>gi|26553506|ref|NP_757440.1| hypothetical protein MYPE540 [Mycoplasma penetrans HF-2] >gi|26453512|dbj|BAC43844.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (177 aa)
Score = 770, Expect = 1.5e-80, Identities = 177/177 (100%), Positives = 177/177 (100%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLDWVKKDFNNDEWKEKINKSVFMIDYTNKDIIESLLELNANIIAVNTKCDEDIKKEKLYKSIIKSNNLVISYGLKNLNEQLLN 177
           MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLDWVKKDFNNDEWKEKINKSVFMIDYTNKDIIESLLELNANIIAVNTKCDEDIKKEKLYKSIIKSNNLVISYGLKNLNEQLLN
  S:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLDWVKKDFNNDEWKEKINKSVFMIDYTNKDIIESLLELNANIIAVNTKCDEDIKKEKLYKSIIKSNNLVISYGLKNLNEQLLN 177
>gi|50365352|ref|YP_053777.1| DNA processing/uptake protein [Mesoplasma florum L1] >gi|50363908|gb|AAT75893.1| DNA processing/uptake protein [Mesoplasma florum L1] (259 aa)
Score = 151, Expect = 1.1e-08, Identities = 31/79 (39%), Positives = 52/79 (65%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRF 79
           M ++LLYF++KY G WE+IY A   +E  +  ++ KV +  P+N+I++I+  YP   K ++KPPF+++  GN  LL  +
  S:     1 MDNVLLYFSLKYHGDWEKIYDALDRKEKIETQDLIKVPNSIPNNFISIINPLYPNNLKQIMKPPFILYYLGNISLLQNY 79
>gi|167756892|ref|ZP_02429019.1| hypothetical protein CLORAM_02441 [Clostridium ramosum DSM 1402] >gi|167703067|gb|EDS17646.1| hypothetical protein CLORAM_02441 [Clostridium ramosum DSM 1402] (250 aa)
Score = 133, Expect = 1.2e-06, Identities = 36/84 (42%), Positives = 51/84 (60%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSE----NPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFV 84
           M +ILLYF++KY+G ++ I +A   +E  KIDE  K+K E       N+  LI  +YP   K +  PPFV+F  GN   L+  KNK +
  S:     1 MEEILLYFSLKYAGDFDSILKALECKE--KIDE--KLKKELFKDITANYTTLISPDYPTALKEIACPPFVLFYYGN---LALVKNKCI 81
>gi|169350424|ref|ZP_02867362.1| hypothetical protein CLOSPI_01192 [Clostridium spiroforme DSM 1552] >gi|169292744|gb|EDS74877.1| hypothetical protein CLOSPI_01192 [Clostridium spiroforme DSM 1552] (251 aa)
Score = 132, Expect = 1.5e-06, Identities = 27/77 (35%), Positives = 45/77 (58%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLS 77
           M +I+LYFA+KY+G +++IYQA   +E    D    +  E    +  +I ++YP   K +  PPFV+F  G+  L++
  S:     2 MEEIILYFALKYAGDFDKIYQALERKEKIDDDLKGHLFKELKSKYTTIISDDYPAALKEINCPPFVLFYYGDLNLVN 78
>gi|15829018|ref|NP_326378.1| DNA processing protein SMF [Mycoplasma pulmonis UAB CTIP] >gi|14089962|emb|CAC13720.1| DNA PROCESSING PROTEIN SMF [Mycoplasma pulmonis] (244 aa)
Score = 130, Expect = 3.0e-06, Identities = 35/96 (36%), Positives = 53/96 (55%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKS---ENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLD 96
           M ++LLYF+    G  ++I+++  + E     E+ K KS   EN   +I ++   YPEEFKY+  PPF++F KGN  LL     K  +  +     NLD
  S:     1 MNEVLLYFSFINKGNTKKIFESLKKHEQIDPVELKKYKSMLEENSIKYITILSSKYPEEFKYLNNPPFILFYKGNLDLLK--NTKIALSGDVVSQKNLD 97
