRLYPQETIVYERHRHRYEFNNAFRPLFLESGYVVSGTSPDGRLVEMIELPSHPFFIATQFHPEFRSRPNDPHPLF 522
>gi|123969431|ref|YP_001010289.1| CTP synthetase [Prochlorococcus marinus str. AS9601] >gi|123199541|gb|ABM71182.1| Glutamine amidotransferase class-I:CTP synthase [Prochlorococcus marinus str. AS9601] (536 aa)
Score = 1181, Expect = 2.8e-127, Identities = 238/528 (45%), Positives = 339/528 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE--LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           +K + VTGGV SS+GKG+  +SLG +LK  G  V I+K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++     D +I E+GGTVGDIES+PFLEA R+ +    R+ V +IH   L  + T  ++KTKP QHSVK+L S GI P+LL+ RS  +++  LK+K+S   G+   ++   ++   IY +P SL+ + +      +  +E   +   K+W+     ++ P     ++A+VGKY +  DAYLS++ +L  +    +  L + ++ S+ + ENN +E  L+E DAI+VPGGFG R + GKI AI++AREN IPF G+CLGMQ A IE+ARNV  + DA S+E + NT NP+I +L  +    +LGGT+RLG Y C L   +    +Y    I ERHRHRYEFN  Y   F   G+  SG + +  LVE+IELENH +F+A Q+HPEF S+   P+P+F   +  S+
  S:     2 SKFVFVTGGVVSSIGKGIVAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTAMTRLNSVTTGSIYQAVINKERRGNYNGGTVQVIPHITGEIRERIHRVAANSNADIIITEIGGTVGDIESLPFLEAIREFKNDVNRNDVAYIHVTLLPYIKTSGEIKTKPTQHSVKELRSIGIQPDLLVCRSDKSINEALKKKLSGFCGVNINSVIEALDADSIYSVPLSLKKEGLCKETLKYLDLE-DKKCDLKNWEQLIHNLRNPGD-PIKVALVGKYIELGDAYLSVVEALRHACIEQRALLDLHWV-SAEMIENNSAETYLNEVDAIVVPGGFGNRGVNGKISAIKFARENKIPFLGLCLGMQCAVIEWARNVANLPDASSSELDPNTPNPVIHLLPEQEDVVDLGGTMRLGVYPCRLTKNTTGKNLYDEDVIYERHRHRYEFNNYYKQSFLDSGYKISGTSPDGRLVELIELENHPYFLACQYHPEFLSRPGKPHPLFKGLIKASQ 529
>gi|159906143|ref|YP_001549805.1| CTP synthetase [Methanococcus maripaludis C6] >gi|159887636|gb|ABX02573.1| CTP synthase [Methanococcus maripaludis C6] (533 aa)
Score = 1181, Expect = 3.0e-127, Identities = 244/526 (46%), Positives = 342/526 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-------SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+  SSLG +LK  G  V ++K DPYL +DAGTM+P +HGEVFVT DG ETDLD+GNYERF++I L  ++N+T G++Y+  ++KER G +LG T+QV+PHIT  I  +I  L      D  I+E+GGTVGDIES+PFLEA RQ +    +  V+++H   L  + +  +LKTKP QHSVK+L   GI P++L+ RS+  +S K+K+K++L   +E E +    + + IY +P +LE + +   +    K++   P+      W      I  P   +  I VVGKY +  DAY+SI+ +L  +     T ++I ++N+  L   N  E+        + D ILVPGGFG R I+GKI A++YARENN+PF GICLGMQ A IEFARNV  +  A+STEF+E T +P+I  +  +   T  GGT+RLG Y   L + S   E+Y   +  ERHRHRYE NP+Y +I +K+G + SG++ +  L E IELENHK+FIA Q HPEF S+   P+P+F+  +  S
  S:     2 KYIFVTGGVVSSLGKGITSSSLGRLLKARGLNVNMIKIDPYLQIDAGTMSPFEHGEVFVTDDGGETDLDLGNYERFVDIGLKADNNITTGKIYWSVLSKERRGDYLGKTVQVIPHITNEIKDRIKALGK--DSDITIIEIGGTVGDIESLPFLEAIRQFKKDVGKENVLYVHVSLLPYIRSAGELKTKPTQHSVKELKGIGIQPDILVCRSEIPISEKIKDKLALFCDVEKEAVIECKDARTIYEVPLNLEKEGLGKLVTEKLKLKDSTPD---LSEWRAIVDRIINPMN-EVTIGVVGKYVELKDAYMSIMEALGHAGAKNDTKVNINWVNAEELENKNYKEVLDKLVEDEKLDGILVPGGFGDRGIDGKINAVRYARENNVPFLGICLGMQCAVIEFARNVCGL-KANSTEFDEETEHPVIDYIPEQREITEKGGTMRLGAYPAILTENSLANELYGSINASERHRHRYEVNPEYHEILKKNGLIISGMSPDGKLAEFIELENHKYFIATQAHPEFKSRPNKPHPLFHGLVKAS 530
>gi|21672672|ref|NP_660739.1| CTP synthetase [Buchnera aphidicola str. Sg (Schizaphis graminum)] >gi|24212099|sp|P59039|PYRG_BUCAP CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|21623310|gb|AAM67950.1| CTP synthase [Buchnera aphidicola str. Sg (Schizaphis graminum)] (553 aa)
Score = 1180, Expect = 3.2e-127, Identities = 250/521 (47%), Positives = 351/521 (67%)
  Q:     8 LIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILE------------GKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           + +TGGV SSLGKG+A +SLGA+L+    ++ IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   +   +N T G +Y E + KER G +LG+TIQV+PHIT AI  +IIL S     D ++VE+GGTVGDIES+PFLEA RQL     R  V++IH   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS+  V    ++KI+L   +    + SL ++  IY +P+ L++QK+ N I  +FK+ VP +   K W+      K   K +  I ++GKY   PDAY S+I +L+ +    K  + IE INS  +   N   L   + IL+PGGFG R I GK+L++QYARENNIP+FGICLGMQ+A IEFA+NV+ + +A+STEF+     P+I +++             KN ++N GGT+RLG+  C+L   S   ++YK+ +I+ERHRHRYE N   +   EK+G   +G +K+NN+VEIIE+ +H +FI  QFHPEFTS     +P+F  F+
  S:     6 IFITGGVVSSLGKGIAAASLGAVLEARNLKITIMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMTCLNNFTTGSIYSEVLKKERRGDYLGSTIQVIPHITNAIKDRIILCSK--NSDIILVEIGGTVGDIESLPFLEAIRQLAVDIGRKNVIYIHLTLVPYIKTAGEIKTKPTQHSVKELLSIGIQPDILICRSQKTVPINERKKIALFCNVPVNAVISLKDVDSIYTIPKLLKDQKLDNYICEYFKLNVP-QADLKEWEKVIYEEKNASK-EIIIGIIGKYIKLPDAYKSVIEALKHAGLKNKIKVKIELINSQEIENKNFKLLQNLNGILIPGGFGDRGIIGKLLSVQYARENNIPYFGICLGMQIAIIEFAQNVIGIKEANSTEFDPQCKFPVIDLIKTKKNDIKDTRQGKKNNKSNFGGTMRLGSQPCKLIFNSLSRKLYKKDTIIERHRHRYEVNNFLLKKIEKNGLKIAGRSKKNNIVEIIEIFDHPWFIGCQFHPEFTSTPRDGHPLFIDFI 535
>gi|88812395|ref|ZP_01127645.1| CTP synthetase [Nitrococcus mobilis Nb-231] >gi|88790402|gb|EAR21519.1| CTP synthetase [Nitrococcus mobilis Nb-231] (557 aa)
Score = 1180, Expect = 3.7e-127, Identities = 232/527 (44%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIH--TVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + +TGGV SSLGKG+A +SLG++L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   +  ++N T GR+Y   I KER G +LG+T+QV+PHIT+ I + I   ++    D ++VE+GGTVGDIES+PFLEA RQ+ ++  R + +++H   VP I +    ++KTKP QHSVK+L S GI P++L+ R+  A+  + + KI+L T ++ + + + +++ +IY +PE L  QK+   +     +E+P       W      ++ PK  +  +A+VGKY +  DAY+S+  +L  +    +  + I +++S  +       L++ DAILVPGGFG+R +EGKI A  YAR   IP+ GICLGMQ+A IEFARNV  +  A STEF  +   P+I ++          E ++  ++LGGT+RLG+  C L   + +  IY +  I ERHRHRYEFN +Y ++ E+ G   SG +++N LVE++EL +H +F+A QFHPEFTS     +P+F  FL  +
  S:     2 TRFIFITGGVVSSLGKGIAAASLGSILQARGLNVTLVKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFVRTRMTCDNNYTTGRIYESVIRKERRGDYLGSTVQVIPHITDEIKRCIKQGADA--ADVVLVEIGGTVGDIESLPFLEAIRQMGSELGRERCLYLHLTLVPFIGV--AGEMKTKPTQHSVKELRSIGIQPDILVCRAARAIPEEERRKIALFTDVQPQAVIAALDVDNIYKVPELLHRQKLDQIVAEKLGLELPP-ANLADWHRVVQAMEYPKG-RVTVAMVGKYVNLTDAYISLNEALRHAGVQTRLKIDIRYVDSEEIEREGPGVLADVDAILVPGGFGERGVEGKISAAGYARRQRIPYLGICLGMQVAVIEFARNVGGLEGAHSTEFLAHPQYPVIGLISEWMTPEGLAEYRDEHSDLGGTMRLGSQACRLVPTTLVHRIYGKDMIRERHRHRYEFNNRYAEVLEQAGLQISGWSRDNRLVEVVELPDHPWFLACQFHPEFTSAPRDGHPLFTQFLRAA 535
>gi|152979704|ref|YP_001345333.1| CTP synthetase [Actinobacillus succinogenes 130Z] >gi|150841427|gb|ABR75398.1| CTP synthase [Actinobacillus succinogenes 130Z] (542 aa)
Score = 1180, Expect = 3.9e-127, Identities = 245/529 (46%), Positives = 343/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T  + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T G++Y E + KER G +LGATIQV+PHIT  I  ++I  +  Y  D  I+EVGGTVGDIES+PFLEA RQL  +  R + +F+H   +  + T  ++KTKP QHSVK+L+S GI P++L+ RS   +    + KI+L   +  + + SL +++ IY +P  L++Q +   + N F +E         W+        P   +  I +VGKY + PDAY S+  +L+ +    +  + I++I+S  +       L + D ILVPGGFG R +EGKIL  QYARENNIP+ GICLGMQ A IE+ARNV  M DA+S+EF ++ A P+I ++          E ++  ++LGGT+RLG   C L +GSK  E+Y +++I ERHRHRYE N   +   E  G   +G++ +  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+  +K+
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAALLEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTQDGAETDLDLGHYERFIRTKMTKRNNFTTGKIYSEVLRKERRGDYLGATIQVIPHITNEIKARVIDGAAGY--DVAIIEVGGTVGDIESLPFLEALRQLAVQVGRERTIFMHLTLVPYIPTAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRMIPANERSKIALFCNVPEKAVISLKDVESIYQIPALLQSQGLDEFVCNRFHLE-GKPADLSEWEQVLYRQANPTG-EVTIGMVGKYVELPDAYKSVNEALKHAGLTNRLTVHIKYIDSQDVETKGTDVLKDLDGILVPGGFGYRGVEGKILTAQYARENNIPYLGICLGMQTALIEYARNVAGMKDANSSEFVKDCAYPVIGLITEWQDAEGNVEQRSENSDLGGTMRLGAQQCHLIEGSKARELYGKETIEERHRHRYEVNNTLLPQIEAAGLKVTGLSADRKLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAAKE 538
>gi|71737563|ref|YP_275960.1| CTP synthetase [Pseudomonas syringae pv. phaseolicola 1448A] >gi|119391149|sp|Q48F77|PYRG_PSE14 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|71558116|gb|AAZ37327.1| CTP synthase [Pseudomonas syringae pv. phaseolicola 1448A] (543 aa)
Score = 1179, Expect = 4.2e-127, Identities = 236/527 (44%), Positives = 338/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+      R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   +    + KI+  T +E   + +L +   IY +P  L +Q + + +   F ++         WD        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +       L   DAILVPGGFG R +EGKI A+Q+AREN +P+ GICLGMQ+A IEFARNVL   DA+STEFN  +A+ ++ ++          E +   ++LGGT+RLG  +C+L+ GS + + Y++  IVERHRHRYE N   +    + G   SG + +  LVE++E  +H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRVYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRFEVGARRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDHPIDVSSRRKIAQFTNVEERAVIALEDADTIYKIPGILHSQGLDDFVVERFGLQCEG-ADLSEWDKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTGLLEGVDAILVPGGFGLRGVEGKITAVQFARENKVPYLGICLGMQVAVIEFARNVLGWKDANSTEFNRTSAHAVVGLITEWEDATGAVETRTESSDLGGTMRLGAQDCQLEAGSLVHDCYRKDVIVERHRHRYEVNNNLLPQLIEAGLKISGRSGDGALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|110004195|emb|CAK98533.1| ctp synthase protein [Spiroplasma citri] (531 aa)
Score = 1179, Expect = 4.6e-127, Identities = 247/528 (46%), Positives = 344/528 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV S LGKG+  SS+G +LK  G  V + KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ NL KESN+T+GR+Y   I KER G++ G T+QVVPH+T  I +K+   ++  + D +I E+GGTVGDIES+PF+EA RQ++ +  R  V+++H   +  +    + KTKP QHSV++L+S GI P++++ R++ A+ + + EKI+L   IE  N+    ++  IY +P  +  Q  Q  I     +++  +     W  F   I + ++    I +VGKY + PDAYLS+  SL I+ +  K  + I++I +  +N+ N  + L     ILVPGGFG+R  EGKILA Q+ARENNIPFFGIC GMQ A IEFARNV  + DA+S+E  E T N II I+ GK++   LGGTLRLGNY       +   ++Y +   +ERHRHRYE N  Y +   + G VFSG+  E NLVE+IE+  + F++A Q+HPEFTS+   PNP+F  F+    K
  S:     3 KYIFVTGGVVSGLGKGITASSIGVLLKASGLNVFMQKFDPYLNVDPGTMSPYQHGEVFVTTDGAETDLDLGHYERFIDENLTKESNITSGRIYKNVIEKERRGEYDGGTVQVVPHVTNEIKKKVYHAASTSKADIIITEIGGTVGDIESLPFIEAIRQVRMEQGRENVIYMHVSLVPYIAASKESKTKPTQHSVRELLSLGIQPDIVVARTEQALDDNVLEKIALFCNIEKSNVLVATDVASIYEVPLKMYEQNAQIVISKLLNLKI-TKTDMSEWKRFVEKINQSQQV-IEIKLVGKYIELPDAYLSVSESLRIAGYENKVKIKIDWIKAEDINKKNYQQLLKNAKGILVPGGFGERGFEGKILACQFARENNIPFFGICFGMQAAVIEFARNVCHIQDANSSELTE-TKNAIIDIIRGKDKTDALGGTLRLGNYKTTFVPNTLAHKLYGKNEALERHRHRYEVNNDYREQLAQAGLVFSGLYVEKNLVEVIEIPKYPFYLAAQYHPEFTSRPNKPNPLFNGFVQAVIK 529
>gi|73666747|ref|YP_302763.1| CTP synthetase [Ehrlichia canis str. Jake] >gi|119391104|sp|Q3YSZ0|PYRG_EHRCJ CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|72393888|gb|AAZ68165.1| CTP synthase [Ehrlichia canis str. Jake] (538 aa)
Score = 1178, Expect = 5.4e-127, Identities = 240/527 (45%), Positives = 344/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGI--NKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           ++ + VTGGV SSLGKG+A +S+GA+L+  G ++ + K DPYLN+D GTM+P QHGEVFVT DG ETDLD+G+YERF  +   K  N+T G+VY+  + KER G +LG T+Q++PH+T+ I+    +L N    DF+I E+GGTVGDIES PFLE+ RQ+  K  ++  +F+H   +  +    +LKTKP QHSVK+L + GI P+++L RSK  +S + ++KI+    +   NI   +++K+IY LP S  N  +   I   F +  P+      W+   ++     K    +A++GKY    DAY S+I +LE +S + +  LSI +I+S SL+ N I+     D+IL+PGGFG   ++GKI AI +AR N IPF GIC+GMQLA +EFA NV  + DA+STEFN    NP+I  L  + ++  LGG+++LG+  C L   SKI  IY++  I ER RHRY FN +Y D+ E+HG  F+G   N +++L+E+IEL NH +FI VQFHPEF S     +P+F SF+  S
  S:     7 SRFIFVTGGVVSSLGKGLAAASIGALLQARGFKICLRKLDPYLNIDPGTMSPIQHGEVFVTDDGAETDLDLGHYERFTGVKTTKNDNITTGKVYHNLLKKERRGDYLGQTVQIIPHVTDLINS--FILHNTEGLDFVICEIGGTVGDIESQPFLESIRQIGYKLSKNNTIFVHLTLVPYIDAAMELKTKPTQHSVKELSAVGIQPDIILYRSKIPLSKEQRDKIANLCNVSPTNIIPALDVKNIYELPISYHNYNLDTQILKHFNVNSPDP-NLSKWENILNISHTLTK-TVTVAIIGKYIKLLDAYKSLIEALEHASIHNRVKLSIRWIDSRSLDSNGINAFDNVDSILIPGGFGDDGVKGKITAITHARLNKIPFLGICMGMQLAIVEFANNVAHLEDANSTEFNLYCKNPVIHQLP-ELQQNFLGGSMKLGSCPCYLDANSKIFSIYQQSVINERRRHRYTFNLQYKDLLEQHGLTFTGKANNTDDSLIEVIELNNHPWFIGVQFHPEFKSSPFHSHPLFISFIKAS 531
>gi|16330891|ref|NP_441619.1| CTP synthetase [Synechocystis sp. PCC 6803] >gi|2494761|sp|P74208|PYRG_SYNY3 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|1653385|dbj|BAA18299.1| CTP synthetase [Synechocystis sp. PCC 6803] (552 aa)
Score = 1178, Expect = 5.4e-127, Identities = 228/529 (43%), Positives = 335/529 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRI-GYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +K + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I KER G ++G T+QV+PHIT  I ++I+ ++    PD +I E+GGTVGDIES+PFLEA RQ + +  R  V+++H   +  +    ++KTKP QHSVK+L S GI P++L+ R    +   +KEK+S    +  E++ +  +   IY +P  LE + + +      +ME  NR      W +    ++ P  +   +A+VGKY    DAYLS++ +L  ++    + L + +I++  +     +  L + D +LVPGGFG R ++GK+ AI+YAREN +PF G+CLGMQ + IE+ARNV K+ +A+S EF   T NP+I +L  +    +LGGT+RLG Y C +   +    +Y+++ + ERHRHRYEFN  Y   F   GFV SG + +  LVEI+E  +H FFIA QFHPEF S+    +P+F  F+N   K
  S:     2 SKFVFVTGGVVSSIGKGIVAASLGRLLKSRHYSVSILKLDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTSMSRLNSVTTGSIYQAVINKERRGAYMGGTVQVIPHITNEIKERILRVAQNTNPDVVITEIGGTVGDIESLPFLEAIRQFRKEVGRHNVIYMHVTLIPWIPAAKEMKTKPTQHSVKELRSIGIQPDILVCRCDRPLHPGMKEKLSEFCDVPVESVITCQDASSIYEVPLILEKEGLAHQTLELLRME--NRSPDLSQWQSLVEKMQSPH-HDITVALVGKYVQLSDAYLSVVEALGHAAIASDSKLHLRWISAEEIEAQGAATFLKDVDGVLVPGGFGIRGVDGKVQAIEYARENQLPFLGLCLGMQCSVIEWARNVAKLPEANSAEFETETPNPVINLLPEQQDVVDLGGTMRLGLYPCRIAPDTLAFSLYQKEVVYERHRHRYEFNNSYRTQFTDTGFVVSGTSPDGRLVEIVEYPHHPFFIACQFHPEFHSRPNQAHPLFSGFINAVLK 530
>gi|86140338|ref|ZP_01058897.1| CTP synthetase [Flavobacterium sp. MED217] >gi|85832280|gb|EAQ50729.1| CTP synthetase [Leeuwenhoekiella blandensis MED217] (546 aa)
Score = 1178, Expect = 5.9e-127, Identities = 230/529 (43%), Positives = 345/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + VTGGV SSLGKG+  +SL  +L+  G  V I K DPY+NVD GT+ P +HGE +VT DG ETDLD+G+YERFLN+N  + +NVT GR+Y   I KER G+FLG T+QVVPHIT  I ++I  L N    D +I E+GGTVGDIES+P++E+ RQL+ +   +  + IH   +  L    +LKTKP QHSVK LM +GI  ++L+ R++  +S+ L+EK++L   +  E +   I+   IY +P  +  + +         +   +      W+ F    K PK  +  I ++GKY +  D+Y SI+ +   +    +  + +  I+S  ++++ I +++S+ D +LV  GFG+R IEGKI A+QYARE+ IPF GICLGMQ+A IEF+RNV  + DA+STE  ++T+ P+I+++E +    ++GGT+RLG ++C+L   S + ++YK + I ERHRHRYEFN KY +  EK G   +G N +  LVEIIE+E+H +F+ VQ+HPE+ S + +P+P+F +++  + K
