>gi|26554010|ref|NP_757944.1| hypothetical protein MYPE5580 [Mycoplasma penetrans HF-2] >gi|26454018|dbj|BAC44348.1| conserved hypothetical protein [Mycoplasma penetrans HF-2] (829 aa)
Score = 3917, Expect = 0.0e+00, Identities = 829/829 (100%), Positives = 829/829 (100%)
  Q:     1 MSNNYFQKQTNKIGKIYAYYDYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKSEKIGLFNTKIVYYEDN 829
           MSNNYFQKQTNKIGKIYAYYDYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKSEKIGLFNTKIVYYEDN
  S:     1 MSNNYFQKQTNKIGKIYAYYDYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKSEKIGLFNTKIVYYEDN 829
>gi|167855263|ref|ZP_02478032.1| possible uncharacterized restriction enzyme [Haemophilus parasuis 29755] >gi|167853627|gb|EDS24872.1| possible uncharacterized restriction enzyme [Haemophilus parasuis 29755] (830 aa)
Score = 1986, Expect = 0.0e+00, Identities = 405/813 (49%), Positives = 571/813 (70%)
  Q:    15 KIYAYYDYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFL-----KNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIE---------IMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLL--RETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFK-DDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKSEKIGLFNTKIVYYE 827
           K+YAY D R    +K+GYTTR+  + R+ EQ+PV  P  + + + F + AIR+DG++F D ++H  L + GV+R  GEWF  +   +  A+ +VK  +   E  RT  F +R EQ+EA+  T  YF      +N  EK   FLWNAKMRFGKTF AY+  +EM +K +L+++FKP V+ AW+EDLQ+H+DF+ + F+ + D+ ++     +      +CF SFQD LGKNK GG K+KN+W+H   WD II DEYH+GAWRE+SK LF  ++  F   +E         + D    E  PI S  +LYLSGTPFRA+++GEF+E+Q++NWTY+DEQ  K+ ++  E+NPY  +P+M+MLTY+LP+++REVALKGEF+EF L +FF AK   +N K+++   ++V ++L+ + G       + LK   ++ PMPF D  LL +L HT W LP+VASCYAM +LL  ++   + +Y++I+AAG  +  G   I  + K M  P+ +KTITLSC KLTTGV++ PW+GIFMLR+L SPETYFQAAFRVQ  W  +  + N+ + E   K++CY+FDF P+RALKQ+ +Y   LNT +K + E KV +FI+FLP+LAY  D + M  +DA  ILD  ++  T  +L R+WESA+LVNVDN+TL ++  N+ A+  L  +E FR+LN+DI  II+KSE +KK K  + + ELT +EKK LS+D+K E+S R++VQ+KLIKFATRIPIFMYLTD RE +LKDVIT+LEP+ F KVTGLT KDF  LVSLN+FN   MNDA++ F+RYED+SL Y+G++K++  +IGL++T I   E
  S:    12 KVYAYSDSRFPHCLKIGYTTRDVAQ-RVAEQYPVKLP-NQSYQVVFDERAIRDDGSSFRDYDLHAVLQKRGVERLEGEWFKCDLNDVKSAYLKVK-TRQAVEKQRTFAFGMRPEQQEAVTKTAQYFRSFHNDENNQEKTPHFLWNAKMRFGKTFAAYQLAKEMGWKKILVLTFKPAVQNAWQEDLQNHLDFQGWRFVTHGDEWQSAVDFPQ------ICFGSFQDYLGKNKAGGTKLKNEWVHTINWDCIIFDEYHYGAWREKSKGLFEAEEQAFQKQLEAEAAEMEMDMPDYFDEETLPITSNHFLYLSGTPFRALNSGEFIEEQVYNWTYSDEQRAKKAWQG-EDNPYLSLPRMVMLTYQLPEDIREVALKGEFNEFDLGQFFEAKGTGKNAKFKY--ENEVQKWLDLIRGALRSTTIDNLKLGAEKPPMPFGDSRLLGSLLHTLWFLPSVASCYAMRNLLTQKQNQFYHEYQVIVAAGNDAGMGADAIIPVRKAMGEPLNSKTITLSCGKLTTGVSVAPWTGIFMLRNLNSPETYFQAAFRVQTPWVLRGHNPNDPNNECIVKEDCYVFDFAPDRALKQLADYCVRLNTDDK-NPEQKVAEFIQFLPVLAY--DGSSMRSIDAAGILDMAMSGTTATLLARRWESALLVNVDNETLSKLRHNEDAMKALMSIEGFRSLNQDIETIINKSESVKKTKNAANDRELTPDEKKTLSDDEKKEKSLRKQVQEKLIKFATRIPIFMYLTDNREYSLKDVITQLEPELFYKVTGLTQKDFSLLVSLNLFNSGQMNDAVYKFKRYEDASLTYSGLIKHQESRIGLYDTTISIQE 826
>gi|158520922|ref|YP_001528792.1| putative restriction enzyme [Desulfococcus oleovorans Hxd3] >gi|158509748|gb|ABW66715.1| putative restriction enzyme [Desulfococcus oleovorans Hxd3] (853 aa)
Score = 1985, Expect = 0.0e+00, Identities = 400/823 (48%), Positives = 565/823 (68%)
  Q:     1 MSNNYFQKQTNKIGKIYAYYDYRNNKE--MKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFL-----KNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKN-KYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQ---------------FPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLL--RETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKD-DYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKSEKIGLFNTKI 823
           MS  +F  +      IYAY D        +KVGYTT +  + R+ +Q+P   P   P+ +   + A+R DGT FTD ++H  L   GV+   GEWF      +  A   V+  +LN E NR+ DF++R EQ+ A+  T  YF      K    K   FLWN KMRFGKTF AY+  ++M ++ VL+++FKP V++AW EDL+ H+DF  + F+ + D     +   K     +VCF SFQD LG+N   GGIK KN+W+H   WD +I+DEYH+GAWRE +K+LF  +D       E+  A G+ Q                PI +  YLYLSGTPFRAI++GEF+E+QIFNWTY+DEQ  K  +K    NPY  +P+M++LTY+LPD +RE+A++GEF+EF LN FFSA+      K +F + ++V ++L+ + G       + LK   ++ PMPF D  LL  LSH+FW LP+VA+C+AM +LL  R+   +  YK+I+AAG  +  G + +  + + M++P+ TKTITLSC KLTTGVT++PW+GI MLR+   PETYFQAAFRVQ+ WT ++ D    + E+  KKECY+FDF P+RAL+Q+ +YS  LN  N+ + E KV++FI FLP+LAY  D + M+++DA  ILD  ++  T  +L R+WESA+LVNVDNDTL R++ NK+A++ L  +E FR LN+DI  II+KSE +KK + ++ + EL+ ++KK LS ++K+ +S+R+++Q+K+IKFATRIPIFMYLTD+RE TLKDVIT+LEP  F+KVTGLT+ DF+ LVSL +FN  +MNDAI+ F+RYED+SL Y GI K++ E IGL++T I
  S:     1 MSKAFFPPRPESRPTIYAYEDTHPQYAGLLKVGYTTVD-AQKRVAQQYPTLRPGAPPYRIVLEEAAMRGDGTVFTDNDVHRMLRINGVKNPEGEWFCCTVAQVKAAIIAVRTGQLN-EENRSLDFTMRPEQEAAVEKTAAYFTGWRKDKGNRNKPPHFLWNCKMRFGKTFAAYQLAKKMGWRKVLVLTFKPAVQSAWEEDLKCHVDFAGWQFVASHDLHTDGEPKIKPP---LVCFGSFQDYLGRNPDTGGIKSKNEWVHTTNWDCVILDEYHYGAWRETAKELFEAEDKK-----EV--AFGVGQGAEFLKERDEEIADIMPITTNGYLYLSGTPFRAIASGEFIEEQIFNWTYSDEQRAKSAWKG-PGNPYVALPRMVLLTYQLPDAIREIAMQGEFNEFDLNVFFSAE--GIGNKAKFKYANEVQKWLDLIRGAFLPTSVDSLKLGARKPPMPFSDVRLLGVLSHSFWFLPSVAACHAMRNLLAKRQNRFYHDYKVIVAAGNAAGIGVAALPPVQEAMDDPLTTKTITLSCGKLTTGVTVKPWTGILMLRNASVPETYFQAAFRVQSPWTVRNPDGASPNSEQIIKKECYVFDFAPDRALRQIADYSCRLNV-NEENQEKKVEEFISFLPVLAY--DGSSMKQIDAAGILDMAMSGTTATLLARRWESALLVNVDNDTLHRLMDNKKAMEALMSIEGFRTLNQDIETIINKSEAVKKARKEANDQELSAQQKKELSQEEKEYKSRRKQIQEKIIKFATRIPIFMYLTDFRERTLKDVITQLEPGLFKKVTGLTVTDFELLVSLGLFNSALMNDAIYKFKRYEDASLSYIGIYKHEGEDIGLYDTVI 831
>gi|33860942|ref|NP_892503.1| hypothetical protein PMM0384 [Prochlorococcus marinus subsp. pastoris str. CCMP1986] >gi|33639674|emb|CAE18843.1| possible uncharacterized restriction enzyme, interrupted-C [Prochlorococcus marinus subsp. pastoris str. CCMP1986] (829 aa)
Score = 1954, Expect = 0.0e+00, Identities = 426/823 (51%), Positives = 577/823 (70%)
  Q:     1 MSNNYFQKQTNKIGKIYAYYDYRNNKE--MKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNY---FLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGI-----EQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLL--RETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKD-DYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKSEKIGLFNTKI 823
           M+ ++F K+     KIYAY D     +  +KVG+T++   + R++ Q+P+  P ++ +T+   ++AIR DGT+F D ++H  L   G     GEWF      +N A   V    +  E  R  +F LR EQKEAI  TKNY   F+K  + K   FLWNAKMRFGKTF AYK   EM++  VL+++FKP V++AW EDL +HIDFE + FIN           + +  K  VCF SFQD LGKN  GGIK KN+W+H  KWD +I+DEYH+GAWRER+K+LF  +++     I++ +  GI     E  PI +  YLYLSGTPFRAIS GEF+E+QIFNWTY+DEQ+ K  +  D+N PY  +P+MI++TYK+PD + EVA +GEFDEF LN FFSAK+ +     EFI+ D+V ++L+ + G++   +   LK +DK+ P PF D  LL+ LSHTFW LPNV+SC+AM +LL  R+   F  YKII+AAG K+  G   +  +   M+NP+E+K+ITLSC KLTTGV+++PWSGIFMLR++ SPETYFQ+AFRVQ  W  ++ D    ++++  K  CY+FDF PNRAL Q+ +YS NLN       E KV +FIKFLP+L+Y  D + M EVDA  ILD TI+  T  +L R+WESA+LVNVDN TL+R++ N +A+  L  +E FR+LN+DI+ II+ SE IK LKTK+ E EL K+EKK L+  +K+  + R+++QK+LIKFATRIPIFMYLTDYRE +LKDVIT+LEP  F+KVTGL++KDFD L+SLN+FN  +MNDAI++F+RYEDSSL Y G+ KN  +++GLF+T I
  S:     1 MAKDFFYKRYEGNPKIYAYSDSHPQYQGLLKVGFTSKNTVKQRVEAQYPIITPGEETYTIHLDRSAIRKDGTSFIDKDVHKILRAKGFPNPAGEWFRCKVTDVNAAIDLVAFGDIGVE-GRPNNFGLRPEQKEAIEKTKNYINGFIKEKSNKVPHFLWNAKMRFGKTFAAYKLALEMKWTKVLVLTFKPAVQSAWEEDLLTHIDFEGWQFINR----NGMSFGEADKSKPFVCFGSFQDFLGKNNAGGIKPKNEWVHTIKWDCVILDEYHYGAWRERAKELFEGEEN---KEIKLQEGEGISFFKEENMPISTNFYLYLSGTPFRAISTGEFIEEQIFNWTYSDEQNAKNNWVGDKN-PYSSLPRMILMTYKVPDYILEVANEGEFDEFDLNTFFSAKYED--DASEFIYKDEVQKWLDLIRGQNLEEIKTTLKLKDKKPPYPFSDSRLLSLLSHTFWYLPNVSSCFAMRNLLQERQNTFFHSYKIIVAAGNKAGLGLKALWPVRDAMDNPLESKSITLSCGKLTTGVSVKPWSGIFMLRNISSPETYFQSAFRVQTPWEIENPDSKSPNEKDVLKHNCYVFDFAPNRALTQISDYSCNLNYQEN-DPEKKVGEFIKFLPVLSY--DGSSMIEVDATSILDMTISGTTATLLARRWESALLVNVDNSTLERLMGNDEAMKALQAIEGFRSLNEDITSIINSSESIKNLKTKANEEELNKKEKKQLTEQEKEFINLRKKIQKQLIKFATRIPIFMYLTDYRERSLKDVITQLEPGLFKKVTGLSLKDFDLLISLNVFNSSLMNDAIYNFKRYEDSSLSYIGLTKNTHDEVGLFDTVI 822
>gi|156742198|ref|YP_001432327.1| putative uncharacterized restriction enzyme [Roseiflexus castenholzii DSM 13941] >gi|156233526|gb|ABU58309.1| putative uncharacterized restriction enzyme [Roseiflexus castenholzii DSM 13941] (837 aa)
Score = 1951, Expect = 0.0e+00, Identities = 400/819 (48%), Positives = 572/819 (69%)
  Q:     3 NNYFQKQTNKIGKIYAYYDYRNNKE--MKVGYTTRENPEDRIKEQFPVSAPVKK-PFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYF--LKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKN-KYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIE--IMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDEN--NPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIE--FKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKD-DYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKSEKIGLFNT 821
           +N+F  +     KIYAY D     E  +K+GYTT+ + ++R+ +Q+P   P  K P+ +   + AIRNDGT FTD ++H  L   G++ + GEWF    E +  A   V+  +L  E  R+ +F++R EQ+ A+  T  YF   +  N K   FLWN KMRFGKTF AY+  + M +K VL+++FKP V++AW EDL+ H+DF+ + FI    K       Q +  K IVCF SFQD LG+N K GGIK KN+W+H   W  +I DEYHFGAWRE++KDLF  +D+    + E   +D    +  PI S  YLYLSGTPFRAI+ GEF+E+QI+NWTY+DEQ  KE++ +D N  NPY  +P+M+++TY+LPD +REVA++GEF+EF LN FFSA+      K  F + D+V ++L+ + G +     + L+   ++ P+P+ D  LLN L+HT W LP+VA+CYAM +LL +     +  YK I+AAG  +  G + +  +   M +P++TKTITL+C KLTTGVT+RPW+GIFMLR+  SPETYFQAAFRVQ+ WT ++ D    + E   K+ECY+FDF P+RAL+Q+ +YS  LN  N+   E KV++FI FLP+LAY  D + M ++DA  +L+  ++  T  +L R+WESA+LVNVDNDTL+R+++N+QA+  L  +E FRNLN++I  II+KSE +K+LK ++ +  L+ +EK+ L+ ++K+ +SKR+++Q+KLIK ATRIPIFMYLTD+RE TL+DVIT+LEP  F+KVTGLT+KDF+ LVSL +FN  +MNDA++ F+RYED SL YTGI +++ E +GL++T