>gi|193216606|ref|YP_001999848.1| putative DNA processing protein, SMF family [Mycoplasma arthritidis 158L3-1] >gi|193001929|gb|ACF07144.1| putative DNA processing protein, SMF family [Mycoplasma arthritidis 158L3-1] (258 aa)
Score = 121, Expect = 2.7e-05, Identities = 31/96 (32%), Positives = 50/96 (52%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPD---NWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLD 96
           M + ++YF  KY+G W++IY AF   E    D   ++  E  D     I ++D+ YP +   + KPPF +   GN  L++ F+  F +  N   D  +D
  S:     1 MNNFIIYFDYKYNGDWDKIYHAFKNFENVDDDLAKQIARERIDLKEKIITILDDEYPAKLDMLRKPPFALHYLGNYSLIN-FEKSFCLTGNLEKDYIVD 98
>gi|71894560|ref|YP_278668.1| putative DNA processing protein [Mycoplasma synoviae 53] >gi|71851348|gb|AAZ43957.1| putative DNA processing protein [Mycoplasma synoviae 53] (246 aa)
Score = 116, Expect = 1.3e-04, Identities = 50/165 (30%), Positives = 83/165 (50%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREV---TKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLDWVKKDFNNDEWKEKINKSVFMIDY-TNKDIIESLLELNANIIAVNTKCDEDIKKEKLYKSIIKSNNLVIS 165
           M +ILLY + K+ G    IY+   ++E    ++IDEI  +  +N   +I++ D NYP     V  PPFV++ KGN  LL+    K + L +   + N ++ K+  + +      N  +    Y + K +I+     NA+II +     E +   K +  I   NNL+IS
  S:     1 MNNILLYLSNKHKGDNYLIYKGLKDKEKLRKSEIDEITNIYLKNDIKFISIFDLNYPSSLFMVHYPPFVLYYKGNINLLNDLTKKRLYLVD---EMNSEYSKEILSKNIRTLTENSILVTNSYASEKHLIDEFKNANASIIYI---AKEGLNSSK-FDDINLENNLIIS 162
>gi|72080588|ref|YP_287646.1| DNA processing protein SMF [Mycoplasma hyopneumoniae 7448] >gi|71913712|gb|AAZ53623.1| DNA processing protein SMF [Mycoplasma hyopneumoniae 7448] (259 aa)
Score = 113, Expect = 2.8e-04, Identities = 29/103 (28%), Positives = 53/103 (51%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSE---NPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLDWVKKDFN 103
           M+  L+Y+A+KY G ++ I  A   +E    +E  K++ +        I ++DENYPE F+ +  PP+V+F +G  + L     K  ++   Y     ++  K  +
  S:     1 MKSSLIYYAIKYKGDYKLIQNAIQTKEEITKEEFLKLQEKLDSGKIKAITILDENYPEAFQVLKNPPYVLFYQGKIEFLENKNPKSALIGEKYNSKIQEFFNKSLD 106
>gi|54020048|ref|YP_115644.1| DNA processing protein SMF [Mycoplasma hyopneumoniae 232] >gi|53987221|gb|AAV27422.1| putative DNA processing protein [Mycoplasma hyopneumoniae 232] (264 aa)
Score = 112, Expect = 3.3e-04, Identities = 29/103 (28%), Positives = 53/103 (51%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSE---NPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLDWVKKDFN 103
           M+  L+Y+A+KY G ++ I  A   +E    +E  K++ +        I ++DENYPE F+ +  PP+V+F +G  + L     K  ++   Y     ++  K  +
  S:     6 MKSSLIYYAIKYKGDYKLIQNAIQTKEEITKEEFLKLQEKLDSGKIKAITILDENYPEAFQVLKNPPYVLFYQGKIEFLENKNPKSALIGEKYNSKIQEFFNKSLD 111
>gi|71893597|ref|YP_279043.1| DNA processing protein SMF [Mycoplasma hyopneumoniae J] >gi|71851724|gb|AAZ44332.1| DNA processing protein SMF [Mycoplasma hyopneumoniae J] (259 aa)
Score = 112, Expect = 3.4e-04, Identities = 29/103 (28%), Positives = 53/103 (51%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSE---NPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLNNFYGDANLDWVKKDFN 103
           M+  L+Y+A+KY G ++ I  A   +E    +E  K++ +        I ++DENYPE F+ +  PP+V+F +G  + L     K  ++   Y     ++  K  +
  S:     1 MKSSLIYYAIKYKGDYKLIQNAIQTKEEITKEEFLKLQEKLDSGKIKAITILDENYPEAFQVLKNPPYVLFYQGKIEFLENKNPKSALIGEKYNSKIQEFFNKSLD 106
>gi|171326464|ref|ZP_02914937.1| DNA protecting protein DprA [Geobacillus sp. WCH70] >gi|171087539|gb|EDT33917.1| DNA protecting protein DprA [Geobacillus sp. WCH70] (294 aa)
Score = 106, Expect = 1.6e-03, Identities = 21/60 (35%), Positives = 34/60 (56%)
  Q:    21 QAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFK 80
           Q F +     I+ + K   +   + I + D +YP   K++ KPP+V++ KGN +LLS FK
  S:    57 QFFQDLHSPHIESMIKTYKDKNIHVITIFDSDYPPLLKHIYKPPWVLYAKGNIRLLSSFK 116
>gi|163791332|ref|ZP_02185745.1| DNA processing protein DprA, putative [Carnobacterium sp. AT7] >gi|159873411|gb|EDP67502.1| DNA processing protein DprA, putative [Carnobacterium sp. AT7] (289 aa)
Score = 104, Expect = 2.6e-03, Identities = 35/124 (28%), Positives = 66/124 (53%)
  Q:    45 WIALIDENYPEEFKYVIKPPFVIFLKG-----NKKLLSRFKNKFVMLNNFYGDANLDWVKKDFNNDEWKEKINKSVFMIDYTNKDIIESLLELNANIIA-VNTKCDE--DIKKEKLYKSIIKSNNLVISYGL 168
           W++++D++YPE  K++  PP ++F +G     N+KLL+   ++   L + YG+  L  +  +   +     I     +    ++ + E  +EL    IA + T  D+    + EKL K I K++ L+  Y L
  S:    79 WVSILDQSYPEYLKHIYNPPALLFYQGDLTLLNQKLLAIVGSR---LTSSYGEKALTILLPELITN----GITTVSGLAKGIDRLVHEKTIELGGRTIAIIGTGLDQFYPFENEKLQKEIAKNHLLISEYPL 203
>gi|47459209|ref|YP_016071.1| DNA processing protein smf [Mycoplasma mobile 163K] >gi|47458538|gb|AAT27860.1| DNA processing protein smf [Mycoplasma mobile 163K] (240 aa)
Score = 99, Expect = 9.5e-03, Identities = 28/80 (35%), Positives = 45/80 (56%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEI---NKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFK 80
           M++I++YF++KY G + +I  A  + E   I+++   NK    N    +   D+ YP  FK +   P+ IF KGN  LL+  K
  S:     1 MKEIIIYFSIKYQGDYFKIKNALIKMEKIDIEKLIQWNKKLENNKIKVLTKFDQTYPNSFKNIKYSPYAIFYKGNIDLLNSEK 83
>gi|158320506|ref|YP_001513013.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs] >gi|158140705|gb|ABW19017.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs] (365 aa)
Score = 95, Expect = 3.3e-02, Identities = 15/32 (46%), Positives = 25/32 (78%)
  Q:    46 IALIDENYPEEFKYVIKPPFVIFLKGNKKLLS 77
           + + DENYPE+ + +  PP+VI++KGNK+ L+
  S:    82 LTIYDENYPEKLRNIYDPPYVIYMKGNKEYLN 113
>gi|160915178|ref|ZP_02077391.1| hypothetical protein EUBDOL_01186 [Eubacterium dolichum DSM 3991] >gi|158432977|gb|EDP11266.1| hypothetical protein EUBDOL_01186 [Eubacterium dolichum DSM 3991] (242 aa)
Score = 93, Expect = 5.5e-02, Identities = 21/77 (27%), Positives = 39/77 (50%)
  Q:     1 MRDILLYFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLS 77
           MR+ +L +A++Y G W  I QA    E  +       + +    ++ + D+ YP+ F  +  PP+++F  G  +L S
  S:     1 MREQILCYAIRYHGEWHAIKQAILRNEEWE-------RCDYDGYYVTIYDKEYPQCFLQLEYPPWILFYAGRLELCS 70