  S:     4 TKYIFVTGGVSSSLGKGIIAASLAKLLQARGYSVTIQKLDPYINVDPGTLNPYEHGECYVTDDGAETDLDLGHYERFLNVNTSQANNVTTGRIYQSVIEKERRGEFLGKTVQVVPHITNEIKERIKHLGNTGDYDIVITEIGGTVGDIESLPYIESVRQLKWELGDENALVIHLTLVPYLSAAGELKTKPTQHSVKTLMESGIKADILVCRTEHELSDDLREKLALFCNVRKEAVIQSIDASTIYDVPNLMLEEGLDAITLQKLGLSQDSEPELTRWNEFLRRHKNPKA-EVTIGLIGKYVELQDSYKSILEAFIHAGAENEVKVRVVPIHSEFISQDVIQNKISKLDGLLVAPGFGERGIEGKIKAVQYAREHKIPFLGICLGMQMAVIEFSRNVAGLKDANSTEMQKDTSAPVISLMEDQKDLKHMGGTMRLGTWDCKLAADSIVADVYKSELITERHRHRYEFNDKYRETLEKAGLKITGTNPKTGLVEIIEMEDHPWFVGVQYHPEYKSTVANPHPLFVAYVQAAVK 533
>gi|124026868|ref|YP_001015983.1| CTP synthetase [Prochlorococcus marinus str. NATL1A] >gi|123961936|gb|ABM76719.1| Glutamine amidotransferase class-I:CTP synthase [Prochlorococcus marinus str. NATL1A] (555 aa)
Score = 1178, Expect = 6.7e-127, Identities = 227/527 (43%), Positives = 337/527 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           K + VTGGV SS+GKG+  +SLG +LK  G  V I+K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++N    D +I E+GGTVGDIES+PFLEA R+ +    R+ V+++H   L  + T  ++KTKP QHSVK+L S GI P++L+ RS   ++++LK KI    G+ +E + + ++   IY +P +L+++ +   + +   +   +    K W+     ++ P     ++A+VGKY    DAYLS++ +L  +       L + +IN+ ++      +L +  DAI+VPGGFG R + GKI AI++ARE  +PF G+CLGMQ A IE+ARN+  + DA S E N N+ +P+I +L  +    +LGGT+RLG Y C L+  +    +Y  + + ERHRHRYEFN  Y  +  + G+V SG + +  LVE+IEL+NH FFIA Q+HPEF S+   P+P+F   +  ++
  S:     3 KFVFVTGGVVSSIGKGIVAASLGRLLKSKGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTAMSRLNSVTTGSIYQAVINKERRGDYDGRTVQVIPHITREIRERIKRVANNSGADVVISEIGGTVGDIESLPFLEAIREFKGDVKRNDVVYVHVTLLPYIGTSGEIKTKPTQHSVKELRSIGIQPDILVCRSDRPINDELKNKIGGFCGVNSEAVIASLDADSIYSVPLALKDEGLCKEVLDCLDLN-DHESDLKDWERLVHKLRNPGP-SVKVALVGKYVQLNDAYLSVVEALRHACISHDASLDLHWINAENIESEGAEKLLQGMDAIVVPGGFGNRGVNGKIAAIRWAREQRVPFLGLCLGMQCAVIEWARNIAGLEDASSAELNPNSKHPVIHLLPEQQDVVDLGGTMRLGVYPCRLQANTTGQSLYNEEVVYERHRHRYEFNNSYRTLLMESGYVISGTSPDGRLVELIELKNHPFFIACQYHPEFLSRPGKPHPLFGGLIQAAQ 529
>gi|156742912|ref|YP_001433041.1| CTP synthetase [Roseiflexus castenholzii DSM 13941] >gi|156234240|gb|ABU59023.1| CTP synthase [Roseiflexus castenholzii DSM 13941] (555 aa)
Score = 1177, Expect = 7.0e-127, Identities = 234/523 (44%), Positives = 338/523 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHD-ADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           K + VTGGV SS+GKG+  +S+G +LK  G  V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+++NL + SNVT G++Y   I KER G +LG TIQV+PHIT  I  +I  ++ +   + +IVE+GGTVGDIE +PFLEA RQ++    R  V++IH   L  +    ++KTKP QHSV +L   GI  ++++ RS   +++++++KI+L   ++ E +  L  ++ IY +P  LE   + N +     + V  PN      W    + IK PK+ K  IA+VGKY +  DAY+S++ +L  +  +   D+ I +I+S  + E      L +   I+VPGGFG R IEGKI A  YARE+ +P+ G+CLGMQ+A+I FAR+V+     A+STEF+ +T +P+I  +  +   T+ GGT+RLG Y C L  G++    Y    +VERHRHR+EFN KY  + E  G V SG + +  LVEIIEL +H +++ VQFHPEF S+   P+P+F  F+
  S:     3 KYIFVTGGVASSVGKGITVASIGRLLKARGVRVSVQKLDPYINVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDVNLTRLSNVTTGQIYSAVIQKERRGDYLGGTIQVIPHITNEIKARIAAVARQTGAEVVIVEIGGTVGDIEGLPFLEAIRQMRKDVGRDNVLYIHVTLLPHIGATGEVKTKPTQHSVMELRRVGITADVIVCRSDYPIADEIRDKIALFADVDVEAVVPLHTVESIYEVPLVLEEAGLGNYLTLRLGLGVREPN---LDDWRDLVARIKAPKR-KLAIALVGKYVELHDAYISVVEALRHAGLHQGVDVDIRWISSEQIEEEGCEPLLRDVYGIVVPGGFGDRGIEGKIAAAGYAREHGVPYLGLCLGMQVATISFARHVIGAESRANSTEFDLHTPHPVIDFMPDQLDITDKGGTMRLGGYPCRLLPGTRAHAAYGVDQVVERHRHRFEFNNKYRRLLESAGLVVSGQSPDGRLVEIIELRDHPWYVGVQFHPEFRSRPERPHPLFRDFI 526
>gi|71891944|ref|YP_277674.1| CTP synthetase [Candidatus Blochmannia pennsylvanicus str. BPEN] >gi|119391077|sp|Q493N6|PYRG_BLOPB CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|71796050|gb|AAZ40801.1| CTP synthetase [Candidatus Blochmannia pennsylvanicus str. BPEN] (548 aa)
Score = 1177, Expect = 7.0e-127, Identities = 244/528 (46%), Positives = 341/528 (64%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILE----------GKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +   + VTGGV SSLGKG+A +SL A+L+  G  V I+K DPY+N+D GT++P QHGEVF+T DG ETDLD+G+YERF+   +   +N TAG++Y + + KER G +LGATIQ++PH+T+ I  K  L++  +  D L+VE+GGTVGDIES+PFLEA RQ+  +  R Q ++IH   +  +    +LKTKP QHSVK+L+S GI P++L+ RS   +SN  ++KISL   +  + I +L ++  IY +P  L++Q + N I   F +  P       W+      + P   +  + +VGKY +  DAY S+  +L+ +    +  ++I  INS  + +  I + L   DAILVPGGFG R +EGKIL+ QYARENNIP+FGICLGMQ+A IEFAR+V  M +A+STEF  N   P+I ++             N  TNLGGT+RLGN  C L  GS   +IY + +I+ERHRHRYE N   +      G    G +K+NNLVE+IE  NH +FI  QFHPEF S     +P+F  F+  +
  S:     2 RVNYIFVTGGVVSSLGKGIATASLAAVLEARGLSVTIIKLDPYINMDPGTISPVQHGEVFITEDGAETDLDLGHYERFIRTKMRHHNNFTAGKIYADVLRKERRGDYLGATIQIIPHVTDTI--KKWLIAGAFGHDVLLVEIGGTVGDIESLPFLEAIRQMVMEVNREQTLYIHLTLVPFIAVSGELKTKPTQHSVKELLSIGIQPDILICRSDRVISNSERKKISLFCNVPKQAIIALQDVDSIYKIPALLKDQGLDNYICKRFNLNCP-EANLSDWEEVIYYQEHPIG-EVTVGMVGKYIELVDAYKSVTEALKHAGIKNRFIVNIRLINSQDVEKLGIEKTLKGLDAILVPGGFGYRGVEGKILSAQYARENNIPYFGICLGMQVALIEFARHVAGMPEANSTEFVTNCKCPVIALITECKDENGIFITHNDNTNLGGTMRLGNQACYLIKGSLTHQIYGKSTILERHRHRYEVNNMLLKHITHAGLSCVGFSKKNNLVEVIEYPNHPWFIGSQFHPEFNSTPREGHPLFIGFIKAA 537
>gi|150402068|ref|YP_001329362.1| CTP synthetase [Methanococcus maripaludis C7] >gi|150033098|gb|ABR65211.1| CTP synthase [Methanococcus maripaludis C7] (533 aa)
Score = 1177, Expect = 7.2e-127, Identities = 244/526 (46%), Positives = 340/526 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-------SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+  SSLG +LK  G  V ++K DPYL +DAGTM+P +HGEVFVT DG ETDLD+GNYERF++I L  ++N+T G++Y+  ++KER G +LG T+QV+PHIT  I  +I  L      D  I+E+GGTVGDIES+PFLEA RQ +    +  V++IH   L  + +  +LKTKP QHSVK+L   GI P++L+ RS+  VS K++EK++L   +E E +    + + IY +P +LE + +   +     ++   P+      W      I  P   +  I +VGKY +  D+Y+SI+ +L  +     T ++I +INS  L   N  E+        +   ILVPGGFG R I+GK+ A++YARE NIPF GICLGMQ A IEFARNV  +  A+STEF+E T NP+I  +  +   T  GGT+RLG Y   L + S   E+Y   ++ ERHRHRYE NP+Y +I +K+G + SG++ +  L E IELENHK+FIA Q HPEF S+   P+P+FY  +  +
  S:     2 KYIFVTGGVVSSLGKGITASSLGRLLKARGLNVNMIKIDPYLQIDAGTMSPFEHGEVFVTDDGGETDLDLGNYERFVDIGLKADNNITTGKIYWSVLSKERRGDYLGKTVQVIPHITNEIKDRIKALGK--DSDITIIEIGGTVGDIESLPFLEAIRQFKKDVGKENVLYIHVSLLPYIRSAGELKTKPTQHSVKELKGIGIQPDILVCRSEIPVSEKIREKLALFCDVEKEAVIECKDARTIYEVPLNLEKEGIGKLVTEKLNLKDSTPD---LTEWRAIVDRIINPMN-EITIGIVGKYVELKDSYMSIMEALGHAGAKNDTKVNIAWINSEELETKNYVEILDKMVDDEKLHGILVPGGFGDRGIDGKVNAVRYAREKNIPFLGICLGMQCAVIEFARNVCGL-KANSTEFDEETENPVIDYIPEQREITEKGGTMRLGAYPAILTEHSLASELYGSINVSERHRHRYEVNPEYHEILKKNGLIISGMSPDGKLAEFIELENHKYFIATQAHPEFKSRPNKPHPLFYGLIKAA 530
>gi|148653467|ref|YP_001280560.1| CTP synthetase [Psychrobacter sp. PRwf-1] >gi|148572551|gb|ABQ94610.1| CTP synthase [Psychrobacter sp. PRwf-1] (543 aa)
Score = 1177, Expect = 7.7e-127, Identities = 240/527 (45%), Positives = 350/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFL-NINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+  +SL A+L+  G +V + K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G YERFL +  + K +N T+GR+Y   + KER G +LG T+QV+PHIT+ I  +I      +  D  I+E+GGTVGDIES+PF+EA RQ+Q +  R++ M +H   +  + +  + KTKP QHSVK+L S G+ P++L+ RS+ A+  + + KI+L T +E   + +  +   IY +P +L  Q + + I   F ++ P       WD     +   +  K  +A+VGKY + PDAY SI  +L  +    KT + I+++++ +L  ++  ++ L + D+ILVPGGFG+R   GK+ AI++AREN +P+ GICLGMQLA IE+A NVL + +ADSTEFN   A PII +          L+ +  +++LGGT+RLG+   EL +GSK+ +IY  K I ERHRHRYE N +Y++  E+ G   SG + + +LVE +E+ +H +FI VQFHPEFTS     +P+F SF+  +
  S:     2 TKFIFVTGGVVSSLGKGITAASLAAVLEARGLKVTMTKMDPYINVDPGTMSPFQHGEVFVTEDGAETDLDLGYYERFLRHSKMSKTNNFTSGRIYQTVLNKERRGDYLGGTVQVIPHITDEIKHRIHASGEGH--DIAIIEIGGTVGDIESLPFMEAVRQMQVELGRNRAMLMHLTLVPYISSAGETKTKPTQHSVKELRSIGLQPDVLICRSEHAIGEENRRKIALFTNVEERAVITCEDADTIYQIPRTLYEQDLDDIICERFGIDAP-EADLSDWDKVVDGLLNAQG-KVTVAIVGKYVELPDAYKSINEALLHAGITHKTQVEIDYVDAEALETDDSLLARLEQADSILVPGGFGERGKLGKMRAIKFARENKMPYLGICLGMQLAVIEYATNVLGL-EADSTEFNRKAAEPIIGLITEWLDEKGELQVRTDDSDLGGTMRLGSQKAELVEGSKLHQIYGAKLITERHRHRYEMNNRYIEPLEQAGMSISGYSAKQHLVESVEIADHPWFIGVQFHPEFTSSPREGHPLFASFVKAA 537
>gi|91776263|ref|YP_546019.1| CTP synthetase [Methylobacillus flagellatus KT] >gi|119391129|sp|Q1H009|PYRG_METFK CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|91710250|gb|ABE50178.1| CTP synthase [Methylobacillus flagellatus KT] (542 aa)
Score = 1177, Expect = 7.8e-127, Identities = 242/524 (46%), Positives = 345/524 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIG-YKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIEL--ENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + VTGGV SSLGKG+A +SLGA+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + K +N T G++Y   I KER G++LG T+QV+PHIT+ I   +         D  IVEVGGTVGDIES+PFLEA RQ+  +  RS   F+H   L  + T  +LKTKP QHSVK+L   GI P++LL R+  A+    K KI+L T + +E + S+++   IY +P  L +Q +   + +  K+ +  R      W+     +K P K++  +A VGKY D  ++Y S+  +L  +  + ++ ++I +I+S  + ++   EL + DAILVPGGFGKR  EGKI AI+YARE+  P+ GICLGMQLA IEFARNV  + DA+STEF+ +T +P++ ++          E ++ +++LGGT+RLG   C +   +K   IY  + + ERHRHRYE N  Y+D  EK G V S       L E++EL  E H +F+A QFHPEFTS   + +P+F +++
  S:     2 TKFVFVTGGVVSSLGKGIAAASLGAILESRGIKVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFISARMGKRNNFTTGQIYETVIKKERRGEYLGKTVQVIPHITDEIKAHV--KRGAEGADVAIVEVGGTVGDIESLPFLEAIRQMGIEEGRSNTCFMHLTLLPWIPTAGELKTKPTQHSVKELREIGIQPDILLCRADRAIPEDEKRKIALFTNVPHEAVISVVDADSIYSIPRMLHDQMLDEIVCH--KLNLLARAADLSSWNRIVHALKNP-KHEVNVAFVGKYVDLTESYKSLTEALIHAGIHNESKVNIHYIDSEEVEKHGTGELEKMDAILVPGGFGKRGTEGKIAAIRYARESKTPYLGICLGMQLAVIEFARNVAGLKDANSTEFDPHTPHPLVGLITEWKNADGKVEQRSEDSDLGGTMRLGAQKCPIVPDTKAFTIYGAE-VNERHRHRYEVNNHYVDKLEKAGLVVSARTPTEQLCEMVELPSEVHPWFVACQFHPEFTSNPRTGHPLFNAYI 533
>gi|88607103|ref|YP_504672.1| CTP synthetase [Anaplasma phagocytophilum HZ] >gi|119391072|sp|Q2GLS9|PYRG_ANAPZ CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|88598166|gb|ABD43636.1| CTP synthase [Anaplasma phagocytophilum HZ] (541 aa)
Score = 1177, Expect = 8.1e-127, Identities = 237/526 (45%), Positives = 335/526 (63%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKN--RETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           + T+ + VTGGV SSLGKG+A +S+GA+L+  G  V + K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF  +   +  NVTAG++Y+E I KER G +LG T+QV+PH+ + I   I  L N    DF+I E+GGTVGDIES PFLEA RQ+  +  ++  +F+H   +  +    +LKTKP QHSVK+L S GI P+++L RS+  +      KI+    +  +NI + +++ +IY+LP      ++   I   F ++ P       W+    +  E    +  IA+VGKY  S DAY S+  +L  +  +    + I++++ + L  + I +L++ DAIL+PGGFG   I  KI AI+YAR NNIP  GICLGMQLA IEFA NV  + DA+STEF  +  NP++  L G     E  +GG++RLG+Y C L  GS+I+ IY   ++VER RHRY  NP+Y D+  K G  F+G  ++ +L E++EL +H +FI VQFHPEF S     +P+F SF+
  S:     6 NPTRFIFVTGGVVSSLGKGLAAASIGALLQARGFSVRLRKLDPYLNVDPGTMSPAQHGEVFVTSDGGETDLDLGHYERFTGVMKTRADNVTAGKIYHELIVKERRGDYLGQTVQVIPHVIDLIISCI--LHNDAGADFVICEIGGTVGDIESQPFLEAIRQVSYRLSKNLTIFVHLTLVPYIGAVGELKTKPTQHSVKELSSLGIQPDIVLYRSRAQLPQYQCAKIANFCNVAEDNIIAALDVSNIYMLPVMYHEHRLDTQILKHFDVDSPEP-DLTQWENVLRM-SETASDRIVIAIVGKYVTSLDAYTSLEEALRHAGLHSGIRVEIKWVD-ARLPASEI-DLTDADAILIPGGFGDNGIGTKICAIEYARVNNIPMLGICLGMQLAVIEFALNVAGIEDANSTEFKSDCKNPVVCELPGLQVGDEYKMGGSMRLGSYTCNLAPGSRIMSIYDSSTVVERRRHRYGINPEYRDVLSKCGLAFTGAAEDRDLPEVLELPDHPWFIGVQFHPEFQSTPFKSHPLFLSFV 528
>gi|158520358|ref|YP_001528228.1| CTP synthetase [Desulfococcus oleovorans Hxd3] >gi|158509184|gb|ABW66151.1| CTP synthase [Desulfococcus oleovorans Hxd3] (553 aa)
Score = 1177, Expect = 8.2e-127, Identities = 231/531 (43%), Positives = 352/531 (66%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKM--EVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL-----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +  K+K + VTGGV SSLGKG+A +S+GA+L+  G  V I K DPY+NVD GTM P QHGEVFVT DG ETDLD+G+YERF +  + + +N T G++Y+  I+KER G +LG T+QV+PHIT+ I + I ++ N    D +I E+GGT+GDIES+PFLEA RQ++    +  V++IH   +  + T  ++KTKP QHSVK+L S GI P++LL R+   +S++LK KI+L   +  + + +  ++ +IY +P +   + + + I     +    P R+ +  W+  +S IK P ++   IA+VGKY++  ++Y S+  +L    F  K+ ++++FI+S ++ + N++E L +   ILVPGGFG R IEGKI A +YAR   +P+FGICLGMQ+A + FAR+V  +  A STEF++NT +P+I ++           + ++ ++++GGT+RLG Y C +   S     Y R +I ERHRHRYEFN  Y    ++ G + SG +    LVEI+E  +H +F+  QFHPEF S+   P+P+F  F+  +
  S:     1 MTSKSKFIFVTGGVVSSLGKGLASASIGALLESRGLTVTIQKLDPYINVDPGTMNPFQHGEVFVTDDGTETDLDLGHYERFTHAVMGRNNNFTTGKIYHSVISKERRGDYLGGTVQVIPHITDEIKRSIRMVEN--DADIVITEIGGTIGDIESLPFLEAIRQMRTDMGKENVLYIHLTLVPYIPTAKEVKTKPTQHSVKELRSIGIQPDILLCRTSGLLSDELKAKIALFCDVSKDAVITAKDVDNIYEVPLNFNREGLDDKIVELLHIWTRAP-RLDF--WENLSSAIKAP-EHDVTIAIVGKYTNLTESYKSLNEALYHGGFANKSRVNLQFIDSETITKENVAEVLKDAHGILVPGGFGPRGIEGKIAACEYARTRKVPYFGICLGMQIAVVTFARHVAGLAGAHSTEFDKNTPDPVIYLMREWFDERLNTIQKRDVDSDMGGTMRLGAYTCAVAPDSLAHTAYGRTTISERHRHRYEFNNDYKATLQEKGLIISGTSPNGELVEIVEAGDHPWFLGCQFHPEFKSRPEDPHPLFREFIKAA 540
>gi|121635211|ref|YP_975456.1| CTP synthetase [Neisseria meningitidis FAM18] >gi|120866917|emb|CAM10677.1| CTP synthase [Neisseria meningitidis FAM18] (544 aa)
Score = 1177, Expect = 8.2e-127, Identities = 240/527 (45%), Positives = 348/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINK-ENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +S+ A+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + + ++ + G+VY   IAKER G +LG T+QV+PHIT+ I ++I   +  Y  D  IVE+GGTVGDIES+PFLEA RQ++++  R+  +F H   +  +    ++KTKP QH+VK+++S G+ P++L+ R    +    + KI+L   +E   I    ++  IY  PE L +Q + N I    ++ V  +     W      I+ P K+  +IA+VGKY D  ++Y S+I +L+ +  + +TD+ I F++S S+ +NN  +S L + DAILVPGGFG R +EGKI A++YARENN+P+ GICLGMQ+A IE+AR+V  +  A+STEF+   A P++ ++          E ++   +LGGT+RLG    ELK GS   +IY  + I ERHRHRYE N  Y+   E+ G V  G++     LVE IEL NH +F A QFHPEFTS     +P+F +F+  +