  S:     2 SNFFPPRPKVEPKIYAYKDTNPEYEGLLKIGYTTK-SVQERVAQQYPTLRPGGKLPYCIVLEEPAIRNDGTVFTDRDVHRMLRINGIRNEGGEWFRCTVEQVRAAINAVRAGQL-LEEQRSLNFTMRPEQEAAVAKTMAYFQSYRRENGKPPHFLWNCKMRFGKTFAAYQLAKRMGWKKVLVLTFKPAVQSAWEEDLRCHVDFQGWQFI----KPGGLTYEQADKNKPIVCFGSFQDYLGRNPKTGGIKAKNEWVHATHWHCVIFDEYHFGAWREKAKDLFEGEDEAERKASEGEAIDYFDEDILPITSDHYLYLSGTPFRAIATGEFIEEQIYNWTYSDEQKAKEEW-DDSNGPNPYAALPRMVLMTYQLPDAIREVAMQGEFNEFDLNVFFSAE--GVGDKARFKYEDEVQKWLDLIRGAYLPTNLDNLRLGAQKPPLPYSDVRLLNVLTHTVWFLPSVAACYAMRNLLAKPHNKFYHDYKAIVAAGAAAGIGVNALPPVLDAMGDPLKTKTITLTCGKLTTGVTVRPWTGIFMLRNTSSPETYFQAAFRVQSPWTIQNPDGTSPNAELILKEECYVFDFAPDRALRQIADYSCRLNV-NEDDPEKKVEEFIHFLPVLAY--DGSSMRQIDAAGVLEMAMSGTTATLLARRWESALLVNVDNDTLRRLITNEQAMQALMNIEGFRNLNQEIETIINKSEAVKRLKKEANDRALSAQEKRELTEEEKEFKSKRKQIQEKLIKLATRIPIFMYLTDHRERTLRDVITQLEPGLFKKVTGLTVKDFELLVSLGVFNSALMNDAVYKFKRYEDPSLVYTGINRHEGEDVGLYDT 821
>gi|189499709|ref|YP_001959179.1| conserved hypothetical protein [Chlorobium phaeobacteroides BS1] >gi|189495150|gb|ACE03698.1| conserved hypothetical protein [Chlorobium phaeobacteroides BS1] (852 aa)
Score = 1734, Expect = 0.0e+00, Identities = 381/813 (46%), Positives = 534/813 (65%)
  Q:    15 KIYAYY--DYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYF---LKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQ---------------FPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLL--RETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFK----DDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDI-SIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKS-EKIGLFNTKIVYYE 827
           ++YAY   D  +   +KVG TTR+  + RI EQ   +A   + + +   ++A R+DG+ F+D E+  AL   G +    EW   + E +  A  E++  +     +  K F++R EQ EAI  T +YF    K       +FLWNAKMRFGKTFTAY+  +++    VL+V+FKP V+ AWR DL+SH+DF+ + +++     +  K  +K      V F SFQDLLG++  G IK KN+WIH   WDL++ DEYHFGAWRE +K+LF E ++D     ++  A G+E                 PI +K YLYLSGTPF+A++ GEF+E+QIFNWTYTDEQ  KE++      + NPY  +P+M +LTY++PD L  +A  GEFDEF LN FF A  +      +F H   V ++L+ + G +     E LK    + P P+ D  LL  L H+FW +PNVA+C AM +LL  R+   +  YK+I+ AG  +  G   +  + K + +  +TKTI LSC KL TGVT+  WS I MLR+LKSPETYFQAAFRVQ+ W+ K    DD NE   EE  K  C++FDF P RAL+Q+ EY   L+ S   + E+ VKD + FLP+LAY  D   M ++DA  ILD  +   +  +L RKWESA+LVNVDN TL+RI+ N +A+  + ++E +R+L   I   II+KSE++K+LK K+ E ELTK+EKK LS+++++ +SKR+ +Q+KLIKFATRIP FMYLTD+RE TL+DVIT+LEPD F+ VTGLT++DF  LV L +FN + MN A+++FRRYED+SL+YTGI  ++     GL+NT +   E
  S:    18 RVYAYSIDDQAHKGLLKVGQTTRD-VKQRIAEQLKTAA--IRNYKIELDESAERDDGSIFSDHEVRAALVAKGFENTELEWMRCSVEDVKTALAELRTGERCTGTHH-KTFAMRREQAEAINKTHDYFHSIWKEDMHAVPRFLWNAKMRFGKTFTAYQLAKKLGATRVLVVTFKPAVEDAWRTDLESHVDFDGWQYLSRNTDGDPRKVSRKTPA---VYFGSFQDLLGRDTAGNIKPKNEWIHEVNWDLVVFDEYHFGAWRETAKELF-EGEEDAQKETKLEYAAGLENVNEDLSELAEKEAEFLPITTKAYLYLSGTPFKALATGEFIEEQIFNWTYTDEQRAKEKFAAKHPAKRNPYGALPQMRLLTYQMPDELLAIASAGEFDEFDLNAFFEA--SGTGVLAQFKHKSDVQKWLDIIRGGYAPKSVEHLKT-GTRPPFPYSDVRLLPYLQHSFWFMPNVAACNAMANLLAERQNTFWHDYKVIVCAGASAGIGLDALLPVRKEIGSGFDTKTIVLSCGKLVTGVTVSQWSSILMLRNLKSPETYFQAAFRVQSPWSIKNPNGDDPNE---EEILKPACFVFDFAPTRALRQLSEYGIGLSPSEP-NPETAVKDLVSFLPVLAY--DGANMTQIDAGGILDIAMAGTSATLLARKWESAVLVNVDNGTLRRILDNPEAMAAVERIEGWRSLGDSIIETIINKSEKVKELKNKAREGELTKKEKKELSDEEREYKSKRKLIQEKLIKFATRIPAFMYLTDFRENTLQDVITKLEPDLFQTVTGLTVEDFHLLVRLRVFNTEQMNQAVFAFRRYEDASLRYTGIESHEGLTHYGLYNTVVAREE 844
>gi|121592633|ref|YP_984529.1| type III restriction system endonuclease, putative [Acidovorax sp. JS42] >gi|120604713|gb|ABM40453.1| type III restriction system endonuclease, putative [Acidovorax sp. JS42] (848 aa)
Score = 1720, Expect = 0.0e+00, Identities = 361/809 (44%), Positives = 529/809 (65%)
  Q:    15 KIYAYY--DYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLK---NANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDD-------DFYNSIE-IMDALGIEQ------FPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKN---DENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLL--RETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKD-DYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKD-ISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKS-EKIGLFNTKI 823
           +IYAY   D  ++ ++KVG TTR N + R+ EQ   +A   + FT+   + A R+DG+ F+D E+  AL R G      EW       +     E++  K        + F LR EQ EA+  T +Y+        +   +FLWNAKMRFGKTFT Y+  ++++ + VL+++FKP V+ AW+ DL++H+DF  + +++     +     Q + G+ +V F SFQDLLG++  G IK +N+W+H   WD+++ DEYHFGAWR+ +K+LF  +DD       +    +E + + LG+         PI ++ YLYLSGTPF+A++ GEF+E+QIFNWTYTDEQ  K  +      + NPY  +P+M +LTY++PD L  VA  GEFDEF LN FF A         +F H   V ++L+ + G H     E LK    + P P+ D  LL  L H+FW LP+VA+C+AM +LL  R    +  Y++I+AAG  +  G + +  + + + +  +++TITLSC KLTTGVT+  WS I MLR+LKSPE+YFQAAFRVQ+ W+ K+ + +  ++EE  K  C++FDF P RAL+Q+ EY   L +  + + E+ V D + FLP+LA+  D   M ++DA  ILD  +   +  +L RKWESA+LVNVDN TL+RI+ N +A+  + ++E +R L  + I  II+KSE++K LK K+ + EL+  EKK LS ++K+ +SKR+ VQ+KLIKFATRIP FMYLTD+RE TL+DVIT+LEP+ F  VTGLT++DF  LV L +FN + MN A+++FRRYED+SL+YTGI  +     IGL++T +
  S:    23 RIYAYSIADAAHHGQLKVGQTTR-NVQQRVAEQLKTAA--IQNFTIELDEPAERDDGSVFSDHEVRAALVRKGFANTQLEWMRCTLADVQTVLAELRSGK-PLGGTHHETFGLRAEQAEAVNKTFDYYQSIWAEDPQAAPRFLWNAKMRFGKTFTTYQLAKKLQARRVLVLTFKPAVEDAWQTDLENHVDFAGWQYLSRTSGSDP---RQADPGRPLVYFGSFQDLLGRDAAGNIKARNEWLHTLNWDVVVFDEYHFGAWRDTAKELFEGEDDASVKKEKELEGVLEQVNEELGMRATLETDFLPITTRAYLYLSGTPFKALATGEFIEEQIFNWTYTDEQRAKAAFAAAHPSQRNPYGALPQMRLLTYQMPDELLAVASGGEFDEFDLNAFFEA--TGSGSGAQFKHKGDVQKWLDIIRGGHLAQSVELLKT-GTRPPFPYSDVRLLPYLQHSFWYLPDVAACHAMANLLAERHNTFWHGYQVIVAAGSAAGIGLAALPPVRRAIGSGFDSQTITLSCGKLTTGVTVAQWSAILMLRNLKSPESYFQAAFRVQSPWSIKNPNGDNPNEEEILKPVCFVFDFAPTRALRQLSEYGIGL-SPGESNPENAVGDLVAFLPVLAF--DGAHMTQIDAGGILDIAMAGTSATLLARKWESALLVNVDNGTLRRILDNPEAMAAVERIEGWRALGDNVIETIINKSEKVKALKQKAKDEELSAREKKELSAEEKEYRSKRKLVQEKLIKFATRIPAFMYLTDFRENTLQDVITKLEPELFLTVTGLTVQDFHLLVQLKVFNTEQMNAAVFAFRRYEDASLRYTGIASHPGLTHIGLYDTVV 845
>gi|94985030|ref|YP_604394.1| type III restriction system endonuclease, putative [Deinococcus geothermalis DSM 11300] >gi|94555311|gb|ABF45225.1| type III restriction system endonuclease, helicase [Deinococcus geothermalis DSM 11300] (850 aa)
Score = 1691, Expect = 0.0e+00, Identities = 367/813 (45%), Positives = 535/813 (65%)
  Q:    15 KIYAYY--DYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLK---NANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFIN-NLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQ---------------FPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLL--RETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKD-DYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDI-SIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKS-EKIGLFNTKIVYYE 827
           ++YAY   D  +   +K+G TTR+    R+ EQ   +A   K + +   ++A R DG+  TD E+  AL R G +    EW       +     E++  K      R + F LR+EQ+EA+  T  YF        +   +FLWNAKMRFGKTFT Y+  + +  + VLIV+FKP V+ AW+ DL+SH+DFE + +++   ++D T    Q +  K +V F SFQDLLG+++ G IK KN+WIH   WDL++ DEYHFGAWR+ +++LF E ++D    ++   A G+E                 PI ++ YLYLSGTPFRA+S GEF+E+QIFNWTYTDEQ  K ++  +   E NPY  +P++ +LTY++PD L  VA  GEFDEF LNEFF+A      ++ +F H D+V ++L+ L G++    +E LK    + P P+ D  LL  L H+FW LP+VA+C AM +LL  R  + +  Y +++AAG  +  G   +  + + +    +TKTITLSC KLTTGVT+  WS I MLR+L+SPETYFQAAFRVQ+ W   + + ++ + E   K  C++FDF P RAL+Q+ EY+  L   ++ + E  V D + FLP+LAY  D   M ++DA  ILD  +   +  +L RKWESA+LVNVDNDTL+R++++ +AL  + ++E +R L  +I   +I++SE+IK LK K+ E +LT  EKK LS+++K+ ++KR+++Q+KLIKFATRIP FMYLTD+RE TL+D+IT+LEP+ F  VTGLT++DF  LV L +FN + MN A+++FRRYED+SL+Y GI  +      GL++T +   E
  S:    19 RLYAYSIDDAAHAGLLKIGQTTRD-VRQRVAEQLRTAA--IKNYRIELDEDATRADGSIITDHELRAALRRKGHEVVTLEWVRCTVADVRAVLHELRTGK-PVSGARHQTFGLRQEQEEAVEKTLAYFRSIWAEDKDAAPRFLWNAKMRFGKTFTTYQLARRLGARRVLIVTFKPAVEDAWQTDLESHVDFEGWQYLSRKSERDPT----QIDPHKPVVYFGSFQDLLGRDRQGNIKPKNEWIHTVNWDLVVFDEYHFGAWRDTARELF-EGEEDAAKELQQEYAAGLETVNEDLGELSVKEAEFLPITTRAYLYLSGTPFRALSTGEFIEEQIFNWTYTDEQRAKGRFAEEHPGEKNPYAALPELRLLTYQMPDELLAVASGGEFDEFDLNEFFAA--TGTGEQAQFKHKDEVQKWLDILRGQYLPRASEYLKT-GTRPPFPYADVRLLPYLQHSFWFLPSVAACQAMANLLAERHNVFWHDYTVVVAAGAGAGIGLDALPPVRRAIGGGFDTKTITLSCGKLTTGVTVPQWSAILMLRNLQSPETYFQAAFRVQSPWVIANPEGDDPNAEVIVKPVCFVFDFAPTRALRQLSEYAIGL-APHEPNPEQAVADLVSFLPVLAY--DGANMTQIDAGGILDIAMAGTSATLLARKWESALLVNVDNDTLRRVLNSPEALAAVERIEGWRALGDNIIETVINQSEKIKGLKGKAKERDLTPAEKKELSDEEKEYKNKRKQIQEKLIKFATRIPAFMYLTDFRENTLQDIITKLEPELFLTVTGLTVEDFHLLVRLKVFNTEQMNAAVFAFRRYEDASLRYAGIDSHPGLTHYGLYDTVVAREE 845
>gi|148261407|ref|YP_001235534.1| hypothetical protein Acry_2421 [Acidiphilium cryptum JF-5] >gi|146403088|gb|ABQ31615.1| hypothetical protein Acry_2421 [Acidiphilium cryptum JF-5] (844 aa)
Score = 1690, Expect = 0.0e+00, Identities = 361/796 (45%), Positives = 530/796 (66%)
  Q:    28 MKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEK---YCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFIN-NLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDA--------LGI------EQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLL--RETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEEN-YKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDI-SIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKS-EKIGLFNTKI 823
           +KVG TTR+  + R+ EQ  +  P    +T+   ++++RNDG   TD  + +AL R G      EW       +     E+++ ++ F     ++F LR+EQ  A+  T  YF     E      +FLWNAKMRFGKTFT+Y+  +++  K VL+++FKP V+ AW+ DL+SH+DF+ + + + N+D D     L+      ++ F SFQDLLG+++ G IK +N+WIH   WDL++ DEYHFGAWRE +K+LF  +D     ++  ++A        LG+      E  PI ++ YLYLSGTPF+A++ GEF+E+QIFNWTYTDEQ  K ++  +   + NPY  +P+M +LTY++PD L  +A  GEFDEF LN FF+A        ++  H   V ++L+ + G + +  +E LKA   + P P+ D  LL  L H+FW LPNVA+C+AM +LL  R+   ++ Y +++AAG  +  G   +  + + + +  +TKTITLSC KLTTGVT+  WS I MLR+LKSPETYFQAAFRVQ+ W+ K+       EE   K  C++FDF P RAL+Q+ EY   L +  + + E+ V++ + FLP+LAY  D   M ++DA  ILD  +   +  +L RKWESA+LVNVDNDTL+RI+ N +A+  + ++E +R L  +I   II+KSE++K+LK K+   ELT +EKK L+N++++ +SKR+ VQ+KLIKFATR+P FMYLTD+RE TL+DVIT+LEPD F  VTGLT+ DF  LV L +FN + MN+A+++FRRYED+SL+YTGI  ++     GL++T +
