>gi|26553989|ref|NP_757923.1| hypothetical protein MYPE5380 [Mycoplasma penetrans HF-2] >gi|26453997|dbj|BAC44327.1| hypothetical protein [Mycoplasma penetrans HF-2] (97 aa)
Score = 444, Expect = 7.5e-43, Identities = 96/97 (98%), Positives = 97/97 (100%)
  Q:     1 LKQWFEENQNKDNFNPYYFLDSKTLWGLGGSTENDFQPVSYVDNSAEIITANLNNTDGRKVGFNKVYSFKITLTPKWGHAWTDGTSASKTIVAYGVY 97
           +KQWFEENQNKDNFNPYYFLDSKTLWGLGGSTENDFQPVSYVDNSAEIITANLNNTDGRKVGFNKVYSFKITLTPKWGHAWTDGTSASKTIVAYGVY
  S:     1 MKQWFEENQNKDNFNPYYFLDSKTLWGLGGSTENDFQPVSYVDNSAEIITANLNNTDGRKVGFNKVYSFKITLTPKWGHAWTDGTSASKTIVAYGVY 97
>gi|26553994|ref|NP_757928.1| hypothetical protein MYPE5430 [Mycoplasma penetrans HF-2] >gi|26454002|dbj|BAC44332.1| hypothetical protein [Mycoplasma penetrans HF-2] (223 aa)
Score = 208, Expect = 1.8e-15, Identities = 51/97 (52%), Positives = 69/97 (71%)
  Q:     1 LKQWFEENQNKDNFNPYYFLDSKTLWGLGGSTEN-DFQPVSYVDNSAEII--TANLNNTDGRKVGFNKVYSFKITLTPKWGHAWTDGTSASKTIVAYGVY 97
           LK WF+EN+NKD FN  +F  + TL GLG  +E  +++ +++VDNSA+II  T + N T   K   N VYSF++ LTP  GHAWTDG+S SKT+  YG+Y
  S:   120 LKTWFDENKNKDKFNDLHFQSTVTLVGLGDLSEGYNYEVITFVDNSAQIIDSTTSQNITLRNK---NFVYSFQVNLTPVSGHAWTDGSSVSKTLTVYGLY 216
>gi|26553993|ref|NP_757927.1| hypothetical protein MYPE5420 [Mycoplasma penetrans HF-2] >gi|26454001|dbj|BAC44331.1| hypothetical protein [Mycoplasma penetrans HF-2] (146 aa)
Score = 199, Expect = 2.1e-14, Identities = 45/97 (46%), Positives = 61/97 (62%)
  Q:     1 LKQWFEENQNKDNFNPYYFLDSKTLWGLGGSTEN-DFQPVSYVDNSAEIITANLNNTDGRKVGFNKVYSFKITLTPKWGHAWTDGTSASKTIVAYGVY 97
           LK WFE+N+   NFN  YFLDSK +  L  S    +++P+ YVDNSA++ T NL+ +      +NKVYSF++TLTP  GH WTDG    K I  +  +
  S:    47 LKDWFEQNKRNPNFNYLYFLDSKNITWLHDSILGYNYEPIEYVDNSAKLFTENLSGSSNSSSKYNKVYSFQVTLTPASGHGWTDGDREGKVITIFAPF 144
>gi|26553982|ref|NP_757916.1| hypothetical protein MYPE5300 [Mycoplasma penetrans HF-2] >gi|26453990|dbj|BAC44320.1| hypothetical protein [Mycoplasma penetrans HF-2] (250 aa)
Score = 184, Expect = 1.2e-12, Identities = 47/97 (48%), Positives = 66/97 (68%)
  Q:     1 LKQWFEENQNKDNFNPYYFLDSKTLWGLG--GSTENDFQPVSYVDNSAEIITA--NLNNTDGRK----VGFNKVYSFKITLTPKWGHAWTDGTSASKTIVAYGVY 97
           L +WF +N++KDNFN  +F   K +  L    +   +++ ++YV+NSA+II    + NN D +     +  NKVYS ++TL P  GHAWTDGTS SKTI  YGVY
  S:   137 LNEWFNQNKDKDNFNGTHFFSVKDISFLSHFSNESYNYEVITYVNNSAKIIKTVDSSNNQDSQNSDSSILKNKVYSLEVTLKPASGHAWTDGTSQSKTITVYGVY 241
>gi|26553990|ref|NP_757924.1| hypothetical protein MYPE5390 [Mycoplasma penetrans HF-2] >gi|26453998|dbj|BAC44328.1| hypothetical protein [Mycoplasma penetrans HF-2] (236 aa)
Score = 160, Expect = 7.7e-10, Identities = 43/97 (44%), Positives = 60/97 (61%)
  Q:     1 LKQWFEENQNKDNFNPYYFLDSKTLWGLGGSTENDFQPVSYVDNSAEIITANLNNTDGRKVGFNKVYSFKITLTPKWGHAWTDGTSASKTIVAYGVY 97
           L+ WF +N+N +NFN  YF+ S  L         +++  S++  SA+I T  LN+ +     FNKVYSF+I LTP +GH+W DGTS SK I  YG+Y
  S:   137 LESWFNQNKNNENFNDTYFVQSNLLGFHVPEYGYNYKIASFISGSAKINTEILNDENKNPQTFNKVYSFEIDLTPNFGHSWIDGTSGSKKITVYGIY 233