  S:     2 TKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERRGDYLGGTVQVIPHITDEIKRRIHEGAAGY--DVAIVEIGGTVGDIESLPFLEAIRQMRSQLGRNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRTMPADERRKIALFCNVEERAIVGSYDVDSIYECPEMLHDQGIDNIITEQLQLNV-QQADLTAWKKIVHAIQNP-KHTVKIAMVGKYVDLTESYKSLIEALKHAGIHTETDVQITFVDSESIEKNNGDVSMLKDMDAILVPGGFGSRGVEGKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKGANSTEFDLKCAAPVVALIDEWQTADGSVETRDESADLGGTMRLGAQEVELKAGSLAAKIYGSEHIRERHRHRYEVNNNYVPTLEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAA 538
>gi|15791426|ref|NP_281249.1| CTP synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] >gi|86150534|ref|ZP_01068758.1| CTP synthase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|24212165|sp|Q9PJ84|PYRG_CAMJE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|85838986|gb|EAQ56251.1| CTP synthase [Campylobacter jejuni subsp. jejuni CF93-6] >gi|112359426|emb|CAL34208.1| CTP synthase [Campylobacter jejuni subsp. jejuni NCTC 11168] (543 aa)
Score = 1177, Expect = 8.3e-127, Identities = 250/528 (47%), Positives = 352/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIH--TVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKR-KSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+A +S+  +LK  G +V I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFL+ +L +++N T GRVY   I KER G++LG TIQV+PHI   I  +I         D LIVE+GGTVGDIE +PFLEA R L+ +  ++  M IH   VP I+     +LKTKP QHSV +L   GI P++++ RS+ A+   LK+KI+++ G+E   +   ++   IY +P +   Q + + I     ++   PN    ++WD+    +  P   + +IA VGKY D  ++Y S+  ++  +   L T + +++++S  L     SE+  +   ILV GGFG R +EGKI AIQYAREN IPF GICLGMQLA +EFARNVLK+ D +S+EFNE   NP++ +++           +  +T LGGT+RLG Y C++K+ S + ++Y   KS+ ERHRHRYE NPKY   FEK+G + SG +K   L+E +EL  H FF+AVQFHPEFTS++   NP+  SF+  +
  S:     3 QTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKERRGEYLGKTIQVIPHIVGEIKDRIKKAGEG--KDILIVEIGGTVGDIEGLPFLEAIRALRLEVGKNNAMNIHLTLVPFIK--AAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLKDKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILSPIAEILDLKNLKPN---MENWDSLVKRVIAPSN-EVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESSEVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLKDVNSSEFNEKCQNPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAKVYNEVKSVKERHRHRYEANPKYRADFEKYGLIVSGESK--GLIEAVELNCHPFFLAVQFHPEFTSRLEHVNPVICSFIKAA 537
>gi|167455026|ref|ZP_02321249.1| CTP synthetase [Listeria monocytogenes FSL J2-064] (502 aa)
Score = 1177, Expect = 8.5e-127, Identities = 233/501 (46%), Positives = 331/501 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFI 505
           TK + VTGGV SS+GKG+  +SLG +LK  G  V I KFDPY+NVD GTM+P QHGEV+VT DG ETDLD+G+YERF++INL K SNVT G+VY E I KER G +LG T+QV+PHIT  +  ++   +     D +I E+GGTVGDIES+PFLEA RQ+++   ++ V++IHT  +  +    ++KTKP QHSVK+L S GI PN+++VR++  VS ++K+KI+L   I+   +    + + +Y +P SL+ QK+ + +    ++E P +     W      +K   K K RI +VGKY    DAYLS+  +L  + +    ++ I++I+S  + + N++E + + D ILVPGGFG R IEGKI AI+YAR N +P+FGICLGMQLA++EFARNVL +  A S E    T + II +L  +    N+GGTLRLG Y   +K G+K    Y    + ERHRHRYEFN +Y +  E+ G + S  + +  LVE++EL +H +F+
  S:     2 TKYIFVTGGVVSSIGKGITAASLGRLLKNRGLSVTIQKFDPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKVYSEVIKKERRGDYLGGTVQVIPHITNELKDRVFRAARMTNSDIIITEIGGTVGDIESLPFLEAIRQIKSDVGAENVLYIHTTLIPYIKAAGEMKTKPTQHSVKELRSLGIQPNIIVVRTEQPVSQEMKDKIALFCDIKASEVIESRDEETLYNVPLSLQKQKMDDIVLEHLQLEAP-QAEMTDWKNLVHRVKNLSK-KVRIGLVGKYVSLQDAYLSVAEALRHAGYDHDAEIEIDWIDSEKVTKENVAEIMKDVDGILVPGGFGDRAIEGKIAAIEYARVNKVPYFGICLGMQLATVEFARNVLGLEGAHSAEIEPETKHNIIDLLPEQKNIENMGGTLRLGLYPARIKQGTKAEAAYGTTLVEERHRHRYEFNNEYREQMEEAGMIVSATSPDGRLVEVVELADHPWFV 502
>gi|116625270|ref|YP_827426.1| CTP synthetase [Solibacter usitatus Ellin6076] >gi|116228432|gb|ABJ87141.1| CTP synthase [Solibacter usitatus Ellin6076] (546 aa)
Score = 1177, Expect = 8.5e-127, Identities = 233/526 (44%), Positives = 335/526 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSL-NENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+A +S+G +L+  G +V   KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  L + +N+T+GR+Y + IA+ER G +LG T+QV+PH+T  I   +  +S     D +I E+GGTVGDIES+PFLEA RQ++ +  R   +F+H   +  +    +LKTKP QHSVK+L + GI P++LL R +  +   +KEKI+L   ++ + + +  ++K +Y +P     + V        K+E   R     W+     I++PK  +  IA+VGKY +  D+Y S+  +L       +  ++I +I +  +  EN   +L ++D +LVPGGFGKR I+G + AI++AREN +P+FGICLGMQ   IEFARNV  +  ADSTEFN  T + +I  L        LGGT+RLG++ C+L +GS   + Y  + I ERHRHRYEFN +Y D  +  G   +G   +N  VEI EL +H +F+  QFHPEF SK + P+P+F +F+  +
  S:     3 KYIFVTGGVVSSLGKGIAAASIGCLLESRGLKVTCQKFDPYLNVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTHSKLTQSNNLTSGRIYEQIIARERRGDYLGKTVQVIPHVTNEIKAAMKKVSQDV--DVVIAEIGGTVGDIESLPFLEAIRQMRHEQGRDNCLFVHVTLVPWIAAAQELKTKPTQHSVKELRALGIQPDILLCRCERFIPEDMKEKIALFCDVDVQAVITARDVKSVYEVPVGFAAEGVDEIAMRLLKLEAGPR-DLAKWNAMLDRIEQPKG-EVSIALVGKYVEYEDSYKSLKEALLHGGLAHQLKVNIHWIEAEGVAGENWERQLEDYDGVLVPGGFGKRGIDGMLNAIRFARENKVPYFGICLGMQTLVIEFARNVCGLEAADSTEFNSGTPHRVIFKLRELKGIDELGGTMRLGSWACKLAEGSFAHKAYGTREINERHRHRYEFNREYEDRLKAGGLKITGETPDNTYVEICELGDHPWFLGCQFHPEFKSKPMEPHPLFKAFIGAA 526
>gi|153951536|ref|YP_001397297.1| CTP synthetase [Campylobacter jejuni subsp. doylei 269.97] >gi|152938982|gb|ABS43723.1| CTP synthase [Campylobacter jejuni subsp. doylei 269.97] (543 aa)
Score = 1176, Expect = 8.8e-127, Identities = 249/528 (47%), Positives = 351/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIH--TVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKR-KSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+A +S+  +LK  G +  I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFL+ +L +++N T GRVY   I KER G++LG TIQV+PHI   I  +I         D LIVE+GGTVGDIE +PFLEA R L+ +  ++  M IH   VP I+     +LKTKP QHSV +L   GI P++++ RS+ A+   LK+KI+++ G+E   +   ++   IY +P +   Q + N I     ++   PN    ++WD+    +  P   + +IA VGKY D  ++Y S+  ++  +   L T + +++++S  L     +E+  +   ILV GGFG R +EGKI AIQYAREN IPF GICLGMQLA +EFARNVLK+ DA+S+EF+E   NP++ +++           +  +T LGGT+RLG Y C++K+ S + ++Y   KS+ ERHRHRYE NPKY   FEKHG + SG +K   L+E +EL  H FF+AVQFHPEFTS++   NP+   F+  +
  S:     3 QTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKASILKADPYINVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKERRGEYLGKTIQVIPHIVGEIKDRIKKAGEG--KDILIVEIGGTVGDIEGLPFLEAIRALRLEVGKNNAMNIHLTLVPFIK--AAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLKDKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILNPIAEILDLKNLKPN---MENWDSLVKRVIAPSN-EVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESAEVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLKDANSSEFDEKCENPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAKVYNEAKSVKERHRHRYEANPKYRVDFEKHGLIVSGESK--GLIEAVELNCHPFFLAVQFHPEFTSRLEHVNPVICGFIKAA 537
>gi|161870408|ref|YP_001599580.1| CTP synthetase [Neisseria meningitidis 053442] >gi|161595961|gb|ABX73621.1| CTP synthase [Neisseria meningitidis 053442] (544 aa)
Score = 1176, Expect = 9.6e-127, Identities = 241/527 (45%), Positives = 347/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINK-ENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +S+ A+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + + ++ + G+VY   IAKER G +LG T+QV+PHIT+ I ++I   +  Y  D  IVE+GGTVGDIES+PFLEA RQ++++  R+  +F H   +  +    ++KTKP QH+VK+++S G+ P++L+ R    +    + KI+L   +E   I    ++  IY  PE L +Q + N I    ++ V  +     W      I+ P K+  +IA+VGKY D  ++Y S+I +L+ +  + +TD+ I F++S S+ +NN  +S L + DAILVPGGFG R +EGKI A++YARENN+P+ GICLGMQ+A IE+AR+V  +  A+STEF+   A P++ ++          E ++   +LGGT+RLG    ELK GS   +IY    I ERHRHRYE N  Y+   EK G V  G++     LVE IEL NH +F A QFHPEFTS     +P+F +F+  +
  S:     2 TKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERRGDYLGGTVQVIPHITDEIKRRIHEGAAGY--DVAIVEIGGTVGDIESLPFLEAIRQMRSQLGRNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRTMPADERRKIALFCNVEERAIVGSYDVDSIYECPEMLHDQGIDNIITEQLQLNV-QQADLTAWKKIVHAIQNP-KHTVKIAMVGKYVDLTESYKSLIEALKHAGIHTETDVQITFVDSESIEKNNGDVSMLKDMDAILVPGGFGSRGVEGKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKGANSTEFDLKCAAPVVALIDEWQTADGSVETRDESADLGGTMRLGAQEVELKAGSLAAKIYGSGHIRERHRHRYEVNNNYVPQLEKAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAA 538
>gi|15794635|ref|NP_284457.1| CTP synthetase [Neisseria meningitidis Z2491] >gi|24212159|sp|Q9JTK1|PYRG_NEIMA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|121052530|emb|CAM08870.1| CTP synthase [Neisseria meningitidis Z2491] (544 aa)
Score = 1176, Expect = 9.9e-127, Identities = 240/527 (45%), Positives = 348/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENN--ISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINK-ENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +S+ A+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + + ++ + G+VY   IAKER G +LG T+QV+PHIT+ I ++I   +  Y  D  IVE+GGTVGDIES+PFLEA RQ++++  R+  +F H   +  +    ++KTKP QH+VK+++S G+ P++L+ R    +    + KI+L   +E   I    ++  IY  PE L +Q + N I    ++ V  +     W      I+ P K+  +IA+VGKY D  ++Y S+I +L+ +  + +TD+ I F++S S+ +NN  +S L + DAILVPGGFG R +EGKI A++YARENN+P+ GICLGMQ+A IE+AR+V  +  A+STEF+   A P++ ++          E ++   +LGGT+RLG    ELK GS   +IY  + I ERHRHRYE N  Y+   E+ G V  G++     LVE IEL NH +F A QFHPEFTS     +P+F +F+  +
  S:     2 TKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERRGDYLGGTVQVIPHITDEIKRRIHEGAAGY--DVAIVEIGGTVGDIESLPFLEAIRQMRSQLGRNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRTMPADERRKIALFCNVEERAIVGSYDVDSIYECPEMLHDQGIDNIITEQLQLNV-QQADLTAWKKIVHAIQNP-KHTVKIAMVGKYVDLTESYKSLIEALKHAGVHTETDVQITFVDSESIEKNNGDVSMLKDMDAILVPGGFGSRGVEGKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKGANSTEFDLKCAAPVVALIDEWQTADGSVETRDESADLGGTMRLGAQEVELKAGSLAAKIYGSEHIRERHRHRYEVNNNYVPTLEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAA 538
>gi|194476857|ref|YP_002049036.1| CTP synthetase [Paulinella chromatophora] >gi|171191864|gb|ACB42826.1| CTP synthetase [Paulinella chromatophora] (531 aa)
Score = 1176, Expect = 1.1e-126, Identities = 232/528 (43%), Positives = 338/528 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYK----HWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV SS+GKG+  +SLG +LK     V I+K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + K ++VT G +Y   I+KER G + G T+QV+PHIT+ I ++I L+++  + D +I E+GGTVGDIES+PFLEA R+ +    +  V ++H   L  + T  ++KTKP QHSVK+L S GI P+LL+ R    ++ +L+ KI    G+    +   I+   IY +P +LE   +   I     ++V N I YK    +W+     ++ P     +IA+VGKY    DAYLS++ SL  +  +    L++++I +  + +    S L   DA++VPGGFG R ++GKI AIQ+ARE  IPF G+CLGMQ A IE+ARN+  + +A STE    T +P+I +L  +    + GGT+RLG   C++K G+    +Y +K + ERHRHRYEFN  Y ++F + G+V SG + +  LVE+IEL  H FF A Q+HPEF S++  P+P+F   +  +++
  S:     3 KFVFVTGGVVSSIGKGIVAASLGRLLKSRSYNVSILKLDPYLNVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFTDTPMSKLNSVTTGSIYQSVISKERRGGYNGGTVQVIPHITKEIRERIHLVASSSRADIVITEIGGTVGDIESLPFLEAIREFRGDVGQHDVAYVHVTLLPYIGTSGEIKTKPTQHSVKELRSIGIQPDLLVCRCDREITEELRGKIGGFCGVSKHAVIPAIDADSIYAVPLTLEEHGLCREI-----LKVLNLINYKSDMENWEQLVYRLRHPGP-SVKIALVGKYIQLNDAYLSVVESLRHACLHQDASLNLQWICAEQIEQQGAESLLKGIDALVVPGGFGNRGVDGKIAAIQWAREQRIPFLGLCLGMQCAVIEWARNIAGLINATSTELESETEHPVIHLLPEQQNIIDRGGTMRLGISPCKIKVGTMAARLYGKKVVYERHRHRYEFNNAYRNLFIESGYVISGTSPDGRLVELIELPGHPFFTACQYHPEFLSRLGVPHPLFRGLIEAAQQ 530
>gi|109947516|ref|YP_664744.1| CTP synthetase [Helicobacter acinonychis str. Sheeba] >gi|109714737|emb|CAJ99745.1| CTP synthase [Helicobacter acinonychis str. Sheeba] (538 aa)
Score = 1176, Expect = 1.1e-126, Identities = 247/526 (46%), Positives = 346/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKH--WDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           D+ K + VTGGV SSLGKG++ SS+  +L+    +V I+K DPY+N+D GTM+P +HGEVFVT DG ETDLDIG+YERFLN NL + +N T G+++   I  ER G++LG TIQ+VPH+T+ I ++I   S     DFLIVEVGGTVGD+E + +LEA RQL+ +    +V+ +H   +  + T ++LKTKP QHSV++L   G+ P ++L RS   +  +LK+KI+L+  +E +++    + K IY  P     + +   I   F +   N++  K   W+T    I  P K+K +I  VGKY    ++Y S+I +L  +  +L T ++IE+++S + NE   + L   DAILVPGGFG+R IEGKI AIQ AR   +PF GICLGMQLA +EF RNVL +  A+STEFN+    P++ ++E           +   + LGGT+RLG Y CE+   S + + YK+ SI ERHRHRYE NPKY   +E  G    G    N+L+E IELE+H FF+ VQFHPEFTS++ SPNPI   F+
  S:     2 DRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDPYINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIENERKGEYLGKTIQIVPHVTDEIKRRI--KSTAKGLDFLIVEVGGTVGDMEGMFYLEAIRQLKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLGKELKKKIALSCDVEQDSVIVATDTKSIYACPILFLQEGILTPIARRFNL---NKLHPKMAAWNTLVEKIIAP-KHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDTQVNIEWLDSENFNEE--TNLEGVDAILVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIVEFCRNVLGLKGANSTEFNQRCEYPVVYLIEDFMDQNHQKQVRTYNSPLGGTMRLGEYECEIMPNSLLEKAYKKPSIKERHRHRYEINPKYRQEWENKGLKVVGFGA-NHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFI 531
>gi|157414348|ref|YP_001481604.1| CTP synthetase [Campylobacter jejuni subsp. jejuni 81116] >gi|157385312|gb|ABV51627.1| CTP synthetase [Campylobacter jejuni subsp. jejuni 81116] (543 aa)
Score = 1175, Expect = 1.2e-126, Identities = 249/528 (47%), Positives = 352/528 (66%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIH--TVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKR-KSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + VTGGV SSLGKG+A +S+  +LK  G +V I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFL+ +L +++N T GRVY   I KER G++LG TIQV+PHI   I  +I         D LIVE+GGTVGDIE +PFLEA R L+ +  ++  M IH   VP I+     +LKTKP QHSV +L   GI P++++ RS+ A+   LK+KI+++ G+E   +   ++   IY +P +   Q + + I     ++   PN    ++WD+    +  P   + +IA VGKY D  ++Y S+  ++  +   L T + +++++S  L     +E+  +   ILV GGFG R +EGKI AIQYAREN IPF GICLGMQLA +EFARNVLK+ DA+S+EF+E   NP++ +++           +  +T LGGT+RLG Y C++K+ S + ++Y   KS+ ERHRHRYE NPKY   FEKHG + SG +K   L+E +EL  H FF+AVQFHPEFTS++   NP+   F+  +
  S:     3 QTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPYINVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKERRGEYLGKTIQVIPHIVGEIKDRIKKAGEG--KDILIVEIGGTVGDIEGLPFLEAIRALRLEVGKNNAMNIHLTLVPFIK--AAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLKDKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILSPIAEILDLKNLKPN---MENWDSLVKRVIAPSN-EVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESAEVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLKDANSSEFDEKCQNPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAKVYNEAKSVKERHRHRYEANPKYRVDFEKHGLIVSGESK--GLIEAVELNCHPFFLAVQFHPEFTSRLEHVNPVICGFIKAA 537