  S:    34 LKVGQTTRD-VKQRVAEQ--LQTPAITNYTIELDESSVRNDGGIITDHAVRDALRRKGFLNPQREWMQCTVADVKTVLAELRNGQI-FTGTHHENFPLRDEQARAVEQTYAYFQSRWQEDPNAAPRFLWNAKMRFGKTFTSYQLAKKLNAKRVLVLTFKPAVEDAWQTDLESHVDFDGWRYQSRNVDGDPREVPLETP----LIYFGSFQDLLGRDQAGNIKPRNEWIHTINWDLVVFDEYHFGAWRETAKELFEGEDTAVVKAVTKLEADLDAVNEDLGVLSQSETEFLPITTRAYLYLSGTPFKALAAGEFIEEQIFNWTYTDEQRAKAEFAAEYPNKRNPYGALPQMRLLTYRMPDELLAIASAGEFDEFDLNAFFAATGTAGTATFK--HKTDVQKWLDIIRGGYAMQTSESLKA-GTRPPFPYSDVRLLPYLQHSFWFLPNVAACHAMANLLAERQNTFWRDYTVVVAAGTSAGIGLDALPPVRQAVGSGFDTKTITLSCGKLTTGVTVAQWSSILMLRNLKSPETYFQAAFRVQSPWSIKNPNGNNPNEEEILKPVCFVFDFAPTRALRQLSEYGIGL-SPGEANPENAVRELVSFLPVLAY--DGANMTQIDAGGILDIAMAGTSATLLARKWESALLVNVDNDTLRRIIDNPEAMAAVERIEGWRALGDNIIETIINKSEKVKELKNKAKNGELTPKEKKELTNEEREYKSKRKLVQEKLIKFATRLPAFMYLTDFRENTLQDVITKLEPDLFLAVTGLTVADFHLLVRLKVFNTERMNEAVFAFRRYEDASLRYTGIESHEGLTHYGLYDTVV 841
>gi|21673987|ref|NP_662052.1| type III restriction system endonuclease, putative [Chlorobium tepidum TLS] >gi|21647132|gb|AAM72394.1| type III restriction system endonuclease, putative [Chlorobium tepidum TLS] (863 aa)
Score = 1668, Expect = 0.0e+00, Identities = 372/813 (45%), Positives = 536/813 (65%)
  Q:    15 KIYAYY--DYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYF---LKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFN-EKDDDFYNSIEIMDALGIEQ---------------FPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRE--TIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFK----DDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKD-ISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSLKYTGILKNKS-EKIGLFNTKIVYYE 827
           +IYAY   D  +   +K+G TTRE  + R+ EQ   +A     + +   ++A R DG+  +D ++  AL+R G     GEW       +     E++  +       ++ F++REEQ+EA+  T  YF        +   +FLWNAKMRFGKTFT Y+  +++  + VL+V+FKP V+ AW+ DL++HIDF+ + F +   +D        ++ + +V F SFQDLLG++  G IK KN+WIH   WDL++ DEYHFGAWRE + +LF  E++       ++  A G+E+                PI SK YLYLSGTPFRA+++GEF+E+QIFNWTY DEQ  KE++  +   + NPY  +P++ +LTY++PD L  +A  GEFDEF LNEFF+A      ++ +F H D+V ++L+ + G++    +E LK   K  P P+ D  LL  L H+FW LPNVA+C+AM +LL E     +  Y +I+AAG  +  G   +  + K + +  +TK+ITLSC KLTTGVT+  WS I MLR+LKSPETYFQAAFRVQ+ W+ K    DD NE   EE  K  C++FDF P RAL+Q+ +Y+  L   ++ S E  V D + FLP+LA+  D   M ++DA  ILD  +   +  +L RKWESA+LVNVDN+TL+RI++N +A+  + ++E +R+L  + I  II++SE+IK LK K+ +  LT  EK+ LS ++K+ +SKR+ VQKKLIKFATRIP FMYLTD+RE TL+DV+T+LEPD F  VTGLT++DF  LV L +FN + MN A+++FRRYED+SL YTGI  ++     GL++T +   E
  S:    21 RIYAYSIADDAHAGLLKIGQTTRE-VKQRVAEQLRTAAITN--YRVELDEDAARADGSIISDFDVRAALARKGFAVVTGEWVRCAVADVQTVLTELRTGQ-KLTGTHSETFAMREEQREAVEKTLAYFESIWAEDADAAPRFLWNAKMRFGKTFTTYQLAKQLAARRVLVVTFKPAVEDAWQSDLEAHIDFDGWQFFSRNTQDNPSTA---DADRPLVYFGSFQDLLGRDAAGNIKPKNEWIHTINWDLVVFDEYHFGAWRETAGELFEGEEEAVAKKEAKLEYAAGLEEVNEDLMVLSEQECDFLPITSKAYLYLSGTPFRALASGEFIEEQIFNWTYVDEQRAKERFAREHPGQQNPYAALPELRLLTYQMPDELLAIASGGEFDEFDLNEFFAA--TGTGEQAQFKHKDEVQKWLDIIRGQYFPKASEYLKTGTK-PPFPYADVRLLPYLQHSFWFLPNVAACHAMANLLAEKHNTFWHNYTVIVAAGAGAGIGLDALPPVRKAIGSGFDTKSITLSCGKLTTGVTVPQWSAILMLRNLKSPETYFQAAFRVQSPWSIKNPNGDDPNE---EEILKPVCFVFDFAPTRALRQLSDYAIGL-APHESSPEKAVADLVSFLPVLAF--DGANMTQIDAGGILDIAMAGTSATLLARKWESALLVNVDNETLRRILNNPEAMAAVERIEGWRSLGDNVIEAIINQSEKIKALKKKAKDEGLTPTEKRELSAEEKEFKSKRKLVQKKLIKFATRIPAFMYLTDFRENTLQDVVTKLEPDLFLAVTGLTVEDFHLLVRLKVFNTEQMNAAVFAFRRYEDASLGYTGIDSHRGLTHYGLYDTVVAREE 849
>gi|168705227|ref|ZP_02737504.1| type III restriction system endonuclease, putative [Gemmata obscuriglobus UQM 2246] (630 aa)
Score = 877, Expect = 9.0e-92, Identities = 195/451 (43%), Positives = 277/451 (61%)
  Q:    15 KIYAY--YDYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEK---YCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDF--------YNS--IEIMDALG------IEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRE 465
           +IYAY  +D  +   +KVG TTR+  + RI EQ   +A   + +T+   ++A R DGT FTD E+  AL R   +    EW   +   +     E++  K  +     + F +R EQ +A+  T   F     E      +FLWNAKMRFGKTFTAY+  +++  K VL+V+FKP V+ AW+ DL+SH+DF ++ +   L +       Q +  K +V F SFQDLLG++  G IK KN+W+H  KWDL++ DEYHFGAWRE +K+LF  +D+          Y S   E+ + +G       E  PI ++ YLYLSGTPFRA+S GEF+E+QIFNWTYTDEQ  KE +  +   + NPY  +P+M +LTY++PD L  +A  GEF+EF LN FF +      +  +F H   V ++L+ + G +     E LK    + P P+ D  LL  L H+FW LPNVA+C+AM +LL E
  S:    18 RIYAYAIHDDAHKGLLKVGQTTRD-VKQRIAEQLKTAA--IENYTIELDESAERADGTIFTDHEVRAALRRKKFENPQLEWMRCSVPDVKTVLAELRTGKA-YTGTHHETFPMRREQADAVHKTFEQFQSIWRENPHAVPRFLWNAKMRFGKTFTAYQLAKKLGAKRVLVVTFKPAVEDAWQTDLESHVDFNDWQY---LSRHSGSDPTQVSDSKPLVYFGSFQDLLGRDPAGNIKAKNEWLHAVKWDLVVFDEYHFGAWRETAKELFEGEDEAVAKKETKLEYGSGLEEVNEDIGELSEKEAEFLPITTRAYLYLSGTPFRALSTGEFIEEQIFNWTYTDEQRAKEAFAAEHPGQRNPYGALPQMRLLTYQMPDELLAIASGGEFNEFDLNAFFES--TGAGETEQFKHKSDVQKWLDIIRGGYMTKEIEYLKT-GTRPPFPYSDVRLLPYLQHSFWFLPNVAACHAMANLLAE 482
>gi|15903144|ref|NP_358694.1| type II restriction endonuclease, putative [Streptococcus pneumoniae R6] >gi|116516375|ref|YP_816550.1| type II restriction endonuclease, putative [Streptococcus pneumoniae D39] >gi|148989243|ref|ZP_01820623.1| type II restriction endonuclease, putative [Streptococcus pneumoniae SP6-BS73] >gi|168493143|ref|ZP_02717286.1| type III restriction enzyme, res subunit [Streptococcus pneumoniae CDC3059-06] >gi|15458726|gb|AAK99904.1| Uncharacterized restriction enzyme, interrupted-C [Streptococcus pneumoniae R6] >gi|116076951|gb|ABJ54671.1| type II restriction endonuclease, putative [Streptococcus pneumoniae D39] >gi|147925221|gb|EDK76300.1| type II restriction endonuclease, putative [Streptococcus pneumoniae SP6-BS73] >gi|183576752|gb|EDT97280.1| type III restriction enzyme, res subunit [Streptococcus pneumoniae CDC3059-06] (1084 aa)
Score = 705, Expect = 8.0e-72, Identities = 232/658 (35%), Positives = 350/658 (53%)
  Q:    15 KIYAYYD---YRNNKEMKVGYTTRENPEDRIKEQFPVS-APVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRK-NGEWFDYN--PEILNKAFFE-VKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFEN-YIFINNLDKDETFKTLQKNSGKNIVC-------FSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY--KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDE-------FSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGE------SLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKE-CYIFDFDPNRALKQVVEYSQNLN------TSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQA-LDILSKL 672
           KIYAY       N   +K+GYT R+  + RIKEQ   +       +T   A     + G TF D + H+ LS   V+R+   EWF +N  PE     F + V+H+   ++  + +D++LR+EQ+EA+  T  YF ++A  K   FLWNAK RFGKT + Y   + ME  NVLIV+ +P +  +W +D ++ I  +  Y F++  D  ++   L +     I+        F S QDL G    GG   K +W+ +  WDL++IDE H G    ++   FN+                     I+    L+LSGT F+A++ G+F E+QI+NW+Y DEQ+ K  +  + +E NPY  +P++ + TY++   + E   KG   +       F L+EFF+      + K +FIH   V  +L+ L+       NE+          PF  + L N L HTFWLL  VAS  A+  LL E   ++ Y+I+LAAG    S E        ++ + K +      KTITLS  +LTTGVTI  W+G+ ML +LKSP  Y QAAFR QN +++ D+     K  +++KE  Y+FDF P R L    E++ NL+           + E  +++ + F PI+A       M E+DA  +L          +L R + S +L     D +  I    Q  LDIL++L
  S:    14 KIYAYTTPTVTSNEGWIKIGYTERDVTQ-RIKEQTHTAHIATDVLWTGDAAYTEEPDKGKTFKDHDFHHFLSFHDVERRPKTEWFYFNGTPEKSKNLFDKFVQHDLSGYQPGKGQDYTLRQEQEEAVAKTLAYFQEHAGGK---FLWNAKPRFGKTLSTYDLARRMEAVNVLIVTNRPAIANSWYDDFETFIAGQTTYKFVSESDSLKSRPILSRQEFLGILADDVRQLAFISLQDLKGSVYLGGEHDKLKWVTDLHWDLLVIDEAHEGVDTFKTDQAFNK---------------------IRRNFTLHLSGTSFKALAKGDFTEEQIYNWSYADEQAAKYSWSLEQEEENPYESLPQLNLFTYQMSQMIGEKLEKGAQIDGENIDYVFDLSEFFAT-----DDKGKFIHEHDVRNWLDTLSS------NEK---------YPFSTKELRNELKHTFWLLERVASAKALKALLEEHPIYENYEIVLAAGDGRMSEEDDKVKLKSLDLVRKAIAE--NDKTITLSVGQLTTGVTIPEWTGVLMLSNLKSPALYMQAAFRAQNPYSWSDN-----KGNHFRKERAYVFDFAPERTLILFDEFANNLSLVTAAGRGTSATREENIRELLNFFPIIA-EDRAGKMVEIDAKAVLTTPRQIKAREVLKRGFMSNLLF----DNISGIFQASQTVLDILNEL 653
>gi|15901083|ref|NP_345687.1| type II restriction endonuclease, putative [Streptococcus pneumoniae TIGR4] >gi|111657849|ref|ZP_01408564.1| hypothetical protein SpneT_02000972 [Streptococcus pneumoniae TIGR4] >gi|14972702|gb|AAK75327.1| putative type II restriction endonuclease [Streptococcus pneumoniae TIGR4] (1084 aa)
Score = 703, Expect = 1.1e-71, Identities = 232/658 (35%), Positives = 349/658 (53%)
  Q:    15 KIYAYYD---YRNNKEMKVGYTTRENPEDRIKEQFPVS-APVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRK-NGEWFDYN--PEILNKAFFE-VKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFEN-YIFINNLDKDETFKTLQKNSGKNIVC-------FSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY--KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDE-------FSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGE------SLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKE-CYIFDFDPNRALKQVVEYSQNL------NTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQA-LDILSKL 672
           KIYAY       N   +K+GYT R+  + RIKEQ   +       +T   A     + G TF D + H+ LS   V+R+   EWF +N  PE     F + V+H+   ++  + +D++LR+EQ+EA+  T  YF ++A  K   FLWNAK RFGKT + Y   + ME  NVLIV+ +P +  +W +D ++ I  +  Y F++  D  ++   L +     I+        F S QDL G    GG   K +W+ +  WDL++IDE H G    ++   FN+                     I+    L+LSGT F+A++ G+F E+QI+NW+Y DEQ+ K  +  + +E NPY  +P++ + TY++   + E   KG   +       F L+EFF+      + K +FIH   V  +L+ L+       NE+          PF  + L N L HTFWLL  VAS  A+  LL E   ++ Y+I+LAAG    S E        ++ + K +      KTITLS  +LTTGVTI  W+G+ ML +LKSP  Y QAAFR QN +++ D+     K  +++KE  Y+FDF P R L    E++ NL            + E  +++ + F PI+A       M E+DA  +L          +L R + S +L     D +  I    Q  LDIL++L