>gi|150021484|ref|YP_001306838.1| DNA protecting protein DprA [Thermosipho melanesiensis BI429] >gi|149794005|gb|ABR31453.1| DNA protecting protein DprA [Thermosipho melanesiensis BI429] (264 aa)
Score = 92, Expect = 7.8e-02, Identities = 17/33 (51%), Positives = 23/33 (69%)
  Q:    46 IALIDENYPEEFKYVIKPPFVIFLKGNKKLLSR 78
           +   DE+YPE  K +  PP V+F KGNK+LLS+
  S:    49 VTYFDEDYPESLKNIWNPPVVLFGKGNKELLSK 81
>gi|168144617|ref|ZP_02587846.1| Nucleotide-binding SMF protein [Bacillus cereus G9842] (289 aa)
Score = 92, Expect = 7.9e-02, Identities = 21/63 (33%), Positives = 36/63 (57%)
  Q:    45 WIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLN----NFYGDANLDWVKKDFNNDEW 107
           +I + DENYP+  + +  PPFV++ KG K  L++  NK  ++     + YG  +L ++       EW
  S:    78 YITIWDENYPQLLREIQDPPFVLYGKGEKDFLNKV-NKLAVVGTREPSLYGHESLKFILHPLLEREW 143
>gi|52785590|ref|YP_091419.1| hypothetical protein BLi01831 [Bacillus licheniformis ATCC 14580] >gi|163119434|ref|YP_079004.2| DNA processing Smf protein [Bacillus licheniformis ATCC 14580] >gi|52348092|gb|AAU40726.1| Smf [Bacillus licheniformis DSM 13] >gi|145902941|gb|AAU23366.2| DNA processing Smf protein homolog [Bacillus licheniformis ATCC 14580] (300 aa)
Score = 90, Expect = 1.3e-01, Identities = 19/56 (33%), Positives = 30/56 (53%)
  Q:    21 QAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLL 76
           +  AE+E++ +  + +          A+   +YP   K +  PP V+FLKGNKKLL
  S:    56 RKLAEQELSNVKRLIRSYEAAGVRMTAISSPDYPASLKTIHDPPPVLFLKGNKKLL 111
>gi|171779425|ref|ZP_02920389.1| hypothetical protein STRINF_01270 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] >gi|171282042|gb|EDT47473.1| hypothetical protein STRINF_01270 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] (280 aa)
Score = 89, Expect = 1.7e-01, Identities = 18/47 (38%), Positives = 32/47 (68%)
  Q:    34 INKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFK 80
           + KV ++ P   I+++D++YP E K+   PP ++F +GN +LL+R K
  S:    62 LRKVFNQYPS--ISILDDDYPLELKHSYNPPVLLFYQGNIELLNRPK 106
>gi|171920578|ref|ZP_02695619.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|185178780|ref|ZP_02554494.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188024439|ref|ZP_02570575.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188039255|ref|ZP_02527959.2| hypothetical protein Uures_00625 [Ureaplasma urealyticum serovar 8] >gi|188518421|ref|ZP_02556519.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|188524222|ref|ZP_02557640.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|188530782|ref|ZP_02546462.2| hypothetical protein Uurese_01000002_0200001313 [Ureaplasma urealyticum serovar 4 str. ATCC 27816] >gi|188568834|ref|ZP_02829041.2| hypothetical protein Uurealyserovar_01935 [Ureaplasma urealyticum serovar 2] >gi|188592652|ref|ZP_02694385.2| hypothetical protein Uureaserovar_01965 [Ureaplasma urealyticum serovar 10] >gi|195867435|ref|ZP_03079439.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] >gi|171903282|gb|EDT49571.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] >gi|184209397|gb|EDU06440.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] >gi|188018732|gb|EDU56772.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] >gi|188998039|gb|EDU67136.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] >gi|195659952|gb|EDX53332.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] >gi|195660911|gb|EDX54164.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] (236 aa)