>gi|88608707|ref|YP_506744.1| CTP synthetase [Neorickettsia sennetsu str. Miyayama] >gi|119391136|sp|Q2GCQ2|PYRG_NEOSM CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|88600876|gb|ABD46344.1| CTP synthase [Neorickettsia sennetsu str. Miyayama] (548 aa)
Score = 1175, Expect = 1.2e-126, Identities = 243/521 (46%), Positives = 342/521 (65%)
  Q:     8 LIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDA-VSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFT----SLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIV-ERHRHRYEFNPKYMDIFEKHGFVFSGINKEN-NLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           + VTGGV SS+GKG+  S+L ++++  G  V I K DPYLNVD GTM+P QHGEVFVT DG E DLD+G+YERF  IN     + TAGR+Y + I +ER+G++LGAT+QV+PH+T  I   I   S++Y  D ++ E+GGTVGDIE  PF E+ RQ+  +  +  V++IH   +  L    +LKTKP QHSVK L + GI P+ L+ R++ A +S   K KI+L   I   N+    ++ +IY +P   + Q +   I        P   G  HW        SL    KK    +A++GKYS   DAY+S+ S+L+ ++F +  +LS++ I++      ++S+LS+FD IL+PGGFG   I+GK+LAI +AR NNIPF GIC G QLA +EFARNV+ + DADSTEFN+N   P+I  L          E + + + +GGT+RLG YNC LK  SK   IY    ++ ERHRHRYE NP Y+   E  G +FSG +++  ++ EI+EL++H +F+ VQFHPEF S+I  P+P+F SF+
  S:     9 IFVTGGVSSSIGKGLTTSALASLMQSMGFRVCIRKMDPYLNVDPGTMSPLQHGEVFVTEDGTEADLDLGHYERFTGINCTHRDSTTAGRIYVDLIERERNGEYLGATVQVIPHVTNLIKDFIYSGSDQY--DVILCEIGGTVGDIEGQPFFESARQVAYEVGKENVIYIHLTLVPYLEASGELKTKPSQHSVKALNALGIQPDFLICRTQSAQMSAADKRKIALFCNIREGNVIEAQDVDNIYKIPLIYKEQGLDTKISALLGCG-PLEAGVSHWKEIVGRTRSLANSGKKL--FVAIIGKYSGLCDAYISVDSALQHAAFAVGVNLSVQIIDARG---KDMSDLSKFDMILIPGGFGNNGIDGKLLAITHARINNIPFLGICFGFQLAILEFARNVVGIKDADSTEFNKNCKAPVICFLDEWHRSDSSVERRRQSSQVGGTMRLGGYNCVLKKESKAYAIYNETEVISERHRHRYEANPHYLPELEAKGMLFSGYSEKGCDIPEILELKDHPWFLGVQFHPEFKSRIFKPHPLFLSFV 539
>gi|15611391|ref|NP_223042.1| CTP synthetase [Helicobacter pylori J99] >gi|11387047|sp|Q9ZM99|PYRG_HELPJ CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|4154844|gb|AAD05897.1| CTP SYNTHASE [Helicobacter pylori J99] (538 aa)
Score = 1175, Expect = 1.4e-126, Identities = 246/526 (46%), Positives = 347/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKH--WDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           D+ K + VTGGV SSLGKG++ SS+  +L+    +V I+K DPY+N+D GTM+P +HGEVFVT DG ETDLDIG+YERFLN NL + +N T G+++   I  ER G++LG TIQ+VPH+T+ I ++I   S     DFLIVEVGGTVGD+E + +LEA RQL+ +    +V+ +H   +  + T ++LKTKP QHSV++L   G+ P ++L RS   +  +LK+KI+L+  +E +++    + K IY  P     + +   I   F +   N++  K   W+T    I  P K+K +I  VGKY    ++Y S+I +L  +  +L T ++IE+++S + NE   ++L   DAILVPGGFG+R IEGKI AIQ AR   +PF GICLGMQLA +EF RNVL +  A+STEFN+    P++ ++E           +   + LGGT+RLG Y CE+   S + + YK+ +I ERHRHRYE NPKY   +E  G    G    N+L+E IELE+H FF+ VQFHPEFTS++ SPNPI   F+
  S:     2 DRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDPYINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIENERKGEYLGKTIQIVPHVTDEIKRRI--KSAAKGLDFLIVEVGGTVGDMEGMFYLEAIRQLKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLDKELKKKIALSCDVEQDSVIVATDTKSIYACPILFLQEGILTPIARRFNL---NKLHPKMAAWNTLVEKIIAP-KHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDTQVNIEWLDSENFNEK--TDLEGVDAILVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIVEFCRNVLGLKGANSTEFNQRCEYPVVYLIEDFMDQNHQKQVRTYNSPLGGTMRLGEYECEIMPNSLLEKAYKKPNIKERHRHRYEINPKYRQEWENKGLKVVGFGA-NHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFI 531
>gi|118602672|ref|YP_903887.1| CTP synthetase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] >gi|118567611|gb|ABL02416.1| CTP synthase [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] (560 aa)
Score = 1175, Expect = 1.5e-126, Identities = 233/529 (44%), Positives = 345/529 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           TK + +TGGV SSLGKG+  +SL ++L+  G  + ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  L K++N TAGRVY   I +ER G++LG T+Q++PHIT  I  K +        D  +VE+GGTVGDIES+PF+EA RQ+  +  R  V+FIH   L  +    +LKTKP QHSVK+L   GI P++L+ RS+  + +  + KI+L T +  +++++ +++  IY +P +L  Q + + +     +          WD     ++ PK     IA+VGKY D  ++Y S+  +L  +S + +T ++I + +S  + +N    LSE  AILVPGGFG R +EGKI  +++ARENN+P+ GICLGMQ+A IE+ARN+  M DA+STEFN +T  P+I ++          + +N++++ GGT+RLG   C L +G+   EIY +  I ERHRHRYE N   +   E  G + SG + +  LVE++E++NH + +A QFHPEFTS     +P+F SF+  + K
  S:    18 TKYIFITGGVVSSLGKGIVSASLASILESRGLNITMLKLDPYINVDPGTMSPFQHGEVFVTNDGAETDLDLGHYERFIHSKLGKKNNFTAGRVYENVIERERRGEYLGDTVQIIPHITNEI--KRLTQVGGQGADVALVEIGGTVGDIESLPFMEAIRQMGFELGRDNVLFIHLTLLPYIKVAGELKTKPTQHSVKELRGIGIQPDILICRSEYQLPDAERAKIALFTNVPQDSVFTSLDVDTIYKVPRALHEQGLDDVVVKKLSLNC-KLTDLSDWDNVVEKLQHPKS-SVDIAMVGKYMDLTESYKSLSEALIHASIHTQTKVNIHYFDSEEIEKNGTDCLSEMGAILVPGGFGNRGVEGKIATVKFARENNVPYLGICLGMQVAVIEYARNMANMTDANSTEFNGSTPYPVIDLITKWQDMDGHKKTRNKDSDFGGTMRLGGQECVLVEGTNSQEIYIKSVITERHRHRYEVNNSLIKQLETAGLIVSGRSIDGTLVEMVEIKNHPWLVACQFHPEFTSNPRDGHPLFESFIKAANK 553
>gi|163728745|ref|ZP_02136228.1| CTP synthetase [Vibrio fischeri MJ11] >gi|161398224|gb|EDQ22510.1| CTP synthetase [Vibrio fischeri MJ11] (546 aa)
Score = 1174, Expect = 1.5e-126, Identities = 243/531 (45%), Positives = 345/531 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + + KER G +LGATIQV+PHIT AI +++I  S     D  IVEVGGTVGDIES+PF+EA RQL  +  R + MF+H   +  L    +LKTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   ++ + + S+ ++  IY +P+ ++ Q   + +   F +  P       W+        P      I +VGKY + PDAY S+  +L+ +    + +++I++++S  +       L   DAILVPGGFG R +EGKILA QYAREN +P+ GICLGMQ+A IE+ARNV  M  A S+EF+++T  P++ ++          E +  +++LGGT+RLG+  C L  GSK  E+Y   ++ ERHRHRYE N   +   EK G   SG++ +  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+  + + +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRKERRGDYLGATIQVIPHITNAIKERVI--SGAEGHDIAIVEVGGTVGDIESLPFMEAIRQLAVELGRERAMFMHLTLVPYLGAAGELKTKPTQHSVKELLSIGIQPDILVCRSDRVIPANERKKIALFCNVQEKAVISMKDVDSIYKIPQLIKAQGTDDLVCQRFGITAP-EADLSEWEQVIYEEANPTG-DVVIGMVGKYIELPDAYKSVNEALKHAGLKNRLNVTIKYVDSQDVESKGTEILEGLDAILVPGGFGDRGVEGKILAAQYARENKVPYLGICLGMQVALIEYARNVANMEGAHSSEFSKDTKFPVVGLITEWIDSEGNVEERTEKSDLGGTMRLGSQLCHLAKGSKARELYGNATVEERHRHRYEVNNNLLPQLEKAGLKVSGLSADKKLVEIIEIPNHPWFVAAQFHPEFTSTPRDGHPLFEGFVKAAGESV 540
>gi|144898641|emb|CAM75505.1| CTP synthase [Magnetospirillum gryphiswaldense MSR-1] (541 aa)
Score = 1174, Expect = 1.5e-126, Identities = 238/527 (45%), Positives = 332/527 (62%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEV--PNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLN-ENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI---------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + +TGGV SSLGKG+A ++LGA L+  G +V + K DPYLNVD GTM+P QHGEV+VT DG ETDLD+G+YERF  +   K  N+T GR+Y + IA+ER G +LGAT+QV+PH+T AI +   + S+    DF++ E+GGTVGDIES+PFLEA RQL  +  R   MFIH   L  + +  +LKTKP QHSVK+L+S GI P+LL+ RS   +    + KI+L   +  E +   +++  IY +P S   Q +   +   F +E   PN      W      +++P+  +  IAVVGKY+   D+Y S+  +L          + + +I+S     E+ +  L     ILVPGGFG+R   GK+ A+++ARE  +P+FGIC GMQ+A IE ARN+  +  A STEF      P++ +         LE +N   +LGGTLRLG Y+C+LK GS++ EIY    I ERHRHRYE N  Y +  E  G  FSG++ +  L EI+E  +H +FI VQFHPE  SK   P+P+F SF+  +
  S:     2 TRFIFITGGVVSSLGKGLASAALGACLQARGFKVRLRKLDPYLNVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFTGVASRKSDNITTGRIYSDVIARERRGDYLGATVQVIPHVTNAIKE--FVKSDVTDEDFILCEIGGTVGDIESLPFLEAIRQLANELGREATMFIHLTLLPYIPSAGELKTKPTQHSVKELLSVGIQPDLLMCRSDRDIPEGERRKIALFCNVRGEAVIPALDVDTIYQVPISYHEQGLDEQVCRHFGIESKEPN---LDRWVNIVERVRQPEG-EVTIAVVGKYTSLLDSYKSLAEALTHGGIANNVRVRLNWIDSQIFEREDAVQHLEPCHGILVPGGFGERGALGKVEAVKFARERRVPYFGICFGMQMAVIETARNLAGLAKASSTEFGP-CEEPVVGLMTEWLKGNALEKRNASGDLGGTLRLGAYDCDLKAGSRVREIYGSDRISERHRHRYEVNMDYREKLEAAGLTFSGLSPDGVLPEIVEYSDHPWFIGVQFHPELKSKPFDPHPLFTSFIEAA 534
>gi|59801571|ref|YP_208283.1| CTP synthetase [Neisseria gonorrhoeae FA 1090] >gi|194097881|ref|YP_002000926.1| CTP synthetase [Neisseria gonorrhoeae NCCP11945] >gi|75355811|sp|Q5F7G6|PYRG_NEIG1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|59718466|gb|AAW89871.1| putative CTP synthase [Neisseria gonorrhoeae FA 1090] >gi|193933171|gb|ACF28995.1| CTP synthetase [Neisseria gonorrhoeae NCCP11945] (544 aa)
Score = 1174, Expect = 1.7e-126, Identities = 239/527 (45%), Positives = 348/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNEN--NISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINK-ENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +S+ A+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + + ++ + G+VY   IAKER G +LG T+QV+PHIT+ I ++I   +  Y  D  IVE+GGTVGDIES+PFLEA RQ++++  R+  +F H   +  +    ++KTKP QH+VK+++S G+ P++L+ R    +    + KI+L   +E   I    ++  IY  PE L +Q + N I    ++ V  +     W      +K P K+  +IA+VGKY D  ++Y S+I +L+ +  + +TD+ I F++S S+ +N  ++S L + DAILVPGGFG R +EGKI A++YARENN+P+ GICLGMQ+A IE+AR+V  +  A+STEF+   A P++ ++          E ++   +LGGT+RLG    ELK GS  ++IY    I ERHRHRYE N  Y+   E+ G V  G++     LVE IEL NH +F A QFHPEFTS     +P+F +F+  +
  S:     2 TKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERRGDYLGGTVQVIPHITDEIKRRIHEGAAGY--DVAIVEIGGTVGDIESLPFLEAIRQMRSQLGRNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRKMPADERRKIALFCNVEERAIVGSYDVDSIYECPEMLHDQGIDNIITEQLQLNV-QQADLTAWKKIVHAVKNP-KHTVKIAMVGKYVDLTESYKSLIEALKHAGIHTETDVQITFVDSESIEKNKGDVSVLKDMDAILVPGGFGSRGVEGKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKGANSTEFDLKCAAPVVALIDEWQTADGSVETRDESADLGGTMRLGAQEVELKAGSLAVKIYGSGHIRERHRHRYEVNNNYVSALEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAA 538
>gi|59712683|ref|YP_205459.1| CTP synthetase [Vibrio fischeri ES114] >gi|75353471|sp|Q5E325|PYRG_VIBF1 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|59480784|gb|AAW86571.1| CTP synthetase [Vibrio fischeri ES114] (546 aa)
Score = 1174, Expect = 1.9e-126, Identities = 242/531 (45%), Positives = 344/531 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + + KER G +LGATIQV+PHIT AI +++I  S     D  IVEVGGTVGDIES+PF+EA RQL  +  R + MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   ++ + + S+ ++  IY +P+ ++ Q   + +   F +  P       W+        P      I +VGKY + PDAY S+  +L+ +    +  ++I++++S  +       L   DAILVPGGFG R +EGKILA QYAREN +P+ GICLGMQ+A IE+ARNV  M  A S+EF+++T  P++ ++          E +  +++LGGT+RLG+  C L  GSK  E+Y   ++ ERHRHRYE N   +   EK G   SG++ +  LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+  + + +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRKERRGDYLGATIQVIPHITNAIKERVI--SGAEGHDIAIVEVGGTVGDIESLPFMEAIRQLAVELGRERAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRVIPANERKKIALFCNVQEKAVISMKDVDSIYKIPQLIKAQGTDDLVCQRFGITAP-EADLSEWEQVIYEEANPTG-DVVIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVTIKYVDSQDVESKGTEILEGLDAILVPGGFGDRGVEGKILAAQYARENKVPYLGICLGMQVALIEYARNVANMEGAHSSEFSKDTKFPVVGLITEWIDSEGNVEERTEKSDLGGTMRLGSQLCHLAKGSKARELYGNATVEERHRHRYEVNNNLLPQLEKAGLKVSGLSADKKLVEIIEIPNHPWFVAAQFHPEFTSTPRDGHPLFEGFVKAAGESV 540
>gi|71083633|ref|YP_266353.1| CTP synthetase [Candidatus Pelagibacter ubique HTCC1062] >gi|119391145|sp|Q4FM39|PYRG_PELUB CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|71062746|gb|AAZ21749.1| CTP synthase [Candidatus Pelagibacter ubique HTCC1062] (538 aa)
Score = 1173, Expect = 2.1e-126, Identities = 248/527 (47%), Positives = 349/527 (66%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG--------KNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           + + VTGGV SSLGKG++ +SL  +L+  G +V I K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF  ++  K  N+T G++Y + + KER G++LG T+QV+PHIT+ I Q I   S+K   DF+I E+GG VGDIES+PF+EA RQ      +   +FIH   +  L    ++KTKP QHSVK+L S GI P++++ RS+  +    ++KISL   ++ +N+   ++++ IY  P S   +K+   + N+FK++         W   T +I   KK +  IA++GKY +  DAY S+  +L       K  +++  I+S  L  + I  +L     IL+PGGFGKR  +GKI AI++AR N IPF GIC GMQ+A IEFARN L + +A S+EF++    PII ++          K  + +LGGT+RLG+Y+ +LKD SKI +IYK K I ERHRHRYE N  + D FEK G +FSG++ +N L EIIEL+NH +FI VQFHPEF S+ L+P+P+F SF+  +K
  S:     3 RYIFVTGGVVSSLGKGLSSASLAYLLQSRGYKVRIRKLDPYLNVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFSGVSAKKSDNITTGKIYSDVLRKERKGEYLGKTVQVIPHITDRIKQFIKHDSSK--EDFVICEIGGIVGDIESLPFVEAIRQFANDVGKKNALFIHLTLVPYLKASDEIKTKPTQHSVKELRSIGIQPDIIICRSERPIPLDHRKKISLFCNVDIKNVIETVDVRTIYEAPMSFFKEKLDLQVLNYFKLKSKKPANLNPWKKITKIILHNKK-QVNIAIIGKYVELKDAYKSLDEALTHGGIDNKVKVNLVRIDSEKLKISEIKKKLKNISGILIPGGFGKRGTDGKIEAIKHARLNKIPFLGICYGMQMAIIEFARNQLNLKNATSSEFDKKGL-PIIGLINEWTKDGKKIKGTDKDLGGTMRLGSYDAKLKDNSKISKIYKSKLIKERHRHRYEVNIAFKDKFEKKGMIFSGLSPDNKLPEIIELKNHPWFIGVQFHPEFKSRPLAPHPLFSSFIKAAK 535
>gi|72383129|ref|YP_292484.1| CTP synthetase [Prochlorococcus marinus str. NATL2A] >gi|119391148|sp|Q46I97|PYRG_PROMT CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|72002979|gb|AAZ58781.1| CTP synthase [Prochlorococcus marinus str. NATL2A] (555 aa)
Score = 1173, Expect = 2.3e-126, Identities = 226/527 (42%), Positives = 336/527 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           K + VTGGV SS+GKG+  +SLG +LK  G  V I+K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++N    D +I E+GGTVGDIES+PFLEA R+ +    R+ V+++H   L  + T  ++KTKP QHSVK+L S GI P++L+ RS   +++ LK KI    G+ ++ + + ++   IY +P +L+++ +   + +   +   +    K W+     ++ P     ++A+VGKY    DAYLS++ +L  +       L + +IN+ ++      +L +  DAI+VPGGFG R + GKI AI++ARE  +PF G+CLGMQ A IE+ARN+  + DA S E N N+ +P+I +L  +    +LGGT+RLG Y C L+  +    +Y  + + ERHRHRYEFN  Y  +  + G+V SG + +  LVE+IEL+NH FFIA Q+HPEF S+   P+P+F   +  ++
  S:     3 KFVFVTGGVVSSIGKGIVAASLGRLLKSKGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTAMSRLNSVTTGSIYQAVINKERRGDYDGRTVQVIPHITREIRERIKRVANNSGADVVISEIGGTVGDIESLPFLEAIREFKGDVKRNDVVYVHVTLLPYIGTSGEIKTKPTQHSVKELRSIGIQPDILVCRSDRPINDGLKNKIGGFCGVNSDAVIASLDADSIYSVPLALKDEGLCKEVLDCLDLN-DHESDLKDWERLVHKLRNPGP-SVKVALVGKYVQLNDAYLSVVEALRHACISHDASLDLHWINAENIESEGAEKLLQGMDAIVVPGGFGNRGVNGKIAAIRWAREQRVPFLGLCLGMQCAVIEWARNIAGLEDASSAELNPNSKHPVIHLLPEQQDVVDLGGTMRLGVYPCRLQANTTGQSLYNEEVVYERHRHRYEFNNSYRTLLMESGYVISGTSPDGRLVELIELKNHPFFIACQYHPEFLSRPGKPHPLFGGLIQAAQ 529
