>gi|26553507|ref|NP_757441.1| hypothetical protein MYPE550 [Mycoplasma penetrans HF-2] >gi|26453513|dbj|BAC43845.1| hypothetical protein [Mycoplasma penetrans HF-2] (143 aa)
Score = 329, Expect = 1.9e-29, Identities = 143/143 (100%), Positives = 143/143 (100%)
  Q:     1 MNLKIFSTPKFSILFYSLFFTLSLVIAFIIGFTYQIQFLYSYLINVSFIILAIVLILSLDKKLLLTFIKKESLPRRKKIQFIFTWKIKWISLVLLFVCSIILISQKIIFINNFGLLYSAIILIIILIISEILKLIKLRYIDLE 143
           MNLKIFSTPKFSILFYSLFFTLSLVIAFIIGFTYQIQFLYSYLINVSFIILAIVLILSLDKKLLLTFIKKESLPRRKKIQFIFTWKIKWISLVLLFVCSIILISQKIIFINNFGLLYSAIILIIILIISEILKLIKLRYIDLE
  S:     1 MNLKIFSTPKFSILFYSLFFTLSLVIAFIIGFTYQIQFLYSYLINVSFIILAIVLILSLDKKLLLTFIKKESLPRRKKIQFIFTWKIKWISLVLLFVCSIILISQKIIFINNFGLLYSAIILIIILIISEILKLIKLRYIDLE 143
>gi|170036823|ref|XP_001846261.1| conserved hypothetical protein [Culex quinquefasciatus] >gi|167879704|gb|EDS43087.1| conserved hypothetical protein [Culex quinquefasciatus] (291 aa)
Score = 83, Expect = 6.1e-01, Identities = 17/65 (26%), Positives = 44/65 (67%)
  Q:    41 SYLINVSFIILAIVLILSLDKKLLLTFIKKESLP--RRKKIQFIFTWKIKWISLVLLFVCSIILISQ 105
           +YL  ++FII+++VL + +   +++  + K++LP  +R+K++ I +  +  I+++ + V S+++  Q
  S:   183 TYLACITFIIMSLVLQMLVAVTMIIVSLTKKNLPEAKRQKLKIITSVGVAIITMINILVASLVVAEQ 249