Score = 88, Expect = 2.2e-01, Identities = 20/62 (32%), Positives = 33/62 (53%)
  Q:     7 YFAVKYSGCWERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIF 68
           YF++KY G W +IY A    E      + + +       I L DE YP ++K + +PPF+++
  S:     7 YFSLKYKGDWLKIYLALINHEEQNEHSLLENEEYERLKAIDLTDEKYPNKYKKINQPPFILY 68
>gi|25011095|ref|NP_735490.1| hypothetical protein gbs1041 [Streptococcus agalactiae NEM316] >gi|76798273|ref|ZP_00780521.1| DNA processing Smf protein [Streptococcus agalactiae 18RS21] >gi|77407070|ref|ZP_00784075.1| DNA processing chain A [Streptococcus agalactiae H36B] >gi|77408077|ref|ZP_00784825.1| DNA processing chain A [Streptococcus agalactiae COH1] >gi|77410536|ref|ZP_00786897.1| DNA processing chain A [Streptococcus agalactiae CJB111] >gi|77414788|ref|ZP_00790911.1| DNA processing chain A [Streptococcus agalactiae 515] >gi|23095494|emb|CAD46700.1| Unknown [Streptococcus agalactiae NEM316] >gi|76586384|gb|EAO62894.1| DNA processing Smf protein [Streptococcus agalactiae 18RS21] >gi|77159164|gb|EAO70352.1| DNA processing chain A [Streptococcus agalactiae 515] >gi|77163484|gb|EAO74434.1| DNA processing chain A [Streptococcus agalactiae CJB111] >gi|77173342|gb|EAO76463.1| DNA processing chain A [Streptococcus agalactiae COH1] >gi|77174323|gb|EAO77187.1| DNA processing chain A [Streptococcus agalactiae H36B] (280 aa)
Score = 87, Expect = 2.4e-01, Identities = 15/35 (42%), Positives = 25/35 (71%)
  Q:    46 IALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFK 80
           ++++D NYP E K +  PP ++F +GN +LLS+ K
  S:    73 LSILDSNYPLELKEIYNPPVLLFYQGNIELLSKPK 107
>gi|29376206|ref|NP_815360.1| DNA processing protein DprA, putative [Enterococcus faecalis V583] >gi|29343669|gb|AAO81430.1| DNA processing protein DprA, putative [Enterococcus faecalis V583] (287 aa)
Score = 87, Expect = 2.6e-01, Identities = 20/58 (34%), Positives = 35/58 (60%)
  Q:    23 FAEREVTKIDEINKVKSENPDNWI-------------------ALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFK 80
           F+  E+ +I EI K +     +W+                    ++D  YP+  + +  PP ++F +GN +LLSR K
  S:    38 FSSTEIIRIAEIKKYRELFEQSWLHHTIHSEALYIRQCQHQFMTILDAVYPKLLREIYNPPAILFYRGNLQLLSRRK 114
>gi|76787406|ref|YP_329722.1| DNA processing protein DprA, putative [Streptococcus agalactiae A909] >gi|76562463|gb|ABA45047.1| DNA processing protein DprA, putative [Streptococcus agalactiae A909] (280 aa)
Score = 87, Expect = 2.6e-01, Identities = 15/35 (42%), Positives = 25/35 (71%)
  Q:    46 IALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFK 80
           ++++D NYP E K +  PP ++F +GN +LLS+ K
  S:    73 LSILDSNYPLELKEIYNPPVLLFYQGNIELLSKPK 107
>gi|168143385|ref|ZP_02586614.1| Smf protein [Bacillus cereus G9842] (290 aa)