>gi|28868758|ref|NP_791377.1| CTP synthetase [Pseudomonas syringae pv. tomato str. DC3000] >gi|37999585|sp|Q886M5|PYRG_PSESM CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|28851997|gb|AAO55072.1| CTP synthase [Pseudomonas syringae pv. tomato str. DC3000] (543 aa)
Score = 1173, Expect = 2.3e-126, Identities = 235/527 (44%), Positives = 338/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+      R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   +    + KI+  T +E   + +L +   IY +P  L +Q + + +   F ++         WD        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +       L   DAILVPGGFG R +EGKI A+Q+AREN +P+ GICLGMQ+A IEFARNVL   DA+STEF+  +A+ ++ ++          E +   ++LGGT+RLG  +C+L+ GS + + Y++  IVERHRHRYE N   +    + G   SG + +  LVE++E  +H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRVYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRFEVGARRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDHPIDISSRRKIAQFTNVEERAVIALEDADTIYKIPGILHSQGLDDFVVERFGLQCGG-ADLSEWDKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTGLLEGVDAILVPGGFGLRGVEGKITAVQFARENKVPYLGICLGMQVAVIEFARNVLGWKDANSTEFDRTSAHAVVGLITEWEDATGAVETRTESSDLGGTMRLGAQDCQLEAGSLVHDCYRKDVIVERHRHRYEVNNNLLPQLIEAGLKISGRSGDGALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|154149163|ref|YP_001405747.1| CTP synthetase [Campylobacter hominis ATCC BAA-381] >gi|153805172|gb|ABS52179.1| CTP synthase [Campylobacter hominis ATCC BAA-381] (541 aa)
Score = 1173, Expect = 2.3e-126, Identities = 246/530 (46%), Positives = 347/530 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILE------GKNR----ETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           +TK + +TGGV SSLGKG+A +S+  +LK  G +V I+K DPY+NVD GTM+P +HGEVFVT DG ETDLD+G+YERFL+ NL +++N T GRVY   I KER G +LG TIQV+PHI   I ++I       +   LIVE+GGTVGDIE +PFLEA R ++ +  +   M IH   +  +    +LKTKP QHSV +L   GI P++++ RS+  ++  LK KI+++ G++   +    +   IY +P +  NQ +   I     ++  N      WD+    +  P   +  IA VGKY D  ++Y S+   L  +   L T + I +++S  LN  N+ + L +   +LVPGGFG+R I+GK+ AI YAR N IPF GICLGMQLA IEFARN+L + DA+S EF+ NT  P+I +++      GK +    ++ LGGT+RLG Y+C +K  + + +IY  K   ERHRHRYE NPKY +I EK+G + SG  + + L+E IEL+NH FF+ VQFHPEFTS+++SPNP+  +F+  S K
  S:     3 ETKYIFITGGVLSSLGKGIASASIATLLKNSGLKVSILKADPYINVDPGTMSPLEHGEVFVTDDGAETDLDLGHYERFLDENLSQKNNFTTGRVYSTVIEKERRGDYLGKTIQVIPHIVGEIVRRIKKAGEGQE--ILIVEIGGTVGDIEGLPFLEAIRAMRVELGKKNAMNIHLTLVPYIKVAGELKTKPTQHSVGELRRIGITPDMIICRSEIPLNRDLKNKIAISCGVDKNCVIESPDSASIYQIPLTFLNQNILEPIAENLALKKLNP-NMSKWDSLVKRVIAPNS-EVTIAFVGKYLDLKESYKSLTEGLIHAGATLDTKVKINWVDSEKLNSENVDKILKDVSGVLVPGGFGERGIDGKMTAINYARINKIPFLGICLGMQLAIIEFARNILNIKDANSMEFDPNTKEPLIYLIDSFIDANGKKQIRTYKSPLGGTMRLGGYDCNIKPNTLLSKIYDTKKTRERHRHRYEANPKYREILEKNGLIVSG--ESDGLIEAIELKNHPFFVGVQFHPEFTSRLISPNPVILNFIEASIK 538
>gi|150015288|ref|YP_001307542.1| CTP synthetase [Clostridium beijerinckii NCIMB 8052] >gi|149901753|gb|ABR32586.1| CTP synthase [Clostridium beijerinckii NCIMB 8052] (536 aa)
Score = 1173, Expect = 2.4e-126, Identities = 236/527 (44%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV S+LGKG+  +SLG +LK  G ++ I KFDPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF++ +L + SNVT G++Y   I KER G++LG T+QV+PHIT AI  K+  ++     D +I E+GGTVGDIES PFLE+ RQ++++  ++ V +IH   +  L    +LKTKP QHSVK+L   GI P++++ R++  +S+ +K KI L   I+  ++   ++ +++Y +P  L ++ + N +     +   + I    W      IK  K    +IA+VGKY +  DAY+S++ +L    +   T++ I++IN+ ++  +N  E L + D ILVPGGFG R IEGKI AI++AREN  PF GICLGMQ A IE+AR+VL   DA+S+E N  T  P+I ++  +    NLGGT+RLG Y C L + +   E+YK + I ERHRHRYEFN ++     + G   +G + +  LVEI+E+E+H +++AVQFHPE  S+   P+ +F  F+  +
  S:     3 TKYVFVTGGVVSALGKGITAASLGRLLKNRGVKISIQKFDPYLNVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDESLTQNSNVTTGKIYSSVIEKERRGEYLGGTVQVIPHITNAIKDKVYQVAKDRDVDVVITEIGGTVGDIESQPFLESIRQIKSEVGAENVCYIHVTLVPYLGKAGELKTKPTQHSVKELRMIGIQPDIIVCRTEKELSDDVKAKIGLFCNIDGRSVIQNLDAENLYEVPLMLHSEGLDNLVCEKLHLGCKD-IDNSEWIQMVQKIKNLKN-NVKIALVGKYVELHDAYISVVEALSHGGYANNTNVEIKWINAENIENSNAQELLKDVDGILVPGGFGDRGIEGKIAAIKWARENKKPFLGICLGMQCAVIEYARSVLGYEDANSSEINPGTNYPVIDLMPDQKDIENLGGTMRLGLYPCRLAENTNSYEVYKNEIINERHRHRYEFNNEFRKQITEAGMKIAGTSPDERLVEIVEVEDHPWYVAVQFHPELKSRPNKPHKLFVGFIKAA 529
>gi|15644977|ref|NP_207147.1| CTP synthetase [Helicobacter pylori 26695] >gi|3183132|sp|O25116|PYRG_HELPY CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|2313438|gb|AAD07406.1| CTP synthetase (pyrG) [Helicobacter pylori 26695] (538 aa)
Score = 1173, Expect = 2.5e-126, Identities = 246/526 (46%), Positives = 346/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKH--WDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           D+ K + VTGGV SSLGKG++ SS+  +L+    +V I+K DPY+N+D GTM+P +HGEVFVT DG ETDLDIG+YERFLN NL + +N T G+++   I  ER G++LG TIQ+VPH+T+ I ++I   S     DFLIVEVGGTVGD+E + +LEA RQL+ +    +V+ +H   +  + T ++LKTKP QHSV++L   G+ P ++L RS   +  +LK KI+L+  +E +++    + K IY  P     + +   I   F +   N++  K   W+T    I  P K+K +I  VGKY    ++Y S+I +L  +  +L T ++IE+++S + NE   ++L   DAILVPGGFG+R IEGKI AIQ AR   +PF GICLGMQLA +EF RNVL +  A+STEFN+    P++ ++          + +   + LGGT+RLG Y CE+   S + + YK+ SI ERHRHRYE NPKY   +E  G    G    N+L+E IELE+H FF+ VQFHPEFTS++ SPNPI   F+
  S:     2 DRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDPYINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIENERKGEYLGKTIQIVPHVTDEIKRRI--KSAAKGLDFLIVEVGGTVGDMEGMFYLEAIRQLKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLDKELKNKIALSCDVEQDSVIVATDTKSIYACPILFLQEGILTPIARRFNL---NKLHPKMAAWNTLVEKIIAP-KHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDTQVNIEWLDSENFNEK--TDLEGVDAILVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIVEFCRNVLGLKGANSTEFNQRCEYPVVYLIGDFMDQNHQKQVRTYNSPLGGTMRLGEYECEIMPNSLLEKAYKKPSIKERHRHRYEINPKYRQEWENKGLKVVGFG-SNHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFI 531
>gi|37199753|dbj|BAC95583.1| CTP synthase [Vibrio vulnificus YJ016] (594 aa)
Score = 1172, Expect = 2.7e-126, Identities = 246/531 (46%), Positives = 344/531 (64%)
  Q:     1 LNDKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           LN  T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + +AKER G +LGATIQV+PHIT  I  ++I  S  +  D  IVEVGGTVGDIES+PF+EA RQL  +  R + MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   +  + + S+ ++  IY +P+ +++Q + + +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++++S  +    +  L   DAILVPGGFG R IEGKILA +YAREN +P+ GICLGMQ+A IE+ARNV  M  A STEFN++T  P++ ++          E +   +NLGGT+RLG+  C L  G+K  E+Y   +I ERHRHRYE N       EK G   SG++ +  LVE+IE  NH +F+A QFHPEFTS     +P+F  F+  +
  S:    48 LNMTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYSDVLAKERRGDYLGATIQVIPHITNDIKDRVINGSQGH--DVAIVEVGGTVGDIESLPFMEAIRQLAVEIGRERAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERKKIALFCNVPEKAVISMKDVDSIYKIPQLIKSQGLDDLVCARFGINAP-EADLSEWEQVIYEEANPTG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVNIKYVDSQDVETKGVEVLQGLDAILVPGGFGDRGIEGKILAAKYARENKVPYLGICLGMQVALIEYARNVAGMEGAHSTEFNKDTKYPVVGLITEWVDSEGNVEERTESSNLGGTMRLGSQLCHLAKGTKARELYGSDTIHERHRHRYEVNNNLRPQIEKAGLKVSGLSADKKLVEMIENPNHPWFVAAQFHPEFTSTPRDGHPLFSGFIKAA 585
>gi|17232492|ref|NP_489040.1| CTP synthetase [Nostoc sp. PCC 7120] >gi|75908484|ref|YP_322780.1| CTP synthetase [Anabaena variabilis ATCC 29413] >gi|24212134|sp|Q8YMD4|PYRG_ANASP CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119391073|sp|Q3MAV1|PYRG_ANAVT CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|17134138|dbj|BAB76699.1| CTP synthetase [Nostoc sp. PCC 7120] >gi|75702209|gb|ABA21885.1| CTP synthase [Anabaena variabilis ATCC 29413] (545 aa)
Score = 1172, Expect = 2.7e-126, Identities = 231/527 (43%), Positives = 335/527 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE--LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SS+GKG+  +SLG +LK     V I+K DPY+N+D GTM+P QHGEVFVT DG ETDLD+G+YERF + ++ + ++VT G +Y   I +ER G + G T+QV+PHIT  I ++I+ ++ +  P  +I E+GGTVGDIES+PFLEA RQL+ +  R  V+++H   +  + +  ++KTKP QHSVK+L S GI P++L+ RS   +   LK+K+S    +  E + +  + + IY +P  LE + +        +ME   PN    + W      +  P K+   IA+VGKY    DAYLS++ +L  ++   + DL + +INS  L E    E  L+  D I+VPGGFG R ++GKI AI+YAR+  IPF G+CLGMQ + IE+ARNV  +  A+S EF+  T  P+I +L  +    +LGGT+RLG Y C +   +   ++Y+ + I ERHRHRYEFN  Y  +    G+V SG + +  LVEI+E   H FFI+ QFHPEF S+  +P+P+F  F+  +
  S:     2 TKFIFVTGGVVSSIGKGIVAASLGRLLKSRDYSVSILKLDPYINIDPGTMSPFQHGEVFVTQDGAETDLDLGHYERFTDTSMSRLNSVTTGSIYQAVIMRERRGDYNGGTVQVIPHITNEIKERILSVAKETNPSVVITEIGGTVGDIESLPFLEAIRQLRKQVGRQNVLYMHVTLMPYIASAGEMKTKPTQHSVKELRSIGIQPDILVCRSDRPIPRGLKQKLSEFCDVPVECVITSQDARSIYEVPLILEGEGLAEQTLKLLQMEQRQPN---LEKWQAMVQGLYSP-KHTVEIAIVGKYVSLGDAYLSVVEALRHAAIATQGDLQLRWINSEDL-ETQAPETYLAGVDGIVVPGGFGTRGVDGKIAAIKYARDRQIPFLGLCLGMQCSVIEWARNVGGLAGANSAEFDSTTKYPVINLLPEQQDVVDLGGTMRLGVYPCHILPNTLASKLYQAEIIQERHRHRYEFNNDYRQLLLDSGYVISGTSPDGRLVEIVEYPQHPFFISCQFHPEFQSRPNTPHPLFTGFVQAA 528
>gi|89092106|ref|ZP_01165061.1| CTP synthetase [Oceanospirillum sp. MED92] >gi|89083841|gb|EAR63058.1| CTP synthetase [Oceanospirillum sp. MED92] (542 aa)
Score = 1172, Expect = 2.9e-126, Identities = 234/527 (44%), Positives = 335/527 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRS-QVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGR+Y   + KER G +LG T+QV+PHIT+ I +++I        D  +VE+GGTVGDIES+PF+EA RQL+A+  S + MF+H   +  + T  ++KTKP QHSVK+L S GI P++L+ RS   + +  + K+SL T +E   + SL +   IY +P  L  Q + + +   F +E         WD        P+  + +IA+VGKY +  DAY S+I ++  +   LK  + IE I+S  +    +  L    AILVPGGFG+R +EGKI A++YAREN +P+ GICLGMQ+A IEFAR+V  +  A S+EF++   + +I ++          E +    +LGGT+RLG   C L +GS   + Y    I ERHRHRYE N  Y+   E+ G   SG + +  LVE++E+ +H +F+A QFHPEFTS     + +F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTTMSKRNNFTAGRIYQHVLRKERRGDYLGGTVQVIPHITDEIKRRVI--EGAGDADVALVEIGGTVGDIESLPFMEAVRQLKAELGSARAMFMHLTLVPYIATAGEIKTKPSQHSVKELRSIGIQPDILVCRSDFPLPDSSRRKLSLFTNVEERAVVSLPDADTIYNIPRMLSEQGLDDIVVERFHLEC-TEADLGEWDRVADAHLNPEG-EVKIAMVGKYMELLDAYKSLIEAISHAGIALKKKVRIECIDSERVEREGVEILEGASAILVPGGFGERGVEGKIAAVRYARENKVPYLGICLGMQVAVIEFARHVAGLEGATSSEFDKEAEHQVIGLITEWATSEGGVETRGEADDLGGTMRLGAQVCHLAEGSTAAKAYGNTEITERHRHRYEVNNNYVAKLEEAGLRISGRSVDGELVEVVEVADHPWFVACQFHPEFTSTPRDGHGLFTGFIQAA 535
>gi|153854581|ref|ZP_01995851.1| hypothetical protein DORLON_01846 [Dorea longicatena DSM 13814] >gi|149752890|gb|EDM62821.1| hypothetical protein DORLON_01846 [Dorea longicatena DSM 13814] (537 aa)
Score = 1172, Expect = 2.9e-126, Identities = 230/528 (43%), Positives = 332/528 (62%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISE-LSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           K + VTGGV S LGKG+  +SLG +LK  G  V + KFDPY+N+D GTM P QHGEVFVT DG ETDLD+G+YERF++ +L K SNVT G++Y+  + KER G F G T+QV+PHIT  I  +          +  I+EVGGTVGDIES PFLEA RQ Q  K R  V+ IH   +  L    ++KTKP Q SVKDL   GI P++L+ RS+  +   +K+KI+L   +   ++   ++++++Y  P ++E + +   +     ++ P     K W      +K P   +  +A+VGKY    DAY+S++ +L+    + +  ++I++I+S ++  +N+ E L +   ILVPGGFG R I+GK+ AI+YAR +N+PF G+CLGMQL+ +EFAR+VL  +DA S E + NT +P+I I+  +    ++GGTLRLG Y C L   SK  E+Y  + I ERHRHRYE N  Y D    HG   SG++ +  +VE+IE+  H +F+A Q HPE  S+   P+P+F  F+  + K
  S:     4 KYVFVTGGVVSGLGKGITAASLGRLLKARGYTVTMQKFDPYINIDPGTMNPVQHGEVFVTDDGAETDLDLGHYERFIDESLSKNSNVTTGKIYWSVLQKERRGDFGGGTVQVIPHITNEIKSRFYRNPAADNTEIAIIEVGGTVGDIESQPFLEAIRQFQHEKGRENVILIHVTLIPYLKASQEMKTKPTQASVKDLQGMGIQPDILVCRSEYPLGVGIKDKIALFCNVPANHVLQNLDVEYLYEAPLAMEKENLAGVVCECLHLDCPEP-DLKDWTEMVDYLKNPNT-EVTVALVGKYIQLHDAYISVVEALKHGGIFSRATVNIKWIDSETVTADNVDELLGDVSGILVPGGFGTRGIDGKLEAIKYARTHNVPFLGLCLGMQLSIVEFARDVLGYNDAHSAELDPNTTHPVIHIMPEQIGIEDIGGTLRLGAYPCVLDKTSKAYEMYGTEQISERHRHRYEVNNDYRDALTSHGMKLSGLSPDGRIVEMIEIPEHPWFVATQAHPELKSRPNRPHPLFRGFIEAALK 531
>gi|54294126|ref|YP_126541.1| CTP synthetase [Legionella pneumophila str. Lens] >gi|81368796|sp|Q5WXA8|PYRG_LEGPL CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|53753958|emb|CAH15429.1| CTP synthase [Legionella pneumophila str. Lens] (545 aa)
Score = 1172, Expect = 3.0e-126, Identities = 243/528 (46%), Positives = 349/528 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           TK + +TGGV SSLGKG+A +SL A+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y   I KER G +LG T+QV+PHIT  I + I L ++ +  D  +VE+GGTVGDIES+PFLEA RQ++ +  SQ  +FIH   +  + T  + KTKP QHSVK+L S GI P++L+ RS+  +S   + KI+L T +E E + SL +   IY +P  L  Q +   +     +E   +     W     + +  +    +IA+VGKY++  DAY SI  +L  +  + +T + I + ++  + ++    L   DAILVPGGFG+R +EGKI AIQYARE+ +PF GICLGMQ A IEFARNV+ +  A+STEFN+ T  P++ ++          + ++  T+LGGT+RLG   C L +G+   ++Y +  I+ERHRHRYE N KY+D   KHG + SG + +N+LVE+IEL +H +F+A QFHPEFTS     +P+F  F+  ++
  S:     2 TKYIFITGGVVSSLGKGIAAASLAAILEARGLRVTLIKLDPYINVDPGTMSPFQHGEVFVTNDGAETDLDLGHYERFVKTTMTKRNNFTSGKIYENVIKKERRGDYLGGTVQVIPHITNEIKRCIKLGADAF--DVAMVEIGGTVGDIESLPFLEAIRQMRIELGSQRAIFIHLTLVPYIATSGETKTKPTQHSVKELRSIGIQPDVLICRSEKPLSMADRAKIALFTNVEKEAVISLEDANSIYQIPMILHAQHLDEIVVKKLSLEA-KQADLSEWQRVVDM-QAVQTMTVKIAMVGKYTELNDAYKSINEALLHAGIHTETKVEIIYFDAEMIEKHGALLLESIDAILVPGGFGERGVEGKIKAIQYAREHKVPFLGICLGMQTAVIEFARNVVGLTGANSTEFNKETLYPVLGLISEWMDADGSKQTRDESTDLGGTMRLGGQYCHLAEGTLARKVYGKSQIIERHRHRYEVNNKYVDSLVKHGLIISGRSADNSLVEMIELADHPWFLACQFHPEFTSNPRDSHPLFKEFVFAAR 536
>gi|153831061|ref|ZP_01983728.1| CTP synthase [Vibrio cholerae 623-39] >gi|148873457|gb|EDL71592.1| CTP synthase [Vibrio cholerae 623-39] (545 aa)