  S:    14 KIYAYTTPTVTSNEGWIKIGYTERDVTQ-RIKEQTHTAHIATDVLWTGDAAYTEEPDKGKTFKDHDFHHFLSFHDVERRPKTEWFYFNGTPEKSKNLFDKFVQHDLSGYQPGKGQDYTLRQEQEEAVAKTLAYFQEHAGGK---FLWNAKPRFGKTLSTYDLARRMEAVNVLIVTNRPAIANSWYDDFETFIAGQTTYKFVSESDSLKSRPILSRQEFLGILADDVRQLAFISLQDLKGSVYLGGEHDKLKWVTDLHWDLLVIDEAHEGVDTFKTDQAFNK---------------------IRRNFTLHLSGTSFKALAKGDFTEEQIYNWSYADEQAAKYSWSLEQEEENPYESLPQLNLFTYQMSQMIGEKLEKGAQIDGENIDYVFDLSEFFAT-----DDKGKFIHEHDVRNWLDTLSS------NEK---------YPFSTKELRNELKHTFWLLERVASAKALKALLEEHPIYENYEIVLAAGDGRMSEEDDKVKLKSLDLVRKAIAE--NDKTITLSVGQLTTGVTIPEWTGVLMLSNLKSPALYMQAAFRAQNPYSWSDN-----KGNHFRKERAYVFDFAPERTLILFDEFANNLLLVTAAGRGTSATREENIRELLNFFPIIA-EDRAGKMVEIDAKAVLTTPRQIKAREVLKRGFMSNLLF----DNISGIFQASQTVLDILNEL 653
>gi|187736164|ref|YP_001878276.1| type III restriction protein res subunit [Akkermansia muciniphila ATCC BAA-835] >gi|187426216|gb|ACD05495.1| type III restriction protein res subunit [Akkermansia muciniphila ATCC BAA-835] (1110 aa)
Score = 673, Expect = 3.2e-68, Identities = 198/613 (32%), Positives = 318/613 (51%)
  Q:    15 KIYAYYD---YRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRK-NGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFEN-YIFINNLDKDETFKTLQKNS-----GKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDEN--NPYRCMPKMIMLTYKLPDNLREVALKG-EFDE--------FSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGESLIEEIHKNMEN-----PIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTS------NKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKIL 627
           K YAY      R+    K+GYT +++ E RI++Q   +  V   + + + ++A   DGT F D   H  L +  V+R+ N EWF   PE+ +  F E   N+   +      + LR EQ EA+  T+ Y   +A +   +FLWNAK RFGKT  AY   ++M  + VLIV+ +P +  +W +D    +  E+ Y FI+  D       + + +      +  + F S QDL G   +GG   K + +    WDL+I+DE H G    R+   F +                     I  +  L+LSGTPF+A++N +F E  IFNWTY DEQ  K +++ +    NPY  +P++ + TY++ + +R+   +G +FD+        F LNEFF+ K +       F + + V +FL  L G               Q   PF  E L   + H+FWLL  V S  A+   L+    F++Y++++AAG      E       K+++          +TITLS  +LTTGVT+  W+ + ML ++KSP  Y QAAFR QN   F +  +E+ ++EN     Y+FDF+P R L    +++ +L ++      +  + + +V++ + F P+     +   M  +DA K+L
  S:    15 KCYAYTTPEVQRHEGWTKIGYTEQDDVEVRIRQQ---TQTVDVRYCLEWHESARFADGTVFHDKAFHRYLGKKEVEREGNSEWFHLVPEVAHGHFREFTRNRGVLQTPGAVPYVLRAEQAEAVERTRLYMASHAGQS-PEFLWNAKPRFGKTLAAYDLCKQMGARTVLIVTNRPAIAHSWYDDYVRFMGTESGYYFISGADALRGLPHVLERAQLPSDAEGYIEFVSLQDLKGSLYFGGEFDKLEHVQKLTWDLLIVDEAHEGVDTYRADVAFEQ---------------------IARRATLHLSGTPFKALANEKFEEKAIFNWTYADEQRAKREWQEEAEEENPYAALPQLDLYTYRMSEVVRDRLKQGADFDDDGENEAYAFDLNEFFATKSDG-----SFKYDEAVERFLEALAG---------------QEKFPFSTEALRREVKHSFWLLDRVDSAKALAKKLKAHPVFREYEVVVAAGDGKTDAEEEATSTLKSLDKVRTAIRAHERTITLSVGQLTTGVTVPEWTAVLMLSNVKSPSLYMQAAFRAQNPCLFVEG-DELRRKEN----AYVFDFEPARTLVIFEQFANDLCSATVSGGGDGETRKRQVRELLNFFPVYGEDEEGE-MVALDAEKVL 608
>gi|119715824|ref|YP_922789.1| type III restriction enzyme, res subunit [Nocardioides sp. JS614] >gi|119536485|gb|ABL81102.1| type III restriction enzyme, res subunit [Nocardioides sp. JS614] (1094 aa)
Score = 667, Expect = 1.6e-67, Identities = 201/601 (33%), Positives = 316/601 (52%)
  Q:    29 KVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRND--GTTFTDIEIHNALSRLGVQR----KNGEW----------FDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFEN-YIFINNLDKDETFKTLQK-----------NSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKN-DENNPYRCMPKMIMLTYKLPDNLREVALKG---EFDE------FSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGESLIEEIHKNMEN---------PIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNL--NTSNKVSTE-SKVKDFIKFLPILAYSSDTNIMEEVDAVKILDY 629
           K+GYT +++ E RI +Q    +  K+     +++ A+     G  FTD + H  L + GVQR    K  EW           DY  E   + F        +F+ +   D+ LR EQ+ A+      F  +      + LWNAK RFGKT T Y  +++++   VLIV+ +P +  +W +D    I     + F++     E    + +           ++   IV F S QDL G   +GG   K + + + +WDL++IDE H G   +++   F++                     I   R L+LSGTPF+A++ G+F +DQIFNWTY DEQ+ ++++ +  + NPY+ +PK+ +LTY++   + +   +G   E DE      F LNEFF+ K N       F H  +V +FL+ L        NE+          PF    L + + H+FWLL  VAS  A+  LL++   FK Y ++LAAG    + +S +  + K+++            + KTITLS  +LTTGVT+  W+ + ML  + SP  Y QAAFR QN  TF     E ++    K+  YIFDF P R LK    ++ NL  N S         ++  + F P+L   S+  ++ E+DA ++L +
  S:    32 KIGYTEQDSAEKRIDQQASQMSITKEKV---WSRRALYTTEAGGRFTDKDFHEYLRQQGVQRETTPKRTEWHNLAAAPKRSLDYFNEFAGQDF-------ADFQADGVDDYVLRPEQQAAVDQALAAFAAHD-----EVLWNAKPRFGKTLTTYNLMRKLDVHRVLIVTNRPAIANSWYDDFMRFIGHRTTFKFVSESPSLENRSPMSREQWRAHSREHGDADPRIVEFVSLQDLKGSQYFGGNYPKLKHVADFEWDLLVIDEAHEGIDTDKTDVAFDQ---------------------ITRARTLHLSGTPFKALAKGKFGKDQIFNWTYEDEQTARQEWADASQENPYQALPKLNLLTYQISRMITDRLAEGVALEEDEANIDFTFDLNEFFATKDNGY-----FEHEAEVIRFLDCLAS------NEK---------YPFSTPELRDEIRHSFWLLNRVASAKALQRLLKQHEVFKDYTVVLAAGDGRSNDDSDLVAVGKSLDKVRTAIAEAEECDGKTITLSVGQLTTGVTVPEWTAVIMLSDMSSPAQYMQAAFRAQNPCTF-----ERAEHVFQKQNAYIFDFAPERTLKIFDAFANNLHPNPSGDPGVRLENIRTLLNFFPVLGEDSEGRMI-ELDASQVLTF 620
>gi|116334899|ref|YP_796424.1| superfamily II DNA/RNA helicase [Lactobacillus brevis ATCC 367] >gi|116100246|gb|ABJ65393.1| DNA or RNA helicase of superfamily II [Lactobacillus brevis ATCC 367] (1480 aa)
Score = 648, Expect = 2.8e-65, Identities = 228/711 (32%), Positives = 366/711 (51%)
  Q:    35 RENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTT--FTDIEIHNALSRLGVQRK----NGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKD----FSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGG-IKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLT--GKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETI---EFKKYKII-----LAAGGKSKSGESLIEEIHKNMEN-PIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVST---ESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIK-KLKTKSTESELTKEE-----------KKLLSNDKK---DEQSKRREVQKKLI----KFATRIPIFMYLTD 745
           R+  + RI  Q+  +A V  P  + +A+ A R +G    FTD ++H  L R  ++R       EWF  +     KA   VK+N+   + +  +D      LR EQ EA++ TK  F    N+KY   LWNAKMRFGKT +A + I++  YK+VLI++ +P V  +W ED       E      + ++  TF++L+  S K  V F+S Q+L G    GG +K KN+ + +  WDL+IIDE H G   E ++ + N                   Q      + L LSGTPF  +   ++ +DQ++ W YT EQ  K+Q++ D   E NPY  +P++ M T+   D  +      +F +     F   +F + N + EFI+ + V QFL  +T   KHT Y              PF  +   + L HT WL+P V    AM  LL++     E   YKII     +    K  + ++ ++ +   + N P  TKTITL+ +KLTTG+TI+PW+G+  L +  S   Y QAAFR Q  ++              K +C+IFDF P+RAL  + E +Q  +   K +T   + ++ D + FLPI+    +          ++  + + ++   +     E A+    ++D+L    S++  +   + LEDF    KD+  I+ K+++ K K+K    +  LT E+           KK  S +++   D+ +  ++ +K LI      + RIP+ +Y  D
  S:   206 RQTAQKRIN-QYMETAGV--PSKLEWAELAYRKNGEPHWFTDKDVHRVLERSKIERSPNLAGQEWFKTDLATARKAIKAVKNNQSVIDTDNNEDQKPKIVLRPEQLEAVKKTKKAF---KNDKYSNMLWNAKMRFGKTLSALQLIKDEGYKHVLIMTHRPAVDESWFEDFAKIGMPEAGYLYGSKNQGATFESLRTGS-KPFVYFASLQNLSGSTMIGGKVKDKNRELFSEDWDLVIIDEAHEGTQTELAQQVLN-------------------QVQGPKTKLLELSGTPFNILD--QYEDDQVYTWDYTMEQRAKQQWEIDHPHEPNPYAGLPRVNMFTFNTDDKFK----NPKFSQVGGKSFNFKEFFKVNDQGEFIYENYVRQFLRNITTPSKHTSY--------------PFSTKQFRDQLRHTLWLMPGVKEAGAMERLLKQDPVLGEINGYKIINVVKDIKGEDKGITDQTDVDRVKSAIGNDPASTKTITLTVRKLTTGITIKPWTGVIFLSNTNSAMQYLQAAFRAQTPYS--------DPHFGTKIDCFIFDFAPDRALTIMAESAQMNSGVGKRTTSVQKQRMSDLLNFLPIIGEQGN----------QMKPFHVDSMLKQIKKVYAEKAVKSGFEDDSL---YSDELLMIKEADLEDF----KDLKTIVGKTKREKTKVKVDINDQGLTDEQYDEAIKGQKKPKKERSPEEQAAIDQMNAMKKQRKTLISILRSISIRIPLMIYGMD 892
>gi|167752923|ref|ZP_02425050.1| hypothetical protein ALIPUT_01185 [Alistipes putredinis DSM 17216] >gi|167659992|gb|EDS04122.1| hypothetical protein ALIPUT_01185 [Alistipes putredinis DSM 17216] (1079 aa)
Score = 617, Expect = 1.0e-61, Identities = 212/705 (30%), Positives = 344/705 (48%)
  Q:    71 TFTDIEIHNALSRLGVQRK-------NGEWFDYNPEILNKAFFEVKHNKLNF---EVNRTKD-FSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDL-QSHIDFENYIF--INNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKN---DENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGES---LIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSL--KSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESK--VKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVN-----------VDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREE----TLKDVITELEPDFFEKVT--GLTIKDFD 775
           +F D E+H+ L R G+++K         EWF  + E + +A   VK  + +    EV+  K     R EQ+EAI  TK  F K       + LWNAKMRFGKT +A + +++M++   LI++ +P V + W ED  +   D  ++ +   NN D   + +T  K      V F+S QDL G    GG   KN  +    WD II+DE H G   +  K +  E   D                     + L LSGTPF  +   +F ED+I+ W Y  EQ  K  +      + NPY  +P M + TY L   L E     E   F+  EFF       N    F+H   V+ FLN +T +            D+++  PF +E   N   HT W+LP V    AM  +L+    F+ +K++  AG   +  ES   L+       ++P  T+TITLSC +LTTGV+++ W+ +FML      +  +Y Q  FRVQ            +     K++CY+FDF P+R LK + E ++  + + K S   +  + +F+ F PI+  S + + M + D  ++L+         ++   +E   L N            + D LK+I+   +A+   ++++       D      +S + K  K    +  LT+EEK+ L   KK +++ R      L   + R+P+ +Y  + ++E    T+ +  + ++P  +E+    G+T + F+