Score = 87, Expect = 2.9e-01, Identities = 22/51 (43%), Positives = 31/51 (60%)
  Q:    34 INKVKSENPDNWIALI---DENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFV 84
           I+K+ SE  D  I      ++ YP   K +  PPF IF+KGN+ LL   +NKF+
  S:    71 ISKILSEFSDEKIEYFIYYEDGYPTSLKSIPSPPFFIFMKGNRSLL---ENKFI 121
>gi|42782926|ref|NP_980173.1| Smf family DNA processing protein [Bacillus cereus ATCC 10987] >gi|42738853|gb|AAS42781.1| DNA processing protein (smf family) [Bacillus cereus ATCC 10987] (289 aa)
Score = 87, Expect = 3.0e-01, Identities = 20/63 (31%), Positives = 36/63 (57%)
  Q:    45 WIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLN----NFYGDANLDWVKKDFNNDEW 107
           ++ + DE+YP+  + +  PPFV++ KG K  L++  NK  ++     N YG  +L ++       EW
  S:    78 YMTIWDEDYPKLLREIQDPPFVLYGKGEKDFLNKV-NKLAVVGTREPNLYGYESLKFILHPLLEKEW 143
>gi|22537166|ref|NP_688017.1| DprA/SMF protein, putative DNA processing factor [Streptococcus agalactiae 2603V/R] >gi|22534030|gb|AAM99889.1|AE014238_2 DprA/SMF protein, putative DNA processing factor [Streptococcus agalactiae 2603V/R] (280 aa)
Score = 87, Expect = 3.0e-01, Identities = 15/35 (42%), Positives = 25/35 (71%)
  Q:    46 IALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFK 80
           ++++D NYP E K +  PP ++F +GN +LLS+ K
  S:    73 LSILDSNYPLELKEIYNPPVLLFYQGNIELLSKPK 107
>gi|13358156|ref|NP_078430.1| hypothetical protein UU591 [Ureaplasma parvum serovar 3 str. ATCC 700970] >gi|11345857|pir||C82870 hypothetical protein UU591 [imported] - Ureaplasma urealyticum >gi|6899602|gb|AAF31005.1|AE002158_3 unique hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970] (239 aa)
Score = 87, Expect = 3.0e-01, Identities = 23/62 (37%), Positives = 37/62 (59%)
  Q:     7 YFAVKYSGCWERIYQAFAERE------VTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIF 68
           YF++KY G W +IY A    E        + ++  KVK+      I L DE YP ++K + +PPF+++
  S:    10 YFSLKYKGDWSKIYLALINHEDQNEYLFLEKEDYEKVKA------IDLTDEKYPNKYKKINQPPFILY 71
>gi|194014384|ref|ZP_03053001.1| DNA protecting protein DprA [Bacillus pumilus ATCC 7061] >gi|194013410|gb|EDW22975.1| DNA protecting protein DprA [Bacillus pumilus ATCC 7061] (300 aa)
Score = 86, Expect = 3.1e-01, Identities = 27/92 (29%), Positives = 46/92 (50%)
  Q:    16 WERIYQAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVM---LNNFYGDANLDWVKKDFNNDEW 107
           + R+ QA  E+E      I +   +   + I +    YP   K++  PP V+FLKGN   L+  K+  V+   + + YG+A +  +  D   +EW
  S:    52 FTRLKQA-EEKEFPIFQHIVQAYLKQNIHMIPITSPLYPSTLKHIYDPPPVLFLKGNISYLNEEKSLGVVGTRVPSSYGEACVKKIVGDLVKEEW 145
>gi|161507471|ref|YP_001577425.1| DNA processing protein chain A [Lactobacillus helveticus DPC 4571] >gi|160348460|gb|ABX27134.1| DNA processing protein chain A [Lactobacillus helveticus DPC 4571] (282 aa)
Score = 86, Expect = 3.1e-01, Identities = 13/33 (39%), Positives = 22/33 (66%)
  Q:    46 IALIDENYPEEFKYVIKPPFVIFLKGNKKLLSR 78
           I+  DE YPE+ + + +PP ++F +GN  LL +
  S:    75 ISFFDEEYPEKLRQIYRPPLILFAQGNLSLLKK 107