Score = 1172, Expect = 3.0e-126, Identities = 244/527 (46%), Positives = 343/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + + KER G +LGATIQV+PHIT AI  ++I  S  +  D  IVEVGGTVGDIES+PF+EA RQL  +  R   MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   +  + + S+ ++  IY +P+ + +Q + + +   F +  P       W+        P   +  I +VGKY++ PDAY S+  +L+ +    +  ++I++++S  +       L+  DAILVPGGFG R IEGKI A QYAREN IP+ GICLGMQ+A IE+ARNV  M  A STEFN+NT  P++ ++          E ++ +++LGGT+RLG+  C L++G+K  E+Y   +I ERHRHRYE N       EK G   SG++ +  LVE+IE   H +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRKERRGDYLGATIQVIPHITNAIKDRVIAGSEGH--DIAIVEVGGTVGDIESLPFMEAIRQLAIEVGREHAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERKKIALFCNVPEKAVISMKDVDSIYKIPQLIRSQGLDDLVCARFGINAP-EADLSEWEQVIYEEANPTG-EVTIGMVGKYTELPDAYKSVNEALKHAGLKNRLSVTIKYVDSQDVETKGTDVLNGLDAILVPGGFGDRGIEGKIRAAQYARENKIPYLGICLGMQVALIEYARNVAGMEGAHSTEFNKNTKYPVVGLITEWVDGEGNVEERSEKSDLGGTMRLGSQLCHLENGTKAYELYGSATIHERHRHRYEVNNLLRPQIEKAGLKVSGLSADKKLVEVIENPAHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|148982337|ref|ZP_01816717.1| CTP synthetase [Vibrionales bacterium SWAT-3] >gi|145960529|gb|EDK25891.1| CTP synthetase [Vibrionales bacterium SWAT-3] (546 aa)
Score = 1172, Expect = 3.1e-126, Identities = 245/527 (46%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL------EGKNRE----TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + +AKER G +LGATIQV+PHIT +I +++I  S     D  IVEVGGTVGDIES+PF+EA RQL  +  R + MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   + +  ++KI+L   ++   + S+ ++  IY +P+ ++ Q   + +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++++S  +    +  L   DAILVPGGFG R +EGKILA QYAREN +P+ GICLGMQ+A IE+ARNV KM  A S+EF   T  P++ ++      EGK  E    ++LGGT+RLG+  C L  G+K  E+Y   +I ERHRHRYE N       EK G   SG++ +  LVE+IE  NH +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYSDVLAKERRGDYLGATIQVIPHITNSIKERVI--SGAEGHDIAIVEVGGTVGDIESLPFMEAIRQLAVELGRERAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRNIPSNERKKIALFCNVQENAVISMRDVDSIYKIPQLIKAQGTDDLVCKRFGITAP-EADLSEWEQVIYEEANPTG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVNIKYVDSQDVESRGVEILEGLDAILVPGGFGDRGVEGKILAAQYARENKVPYLGICLGMQVALIEYARNVAKMEGAHSSEFCPETKYPVVGLITEWVDGEGKVEERTETSDLGGTMRLGSQLCHLAKGTKAYELYGSATIHERHRHRYEVNNNLRPQIEKAGLKVSGLSADKKLVEVIENPNHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|91070511|gb|ABE11418.1| glutamine amidotransferase class-I:CTP synthase [uncultured Prochlorococcus marinus clone HOT0M-3E5] (536 aa)
Score = 1171, Expect = 3.7e-126, Identities = 234/528 (44%), Positives = 337/528 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSK 532
           +K + VTGGV SS+GKG+  +SLG +LK  G  V I+K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++     D +I E+GGTVGDIES+PFLEA R+ +    R+ V +IH   L  + T  ++KTKP QHSVK+L S GI P+LL+ RS  +++  LK+K+S   G+   ++   ++   IY +P SL+ + +      +  +E   +   K+W+     ++ P     ++A+VGKY +  DAYLS++ +L  +    K  L + ++++  + +N+  + L+E  AI+VPGGFG R + GKI AI++AREN IPF G+CLGMQ A IE+ARNV  + DA S+E + NT NP+I +L  +    +LGGT+RLG Y C L   +    +Y    I ERHRHRYEFN  Y   F   G+  SG + +  LVE+IELENH +F+A Q+HPEF S+   P+P+F   +  S+
  S:     2 SKFVFVTGGVVSSIGKGIVAASLGRLLKSRGYTVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTAMTRLNSVTTGSIYQAVINKERRGNYNGGTVQVIPHITGEIRERIHRVAANSNADIIITEIGGTVGDIESLPFLEAIREFKNDVNRNDVAYIHVTLLPYIKTSGEIKTKPTQHSVKELRSIGIQPDLLVCRSDKSINEALKKKLSGFCGVSINSVIEALDADSIYSVPLSLKKEGLCKETLKYLDLE-DKKCDLKNWEQLIHNLRNPGD-PIKVALVGKYIELGDAYLSVVEALRHACIEQKALLDLHWVSAEMIEKNSAETYLNEVHAIVVPGGFGNRGVNGKISAIKFARENKIPFLGLCLGMQCAVIEWARNVANLPDASSSELDPNTPNPVIHLLPEQEDVVDLGGTMRLGVYPCRLTKNTTGKNLYDEDVIYERHRHRYEFNNYYKQSFLDSGYKISGTSPDGRLVELIELENHPYFLACQYHPEFLSRPGKPHPLFKGLIKASQ 529
>gi|188527154|ref|YP_001909841.1| CTP synthetase [Helicobacter pylori Shi470] >gi|188143394|gb|ACD47811.1| CTP synthetase [Helicobacter pylori Shi470] (538 aa)
Score = 1171, Expect = 3.9e-126, Identities = 246/526 (46%), Positives = 345/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKH--WDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEG----------KNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           D+ K + VTGGV SSLGKG++ SS+  +L+    +V I+K DPY+N+D GTM+P +HGEVFVT DG ETDLDIG+YERFLN NL + +N T G+++   I  ER G++LG TIQ+VPH+T+ I ++I   S     DFLIVEVGGTVGD+E + +LEA RQL+ +    +V+ +H   +  + T ++LKTKP QHSV++L   G+ P ++L RS   +  +LK KI+L+  +E +++    + K IY  P     + +   I   F +   N++  K   W+T    I  P K+K +I  VGKY    ++Y S+I +L  +  +L   ++IE+++S + NE   ++L   DAILVPGGFG+R IEGKI AIQ AR   +PF GICLGMQLA +EF RNVL +  A+STEFN+    P++ ++E           +   + LGGT+RLG Y CE+   S + + YK+ SI ERHRHRYE NPKY   +E  G    G    N+L+E IELE+H FF+ VQFHPEFTS++ SPNPI   F+
  S:     2 DRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDPYINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIENERKGEYLGKTIQIVPHVTDEIKRRI--KSAAKGLDFLIVEVGGTVGDMEGMFYLEAIRQLKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLDKELKNKIALSCDVERDSVIVATDTKSIYACPILFLQEGILTPIARRFNL---NKLHPKMAAWNTLVEKIIAP-KHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDVQVNIEWLDSENFNEK--TDLEGVDAILVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIVEFCRNVLGLKGANSTEFNQRCEYPVVYLIEDFIDQNHQKQVRTYNSPLGGTMRLGEYECEIVPNSLLEKAYKKPSIKERHRHRYEINPKYRQEWENKGLKVVGFGA-NHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFI 531
>gi|15677405|ref|NP_274561.1| CTP synthetase [Neisseria meningitidis MC58] >gi|24212160|sp|Q9JYJ8|PYRG_NEIMB CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|7226800|gb|AAF41908.1| CTP synthase [Neisseria meningitidis MC58] (544 aa)
Score = 1171, Expect = 3.9e-126, Identities = 239/527 (45%), Positives = 348/527 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNEN--NISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINK-ENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +S+ A+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF++  + + ++ + G+VY   IAKER G +LG T+QV+PHIT+ I ++I   +  Y  D  IVE+GGTVGDIES+PFLEA RQ++++  R+  +F H   +  +    ++KTKP QH+VK+++S G+ P++L+ R    +    + KI+L   +E   I    ++  IY  PE L +Q + N I    ++ V  +     W      I+ P K+  +IA+VGKY D  ++Y S+I +L+ +  + +TD+ I F++S ++ +N  ++S L + DAILVPGGFG R +EGKI A++YARENN+P+ GICLGMQ+A IE+AR+V  +  A+STEF+   A P++ ++          E ++  T+LGGT+RLG    ELK GS   +IY    I ERHRHRYE N  Y+   E+ G V  G++     LVE IEL NH +F A QFHPEFTS     +P+F +F+  +
  S:     2 TKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIAKERRGDYLGGTVQVIPHITDEIKRRIHEGAAGY--DVAIVEIGGTVGDIESLPFLEAIRQMRSQLGRNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSIGLQPDILICRMDRTMPADERRKIALFCNVEERAIVGSYDVDSIYECPEMLHDQGIDNIITEQLQLNV-QQADLTAWKKIVHAIQNP-KHTVKIAMVGKYVDLTESYKSLIEALKHAGIHTETDVQITFVDSENIEKNKGDVSMLKDMDAILVPGGFGSRGVEGKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKGANSTEFDLKCAAPVVALIDEWQTADGSVETRDESTDLGGTMRLGAQEVELKAGSLAAKIYGSGHIRERHRHRYEVNNNYVPTLEQAGLVIGGVSAGRERLVETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAA 538
>gi|86146350|ref|ZP_01064674.1| CTP synthetase [Vibrio sp. MED222] >gi|85835829|gb|EAQ53963.1| CTP synthetase [Vibrio sp. MED222] (546 aa)
Score = 1171, Expect = 4.1e-126, Identities = 244/527 (46%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL------EGKNRE----TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + +AKER G +LGATIQV+PHIT +I +++I  S     D  +VEVGGTVGDIES+PF+EA RQL  +  R + MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   + +  ++KI+L   ++   + S+ ++  IY +P+ ++ Q     +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  ++I++++S  +    +  L   DAILVPGGFG R +EGKILA QYAREN +P+ GICLGMQ+A IE+ARNV KM  A S+EF  +T  P++ ++      EGK  E    ++LGGT+RLG+  C L  G+K  E+Y   +I ERHRHRYE N       EK G   SG++ +  LVE+IE  NH +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYSDVLAKERRGDYLGATIQVIPHITNSIKERVI--SGAAGHDIALVEVGGTVGDIESLPFMEAIRQLAVELGRERAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRNIPSNERKKIALFCNVQENAVISMRDVDSIYKIPQLIKAQGTDELVCKRFGITAP-EADLSEWEQVIYEEANPTG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVNIKYVDSQDVESRGVEVLEGLDAILVPGGFGDRGVEGKILAAQYARENKVPYLGICLGMQVALIEYARNVAKMEGAHSSEFCTDTKYPVVGLITEWTDGEGKVEERTETSDLGGTMRLGSQLCHLAKGTKAYELYGSATIHERHRHRYEVNNNLRPQIEKAGLKVSGLSADKKLVEVIENPNHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|160878483|ref|YP_001557451.1| CTP synthetase [Clostridium phytofermentans ISDg] >gi|160427149|gb|ABX40712.1| CTP synthase [Clostridium phytofermentans ISDg] (534 aa)
Score = 1171, Expect = 4.2e-126, Identities = 227/526 (43%), Positives = 332/526 (63%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV S LGKG+  +SLG +LK  G  V + KFDPY+N+D GTM P QHGEVFVT DG ETDLD+G+YERF++ +L K+SNVT G++Y+  +++ER G F G T+QV+PHIT  I  +        +    I+EVGGTVGDIES PFLEA RQ Q    R   + IH   +  L    ++KTKP Q SVKDL   GI P++++ R++  +   ++EKI+L   +   ++   ++   +Y +P  +E + + +       ++ P     + W+     +K P +    +A+VGKY+   DAY+S++ SL+  +      + I++I S S+ + ++++L  E   +LVPGGFG R IEGKILAIQYARE+ +PF G+CLGMQLA +EF R+VL   DA S E +  T +P+I ++  ++   ++GGTLRLG+Y C L   SK  E+Y+  +I ERHRHRYE N  Y D   +HG   SG++ +  +VE+IEL +H +F+A Q HPEF S+   P+P+F  F+  +
  S:     4 KYVFVTGGVVSGLGKGITAASLGRLLKARGYHVTMQKFDPYINIDPGTMNPIQHGEVFVTDDGAETDLDLGHYERFIDESLTKQSNVTTGKIYWTVLSRERRGDFGGGTVQVIPHITNEIKSRFYRNDGCDETQIAIIEVGGTVGDIESQPFLEAIRQFQHDVGRENAILIHVTLIPYLKASGEMKTKPTQASVKDLQGMGIQPDIIMCRTELPLETGIREKIALFCNVPRNHVLQNLDADTLYEIPLMMEEEHLADVACECLHLDCPEP-DLRDWEDMVYSLKNPTR-DVTVALVGKYTQLHDAYISVVESLKHGAVAHNASIQIKWIPSESVTKESVADLLQEVSGVLVPGGFGDRGIEGKILAIQYAREHKLPFLGLCLGMQLAVVEFTRHVLGFSDAHSVELSPETTHPVIHLMPEQDGIEDIGGTLRLGSYPCILDKTSKAYELYQTTTITERHRHRYEVNNYYRDELIRHGVKLSGLSPDGRIVEMIELLDHPWFLATQAHPEFKSRPNRPHPLFKGFVGAA 529
>gi|15642444|ref|NP_232077.1| CTP synthetase [Vibrio cholerae O1 biovar eltor str. N16961] >gi|121591593|ref|ZP_01678845.1| CTP synthase [Vibrio cholerae 2740-80] >gi|147675626|ref|YP_001217950.1| CTP synthetase [Vibrio cholerae O395] >gi|153214502|ref|ZP_01949411.1| CTP synthase [Vibrio cholerae 1587] >gi|153224997|ref|ZP_01954664.1| CTP synthase [Vibrio cholerae MAK 757] >gi|153803088|ref|ZP_01957674.1| CTP synthase [Vibrio cholerae MZO-3] >gi|194531107|ref|YP_002066622.1| CTP synthase [Vibrio cholerae MO10] >gi|24212162|sp|Q9KPC4|PYRG_VIBCH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|9657025|gb|AAF95590.1| CTP synthase [Vibrio cholerae O1 biovar El Tor str. N16961] >gi|121546548|gb|EAX56751.1| CTP synthase [Vibrio cholerae 2740-80] >gi|124115304|gb|EAY34124.1| CTP synthase [Vibrio cholerae 1587] >gi|124117399|gb|EAY36142.1| CTP synthase [Vibrio cholerae MAK 757] >gi|124121370|gb|EAY40113.1| CTP synthase [Vibrio cholerae MZO-3] >gi|125617467|gb|EAZ46031.1| CTP synthase [Vibrio cholerae MO10] >gi|146317509|gb|ABQ22048.1| CTP synthase [Vibrio cholerae O395] >gi|150422420|gb|EDN14379.1| CTP synthase [Vibrio cholerae AM-19226] (545 aa)
Score = 1170, Expect = 4.5e-126, Identities = 244/527 (46%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + + KER G +LGATIQV+PHIT AI  ++I  S  +  D  IVEVGGTVGDIES+PF+EA RQL  +  R   MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   +  + + S+ ++  IY +P+ + +Q + + +   F +  P       W+        P   +  I +VGKY++ PDAY S+  +L+ +    +  ++I++++S  +       L+  DAILVPGGFG R IEGKI A QYAREN IP+ GICLGMQ+A IE+ARNV  M  A STEFN+NT  P++ ++          E ++ +++LGGT+RLG+  C L+ G+K  E+Y   +I ERHRHRYE N       EK G   SG++ +  LVE+IE   H +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRKERRGDYLGATIQVIPHITNAIKDRVIAGSEGH--DIAIVEVGGTVGDIESLPFMEAIRQLAIEVGREHAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERKKIALFCNVPEKAVISMKDVDSIYKIPQLIRSQGLDDLVCARFGINAP-EADLSEWEQVIYEEANPTG-EVTIGMVGKYTELPDAYKSVNEALKHAGLKNRLSVTIKYVDSQDVETKGTDVLNGLDAILVPGGFGDRGIEGKIRAAQYARENKIPYLGICLGMQVALIEYARNVAGMEGAHSTEFNKNTKYPVVGLITEWVDGEGNVEERSEKSDLGGTMRLGSQLCHLEKGTKAYELYGSATIHERHRHRYEVNNLLRPQIEKAGLKVSGLSADKKLVEVIENPAHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|117618946|ref|YP_855363.1| CTP synthetase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] >gi|117560353|gb|ABK37301.1| CTP synthase [Aeromonas hydrophila subsp. hydrophila ATCC 7966] (545 aa)
Score = 1170, Expect = 4.7e-126, Identities = 243/527 (46%), Positives = 341/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITI----------LEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           TK + VTGGV SSLGKG+A +SL A+L+  G +V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y + + KER G +LGATIQV+PHIT AI +++I  +  +Q    IVEVGGTVGDIES+PFLEA RQL A+  R+  MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS  A+    + KI+L   +    + S+ ++  IY +P  L++Q + +     F +E         W+        P   +  I +VGKY   PDAY S+  +L+      +  ++I++I+S  +       L   DAILVPGGFG+R +EGKI A QYAREN IP+ GICLGMQ+A IEFARNV  M  A S+EF ++ A P++ +          +E +  +++LGGT+RLG+  C L +GSK+ ++Y   +I ERHRHRYE N K +   E  G   +G++ +  LVEIIE+ +H +F+A QFHPEFTS     + +F  F+  +
  S:     3 TKYIFVTGGVVSSLGKGIAAASLAAILEARGLDVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRIYADVLRKERRGDYLGATIQVIPHITNAIKERVIAGAEGHQ--VAIVEVGGTVGDIESLPFLEAIRQLAAEVGRNNAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAIPAVERAKIALFCNVPERAVISMKDVDSIYKIPALLKSQNLDSYFTERFGLEC-KEADLAEWEQVIYEEANPTA-EVTIGMVGKYVSLPDAYKSVNEALKHGGLKTRLSVNIKYIDSQDIETRGAELLEGLDAILVPGGFGERGVEGKIQAAQYARENKIPYLGICLGMQVAMIEFARNVAGMEGAHSSEFKKDCAYPVVGLITEWVDDEGNIETRTEKSDLGGTMRLGSQLCHLVEGSKVRQMYGSPTIYERHRHRYEVNNKLLPQIEAAGLKVTGLSADKKLVEIIEIPDHPWFVAAQFHPEFTSTPRDGHALFAGFVKAA 536
>gi|157414295|ref|YP_001485161.1| CTP synthetase [Prochlorococcus marinus str. MIT 9215] >gi|157388870|gb|ABV51575.1| CTP synthase [Prochlorococcus marinus str. MIT 9215] (536 aa)
Score = 1170, Expect = 4.7e-126, Identities = 232/531 (43%), Positives = 340/531 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKKPI 535
           +K + VTGGV SS+GKG+  +SLG +LK  G  V I+K DPYLNVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + + ++VT G +Y   I KER G + G T+QV+PHIT  I ++I  ++     D +I E+GGTVGDIES+PFLEA R+ +    R+ V +IH   L  + T  ++KTKP QHSVK+L S GI P+LL+ RS  +++  LK+K+S   G+  +++   ++   IY +P +L+ + +      + ++E       K+W+     ++ P     ++A+VGKY +  DAYLS++ +L  +    K  L + ++++  + + +  + L E DAI+VPGGFG R + GKI AI++ARE  IPF G+CLGMQ A IE+ARNV  + DA S+E N +T NP+I +L  +    +LGGT+RLG Y C L + +   ++Y    I ERHRHRYEFN  Y   F   G+  SG + +  LVE+IELENH +F+A Q+HPEF S+   P+P+F   +  S++ +