  S:    85 SFNDKEVHSVLERSGIKKKIFDTENKANEWFITDLETVKRAIIAVKEGRESLSSAEVSHDKSPIVFRPEQREAIEKTKKQFKKGN-----QMLWNAKMRFGKTLSALQEVKDMDFSRTLILTHRPVVDSGWFEDFGKIFYDRRDFAYGSKNNGDSHTSLETRAKQGQCKYVYFASMQDLRGSELVGGNFDKNNEVFATAWDCIIVDEAHEGTQTDLGKAVMQELTKD-------------------KTKILRLSGTPFNLLD--DFKEDEIYTWDYVMEQRAKASWDELHFGDPNPYASLPTMNIYTYDLGRLLNEFV--DEDVAFNFREFFRV-----NDNGTFVHDKDVSAFLNLITKE------------DRESCYPFANEEYRNIFRHTLWMLPGVKEARAMSAMLQTHSVFQHFKVVNVAGNGDEDEESKDALVAVEEAIGKDPDATRTITLSCGRLTTGVSVKAWTAVFMLSGSYNTAASSYMQTIFRVQTP---------AAINGKVKEQCYVFDFAPDRTLKVIAETAKISSKTGKTSGNDRKIMGEFLNFCPII--SIEGSKMNQFDVPRMLEQLKKVYVERVVRNGFEDRSLYNDELMKLNDLELQEFDDLKKIIGQTKAMPKTNQVDINNQGLTDEQYEELESLEKKSKKKGKDKQPLTEEEKQRLEELKK-KKNNREAAISILRGISIRMPLLIYGAELKDESQEITIDNFASLIDPQSWEEFMPKGVTKQKFN 773
>gi|72384715|gb|AAZ67649.1| putative type III restriction system endonuclease [Haemophilus parasuis] (310 aa)
Score = 615, Expect = 1.8e-61, Identities = 131/294 (44%), Positives = 188/294 (63%)
  Q:    15 KIYAYYDYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNGEWFDYNPEILNKAFFEVKHNKLNFEVNRTKDFSLREEQKEAIRVTKNYFL-----KNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIE---------IMDALGIEQFPIKSKRYLY 308
           K+YAY D R    +K+GYTTR+  + R+ EQ+PV  P  + + + F + AIR+DG++F D ++H  L + GV+R  GEWF  +   +  A+ +VK  +   E  RT  F +R EQ+EA+  T  YF      +N  EK   FLWNAKMRFGKTF AY+  +EM +K +L+++FKP V+ AW+EDLQ+H+DF+ + F+ + D+ ++     +      +CF SFQD LGKNK GG K+KN+W+H   WD II DEYH+GAWRE+SK LF  ++  F   +E         + D    E  PI S  +LY
  S:    12 KVYAYSDSRFPHCLKIGYTTRDVAQ-RVAEQYPVKLP-NQSYQVVFDERAIRDDGSSFRDYDLHAVLQKRGVERLEGEWFKCDLNDVKSAYLKVK-TRQAVEKQRTFAFGMRPEQQEAVTKTAQYFRSFHNDENNQEKTPHFLWNAKMRFGKTFAAYQLAKEMGWKKILVLTFKPAVQNAWQEDLQNHLDFQGWRFVTHGDEWQSAVDFPQ------ICFGSFQDYLGKNKAGGTKLKNEWVHTINWDCIIFDEYHYGAWREKSKGLFEAEEQAFQKQLEAEAAEMEMDMPDYFDEETLPITSNHFLY 310
>gi|188994279|ref|YP_001928531.1| restriction endonuclease [Porphyromonas gingivalis ATCC 33277] >gi|188593959|dbj|BAG32934.1| restriction endonuclease [Porphyromonas gingivalis ATCC 33277] (1324 aa)
Score = 607, Expect = 1.8e-60, Identities = 212/679 (31%), Positives = 338/679 (49%)
  Q:    71 TFTDIEIHNALSRLGVQRKN----GEWFDYNPEILNKAFFEVKHNKLNF---EVNRTKD-FSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDL-QSHIDFENYIFINNLDKDETFKTLQK--NSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAG-GKSKSGES--LIEEIHKNM-ENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPET--YFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESK--VKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVN-----------VDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESE--LTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREE 749
           +F D ++H+ L R GV+RK+     EW+  +   + +A   +K  K +    EV  + +   LR EQKEAI  T   F K       K LWNAKMRFGKT  A +  +EME    +I++ +P V  +W ED  ++  D   + +  +  K E+F +L+K  + GK  V F+S QD+ G    GG   KN  + +  WDL+I+DE H G   E  K +                     Q   K  + L+LSGTP+      +  E+++F W Y  EQ  K  ++ +   + NPY  +P + + TY L   + E +   E   F+  EFF  +     +   F+H   +++FL+ L  +            D++A  P+ +E       HT W+LP V +  A+   L +   F  +K+   AG G  +  ES   +E +++ + ++P ET TITLSC +LTTGV+I+PW+G+FM+    S     Y Q  FRVQ  +T  + Y         K ECY FDF P+R L+ + E ++    + K S   +  + DF+ F PI+  S + + M+  D   +L          ++   +E+  L N            D D LK I+   +A   ++K  D      DI+      EQ ++ +      +  LT EEKK L ++ K +  +RRE    L   + R+P+ +Y  + ++E
  S:    87 SFNDKQVHSVLERSGVKRKSFAGATEWYSCDLATVKRAISAIKEGKDSLGASEVTLSDNPIILRPEQKEAIERTLKQFRKGN-----KMLWNAKMRFGKTLCALRVAKEMEAVRTIIITHRPVVDASWFEDFGKTFYDRPEWHY-GSRSKGESFASLEKLASQGKKCVYFASMQDMRGSKDVGGKFDKNNEVFSTSWDLVIVDEAHEGTQTELGKAVLG-------------------QLMSKDTKALHLSGTPYNLFDQHK--EEEVFTWDYVMEQQAKIDWEINHLGDTNPYASLPAIHIYTYDLGRLMSEYS--DEEKAFNFREFFRTR-----EDGSFVHEGDIDRFLSLLCRE------------DEEALYPYSNEHFRQIFRHTLWILPGVRAAKALSKKLSKHPIFGLFKVANVAGDGDDEEEESRDALELVNQAIGKDPDETYTITLSCGRLTTGVSIKPWTGVFMMAGSYSTSASGYMQTIFRVQTPYT-HNGY--------MKTECYAFDFAPDRTLRVLAEAAKVSYKAGKQSESDRKLLGDFLNFCPII--SIEGSRMKPYDVNTMLGQLKRAQIEKVVQDGFENGALYNDELLKLTEVELHDFDELKGIIGKTKA---MAKSGDI-----DINHQGLTHEQYEEKERLEKRKKKGLTPEEKKRL-DELKAKGDQRREAVSILRGISIRMPLMLYGAEMKDE 734
>gi|34541333|ref|NP_905812.1| type II restriction endonuclease, putative [Porphyromonas gingivalis W83] >gi|34397649|gb|AAQ66711.1| type II restriction endonuclease, putative [Porphyromonas gingivalis W83] (1324 aa)
Score = 607, Expect = 1.8e-60, Identities = 212/679 (31%), Positives = 338/679 (49%)
  Q:    71 TFTDIEIHNALSRLGVQRKN----GEWFDYNPEILNKAFFEVKHNKLNF---EVNRTKD-FSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDL-QSHIDFENYIFINNLDKDETFKTLQK--NSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAG-GKSKSGES--LIEEIHKNM-ENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPET--YFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESK--VKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVN-----------VDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESE--LTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREE 749
           +F D ++H+ L R GV+RK+     EW+  +   + +A   +K  K +    EV  + +   LR EQKEAI  T   F K       K LWNAKMRFGKT  A +  +EME    +I++ +P V  +W ED  ++  D   + +  +  K E+F +L+K  + GK  V F+S QD+ G    GG   KN  + +  WDL+I+DE H G   E  K +                     Q   K  + L+LSGTP+      +  E+++F W Y  EQ  K  ++ +   + NPY  +P + + TY L   + E +   E   F+  EFF  +     +   F+H   +++FL+ L  +            D++A  P+ +E       HT W+LP V +  A+   L +   F  +K+   AG G  +  ES   +E +++ + ++P ET TITLSC +LTTGV+I+PW+G+FM+    S     Y Q  FRVQ  +T  + Y         K ECY FDF P+R L+ + E ++    + K S   +  + DF+ F PI+  S + + M+  D   +L          ++   +E+  L N            D D LK I+   +A   ++K  D      DI+      EQ ++ +      +  LT EEKK L ++ K +  +RRE    L   + R+P+ +Y  + ++E
  S:    87 SFNDKQVHSVLERSGVKRKSFAGATEWYSCDLATVKRAISAIKEGKDSLGASEVTLSDNPIILRPEQKEAIERTLKQFRKGN-----KMLWNAKMRFGKTLCALRVAKEMEAVRTIIITHRPVVDASWFEDFGKTFYDRPEWHY-GSRSKGESFASLEKLASQGKKCVYFASMQDMRGSKDVGGKFDKNNEVFSTSWDLVIVDEAHEGTQTELGKAVLG-------------------QLMGKDTKALHLSGTPYNLFDQHK--EEEVFTWDYVMEQQAKIDWEINHLGDTNPYASLPAIHIYTYDLGRLISEYS--DEEKAFNFREFFRTR-----EDGSFVHEGDIDRFLSLLCRE------------DEEALYPYSNEHFRQIFRHTLWILPGVRAAKALSKKLSKHPIFGLFKVANVAGDGDDEEEESRDALELVNQAIGKDPDETYTITLSCGRLTTGVSIKPWTGVFMMAGSYSTSASGYMQTIFRVQTPYT-HNGY--------MKTECYAFDFAPDRTLRVLAEAAKVSYKAGKQSESDRKLLGDFLNFCPII--SIEGSRMKPYDVNTMLGQLKRAQIEKVVQDGFENGALYNDELLKLTEVELHDFDELKGIIGKTKA---MAKSGDI-----DINHQGLTHEQYEEKERLEKRKKKGLTPEEKKRL-DELKAKGDQRREAISILRGISIRMPLMLYGAEMKDE 734
>gi|169837334|ref|ZP_02870522.1| type II restriction endonuclease, putative [candidate division TM7 single-cell isolate TM7a] (570 aa)
Score = 590, Expect = 1.3e-58, Identities = 193/529 (36%), Positives = 281/529 (53%)
  Q:    24 NNKEMKVGYTTRENPEDRIKEQFPVSAP-VKKPFTMFFAKNAIRNDGTTFT---DIEIHNALSRLGVQRKNG---EWFDYN--PEILNKAFFEVKHNKLNF-EVNRTKDFSLREEQKEAIRVTKNYF-------LKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQK-------NSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQ-SKKEQYKNDENNPYRCMPKMIMLTYKLPDNLREVALKG-EFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPN-VASCYAMYDLLRETIEF--KKYKIILAAG-GKSKSGESLIEEIHKNMENPIET------------KTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDD 552
           N+   K+GYT RE+ + RI+EQ  V  P + + +   ++  AI      F    D ++H  + + G+++  G   EWF +N  PE   + F   +    +  +  +   ++LR EQ  A+  T  Y          N NE+  KFLWNAK RFGKT T Y F +  E KN+LIV+ +P +  +W +D +  ID   Y FI+  D  +   TL +       +  K    F S QDL G   +GG   K +W+ + +WDL++IDE H G    R+++ F                       IK +  L+LSGTPFRA+ N +F  +QIFNWTY DEQ +K+ + K  E+  +  MP M + TYK+ D + +   +G + D+   +  F           +FIH   + +FL+ LT       NE+          PF    L   L HTFWL+ N VAS  AMY LL++   F    YKIILAAG GK  S ++  +E  KN     +             KTITLS  +LTTGVT++ WS + ML  +K+   Y QA FR QN + F+ +
  S:    28 NDGWQKIGYTEREDVDKRIREQ--VRTPGLHEEYKKLWSAPAIFEPVEKFDFFDDHKLHKYMVKNGIRKDEGRGKEWFYFNGAPEKSKELFDSFRRRDFSIIQHGQKHKYTLRHEQNVAVEKTLEYAKRHQTIDFNNPNEE-AKFLWNAKPRFGKTLTTYDFAKRFEAKNILIVTNRPAIANSWFDDYKKFID--GYYFISTADSLKNLPTLTREDYLQMTDVYKKQFTFLSLQDLKGAKVFGGGYDKLKWVADLQWDLLVIDEAHEGIDTGRTEEAFRN---------------------IKRRFTLHLSGTPFRALRNDKFTHEQIFNWTYIDEQKAKQSELKTGESGDHTDMPDMRLFTYKISDMIADKINQGVKIDDKDTSYAFDLNSTFATAGGKFIHEADIKRFLDTLT------TNEK---------YPFSTPELRTELKHTFWLVGNRVASAKAMYKLLKDHPVFGNGNYKIILAAGDGKPFSDDNGFDEEVKNTAQNEKALDRVRSAIKHHDKTITLSVGQLTTGVTVKEWSAVLMLSDIKAESLYMQAIFRAQNPYAFEKN 557
>gi|114331328|ref|YP_747550.1| superfamily II DNA/RNA helicase [Nitrosomonas eutropha C91] >gi|114308342|gb|ABI59585.1| DNA or RNA helicases of superfamily II-like [Nitrosomonas eutropha C91] (820 aa)
Score = 590, Expect = 1.6e-58, Identities = 236/789 (29%), Positives = 382/789 (48%)
  Q:    15 KIYAYY--DYRNNKEMKVGYTTRENPEDRIKEQFPVSAPVKKPFTMFFAKNAIRNDGTTFTDIEIHNALSRLGVQR----KNGEWFDYNPEILNKAFFEVK--HNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYC-------KFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDE--------TFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQ-SKKEQYKNDENNP----YRCMPKMIMLTYKLPDN----LREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGE----------SLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTS-------------NKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRN--LNKDISIIISKSEQIKKLKTKSTESELTKEEK-KLLSNDKKDEQSKRREVQKK-----LIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDSSL 803
           ++YAY   +Y+ N  +KVG+T  +  E+RI  QF  S P    + M      +  DG    D  IH  L + G ++       EWF    +  N  F +V+  +N++    +RT+ + LR+EQ  AI     +F K    +         +FL NAKMRFGK FT+    +++  +N LIV++KP V   W + +   +DF+ +  I    K +              + SG  ++C S  QDL   ++ G  K +   I    WDL+I DE H+G+  ER+K +  +                     IK    L LSGTPFR I   +F   Q++ ++Y DEQ +KKE+ + D  N     YR MP + +   ++ D      RE     + D FSLN  F     E N++ +F++ + V+ F+  LT           +AR          ++      HT W +  V S  A+ + L+    F  + +I A+G  +K  +          S+ + I++  ENP +  TIT +C +  TGVTIR W  I +L  +KS E+Y+QA FRVQ++W      NE +K    K + ++FDF   R L+   + + N+                NK + E   +     L I  +   + +     A  I +      +   L R+  S +LVN     LK +  +   L IL K++ +R+      I   +        L+    +  LT++EK K++ +  + ++ K R+ +KK     + + A  +  F+Y+T  RE  + DVI    P FFE +TG++   F  L      N   +N  +  FR  E++SL