>gi|16800381|ref|NP_470649.1| hypothetical protein lin1313 [Listeria innocua Clip11262] >gi|16413786|emb|CAC96544.1| lin1313 [Listeria innocua] (286 aa)
Score = 86, Expect = 3.3e-01, Identities = 22/64 (34%), Positives = 38/64 (59%)
  Q:    15 CWERIYQAFA---------EREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSR 78
           CWE   +  A         E+ +T+++E   + S    + + ++DENYPE  K + + P ++F KGN  LL +
  S:    35 CWEMSIEQIATHFFTADKKEQIITELEEA-AIYSPEEASVVCILDENYPELLKEIYEAPPLLFYKGNLDLLKK 106
>gi|170762318|ref|YP_001752676.1| hypothetical protein UPA3_0631 [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171920194|ref|ZP_02690806.2| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|183508598|ref|ZP_02689651.2| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] >gi|168827895|gb|ACA33157.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str. ATCC 27815] >gi|171902575|gb|EDT48864.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str. ATCC 27813] >gi|182676054|gb|EDT87959.1| conserved hypothetical protein [Ureaplasma parvum serovar 14 str. ATCC 33697] (236 aa)
Score = 86, Expect = 3.6e-01, Identities = 23/62 (37%), Positives = 37/62 (59%)
  Q:     7 YFAVKYSGCWERIYQAFAERE------VTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIF 68
           YF++KY G W +IY A    E        + ++  KVK+      I L DE YP ++K + +PPF+++
  S:     7 YFSLKYKGDWSKIYLALINHEDQNEYLFLEKEDYEKVKA------IDLTDEKYPNKYKKINQPPFILY 68
>gi|47570335|ref|ZP_00240980.1| MW1132 [Bacillus cereus G9241] >gi|47553000|gb|EAL11406.1| MW1132 [Bacillus cereus G9241] (284 aa)
Score = 86, Expect = 3.6e-01, Identities = 21/68 (30%), Positives = 37/68 (54%)
  Q:    40 ENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLN----NFYGDANLDWVKKDFNNDEW 107
           EN   ++ + DE+YP+  + +  PPFV++ KG K  L++  NK  ++       YG  +L ++       EW
  S:    73 ENRIFYMTIWDEDYPKLLREIQDPPFVLYGKGEKDFLNK-ANKLAVVGTREPTLYGHESLKFILHPLLEKEW 143
>gi|167626698|ref|YP_001677198.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] >gi|167596699|gb|ABZ86697.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] (288 aa)
Score = 86, Expect = 4.0e-01, Identities = 35/120 (29%), Positives = 55/120 (45%)
  Q:    46 IALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFV--MLNNFYGDANLDWVKKDFNNDEWKEKINKSVFMIDYTNKDIIESLLELNANIIAVNTKCD--EDIKKEKLYKSIIKSNNLVIS 165
           I   D+ YPE  K++  PPFV++  GN KLL   +   V    N+ YG +    + K+  +         +  +    +K  +E+ L     I  V T  D        +LY +II +N L+IS
  S:     2 ITYKDKAYPESLKHISNPPFVLYCTGNIKLLETAQLAIVGARKNSTYGKSATCKLCKELKDSNITITSGLAYGIDTLAHKYALENSLN---TIAVVGTGVDIIYPSSNRELYSNIISNNGLIIS 122
>gi|164688549|ref|ZP_02212577.1| hypothetical protein CLOBAR_02194 [Clostridium bartlettii DSM 16795] >gi|164602962|gb|EDQ96427.1| hypothetical protein CLOBAR_02194 [Clostridium bartlettii DSM 16795] (374 aa)
Score = 85, Expect = 4.9e-01, Identities = 18/60 (30%), Positives = 32/60 (53%)
  Q:    26 REVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVM 85
           R  ++I+ I  V  E    ++   D++YPE  K++  PP ++F KG+  +L    N  V+