  S:     2 SKFVFVTGGVVSSIGKGIVAASLGRLLKSRGYSVSILKLDPYLNVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFTDTAMTRLNSVTTGSIYQAVINKERRGSYNGGTVQVIPHITGEIRERIHRVAANSNADIIITEIGGTVGDIESLPFLEAIREFKNDVNRNDVAYIHVTLLPFIKTSGEIKTKPTQHSVKELRSIGIQPDLLVCRSDKSINEGLKKKLSGFCGVNIKSVIEALDADSIYSVPLALKKEGLCKETLKYLELE-DKECDLKNWEALIHNLRNPGD-PIKVALVGKYIELGDAYLSVVEALRHACIEKKASLDLHWVSAEMIEKGSAETYLKEVDAIVVPGGFGNRGVNGKISAIKFAREKKIPFLGLCLGMQCAVIEWARNVANLPDASSSELNPDTPNPVIHLLPEQEDVVDLGGTMRLGVYPCRLTNNTTGKKLYDEDVIYERHRHRYEFNNYYKQSFLNSGYKISGTSPDGRLVELIELENHPYFLACQYHPEFLSRPGKPHPLFQGLIKASQEKL 532
>gi|168261909|ref|ZP_02683882.1| hypothetical protein Salmentericaenterica_12553 [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] (545 aa)
Score = 1170, Expect = 4.9e-126, Identities = 240/529 (45%), Positives = 341/529 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVSKK 533
           T  + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y + + KER G +LGAT+QV+PHIT AI +++  L      D ++VE+GGTVGDIES+PFLEA RQL     R   +F+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS  AV    + KI+L   +  + + S+ ++  IY +P  L++Q + + I   F +  P       W+        P   +  I +VGKY + PDAY S+I +L+      +  ++I+ I+S  +    +  L + DAIL+PGGFG R +EGKI   +YARENNIP+ GICLGMQ+A IEFARNV  M +A+STEF  +   P++ ++          E ++ +++LGGT+RLG   C+L DGS + ++Y   +IVERHRHRYE N   +   E  G   +G + ++ LVEIIE+ NH +F+A QFHPEFTS     +P+F  F+  + +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNAIKERV--LEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQLAVDIGREHALFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISMKDVDSIYKIPGLLKSQGLDDYICKRFSLNCP-EANLSEWEQVIYEEANPAG-EVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVTVNIKLIDSQDVETRGVEILKDLDAILIPGGFGYRGVEGKIATARYARENNIPYLGICLGMQVALIEFARNVAGMDNANSTEFVPDCKYPVVALITEWRDEDGNVEVRSEKSDLGGTMRLGAQQCQLSDGSLVRQLYGASTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAANE 538
>gi|156975782|ref|YP_001446689.1| CTP synthetase [Vibrio harveyi ATCC BAA-1116] >gi|156527376|gb|ABU72462.1| hypothetical protein VIBHAR_03526 [Vibrio harveyi ATCC BAA-1116] (546 aa)
Score = 1170, Expect = 5.0e-126, Identities = 245/527 (46%), Positives = 345/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL------EGKNRE----TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + + KER G +LGATIQV+PHIT AI  ++I  S  +  D  IVEVGGTVGDIES+PF+EA RQL  +  R + MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   ++ + + S+ ++  IY +P+ +++Q + + +   F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    + +++I++++S  +    +  L   DAILVPGGFG R IEGKI A QYAREN +P+ GICLGMQ+A IE+ARNV  M  A STEFN++T  P++ ++      EGK  E    ++LGGT+RLG+  C L+ G+K  E+Y   +I ERHRHRYE N       EK G   SG++ +  LVE+IE   H +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYADVLRKERRGDYLGATIQVIPHITNAIKDRVIAGSEGH--DVAIVEVGGTVGDIESLPFMEAIRQLAVELGRERAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERKKIALFCNVQEKAVISMKDVDSIYKIPQLVKSQGLDDLVCARFGINAP-EADLSEWEQVIYEEANPTG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLNVTIKYVDSQDVETKGVEVLEGLDAILVPGGFGDRGIEGKIRAAQYARENKVPYLGICLGMQVALIEYARNVAGMEGAHSTEFNKDTKYPVVGLITEWVDGEGKVEERTETSDLGGTMRLGSQLCHLEKGTKARELYGNATIHERHRHRYEVNNNLRPQIEKAGLKVSGLSADKKLVEMIENPAHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|67156394|ref|ZP_00417987.1| CTP synthase [Azotobacter vinelandii AvOP] >gi|67086153|gb|EAM05623.1| CTP synthase [Azotobacter vinelandii AvOP] (543 aa)
Score = 1170, Expect = 5.6e-126, Identities = 230/527 (43%), Positives = 342/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY + + +ER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+ +  ++  M IH   +  + T  + KTKP QHSVK+L S G+ P++L+ RS   +    + KI+L T +E   + +L ++  IY +P  L  Q + + +   F +          W+        P+K +  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +     + L   DAILVPGGFG R +EGKI A++YAREN +P+ GICLGMQ+A IE+AR+VL   DA+STEF+++  +P++ ++          E ++  ++LGGT+RLG   C+L+  S++ + Y +  +VERHRHRYE N   +    + G   +G + +  LVE+IE+ +H +F+A QFHPEFTS     +P+F  F+N +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTLLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFVRTTMTRNNNFTTGRVYEDVLRRERRGDYLGATIQVIPHITDEIKRRII--KGAGNADVAMVEIGGTVGDIESQPFLEAIRQLRLEVGAKRAMLIHLTLVPYIATAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPIDISSRRKIALFTNVEERAVIALEDVDTIYKIPSVLHAQGLDDIVVERFGLAC-GSADLSEWERVVDAKLHPEK-EVTIAMVGKYMELLDAYKSLIEAMGHAGIQNRTRVNLRYIDSEDIENQGTALLEGADAILVPGGFGLRGVEGKIAAVRYARENKVPYLGICLGMQVAVIEYARDVLGWADANSTEFDKSCGHPVVGLITEWQDATGATEVRSESSDLGGTMRLGAQECQLEANSQVRQCYGKDEVVERHRHRYEVNNNLLPHLIEAGLKVTGRSGDGALVEVIEVADHPWFVACQFHPEFTSTPRDGHPLFSGFVNAA 535
>gi|163802967|ref|ZP_02196854.1| CTP synthetase [Vibrio campbellii AND4] >gi|159173257|gb|EDP58085.1| CTP synthetase [Vibrio campbellii AND4] (546 aa)
Score = 1169, Expect = 5.8e-126, Identities = 246/527 (46%), Positives = 343/527 (65%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL------EGKNRE----TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G +V +MK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N TAGRVY + +AKER G +LGATIQV+PHIT AI  ++I  S     D  IVEVGGTVGDIES+PF+EA RQL  +  R + MF+H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS   +    ++KI+L   ++ + + S+ ++  IY +P+ ++ Q + + + + F +  P       W+        P   +  I +VGKY + PDAY S+  +L+ +    +  + I++++S  +       L+  DAILVPGGFG R IEGKILA +YAREN +P+ GICLGMQ+A IE+ARNV  M  A STEFN+ T  P++ ++      EGK  E    ++LGGT+RLG+  C L+ G+K  E+Y   +I ERHRHRYE N       EK G   SG++ +  LVE+IE   H +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMSKRNNFTAGRVYSDVLAKERRGDYLGATIQVIPHITNAIKDRVI--SGAEGHDIAIVEVGGTVGDIESLPFMEAIRQLAVELGRERAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERKKIALFCNVQEKAVISMKDVDSIYKIPQLIKAQGLDDIVCSRFGITAP-EANLSEWEQVIYEEANPTG-EVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVKIKYVDSQDVESKGDEALANLDAILVPGGFGDRGIEGKILAAKYARENKLPYLGICLGMQVALIEYARNVAGMEGAHSTEFNKETKYPVVGLITEWVDGEGKVEERTETSDLGGTMRLGSQLCHLEKGTKARELYGSATIHERHRHRYEVNNVLRPQIEKAGLKVSGLSADKKLVEVIENPAHPWFVAAQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|16123526|ref|NP_406839.1| CTP synthetase [Yersinia pestis CO92] >gi|22124726|ref|NP_668149.1| CTP synthetase [Yersinia pestis KIM] >gi|45440168|ref|NP_991707.1| CTP synthetase [Yersinia pestis biovar Microtus str. 91001] >gi|51595104|ref|YP_069295.1| CTP synthetase [Yersinia pseudotuberculosis IP 32953] >gi|108808866|ref|YP_652782.1| CTP synthetase [Yersinia pestis Antiqua] >gi|108810880|ref|YP_646647.1| CTP synthetase [Yersinia pestis Nepal516] >gi|145600239|ref|YP_001164315.1| CTP synthetase [Yersinia pestis Pestoides F] >gi|153949223|ref|YP_001402274.1| CTP synthetase [Yersinia pseudotuberculosis IP 31758] >gi|153997580|ref|ZP_02022680.1| CTP synthase [Yersinia pestis CA88-4125] >gi|162420062|ref|YP_001605542.1| CTP synthetase [Yersinia pestis Angola] >gi|165925770|ref|ZP_02221602.1| CTP synthase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165936807|ref|ZP_02225374.1| CTP synthase [Yersinia pestis biovar Orientalis str. IP275] >gi|166010095|ref|ZP_02230993.1| CTP synthase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166214092|ref|ZP_02240127.1| CTP synthase [Yersinia pestis biovar Antiqua str. B42003004] >gi|167398782|ref|ZP_02304306.1| CTP synthase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167420816|ref|ZP_02312569.1| CTP synthase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167423688|ref|ZP_02315441.1| CTP synthase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|170025662|ref|YP_001722167.1| CTP synthase [Yersinia pseudotuberculosis YPIII] >gi|186894116|ref|YP_001871228.1| CTP synthase [Yersinia pseudotuberculosis PB1/+] >gi|24212136|sp|Q8ZBN1|PYRG_YERPE CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|81640353|sp|Q66ED9|PYRG_YERPS CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119361439|sp|Q1C3Y5|PYRG_YERPA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|119361440|sp|Q1CLT3|PYRG_YERPN CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|21957543|gb|AAM84400.1|AE013684_2 CTP synthetase [Yersinia pestis KIM] >gi|45435024|gb|AAS60584.1| CTP synthase [Yersinia pestis biovar Microtus str. 91001] >gi|51588386|emb|CAH19994.1| CTP synthetase [Yersinia pseudotuberculosis IP 32953] >gi|108774528|gb|ABG17047.1| CTP synthase [Yersinia pestis Nepal516] >gi|108780779|gb|ABG14837.1| CTP synthase [Yersinia pestis Antiqua] >gi|115349005|emb|CAL21966.1| CTP synthase [Yersinia pestis CO92] >gi|145211935|gb|ABP41342.1| CTP synthase [Yersinia pestis Pestoides F] >gi|149289217|gb|EDM39297.1| CTP synthase [Yersinia pestis CA88-4125] >gi|152960718|gb|ABS48179.1| CTP synthase [Yersinia pseudotuberculosis IP 31758] >gi|162352877|gb|ABX86825.1| CTP synthase [Yersinia pestis Angola] >gi|165915456|gb|EDR34066.1| CTP synthase [Yersinia pestis biovar Orientalis str. IP275] >gi|165922382|gb|EDR39559.1| CTP synthase [Yersinia pestis biovar Orientalis str. F1991016] >gi|165991002|gb|EDR43303.1| CTP synthase [Yersinia pestis biovar Antiqua str. E1979001] >gi|166204723|gb|EDR49203.1| CTP synthase [Yersinia pestis biovar Antiqua str. B42003004] >gi|166961622|gb|EDR57643.1| CTP synthase [Yersinia pestis biovar Orientalis str. MG05-1020] >gi|167051286|gb|EDR62694.1| CTP synthase [Yersinia pestis biovar Antiqua str. UG05-0454] >gi|167057858|gb|EDR67604.1| CTP synthase [Yersinia pestis biovar Mediaevalis str. K1973002] >gi|169752196|gb|ACA69714.1| CTP synthase [Yersinia pseudotuberculosis YPIII] >gi|186697142|gb|ACC87771.1| CTP synthase [Yersinia pseudotuberculosis PB1/+] (545 aa)
Score = 1169, Expect = 5.9e-126, Identities = 241/527 (45%), Positives = 340/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI ++II     +  D ++VE+GGTVGDIES+PFLEA RQ+     R   +++H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS  AV    + KI+L   +  + + SL ++  IY +P  L++Q + + I   F +  P       W+        P   +  I ++GKY + PDAY S+I +L+      +  ++I+ I+S  +       L E DAIL+PGGFG R +EGK+LA +YARE+NIP+ GICLGMQ+A +EFARNV  M +A+STEF  +   P++ ++          E +  E++LGGT+R+G   C L +GS + ++Y   +IVERHRHRYE N   +   E  G   +G + +N LVEIIEL +H +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRIYSEVLRKERRGDYLGATIQVIPHITNAIKERIIEGGEGH--DVVLVEIGGTVGDIESLPFLEAIRQMAVDVGREHTLYMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLTCP-EANLAEWEQVLYEESNPGG-EVTIGMIGKYVELPDAYKSVIEALKHGGLKNRLTVNIKLIDSQDVETRGEEMLKELDAILIPGGFGYRGVEGKVLAARYAREHNIPYLGICLGMQVALMEFARNVAGMENANSTEFVPDCKYPVVALITEWRDEDGNVEIRTEESDLGGTMRVGGQQCHLTEGSLVRQMYGEPTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSADNKLVEIIELPDHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|77976029|ref|ZP_00831562.1| COG0504: CTP synthase (UTP-ammonia lyase) [Yersinia frederiksenii ATCC 33641] (545 aa)
Score = 1169, Expect = 6.3e-126, Identities = 241/527 (45%), Positives = 340/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI ++II     +  D ++VE+GGTVGDIES+PFLEA RQ+     R   +++H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS  AV    + KI+L   +  + + SL ++  IY +P  L++Q + + I   F +  P       W+        P   +  I ++GKY + PDAY S+I +L+      +  ++I+ I+S  +       L   DAIL+PGGFG R +EGK+LA +YARE+NIP+ GICLGMQ+A +EFARNV  M +A+STEF  +   P++ ++          E +  E++LGGT+R+G   C L +GS + ++Y   +IVERHRHRYE N   +   E  G   +G++ +N LVEIIEL NH +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRIYSEVLRKERRGDYLGATIQVIPHITNAIKERIIEGGEGH--DVVLVEIGGTVGDIESLPFLEAIRQMAVDVGREHTLYMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLTCP-EANLAEWEQVLYEESNPGG-EVTIGMIGKYVELPDAYKSVIEALKHGGLKNRLTVNIKLIDSQDVETRGEEMLKGLDAILIPGGFGYRGVEGKVLAARYAREHNIPYLGICLGMQVALMEFARNVAGMENANSTEFVPDCKYPVVALITEWRDENGNVEVRTEESDLGGTMRVGGQQCHLVEGSLVRQMYGEPTIVERHRHRYEVNNMLLKQIEAAGLRVAGLSADNKLVEIIELPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|77962819|ref|ZP_00826635.1| COG0504: CTP synthase (UTP-ammonia lyase) [Yersinia mollaretii ATCC 43969] (545 aa)
Score = 1169, Expect = 6.4e-126, Identities = 241/527 (45%), Positives = 340/527 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T  + VTGGV SSLGKG+A +SL A+L+  G  V IMK DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GR+Y E + KER G +LGATIQV+PHIT AI ++II     +  D ++VE+GGTVGDIES+PFLEA RQ+     R   +++H   +  L    ++KTKP QHSVK+L+S GI P++L+ RS  AV    + KI+L   +  + + SL ++  IY +P  L++Q + + I   F +  P       W+        P   +  I ++GKY + PDAY S+I +L+      +  ++I+ I+S  +       L   DAIL+PGGFG R +EGK+LA +YARE+NIP+ GICLGMQ+A +EFARNV+ M +A+STEF  +   P++ ++          E +  E++LGGT+R+G   C L +GS + ++Y   +IVERHRHRYE N   +   E  G   +G + +N LVEIIEL NH +F+A QFHPEFTS     +P+F  F+  +
  S:     3 TNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRIYSEVLRKERRGDYLGATIQVIPHITNAIKERIIEGGEGH--DVVLVEIGGTVGDIESLPFLEAIRQMAVDVGREHTLYMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDVLICRSDRAVPANERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLTCP-EANLAEWEQVLYEESNPGG-EVTIGMIGKYVELPDAYKSVIEALKHGGLKNRLTVNIKLIDSQDVETRGEEMLKGLDAILIPGGFGYRGVEGKVLAARYAREHNIPYLGICLGMQVALMEFARNVVGMENANSTEFVPDCKYPVVALITEWRDEDGNVEVRTEESDLGGTMRVGGQQCNLTEGSLVRQMYGEPTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSADNKLVEIIELPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAA 536
>gi|116749506|ref|YP_846193.1| CTP synthetase [Syntrophobacter fumaroxidans MPOB] >gi|116698570|gb|ABK17758.1| CTP synthase [Syntrophobacter fumaroxidans MPOB] (557 aa)
Score = 1169, Expect = 6.9e-126, Identities = 236/528 (44%), Positives = 345/528 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSE-FDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----EGKNRE-------TNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + +TGGV SSLGKG+A +S+ A+++  G  V +MK DPY+NVD GTM P QHGEVFVT DG ETDLD+G+YERF +  + K++N T+G +YY  I KER G +LG T+QV+PH+T+ I   I    +    D  IVE+GGTVGDIES+PFLEA RQ +    R  V++IH   +  L T  ++KTKP QHSVK+L S GI P++LL R++  +S  +K+KI+    ++ + + +  +++ IY +P     + +   I     +     +    W      +KEP  +  RIA+VGKY D  ++Y S+  +L          + +++++S ++ ++    L E  + IL+PGGFG+R +EGKI AI+YAREN IPF GICLGMQLA++EFAR+V  +  A S EF++NT++P+I ++    + KN +       ++ GGT+RLG Y C L+ GS   E Y    I ERHRHRYEFN  Y +   +HG  F+G++ + NLVEIIE+ +H +F+  QFHPEF S+ + P+PIF +F+  S