  S:     5 ELYAYTTEEYKKNGWIKVGHT--KVGEERIWNQFGTSNPENPDYQMI----GMLPDGVC--DHHIHAQLIKNGCKKIEKVPGQEWFQVTNK--NDPFKDVRRAYNEIVNGSSRTEHYKLRKEQAGAIEKASKWFKKEYPAEVIGSATHSNRFLINAKMRFGKCFTSIHLAKKINARNTLIVTYKPDVIGEWIDTVNEQVDFDGWTGIRAKPKSDRPADPALNDSGDFPRTSGPIVLCVS-LQDLW-IDEDGNTKDRLHKIPEIAWDLVIFDEVHYGSRTERAKSILEK---------------------IKFTHRLDLSGTPFRLIEQDDFSSQQVYTYSYLDEQKNKKEEIEFDPQNQAEKIYRLMPDLNISAIEITDEDIAEQRETFKTDDID-FSLNRLF-----ETNEENKFVYEEAVDHFIEGLT-------QSGHEARSISVYGKLGSQLGCPPKRHTVWWMNRVDSISALIEKLQSHPYFSNFILINASGSDNKKDDDDRIVAREKSSVQKAINEANENPNKLGTITFTCGRFLTGVTIREWDSILILNDIKSAESYYQAIFRVQSAWV-----NEKTKSP-LKPKAWVFDFAITRCLQVTYDCASNIADQIDQQESYEQRTDVNKDNLEIVTEGLCDTLDIKRFYEGSLVSTPTTAKDIFEVLNHEGSRIALARRITSNVLVNFGK--LKLLEEHPHILGILEKVKGYRSGEFTATIEDFVQIGRDASDLEQVKGDPNLTQDEKEKIIEDFAEKDKDKERQTRKKWYATQIKRLAICMADFIYMTYEREYNIDDVIQTKSPQFFEVMTGISKDGFVELCDKGFMNRFALNRIVREFRDQENTSL 802
>gi|29349421|ref|NP_812924.1| restriction endonuclease [Bacteroides thetaiotaomicron VPI-5482] >gi|29341330|gb|AAO79118.1| restriction endonuclease [Bacteroides thetaiotaomicron VPI-5482] (1332 aa)
Score = 589, Expect = 2.2e-58, Identities = 184/558 (32%), Positives = 273/558 (48%)
  Q:    71 TFTDIEIHNALSRLGVQRK-------NGEWFDYNPEILNKAFFEVKHNKLNF---EVNRTKD-FSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFI----NNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY---KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGG-----KSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSL--KSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESK--VKDFIKFLPILAYSSDTNIMEEVDAVKILD 628
           +F D E+H+ L R G+++K         EWF  + E + +A   VK  + +    EV+  +     R EQ+EAI  TK  F K       + LWNAKMRFGKT +A + ++ M++   LI++ +P V + W ED    I ++   F     NN D   + +   K      V F+S QDL G    GG   KN  +    WD II+DE H G   E  K +  E                       + + L LSGTPF  +   +F ED+I+ W Y  EQ  K  +      + NPY  +P M + T  L   L E     E   F+  EFF       N+   FIH   V  FLN ++ +            DK +  PF +E   N   HT W+LP V    AM  LL+    F+ +K++  AG      +SK   + +EE     ++P  T+TITLSC +LTTGV+++ W+G+FML      +  +Y Q  FRVQ   T              K++CY+FDF P+R LK + E ++  + + K S   +  + +F+ F PI+  S + + M + D  K+L+
  S:    85 SFNDKEVHSVLERSGIRKKIFDTENKANEWFITDLETVKRAIIAVKEGRESLSSAEVSHAQTPIVFRPEQREAIEKTKKQFKKGN-----QMLWNAKMRFGKTLSALQVVKGMDFSRTLILTHRPVVDSGWFEDF-GKIFYDCPCFAYGSKNNGDSHASLEARAKQGKCQYVYFASMQDLRGSELVGGNFDKNNEVFATAWDCIIVDEAHEGTQTELGKAVMQE-------------------LTKANTKILRLSGTPFNLLD--DFKEDEIYTWDYVMEQRAKASWDLTHFGDPNPYASLPTMNIYTCDLGRLLHEFV--DEDVAFNFREFFRV-----NEAGNFIHEKDVKAFLNLISKE------------DKDSCYPFANEEYRNIFRHTLWMLPGVKEARAMSALLQSHPVFQHFKVVNVAGDGDEDEESKDALAAVEEAIG--KDPDATRTITLSCGRLTTGVSVKAWTGVFMLSGSYNTAASSYMQTIFRVQTPATING---------RVKEQCYVFDFAPDRTLKVIAETAKISSKAGKTSGNDRKIMGEFLNFCPII--SIEGSKMSQFDVPKMLE 610
>gi|118476570|ref|YP_893721.1| type II restriction endonuclease [Bacillus thuringiensis str. Al Hakam] >gi|118415795|gb|ABK84214.1| possible type II restriction endonuclease [Bacillus thuringiensis str. Al Hakam] (1333 aa)
Score = 580, Expect = 2.4e-57, Identities = 226/742 (30%), Positives = 358/742 (48%)
  Q:     1 MSNNYFQKQTNKIGKIYAYYDYRNNKEMKVGYTTRE-NPEDR------IKEQFPVSAPVKKPF-TMFFAKNAIRNDGTTFTDIEIHNALSRLGVQRKNG----EWFDYNPEILNKAFFEVKHNKLNF----EVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHID-FENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFD----EFSLNEFFSAKFNER---NKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGG---KSKSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNV------DNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKK--------------------LKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIK-FATRIPIFMY 742
           MS   +Q   +K+  +++  D  +   +K+G TT E NP DR      +K++          F  +     AI   G +F D ++HN L R G+    G    EWF    +    A   VK  +++     E+      + R EQ+ AI+ T     K  ++K    LWNAKMRFGKT +A + I+   +   +I++ +P V   W ED     D  ++Y + ++   +   + L+K +  + V F+S QDL G    GG   KN  I    WD +IIDE H G   E ++ +                        +K    L LSGTPF    + E  ED I+ W Y  EQ  K ++  +   ++NPY  +PK+ + TY+L    +E + K   D     F+  EFF    +E     K+ +FIH   + +FLN ++ K         +  +     PF  +    NL +T WL+P V    A+ +L+++   F+ ++I+  AG    +S+SG++L +      +NP    TIT++C KLTTGV++  W+G+ ML +  SP TY Q AFRVQ                  K +CY+FDF P+R LK V + ++ LNT        K K+ +     L Y S          + I D  ++ I    ++R+ + A +  V      DN+     +     +DI    E+F NL +    II  S+Q KK                       K  + E T EE+ +L  DK  E  K+R+    +++  + RIP+ +Y
  S:     5 MSGKSYQTFRHKLIYVFSIPDKAHEGRLKIGETTFEGNPYDREGIEKTVKQRIDQYTKTADIFYNLLHFDLAITYKGASFRDYDVHNVLKRSGITPSQGSRGREWFKIGIDTAIAAIEAVKKGEMSLGKVKELINYNSITFRPEQERAIQETLASIKKGKSKK----LWNAKMRFGKTVSALELIKRAAFTKTIIITHRPVVAAGWFEDFYKIFDPIDDYQYGSSSKGEGIEELLRKQT--SFVYFASMQDLRGSAVIGGGYNKNNLIFETDWDCVIIDEAHEGNKTELAQSVHRH---------------------LKRSFTLELSGTPFNLFEDYE-EEDDIYTWDYVMEQHAKYEWDQNNFGDSNPYANLPKLSIFTYQLD---KEFSSKQYIDIEDAAFNFKEFFKTYGSEEPDVEKRGKFIHEKDIWKFLNLISHKD--------QYEENNTNFPFSTDHYRENLKNTLWLVPGVQEARALSELMKKHDIFRHFEIVNVAGSGDDESESGDALHKVKTAIGDNPENAYTITITCGKLTTGVSVPAWTGVLMLSNTTSPSTYLQTAFRVQTPANIGG---------KVKTDCYVFDFAPDRTLKMVAQAAR-LNTKAGSLNAPKQKEAMA--TFLNYCS---------VISIDDSKMSAINVEHMLRQLKKAAVDRVVSTGFDDNNLYNDELLKLNDVDI----EEFNNLKE----IIGTSKQEKKPLDVTLNNQGFDDEEWEQAEEAEKKKKKERTPEEQAIL--DKMQELRKQRKTMISILRGISIRIPMMIY 733
>gi|58336806|ref|YP_193391.1| restriction endonuclease [Lactobacillus acidophilus NCFM] >gi|58254123|gb|AAV42360.1| restriction endonuclease [Lactobacillus acidophilus NCFM] (1501 aa)
Score = 563, Expect = 2.3e-55, Identities = 195/606 (32%), Positives = 299/606 (49%)
  Q:     5 YFQKQTNKIGKIYAYYDYRNNKEMKVGYTTRENPED----------RIKEQFPVSAPVKKPFTMFFAKNAIR-NDGTTFTDIEIHNALSRLGVQRKNG----EWFDYNPEILNKAFFEVKHNKLNFEVNRT----KDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQS-HIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGG-IKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKNDE---NNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNE--FFSAKFNERNKKYEFIHGDQVNQFLNFLT--GKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGESLIEEIHKNMENPIETK-------TITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTE---SKVKDFIKFLPILA 610
           Y Q   N  G+  AY   +   +  VG    +N ++          RI +    S     PF + +A+ A R +DG  F+D ++H  L R G++  +     EWF  + E   +A   VK NK +  +           LR EQ+ A+  TK  F  +      K LWNAKMRFGKT TA K I+E +Y+ VLI++ +P V   W +D     +    YI+ +     ++ K+L+K   K+ + F+S QDL G    GG +  KN+ +    WDL+I+DE H G   E ++++                   ++    K+ + L LSGTPF  +   +F ED ++ W YT EQ  K+ +  +     NPY  +PK+ M T+++  N  +      F++ +L +  F   +F   +K  +F++   VN+FL+ ++  GK+                 PF       NL HT W++P +    A+ DLL +   F K   IL      KS E L  +     EN    K       TITL+ +KLTTG TI  W+G+  L ++ S   Y QAAFR Q  ++        S E   K+ CYIFDF P+RAL  + E +       K+ T+    ++   + FLPIL 
  S:   174 YIQTADNSKGQFPAYIGSQKVGKTGVGDLAEDNSDNSLYLRDWATKRINQYMNTSG---VPFKLEWAELAYRKSDGWWFSDHDVHRVLERSGIKHSDNLTGDEWFKTDLETTKRAIKAVKENKDSISITDKDKADNQIVLRPEQQAAVDKTKAGFKTSK-----KMLWNAKMRFGKTLTALKLIKEEKYQKVLIMTHRPVVNDGWFDDFNKIGMPDAGYIYGSKTKGYKSVKSLEKED-KSYIYFASIQDLAGSEIAGGKVSDKNRDLFGIDWDLVIVDEAHEGTQTELTQNV-------------------LDLVLKKNTKELDLSGTPFNILF--DFDEDHVYTWDYTMEQEAKQNWYEEHPGVKNPYESLPKVSMFTFEMNKNFSD----PRFNDINLGKPTFNFKEFFRTDKDGKFVYESDVNRFLDNISNPGKNN---------------YPFSTRQFRRNLRHTLWIMPGIKEANALEDLLNQHPVFGKEYRILNVVRGDKSDELLGTDNDAEAENKQIAKADKEGLNTITLTVRKLTTGATIPEWTGVLFLSNISSAMQYLQAAFRAQTPYS--------SPEFGKKENCYIFDFAPDRALNIMAESTSLATGVGKIQTKEQRERMAKLMNFLPILG 760
>gi|4467889|emb|CAB37845.1| restriction endonuclease [Lactococcus lactis subsp. cremoris] (1461 aa)
Score = 562, Expect = 2.6e-55, Identities = 229/754 (30%), Positives = 362/754 (48%)
  Q:    66 RNDGTTFTDIEIHNALSRLGVQR----KNGEWFDYNPEILNKAFFEVKHNKLNFE----VNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDL-QSHIDFENYIFINNLDKDETFKTLQKNSGKN-IVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKND---ENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEF-KKYKII-LAAGGKSKSGESL----IEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQ---NLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVD----------AVKILDYTITNIT-YNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMY---LTDYREETLKDVITELEPDFFEKVTGLTIKDFDFLVSLNIFNEKIMNDAIWSFRRYEDS--SLKYTGILKNKSEKIGLF 819
           ++  T F D ++H  L R G++R       EWF+ + E    A   VK  +   +     N     +LR EQ  A+  T+  F KN      K LWNAKMRFGKT T+ + I+E +Y  VLI++ +P V  +W ED  +  +  E Y + +   +D  FK     SG    + F S Q L    +YGG KV  +   +  WDLIIIDE H G   E + ++    + D                   + + L LSGTPF      ++ E+ ++ W Y  EQ  K +Y  +   E NPY  +PK+ M T+++ +  R      +   F+  EFF  + NE N   EF+H   +N FL+ +T +            D     PF  +   N L HT WLLP V    A   LL E   F K+YKI+ +    KS S E      ++++ + + +P ++KTITL+ +KLTTGV I  W+ +  L +  S   Y QAAFR Q  ++         ++   KK CYIFDF P+RAL  + E +Q    +   N +  +  +   + F+PIL  +     +  VD          A K +     + + YN  +   + A L + +N  LK IV       +  K+E   N+N        K E+ +K K +    E T EEK+++   K+ ++ +R+ +   L   + RIP+ +Y   +   +E  + + +  ++   +E+     IK  DF      ++ ++  +A    R+   S   L+YT   +  +E  G F