  S:    60 RSHSRIENIKGVLEEKDIQYVCFSDDDYPESLKHIQMPPPILFYKGDISILDHRNNIAVI 119
>gi|154250247|ref|YP_001411072.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1] >gi|154154183|gb|ABS61415.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1] (333 aa)
Score = 85, Expect = 5.1e-01, Identities = 20/46 (43%), Positives = 29/46 (63%)
  Q:    32 DEINKVKSENPDNWIALI---DENYPEEFKYVIKPPFVIFLKGNKKLLS 77
           D ++K++       I+LI   DE YPEE +++  PP  IF KGN + LS
  S:    43 DLVHKLEMRLSKGDISLITYWDEEYPEELRHIPDPPVFIFAKGNVEFLS 91
>gi|30021922|ref|NP_833553.1| nucleotide-binding SMF protein [Bacillus cereus ATCC 14579] >gi|29897478|gb|AAP10754.1| Nucleotide-binding SMF protein [Bacillus cereus ATCC 14579] (289 aa)
Score = 85, Expect = 5.1e-01, Identities = 20/63 (31%), Positives = 36/63 (57%)
  Q:    45 WIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFVMLN----NFYGDANLDWVKKDFNNDEW 107
           +I + DE+YP+  + +  PPFV++ KG K  L++  NK  ++     + YG  +L ++       EW
  S:    78 YITIWDEDYPQLLREIQDPPFVLYGKGEKDFLNKV-NKLAVVGTREPSLYGYESLKFILHPLLEREW 143
>gi|89511689|emb|CAI68095.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] >gi|89511691|emb|CAI68096.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] >gi|89511695|emb|CAI68097.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] >gi|89511697|emb|CAI68098.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis bv. diacetylactis] >gi|89511701|emb|CAI68099.1| DNA processing SMF protein [Lactococcus lactis subsp. cremoris] >gi|89511710|emb|CAI68101.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] >gi|89511714|emb|CAI68103.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] >gi|89511716|emb|CAI68104.1| DNA processing SMF protein [Lactococcus lactis subsp. lactis] (282 aa)
Score = 84, Expect = 5.4e-01, Identities = 20/64 (31%), Positives = 35/64 (54%)
  Q:    21 QAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFV 84
           + +  ++V+K+ E  K+         +L+DE YPE  K +  PP ++F +G+ +LL   K  FV
  S:    53 EQYKNQDVSKLREEYKIYPS-----FSLLDEIYPERLKEIYNPPVLLFYQGDIRLLKTPKLAFV 111
>gi|89211427|ref|ZP_01189792.1| SMF protein [Halothermothrix orenii H 168] >gi|89158954|gb|EAR78637.1| SMF protein [Halothermothrix orenii H 168] (409 aa)
Score = 83, Expect = 8.3e-01, Identities = 22/62 (35%), Positives = 41/62 (66%)
  Q:    10 VKYSGCWERIYQAFAEREVTKIDEINKVK-------------------SENPDNWIALIDENYPEEFKYVIKPPFVIFLKG 71
           + Y G    I+QA +E+E+ +++ INK+                    ++N   ++ + D NYP++ + + KPP VI+ KG
  S:    55 LNYFGSASSIWQA-SEKELKQVNGINKLAEKIVKQRKKINIENILENLAKNNIKYVTIFDNNYPDKLRDISKPPPVIYYKG 134
>gi|30024029|ref|NP_835316.1| hypothetical protein L200051 [Lactococcus lactis subsp. lactis Il1403] (155 aa)
Score = 82, Expect = 9.3e-01, Identities = 20/64 (31%), Positives = 35/64 (54%)
  Q:    21 QAFAEREVTKIDEINKVKSENPDNWIALIDENYPEEFKYVIKPPFVIFLKGNKKLLSRFKNKFV 84
           + +  ++V+K+ E  K+         +L+DE YPE  K +  PP ++F +G+ +LL   K  FV
  S:    15 EQYKNQDVSKLREEYKIYPS-----FSLLDEIYPERLKEIYNPPVLLFYQGDIRLLKTPKLAFV 73