  S:     3 QTKFIFITGGVLSSLGKGLAAASIAALMESRGLRVTLMKLDPYINVDPGTMNPFQHGEVFVTDDGAETDLDLGHYERFTHARMSKKNNYTSGGIYYSVITKERRGDYLGGTVQVIPHVTDEIKDCIKGAVDDV--DIEIVEIGGTVGDIESLPFLEAIRQFRTDVGRENVLYIHVTLVPYLSTSGEVKTKPTQHSVKELRSIGIQPDILLCRTEKFLSGDIKKKIAHFCNVDTDAVITAKDVECIYEVPLLFHQEGLDEKIVRMLNIWTRAPL-LDTWAGMVRQLKEP-SHAVRIAIVGKYIDLKESYKSLNEALVHGGAPNDARVILDYVDSENVEKDGGEALIEGAEGILIPGGFGQRGVEGKIKAIRYARENRIPFLGICLGMQLATVEFARHVAGIEKAHSMEFDKNTSHPVIFLMREWFDYKNNQMIRRSEGSDFGGTMRLGAYPCVLEPGSLAYEAYGCPEISERHRHRYEFNNAYRETLGEHGMRFTGLSPDKNLVEIIEIPDHPWFLGCQFHPEFKSRPMEPHPIFRAFVGKS 539
>gi|66044609|ref|YP_234450.1| CTP synthetase [Pseudomonas syringae pv. syringae B728a] >gi|75502987|sp|Q4ZWR0|PYRG_PSEU2 CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|63255316|gb|AAY36412.1| CTP synthase [Pseudomonas syringae pv. syringae B728a] (543 aa)
Score = 1169, Expect = 7.3e-126, Identities = 235/527 (44%), Positives = 336/527 (63%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ---AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           T+ + VTGGV SSLGKG+A +SL A+L+  G +V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + + +N T GRVY   + KER G +LGATIQV+PHIT+ I ++II        D  +VE+GGTVGDIES PFLEA RQL+      R+ +M +  VP I   T  + KTKP QHSVK+L S G+ P++L+ RS   +    + KI+  T +E   + +L +   IY +P  L +Q + + +   F ++         WD        P +++  IA+VGKY +  DAY S+I ++  +    +T +++ +I+S  +       L   DAILVPGGFG R +EGKI A+Q+AREN +P+ GICLGMQ+A IEFARNVL   DA+STEF+  +A+ ++ ++          E +   ++LGGT+RLG   C+L+ GS + + Y +  IVERHRHRYE N   +    + G   SG + +  LVE++E  +H +F+A QFHPEFTS     +P+F  F+  +
  S:     2 TRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVFVTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRVYEHVLRKERRGDYLGATIQVIPHITDEIKRRII--KGAGDADVALVEIGGTVGDIESQPFLEAIRQLRFEVGARRAMLMHLTLVPYIA--TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDHPIDVSSRRKIAQFTNVEERAVIALEDADTIYKIPGILHSQGLDDFVVERFGLQCGG-ADLSEWDKVVDAKLNP-EHEVTIAMVGKYMELLDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTGLLEGVDAILVPGGFGLRGVEGKITAVQFARENKVPYLGICLGMQVAVIEFARNVLGWKDANSTEFDRTSAHAVVGLITEWEDATGAVETRTESSDLGGTMRLGAQECQLEAGSLVHDCYTKDVIVERHRHRYEVNNNLLPQLIEAGLKISGRSGDGALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAA 535
>gi|134045740|ref|YP_001097226.1| CTP synthetase [Methanococcus maripaludis C5] >gi|132663365|gb|ABO35011.1| CTP synthase [Methanococcus maripaludis C5] (533 aa)
Score = 1169, Expect = 7.4e-126, Identities = 243/526 (46%), Positives = 339/526 (64%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKME--VPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-------SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + VTGGV SSLGKG+  SSLG +LK  G  V ++K DPYL +DAGTM+P +HGEVFVT DG ETDLD+GNYERF++I L  ++N+T G++Y+  ++KER G +LG T+QV+PHIT  I  +I  L      D  I+E+GGTVGDIES+PFLEA RQ +    +  V++IH   L  + +  +LKTKP QHSVK+L   GI P++L+ RS+  +S K+K+K++L   +E E +    + + IY +P +LE + +   +     +    P+      W      I  P   +  I +VGKY +  D+Y+SI+ +L  +     T ++I +INS  L   N  E+        +   ILVPGGFG R I+GK+ A++YARE NIPF GICLGMQ A IEFARNV  +  A+STEF+E T +P+I  +  +   T  GGT+RLG Y   L + S   E+Y   ++ ERHRHRYE NP+Y +I +K+G + SG++ +  L E IELENHK+FIA Q HPEF S+   P+P+FY  +  S
  S:     2 KYIFVTGGVVSSLGKGITSSSLGRLLKARGLNVNMIKIDPYLQIDAGTMSPFEHGEVFVTDDGGETDLDLGNYERFVDIGLKADNNITTGKIYWSVLSKERRGDYLGKTVQVIPHITNEIKDRIKALGK--DSDITIIEIGGTVGDIESLPFLEAIRQFKKDVGKENVLYIHVSLLPYIRSAGELKTKPTQHSVKELKGIGIQPDILVCRSEIPISEKIKDKLALFCDVEKEAVIECKDARTIYEVPLNLEKEGLGKLVTEKLNLRDSTPD---LTEWRAIVDRIINPMN-EITIGIVGKYVELKDSYMSIMEALGHAGAKNDTKVNIAWINSEELETKNNEEILDKMVDDEKLHGILVPGGFGDRGIDGKVNAVRYARERNIPFLGICLGMQCAVIEFARNVCGL-KANSTEFDEETEHPVIDYIPEQREITEKGGTMRLGAYPTILTENSLASELYGSINVSERHRHRYEVNPEYHEILKKNGLIISGMSPDGKLAEFIELENHKYFIATQAHPEFKSRPNKPHPLFYGLVKAS 530
>gi|87310803|ref|ZP_01092930.1| CTP synthetase [Blastopirellula marina DSM 3645] >gi|87286560|gb|EAQ78467.1| CTP synthetase [Blastopirellula marina DSM 3645] (548 aa)
Score = 1168, Expect = 7.8e-126, Identities = 245/524 (46%), Positives = 338/524 (64%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQ-AKYRSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLK-HIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISEL-SEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + VTGGV SSLGKG+  +S+G +L+  G  V + K DPY+NVD GTM+P QHGEV+V  DG ETDLD+G+YERF N  L +++N T G++Y   I KER G+FLG T+QV+PHIT  I   I  L ++ + D +I E+GGTVGDIES PFLEA RQ      +   ++IH   +  L   ++LKTKP QHSV  L   GI P++L+ R++  +S+  +EKI+L   +  E +    +    IY +P SL   ++ + I   F     + I    W      ++ P+  +  IAVVGKY++  DAY SI  +++ +    ++ + I  I S ++       L S +D ILVPGGFG+R IEGK+ AI+YARE +IPF GICLGMQ A+IEFARNV+ +  A STEF++++ +P+I +L+ +   T+ GGT+RLG  +C L  GS   E Y  +SI ERHRHRYEFN KY + F KHG  FSG+  + +LVEIIE ENH +F+AVQFHPEF SK +   P+F SF+
  S:     2 TKHIFVTGGVVSSLGKGLTSASIGMLLEQRGLRVKLQKLDPYINVDPGTMSPYQHGEVYVLDDGSETDLDLGHYERFTNSPLTRDANYTTGQIYLSVINKERRGEFLGKTVQVIPHITNEIKSVIEKLGDE-ETDVVITEIGGTVGDIESQPFLEAIRQFSLTAGKENCLYIHLTLVPYLKAAAELKTKPTQHSVGQLREIGIQPDILICRTERNLSHDDREKIALFCNVPIEAVIEEKDKDFSIYEVPLSLHENRLDHLIAKKFGFPRGD-IDLTQWQEILHTLRNPET-EISIAVVGKYAEHKDAYKSIYEAIDHAGIAHRSQIRIGRIQSEAIESEGAERLLSGYDGILVPGGFGERGIEGKVDAIRYARERDIPFLGICLGMQCAAIEFARNVVGLEGAHSTEFSKDSPHPVICLLDEQKNITDKGGTMRLGAQDCSLVPGSHAHEAYGHESINERHRHRYEFNNKYREQFAKHGLRFSGLKPDGSLVEIIENENHPWFVAVQFHPEFKSKPIKAQPLFASFV 525
>gi|52841415|ref|YP_095214.1| CTP synthetase [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|54297139|ref|YP_123508.1| CTP synthetase [Legionella pneumophila str. Paris] >gi|148358768|ref|YP_001249975.1| CTP synthetase [Legionella pneumophila str. Corby] >gi|81370745|sp|Q5X5Y6|PYRG_LEGPA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|81377672|sp|Q5ZWA4|PYRG_LEGPH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|52628526|gb|AAU27267.1| CTP synthase PyrG [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] >gi|53750924|emb|CAH12335.1| CTP synthase [Legionella pneumophila str. Paris] >gi|148280541|gb|ABQ54629.1| CTP synthase PyrG [Legionella pneumophila str. Corby] (545 aa)
Score = 1168, Expect = 8.0e-126, Identities = 243/524 (46%), Positives = 347/524 (66%)
  Q:     5 TKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           TK + +TGGV SSLGKG+A +SL A+L+  G  V ++K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF+   + K +N T+G++Y   I KER G +LG T+QV+PHIT  I + I L ++ +  D  +VE+GGTVGDIES+PFLEA RQ++ +  SQ  +FIH   +  + T  + KTKP QHSVK+L S GI P++L+ RS+  +S   + KI+L T +E E + SL +   IY +P  L  Q +   +     +E   +     W     + +  +    +IA+VGKY++  DAY SI  +L  +  + +T + I + ++  + ++    L   DAILVPGGFG+R +EGKI AIQYARE+ +PF GICLGMQ A IEFARNV+ +  A+STEFN+ T  P++ ++          + ++  T+LGGT+RLG   C L +G+   ++Y +  I+ERHRHRYE N KY+D   KHG + SG + +N+LVE+IEL +H +F+A QFHPEFTS     +P+F  F+
  S:     2 TKYIFITGGVVSSLGKGIAAASLAAILEARGLRVTLIKLDPYINVDPGTMSPFQHGEVFVTNDGAETDLDLGHYERFVKTTMTKRNNFTSGKIYENVIKKERRGDYLGGTVQVIPHITNEIKRCIKLGADAF--DVAMVEIGGTVGDIESLPFLEAIRQMRIELGSQRAIFIHLTLVPYIATSGETKTKPTQHSVKELRSIGIQPDVLICRSEKPLSMADRAKIALFTNVEKEAVISLEDANSIYQIPMILHAQHLDEIVVKKLSLEA-KQADLSEWQRVVDM-QAVQTMTVKIAMVGKYTELNDAYKSINEALLHAGIHTETKVEIIYFDAEMIEKHGALLLESIDAILVPGGFGERGVEGKIKAIQYAREHKVPFLGICLGMQTAVIEFARNVVGLTGANSTEFNKETLYPVLGLISEWMDADGSKQIRDENTDLGGTMRLGGQYCHLAEGTLARKVYGKPQIIERHRHRYEVNNKYVDSLVKHGLIISGRSADNSLVEMIELADHPWFLACQFHPEFTSNPRDSHPLFKEFV 532
>gi|15669363|ref|NP_248168.1| CTP synthetase [Methanocaldococcus jannaschii DSM 2661] >gi|2494762|sp|Q58574|PYRG_METJA CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|1591801|gb|AAB99177.1| CTP synthase (pyrG) [Methanocaldococcus jannaschii DSM 2661] (540 aa)
Score = 1168, Expect = 8.3e-126, Identities = 241/526 (45%), Positives = 342/526 (65%)
  Q:     6 KILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNR-IGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNE-------NNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           K + +TGGV SSLGKG+  +SLG +LK  G +V ++K DPYL +DAGTM+P +HGEVFVT DG E+DLD+G+YERF++ NL K +N+T G++Y+  + KER G++LG T+QV+PHIT  I   I  L   Y  D  IVE+GGTVGDIES+PFLEA RQ +    +  V++IH   L  +    +LKTKP QHSVK+L S GI P++L+ R++  +S+K++EK++L   ++ E +    + + IY +P +LE + +   +    K+ +P+R      W  F   +  P   +  I +VGKY +  DAYLSI  +L  +     T ++I +I+S  L         +   E ++ D ILVPGGFG R +EGKI AI+YAREN+IPF GIC+GMQ A IEFARNV  +  A+STEF+ENT  P++ +L  +      GGT+RLG Y   L +G+   ++Y RK + ERHRHRYE NP+Y +I E HG   SG + +  L E IE+  +++FIA Q HPEF S+   P+P+F   +  S
  S:     5 KFIFITGGVISSLGKGITAASLGRLLKARGFKVNMIKIDPYLQIDAGTMSPYEHGEVFVTEDGGESDLDLGHYERFIDENLTKNNNITTGKIYWSVLTKERKGEYLGKTVQVIPHITNEIKDWIKNLGEGY--DITIVEIGGTVGDIESLPFLEAIRQFKKDVGKENVLYIHVSLLPYIRAAGELKTKPTQHSVKELRSIGIQPDILICRTEMPISDKIREKLALFCDVDKEAVIEARDARTIYEVPLNLEKEGLGKLVTK--KLNLPDREPDLDEWRKFVDRVINPLN-EVTIGIVGKYVELKDAYLSITEALIHAGAKNDTKVNINWIHSERLESEEFEELLDRYREDNQLDGILVPGGFGDRGVEGKINAIKYARENDIPFLGICMGMQCAVIEFARNVCGLEGANSTEFDENTKYPVVDLLPEQKEIDAKGGTMRLGAYPAILMEGTLAYKLYGRKEVYERHRHRYEVNPEYHEILENHGLTISGKSPDGRLAEFIEISKNRYFIATQAHPEFKSRPNKPHPLFDGLVRAS 534
>gi|108562769|ref|YP_627085.1| CTP synthetase [Helicobacter pylori HPAG1] >gi|119391115|sp|Q1CUG1|PYRG_HELPH CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|107836542|gb|ABF84411.1| CTP synthetase [Helicobacter pylori HPAG1] (538 aa)
Score = 1168, Expect = 8.5e-126, Identities = 245/526 (46%), Positives = 345/526 (65%)
  Q:     3 DKTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKY-RSQVMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKH--WDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNISELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITIL----------EGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           D+ K + VTGGV SSLGKG++ SS+  +L+    +V I+K DPY+N+D GTM+P +HGEVFVT DG ETDLDIG+YERFLN NL + +N T G+++   I  ER G++LG TIQ+VPH+T+ I ++I   S     DFLIVEVGGTVGD+E + +LEA RQL+ +    +V+ +H   +  + T ++LKTKP QHSV++L   G+ P ++L RS   +  +LK KI+L+  +E +++    + K IY  P     + +   I   F +   N++  K   W+T    I  P K+K +I  VGKY    ++Y S+I +L  +  +L   ++IE+++S + NE   ++L   DAILVPGGFG+R IEGKI AIQ AR   +PF GICLGMQLA +EF RNVL +  A+STEFN+    P++ ++          + +   + LGGT+RLG Y CE+   S + + YK+ SI ERHRHRYE NPKY   +E  G    G    N+L+E IELE+H FF+ VQFHPEFTS++ SPNPI   F+
  S:     2 DRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDPYINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIENERKGEYLGKTIQIVPHVTDEIKRRI--KSAAKGLDFLIVEVGGTVGDMEGMFYLEAIRQLKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLDKELKNKIALSCDVEQDSVIVATDTKSIYACPILFLQEGILTPIARRFNL---NKLHPKMAAWNTLVEKIIAP-KHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDAQVNIEWLDSENFNEK--TDLEGVDAILVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIVEFCRNVLGLKGANSTEFNQRCEYPVVYLIGDFMDQNHQKQVRTYNSPLGGTMRLGEYECEIMPNSLLEKAYKKPSIKERHRHRYEINPKYRQEWESKGLKVVGFGA-NHLIEAIELEDHPFFVGVQFHPEFTSRLQSPNPIILDFI 531
>gi|85858674|ref|YP_460876.1| CTP synthetase [Syntrophus aciditrophicus SB] >gi|119391191|sp|Q2LRK2|PYRG_SYNAS CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|85721765|gb|ABC76708.1| CTP synthase [Syntrophus aciditrophicus SB] (538 aa)
Score = 1168, Expect = 8.8e-126, Identities = 234/528 (44%), Positives = 335/528 (63%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHT--VPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFFKMEVPNRIGYKH---WDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNIS-ELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFLNVS 531
           +TK + +TGGV SSLGKG+A +S+ A+L+C G  V   K DPY+NVD GTM+P QHGEVFVT DG ETDLD+G+YERF +  + K +N+T G+VY+  I KER G +LG T+QV+PHIT  I   I   S  +  D  ++E+GGTVGDIES+PFLEA RQ + +   Q  +FIH   VP I+  T  ++KTKP QHSVK L   GI P++LL R+++ +S  +K KI+L   +E   +++  ++  IY +P     + +   I +   +      G  H   W+     I  P  Y+  IA+VGKY +  D+Y S+  +L          +++ F++S  + ++ ++ +L   D ILVPGGFG R IEG I  I+YAREN +PFFGICLGMQ+A +EFAR+V  +  A+S+EF+ENT +P+I +L  +     +G ++RLG+Y C L D S   E Y    I ERHRHRYEFN  Y +  E  G   +G + +  LVEI+E+++H +F+  QFHPEF S+   P+P+F  F+  +
  S:     2 RTKYIFITGGVLSSLGKGLAAASIAAVLECRGLRVTNQKLDPYINVDPGTMSPFQHGEVFVTDDGAETDLDLGHYERFTSTRMGKSNNLTTGQVYFSVITKERRGDYLGKTVQVIPHITNEIKDYIRQSSEGF--DVALIEIGGTVGDIESLPFLEAIRQFRNEVGKQNAIFIHLTWVPFIK--TAGEVKTKPTQHSVKALREIGIQPDILLCRTEEFLSEDIKAKIALFCNVEEAAVFTAKDVSCIYEVPLIYHREGLDQKIVDLLNIWT----GQPHLEAWENVVQKITSPS-YEVNIAIVGKYVNLTDSYKSLNEALVHGGIGNDCQVNLRFVDSEKIEKDGLNHQLENVDGILVPGGFGNRGIEGMIQVIRYARENKVPFFGICLGMQMAVVEFARHVCGLEKANSSEFDENTPHPVIDLLPEQKAVQEMGASMRLGSYPCRLSDASLACEAYGEVEIGERHRHRYEFNRDYQERLEACGLRITGRSPDGRLVEIVEIKDHPWFLGCQFHPEFKSRPTEPHPLFQRFIEAA 527
>gi|83816692|ref|YP_444693.1| CTP synthetase [Salinibacter ruber DSM 13855] >gi|119391171|sp|Q2S538|PYRG_SALRD CTP synthase (UTP--ammonia ligase) (CTP synthetase) >gi|83758086|gb|ABC46199.1| CTP synthase [Salinibacter ruber DSM 13855] (565 aa)
Score = 1168, Expect = 8.8e-126, Identities = 231/525 (44%), Positives = 343/525 (65%)
  Q:     4 KTKILIVTGGVFSSLGKGVACSSLGAMLKCFGQEVLIMKFDPYLNVDAGTMAPGQHGEVFVTFDGRETDLDIGNYERFLNINLPKESNVTAGRVYYETIAKERDGKFLGATIQVVPHITEAISQKIILLSNKYQPDFLIVEVGGTVGDIESIPFLEATRQLQAKYRSQ-VMFIHTVPLIELLTGSDLKTKPLQHSVKDLMSAGIFPNLLLVRSKDAVSNKLKEKISLTTGIENENIYSLINLKHIYLLPESLENQKVQNSIFNFF-------KMEVPNRIGYKHWDTFTSLIKEPKKYKARIAVVGKYSDSPDAYLSIISSLEISSFYLKTDLSIEFINSSSLNENNI-SELSEFDAILVPGGFGKRDIEGKILAIQYARENNIPFFGICLGMQLASIEFARNVLKMHDADSTEFNENTANPIITILEGKNRETNLGGTLRLGNYNCELKDGSKILEIYKRKSIVERHRHRYEFNPKYMDIFEKHGFVFSGINKENNLVEIIELENHKFFIAVQFHPEFTSKILSPNPIFYSFL 528
           +TK + VTGGV SSLGKG+  +SLG +L   G +V I KFDPY+NVD GTM P +HGEV+VT DG ETDLD+G+YERFL+    + +NVT GRVY E I+KER+G +LG T+QVVPHI + I   ++ L      D +I E+GGTVGDIE  P+LEA RQL+ +   +  M  H   +  L    +LKTKP QHSVK+L++ G+ P+ ++ RS+ +++ +++ KISL   +E E +  +++ + IY +P  L ++     + + F         +  +      W