  S:   227 KSTKTWFHDHDVHEVLKRSGIKRPEFLDGSEWFETDVETAKSAIKAVKEGQSALDRVGSTNADDHITLRPEQSLAVEKTRKNFKKNK-----KMLWNAKMRFGKTLTSLELIKEQKYTKVLIMTHRPVVSDSWVEDFGKMKMAEEGYRYGS---EDTQFKLKDLKSGNTPFIYFVSIQKL----RYGGGKVNLREFTDVDWDLIIIDEAHEGTQTELADNVLKSLEKD-------------------NTKILSLSGTPFNI--QDQYSEESVYTWDYPMEQLAKLRYSLEHPTEENPYESLPKVNMFTFEMKNKER---FLDDSKSFNFREFF--RVNENN---EFVHKVDINAFLDNITNQ------------DSNTNYPFSTKQYRNELRHTLWLLPGVKEANAFEKLLNEHRIFGKEYKIVNVVKDDKSDSNEVATKGDLDKVRQAIGDPSQSKTITLTVRKLTTGVNIPEWTAVLFLSNTNSAMNYLQAAFRAQTKFS--------HEKLGMKKNCYIFDFAPDRALTVMAESAQINSGVGKKNTLQQKEAMTQLLNFMPILGQTDHGMKVFNVDRMLTQLKKVYAEKAVRSGFEDDSLYNDELLTLDEADLNDFNN--LKEIVGKTNLSGLPKKVE--INVNGLTDEEYEKGEKAQKKKPR----ERTTEEKEIIEKVKQAKK-QRKTMISILRGISIRIPMMIYGMPIEVDKEMGIDEFVNHVDSISWEEFMPKGIKKSDFKRFAKYYDPEVFVEAGRIIRQRAQSYDDLEYTERAEKIAELFGTF 948
>gi|154498489|ref|ZP_02036867.1| hypothetical protein BACCAP_02478 [Bacteroides capillosus ATCC 29799] >gi|150272557|gb|EDM99742.1| hypothetical protein BACCAP_02478 [Bacteroides capillosus ATCC 29799] (1325 aa)
Score = 547, Expect = 1.6e-53, Identities = 206/674 (30%), Positives = 326/674 (48%)
  Q:    72 FTDIEIHNALSRLGVQRK------NGEWFDYNPEILNKAFFEVKHNKLNFE-VNRTKDFS---LREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQS-HIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNE--KDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQYKN---DENNPYRCMPKMIMLTYKLPDNLREVA-LKGEFDEFSLNEFFSAKFNERNKKY----------EFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEF--KKYKIILAA--GGKSKSGESLIEEIHKNMENP-IETKTITLSCQKLTTGVTIRPWSGIFMLRS--LKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVK---DFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLK---------TKSTESELTKEEKKLLSNDKKDEQSKRREVQKK----------LIKFATRIPIFMYLTD 745
           F D ++H  L   G+ +K      + EWF+ +   + KA   VK  + N   +     F+    R EQ+EAI  T   F   +     + LWNAKMRFGKT +A + +++  +   +IV+ +P V   W ED Q    D ++Y + +          L  NSGK  V F+S QDL G +  GG   KN  + +  WDL+I+DE H G       D+     K+ D Y++                 ++L LSGTPF  +   EF +D I+ W Y  EQ +K Q+      ++NPY  +P++ + TY L   L + + ++ E   F+  EFF     +    +          +F+H   V  FLN +T              D  +  P+ +E   N   H  W++P V    A+  L+++   F    + I+  A  G + +  E  ++++ + +     +  TITLSC KLTTGVT+  W+ +FML      S   Y Q  FRVQ+           +K+   K+ CY+FDF P+R LK V E S  L+T    + ES  +   +F+ + P++A   D  +M+  D  ++L           +   ++     N+ ND L R+    + LDI    E F NL K    I+  S+   K K         T     EL + EKK       DE+ + +E+++K          L   + R+P+ +Y  D
  S:    94 FRDHDVHRVLENSGIPKKKLKNSTSREWFEVDLATVQKAIEAVKKCQPNLSGMGAGTGFTPIVFRPEQEEAIEKTLKQFKTGS-----RMLWNAKMRFGKTLSALQVVKKSGFAKTIIVTHRPVVDDGWYEDFQKIFYDTDDYTYGSKGHGAAIEDLL--NSGKKFVYFASIQDLRGSSTVGGKFDKNDAVFSLDWDLVIVDEAHEGTTTALGDDVIKNLVKEGDGYDT-----------------KFLALSGTPFNILK--EF-DDNIYTWDYVMEQQRKAQWDELHFGDSNPYDELPELKIYTYDLGKILTDKSYVELEDKAFNFREFFRVWTGDIKHDHKAMPATAQVGDFVHESDVWSFLNLITKD------------DPDSHYPYANEEYRNLFRHALWMVPGVKEAKALSKLMKKHPVFGCGVFDIVNVAGDGDEEERSEDALQKVRQAINGAGNDGYTITLSCGKLTTGVTVPEWTAVFMLAGSFSTSAANYLQTIFRVQSP---------CNKDGKIKRCCYVFDFAPDRTLKMVAE-SAALSTKAGKANESDRRIMGEFLNYCPVIAV--DGTVMKAYDTNRLLQQLKRAYAERAVQNGFDDT---NLYNDELLRL----EELDI----EKFNNLKK----IVGTSKAAPKAKEIDINAQGFTDEEYEELGRIEKKPKRERTPDEEKRLQEMKEKQKLKNNAISILRGISIRMPLLIYGAD 757
>gi|77408828|ref|ZP_00785556.1| reticulocyte binding protein [Streptococcus agalactiae COH1] >gi|77172559|gb|EAO75700.1| reticulocyte binding protein [Streptococcus agalactiae COH1] (1456 aa)
Score = 503, Expect = 1.9e-48, Identities = 221/720 (30%), Positives = 352/720 (48%)
  Q:    55 PFTMFFAKNAIRNDGTT-FTDIEIHNALSRLGVQR----KNGEWFDYNPEILNKAFFEVKHNK--LNFEVNRT----KDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQS-HIDFENYIFINNLDKDETFKTLQKNSGKN-IVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY---KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEF-KKYKIILAAGGKSK----SGESLIEEIHKNM-ENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESK---VKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQAL-----DILSKLEDFRNLNK----DISIIISKSEQI----KKLKTKSTESELTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDF 774
           P+T+ + + A +    + F D ++HN L R G+++    +  EWF  + E    A   VK  K  LN  ++ +       +LR EQ+ A+  T+  F K       + LWNAKMRFGKT TA + ++   ++ VLI++ +P V  +W +D +  ++  E Y F  ++ + ET + L+K  G+N  V F+S Q L    +Y G +   +   +  WDLIIIDE H G   E S                +M  L  E       + L LSGTPF  +   +F ++Q++ W Y  EQ+ K+++   + +E NPY  +PK+ M T+++    R      E   F+  EFF    N        ++  +V QFL+ +T              D     PF        L HT WL+P V    A  +LLRE   F K+YKI+    G S     + +  IE++   + ++P  TKTITL+ +KLTTGV I  W+ +  L +  S   Y QAAFR Q  ++         ++   K  CY+FDF P+RAL  + E +Q  +   K +TE +   +   + F+PIL  S   N M+  +  K+L           +   +E   L    ND L  + ++   +      I+ K    RN NK    D  +   + EQ     KK K K T+ +L   EK      +K+ + +R+ +   L   + RIP+ +Y    + +  KD+  +   DF ++V   + K+F
  S:   217 PYTLGWVELAYKKTTKSWFHDYDVHNILKRSGIKQAENLEGTEWFKTDLETAKAAIKAVKEGKNCLNMAIDESCVAEPIITLRPEQEAAVEQTQKVFKKKD-----RMLWNAKMRFGKTLTALQLVKNEAFQRVLIMTHRPVVSDSWFDDFKKMNMSEEGYDF-GSVHRGETLEVLKK--GENPFVYFASIQLL----RYNGGQTNLKNFSDIDWDLIIIDEAHEGTQTELSD--------------SVMRVLIKEH-----TKVLELSGTPFNLLD--KFDDEQVYTWDYVMEQTAKKRWELERPNEPNPYETLPKVSMYTFEMKHKER---FSDESKSFNFREFFRVDENG-----TLVYKQEVRQFLDNITNP------------DGSTNYPFSTSAYREELRHTLWLMPGVKEANAFEELLREHPIFGKEYKIVNVVRGSSTDDGITNDVDIEKVRYAIGKDPSRTKTITLTVRKLTTGVNIPEWTAVLFLSNTNSAMNYLQAAFRAQTPFS--------HEKLGMKTNCYVFDFAPDRALTVMAESAQINSGVGKKNTEKQKQAMARLLNFMPILGVSE--NGMKTYNVDKMLTQLKKVYAEKAVRSGFEDDSLY---NDNLLTLTADDATVFNKLNAIVGKTHSQRNSNKVIINDNGLTDEEHEQAERAKKKPKVKRTQEDLEVIEK------QKEAKKQRKNMISILRGVSIRIPMMIY--GMKVDLAKDISIQ---DFVKQVDDESWKEF 897
>gi|116628082|ref|YP_820701.1| superfamily II DNA/RNA helicase [Streptococcus thermophilus LMD-9] >gi|116101359|gb|ABJ66505.1| DNA or RNA helicase of superfamily II [Streptococcus thermophilus LMD-9] (1462 aa)
Score = 467, Expect = 2.7e-44, Identities = 219/734 (29%), Positives = 343/734 (46%)
  Q:    41 RIKEQFPVSAPVKKPFTMFFAKNAIRNDGTT-FTDIEIHNALSRLGVQR----KNGEWFDYNPEILNKAFFEVK-------HNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY---KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEF-KKYKII-LAAGGKS-----KSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQ---NLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKR--------------REVQKKLIKF----ATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDF 774
           RIK+    S     PF + + + A +    + F D E+H  L R G+      +  EWF+ + E   +A   VK         +  ++  + K  +LR EQ  A++ T+        +K  + LWNAKMRFGKT T+ + I++  ++ VLI++ +P V+ +W ED +     E      ++DK E   TL K+  K  + F+S Q L    +Y G +       +  WDLIIIDE H G   E S  +      D +  I                  L LSGTPF  +   +F  +Q++ W Y  EQ  K ++     ++ NPY  +P+++M T+++    +      E   F+  EFF       + K E ++   V +FL+ +T              D +   PF      + L HT WL+P V    A   LL+E   F   YKI+ +    KS      SG+ L +      ++P +TKTITL+ ++LTTGV +  W+ +  L +  S   Y QAAFR Q  ++         ++   KK CYIFDF P+RAL  + E +Q    +   N    +  + + + FLPIL  S   N ME  +  ++L  T     Y       E A+    ++D+L     N   L + S  +D    NK  +I+    +Q    K     S+LT EE       KK +  +R              R+ QK +I      + RIP+ +Y  D   +  KD+  E   DF ++V   + K+F
  S:   206 RIKQYMTTSG---LPFELGWVELAYKKSTKSWFHDHEVHEVLRRSGISHPKHLEGNEWFETDLETAKEAIKAVKDGRSFISETQAAYKAEKVK-ITLRPEQDAAVKQTQK-----TYKKKNRMLWNAKMRFGKTLTSLELIKQEGFQRVLIMTHRPVVRDSWFEDYKKMEMAEAGYLYGSVDKGEKLTTL-KSGDKPFIYFTSIQYL----RYNGAQANLPLFSDIDWDLIIIDEAHEGTQTELSDTVMKSLVKDGHTKI------------------LELSGTPFNLLD--QFEPEQVYTWDYVMEQQAKLKWDLENPEQPNPYEQLPEVLMYTFEMKHKEK---FTDENKSFNFREFFRV-----DDKGELVYKADVRRFLDNITNP------------DSETNYPFSTREYRDELRHTLWLMPGVREANAFEKLLKEHPVFGMDYKIVNVVRNDKSDNILDTSGDDLSKVRQAITDDPSQTKTITLTVRRLTTGVNVPEWTAVMFLSNTSSSTNYLQAAFRAQTPFS--------HEKLGMKKRCYIFDFAPDRALTVMAETAQINSGVGKKNTHQQKQAMANLLNFLPILGKSD--NGMEPFNVDRML--TQIKKVYA------EKAVRSGFEDDSL----YNDNLLTLTS--DDAELFNKLNAIVGKTQKQKTPTKVTINVSDLTDEEYDQAEKAKKKKPRERSQEEKEAMEKLKEARKQQKTMISILRGVSIRIPMMIYGMDV--DLSKDITIE---DFIKEVDDESWKEF 899
>gi|55823287|ref|YP_141728.1| type II restriction-modification system restriction subunit [Streptococcus thermophilus CNRZ1066] >gi|55739272|gb|AAV62913.1| type II restriction-modification system restriction subunit [Streptococcus thermophilus CNRZ1066] (1456 aa)
Score = 467, Expect = 2.9e-44, Identities = 219/734 (29%), Positives = 342/734 (46%)
  Q:    41 RIKEQFPVSAPVKKPFTMFFAKNAIRNDGTT-FTDIEIHNALSRLGVQR----KNGEWFDYNPEILNKAFFEVK-------HNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY---KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEF-KKYKII-LAAGGKS-----KSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQ---NLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKR--------------REVQKKLIKF----ATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDF 774
           RIK+    S     PF + + + A +    + F D E+H  L R G+      +  EWF+ + E   +A   VK         +  ++  + K  +LR EQ  A++ T+        +K  + LWNAKMRFGKT T+ + I++  ++ VLI++ +P V+ +W ED +     E      ++DK E   TL K+  K  + F+S Q L    +Y G +       +  WDLIIIDE H G   E S  +      D +  I                  L LSGTPF  +   +F  +Q++ W Y  EQ  K ++     ++ NPY  +P+++M T+++    +      E   F+  EFF       + K E ++   V +FL+ +T              D +   PF      + L HT WL+P V    A   LL+E   F   YKI+ +    KS      SG+ L +      ++P +TKTITL+ ++LTTGV +  W+ +  L +  S   Y QAAFR Q  ++         ++   KK CYIFDF P+RAL  + E +Q    +   N    +  + + + FLPIL  S   N ME  +  ++L  T     Y       E A+    ++D+L     N   L + S  +D    NK  +I+    +Q    K     S+LT EE       KK    +R              R+ QK +I      + RIP+ +Y  D   +  KD+  E   DF ++V   + K+F
  S:   206 RIKQYMTTSG---LPFELGWVELAYKKSTKSWFHDHEVHEVLRRSGISHPKHLEGNEWFETDLETAKEAIKAVKDGRSFISETQAAYKAEKVK-ITLRPEQDAAVKQTQK-----TYKKKNRMLWNAKMRFGKTLTSLELIKQEGFQRVLIMTHRPVVRDSWFEDYKKMEMAEAGYLYGSVDKGEKLTTL-KSCDKPFIYFTSIQYL----RYNGAQANLPLFSDIDWDLIIIDEAHEGTQTEFSDTVMKSLVKDGHTKI------------------LELSGTPFNLLD--QFEPEQVYTWDYVMEQQAKLKWDLENPEQPNPYEQLPEVLMYTFEMKHKEK---FTDENKSFNFREFFRV-----DDKGELVYKADVRRFLDNITNP------------DSETNYPFSTREYRDELRHTLWLMPGVREANAFEKLLKEHPVFGMDYKIVNVVRNDKSDNILDTSGDDLSKVRQAITDDPSQTKTITLTVRRLTTGVNVPEWTAVMFLSNTSSSTNYLQAAFRAQTPFS--------HEKLGMKKRCYIFDFAPDRALTVMAETAQINSGVGKKNTHQQKQAMANLLNFLPILGKSD--NGMEPFNVDRML--TQIKKVYA------EKAVRSGFEDDSL----YNDNLLTLTS--DDAELFNKLNAIVGKTQKQKTPTKVTINVSDLTDEEYDQAEKAKKKRPHERSQEEKEAMEKLKEARKKQKTMISILRGVSIRIPMMIYGMDV--DLSKDITIE---DFIKEVDDESWKEF 899
>gi|55821363|ref|YP_139805.1| type II restriction-modification system restriction subunit [Streptococcus thermophilus LMG 18311] >gi|55737348|gb|AAV60990.1| type II restriction-modification system restriction subunit [Streptococcus thermophilus LMG 18311] (1470 aa)
Score = 461, Expect = 1.3e-43, Identities = 219/734 (29%), Positives = 343/734 (46%)
  Q:    41 RIKEQFPVSAPVKKPFTMFFAKNAIRNDGTT-FTDIEIHNALSRLGVQR----KNGEWFDYNPEILNKAFFEVK-------HNKLNFEVNRTKDFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY---KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEF-KKYKII-LAAGGKS-----KSGESLIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQ---NLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESELTKEEKKLLSNDKKDEQSKR--------------REVQKKLIKF----ATRIPIFMYLTDYREETLKDVITELEPDFFEKVTGLTIKDF 774
           RIK+    S     PF + + + A +    + F D E+H  L R G+      +  EWF+ + E   +A   VK         +  ++  + K  +LR EQ  A++ T+        +K  + LWNAKMRFGKT T+ + I++  ++ VLI++ +P V+ +W ED +     E      ++DK E   TL K+  K  + F+S Q L    +Y G +       +  WDLIIIDE H G   E S  +      D +  I                  L LSGTPF  +   +F  +Q++ W Y  EQ  K ++     ++ NPY  +P+++M T+++    +      E   F+  EFF       + K E ++   V +FL+ +T              D +   PF      + L HT WL+P V    A   LL+E   F   YKI+ +    KS      SG+ L +      ++P +TKTITL+ ++LTTGV +  W+ +  L +  S   Y QAAFR Q  ++         ++   KK CYIFDF P+RAL  + E +Q    +   N    +  + + + FLPIL  S   N ME  +  ++L  T     Y       E A+    ++D+L     N   L + S  +D    NK  +I+    +Q    K     S+LT EE       KK +  +R              R+ QK +I      + RIP+ +Y  D   +  KD+  E   DF ++V   + K+F
  S:   206 RIKQYMTTSG---LPFELGWVELAYKKSTKSWFHDHEVHEVLRRSGISHPKHLEGNEWFETDLETAKEAIKAVKDGRSFISETQAAYKAEKVK-ITLRPEQDAAVKQTQK-----TYKKKNRMLWNAKMRFGKTLTSLELIKQEGFQRVLIMTHRPVVRDSWFEDYKKMEMAEAGYLYGSVDKGEKLTTL-KSGDKPFIYFTSIQYL----RYNGAQANLPLFSDIDWDLIIIDEAHEGTQTELSDTVMKSLVKDGHTKI------------------LELSGTPFNLLD--QFEPEQVYTWDYVMEQQAKLKWDLENPEQPNPYEQLPEVLMYTFEMKHKEK---FTDENKSFNFREFFRV-----DDKGELVYKADVRRFLDNITNP------------DSETNYPFSTREYRDELRHTLWLMPGVREANAFEKLLKEHPVFGMDYKIVNVVRNDKSDNILDTSGDDLSKVRQAITDDPSQTKTITLTVRRLTTGVNVPEWTAVMFLSNTSSSTNYLQAAFRAQTPFS--------HEKLGMKKRCYIFDFAPDRALTVMAETAQINSGVGKKNTHQQKQAMANLLNFLPILGKSD--NGMEPFNVDRML--TQIKKVYA------EKAVRSGFEDDSL----YNDNLLTLTS--DDAELFNKLNAIVGKTQKQKTPTKVTINVSDLTDEEYDQAEKAKKKKPRERSQEEKEAMEKLKEARKQQKTMISILRGVSIRIPMMIYGMDV--DLSKDITIE---DFIKEVDDESWKEF 899
>gi|13507849|ref|NP_109798.1| hypothetical protein MPN110 [Mycoplasma pneumoniae M129] >gi|11135697|sp|P75452|Y110_MYCPN Uncharacterized protein MPN_110 >gi|1673693|gb|AAB95692.1| conserved hypothetical protein [Mycoplasma pneumoniae M129] (718 aa)
Score = 431, Expect = 4.4e-40, Identities = 160/550 (29%), Positives = 293/550 (53%)
  Q:   123 FSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFINNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKV-----KNQWIHNNKWDLIIIDEYHFGAWRERSK----------------DLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFL-EDQIFNWTYTDEQSKKEQYKNDENNP-----YRCMPKMIMLTYKLPDNL----REVAL-----KGEFDEFSLNEFFSAKFNERNKK---YEFIHGDQVNQFLNFLTGKHTIYLNERLKARDKQAPMPFLDEILLNNLSHTFWLLPNVASCYAMYDLLRETIEFKK--YKIILAAGGKSKSGESLIEEIHKNMENPIETK--TITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESKVKDFIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKL 672
           ++ R+EQ   + V + YF   AN +  +FL N KMRFGK FT Y + Q+     +LI++F P V+ + ++DL +HI+ +NY F  + D  ++   L KN  +  V F S Q++LGK +  G K      +   +    +DLI+ DEYH+GA ++R++                D  ++ +++  ++ ++ D     +F    K+ + LSGTPF ++ N EF  +DQ+F ++Y DEQ    + K+ EN+P     Y   P+M +  ++L +      +E+ +     K +  E S  + F  +   +      Y F++ + V + ++ L  K   + +  L   +            ++   H+  +LP   +C+A+ +LL+    F+   ++II  +  +  +G+  + E++K+++   +T   T+T++  KLT G+T++ WS +F L+ LK  E+YFQ  FR+Q  +        +   +N K+ CY++DF+  R L+   EYS+   T  K S  S  ++  KFLPI     D   +++ D   +  Y    +       +W     + +D D L  +  ++ A  IL K+
  S:    29 YTPRKEQAACVEVLERYF--QANPENGRFLMNCKMRFGKCFTLYSYAQKNNINKILILTFVPAVEESLKDDL-NHIE-KNYKFYTDDDLQKSNFDL-KNQNEPYVVFLSLQNVLGKQRIDGAKTDFDKERISKLQEIDFDLIVFDEYHYGANKKRTQIKVEKVNKKIDNPEQQDNQDDAEEELASTFKLKDIK--SKFQFSYKQLVCLSGTPFSSLRNNEFSSKDQVFTYSYFDEQ----KAKSAENHPLKLGQYGIFPEMNIYCFELAEIFTAQEQEIFITPGKGKNKLPEISFRKLFQTENVSKESSKPVYRFVNENLVEKLIDSLIDKRKGFSHTPLSWEN------------IDKHKHSLLILPTRVACFALANLLKNHWYFENNDFQIINMSESQFGNGKKALIELNKHLDEAKKTNKNTLTITVAKLTIGITVKEWSTVFFLKDLKGAESYFQTIFRIQTPY--------IKNCKNLKEICYVYDFNMYRCLEVTNEYSKQTQTDPKFSA-SWFQNLDKFLPIYLVRGDE--IQKTDPEILQKYEYFIMDKRAFSTRWMDESNI-IDIDVLCNVGQDEDAQKILKKI 586
>gi|160886662|ref|ZP_02067665.1| hypothetical protein BACOVA_04674 [Bacteroides ovatus ATCC 8483] >gi|156107073|gb|EDO08818.1| hypothetical protein BACOVA_04674 [Bacteroides ovatus ATCC 8483] (423 aa)
Score = 337, Expect = 3.0e-29, Identities = 115/349 (32%), Positives = 169/349 (48%)
  Q:    71 TFTDIEIHNALSRLGVQRK-------NGEWFDYNPEILNKAFFEVKHNKLNF---EVNRTK-DFSLREEQKEAIRVTKNYFLKNANEKYCKFLWNAKMRFGKTFTAYKFIQEMEYKNVLIVSFKPTVKTAWREDLQSHIDFENYIFI----NNLDKDETFKTLQKNSGKNIVCFSSFQDLLGKNKYGGIKVKNQWIHNNKWDLIIIDEYHFGAWRERSKDLFNEKDDDFYNSIEIMDALGIEQFPIKSKRYLYLSGTPFRAISNGEFLEDQIFNWTYTDEQSKKEQY---KNDENNPYRCMPKMIMLTYKLPDNLREVALKGEFDEFSLNEFFSAKFNERNKKYEFIHGDQVNQFLNFLTGKHTIYL 419
           +F D E+H+ L R G+++K         EWF  + E + +A   VK  + +    EV+  +     R EQ+EAI  TK  F K+      + LWNAKMRFGKT +A + +++M++   LI++ +P V + W ED    I ++   F     NN D   + +   K      V F+S QDL G    GG   KN  +    WD II+DE H G   E  K +  E                       + + L LSGTPF  +   +F ED+I+ W Y  EQ  K  +      + NPY  +P M + TY L   L E     E   F+  EFF  + NE   K+ +I     ++F   ++ K TIY+
  S:    85 SFNDKEVHSVLERSGIRKKIFDTENKANEWFITDLETIKRAITAVKEGRESLSSAEVSHDQMPIVFRPEQREAIEKTKKQFKKSN-----QMLWNAKMRFGKTLSALQVVKDMDFSRTLILTHRPVVDSGWFEDF-GKIFYDCPCFAYGSKNNGDSHASLEARAKQGKCQYVYFASMQDLRGSELVGGNFDKNNEVFATAWDCIIVDEAHEGTQTELGKAVMQE-------------------LTKANTKILRLSGTPFNLLD--DFKEDEIYTWDYVMEQRAKASWDLTHFGDPNPYASLPTMNIYTYDLGRLLHEFV--DEDVAFNFREFF--RVNEAG-KFSYI-----SKFHILISYKLTIYI 414
>gi|160886778|ref|ZP_02067781.1| hypothetical protein BACOVA_04791 [Bacteroides ovatus ATCC 8483] >gi|156107189|gb|EDO08934.1| hypothetical protein BACOVA_04791 [Bacteroides ovatus ATCC 8483] (899 aa)
Score = 221, Expect = 9.4e-16, Identities = 61/180 (33%), Positives = 98/180 (54%)
  Q:   449 LLPNVASCYAMYDLLRETIEFKKYKIILAAGGKSKSGES---LIEEIHKNMENPIETKTITLSCQKLTTGVTIRPWSGIFMLRSL--KSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVSTESK--VKDFIKFLPILAYSSDTNIMEEVDAVKILD 628
           +LP V    AM  LL+    F+ +K++  AG   +  ES   L+       ++P  T+TITLSC +LTTGV+++ W+G+FML      +  +Y Q  FRVQ   T              K++CY+FDF P+R LK + E  +  + + K S   +  + +F+ F PI+  S + + M + D  K+L+
  S:     1 MLPGVKEARAMSALLQSHPVFQHFKVVNVAGDGDEDEESKDALVAVEEAIGKDPDATRTITLSCGRLTTGVSVKAWTGVFMLSGSYNTAASSYMQTIFRVQTPATING---------RVKEQCYVFDFAPDRTLKVIAETVKISSKAGKTSGNDRKIMGEFLNFCPII--SIEGSKMSQFDVPKMLE 176
>gi|167933102|ref|ZP_02520189.1| type II restriction endonuclease, putative [candidate division TM7 single-cell isolate TM7b] (255 aa)
Score = 190, Expect = 3.5e-12, Identities = 61/235 (25%), Positives = 114/235 (48%)
  Q:   503 KTITLSCQKLTTGVTIRPWSGIFMLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVS--TESKVKD----FIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESE-LTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRI 737
           KTITLS  +LTTGVT++ WS + ML  +K+   Y QA FR QN + F+ + +        KK  Y+FDF PNR L+    ++ +L  +      TE K +D     + + P+L+   +   M E+DA ++L +    +   ++  ++ + +L                          F+N+N   +I     ++I KL   + + + +T  + +L  N  + E++++R    + + F  ++
  S:    20 KTITLSVGQLTTGVTVKEWSAVLMLSDIKAESLYMQAIFRAQNPYAFEKNGHYFR-----KKSAYVFDFSPNRVLEIYDHFANSLLHTGATGHITEEKRRDNIAELLNYFPVLS-EDEGGKMIELDAAQVLTFPKAIMAREVVKHRFITNLL--------------------------FKNINNVYNIPSEIRKRINKLADTNEQGKVITSSKDELPDNTDRRERTQKRITANRNVVFGEKV 229
>gi|169837057|ref|ZP_02870245.1| type II restriction endonuclease, putative [candidate division TM7 single-cell isolate TM7a] (660 aa)
Score = 113, Expect = 2.9e-03, Identities = 47/212 (22%), Positives = 96/212 (45%)
  Q:   526 MLRSLKSPETYFQAAFRVQNSWTFKDDYNEVSKEENYKKECYIFDFDPNRALKQVVEYSQNLNTSNKVS--TESKVKD----FIKFLPILAYSSDTNIMEEVDAVKILDYTITNITYNMLVRKWESAMLVNVDNDTLKRIVSNKQALDILSKLEDFRNLNKDISIIISKSEQIKKLKTKSTESE-LTKEEKKLLSNDKKDEQSKRREVQKKLIKFATRI 737
           ML  +K+   Y QA FR QN + F+ + +        KK  Y+FDF PNR L+    ++ +L  +      TE K +D     + + P+L+   +   M E+DA ++L +    +   ++  ++ + +L                          F+N+N   +I     ++I KL   + + + +T  + +L  N  + E++++R    + + F  ++
  S:     1 MLSDIKAESLYMQAIFRAQNPYAFEKNGHYFR-----KKSAYVFDFSPNRVLEIYDHFANSLLHTGATGHITEEKRRDNIAELLNYFPVLS-EDEGGKMIELDAAQVLTFPKAIMAREVVKHRFITNLL--------------------------FKNINNVYNIPSEIRKRINKLADTNEQGKVITSSKDELPDNTDRRERTQKRITANRNVVFGEKV 187